2FWOB

Mhc class i h-2kd heavy chain in complex with beta-2microglobulin and peptide derived from influenza nucleoprotein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-D alpha chain
publication title Structural Definition of the H-2Kd Peptide-binding Motif.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/viral protein
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fwoB00
1H8OA 5MENE 1GGIL 1P9MA 4J6RL 1H3XA 4LLVA 4MX7A 3SN6N 3TT1H 3DGCR 1KIRA 2VL5A 5EO1B 3CCHB 4LCCC 4HUWA 1VEMA 4X5LA 4WEBL 5SX4I 4ZFGH 1RSFA 1A6AB 5D7SH 4NQCE 4S10A 2W59A 5IFAH 2VC2L 4QF1A 3V4PL 4FXGB 3PDOA 5F7UA 4ODVL 3DMMB 2B39A 2HMIC 1FZOB 2NW2A 1T2XA 4FQXC 1DQQB 4AIXA 1A7PL 3O9WB 1PQZA 1GGBL 1HXMB 4LKCA 4WHTB 4XPGH 5GRJL 2XI9A 2IWGA 4IRSC 3RVWC 1E6OH 1NGQH 2PYED 3UPRA 1R24A 5JXEC 4YO0B 3UJTH 3TPKA 3TZVD 4MA8H 1MCDA 3VI3F 1IQWH 2EC9U 2I60L 5DMKA 4KJYA 4P5TA 4XXDA 5F93C 3QUYD 4Z8FH 1OLZA 4I18B 4QHMA 4F7PA 3LB6D 4P4KD 1YEFH 2HTLC 2APBA 4HDIB 1I8KA 1AHWC 2H32H 1VFOA 3SCMC 3FB5B 3UAJD 4BQ8A 4BK4A 5ESQB 1N2RB 3CSGA 2BC4B 2B4CL 1T89A 1CGVA 4BM7A 3TNNB 3OB8A 4EI6A 4OF0A 1QKZH 5EOQH 3EJZC 4W68A 2AEPL 3MZTA 3E6FB 3MRDA 3MXVH 1B9ZA 4BQ6A 4NOFA 4MJ2A 5K9KA 4JFZL 1QFWL 4ORGB 3FO0L 2EH8L 1KFAH 4OF5A 1QRKA 3T04D 3S88H 3PWUA 4KJWC 3LV3A 4MAUL 2NY2C 2G2RA 2VJXA 3JVGA 1RPQA 4LK4A 1TETL 4NSKA 5DFVD 1V3JA 5IK3B 5KZCB 2HRPL 2OLDA 1FNHA 4MCZA 3DGGA 4HD9A 3MJ8A 4M7JL 1B0RA 1Q94B 3O2WH 3DO7B 2C7UB 2Y7QB 1MCFA 1QRNB 2D7PA 5CS7A 1JF5A 1QSFD 4DOHB 3MROB 2CR3A 2YK1L 1KN2L 1CDYA 1OSZB 3KNBB 5DO2D 3RDTA 4TPRL 3Q0HA 4JEGB 3WFCH 1A3RL 3OTTA 3AUVA 2F15A 2Y1VA 3O4OC 1BREA 2UYLA 4NNPH 3ZHLA 4X9IA 5LKNA 4NPYB 1T0MB 4R6UA 4S1DC 4HPYL 3LPGA 1QPXA 4M3JA 5CKAA 2V2WB 2IGFH 1A6AA 1JGDA 2RBLA 3ARRA 1P7QA 3U9UB 2Z9TA 4JO4L 3VGAC 1G84A 1G7IA 3LSOB 3QQ3B 5D70L 2M2DA 1DQQA 1BM3H 2CUMA 2DQTH 3MRIB 3O9WA 4LU5H 1HXMA 4WHTA 4IDJH 3MLTB 3OX8B 2OZ4A 1WWWX 3KYAA 2QHLA 4WJ5B 4Y16C 1LO5B 2B20A 4X6CA 4P2QB 4I4WA 1KIQB 2J6EH 2O5ZH 3Q1SH 2X4OB 4XHJC 4G5ZH 5A2FA 1OGAE 1JPGB 2IPKA 2VB5A 1F4YH 4LRNL 4LIQL 4YHIA 4NUGL 2R2HB 5DGRA 3NMEA 3MRPB 4PJBB 5FGCB 1P84K 2YS4A 2ESVE 4IMKA 2JE8A 2FD6L 2AJZB 4N5UA 4Q7DA 5ESQA 3MTRA 5ALBH 3RA7L 5KSAB 4BH7A 2BC4A 4AENB 3L5XL 2CRYA 5FYLL 2ZSWB 3TNNA 4HFUH 4OF3A 3SPVA 5EOCJ 1FL6B 3F58H 3S34L 1MHCB 1N6VA 4JRXA 4WIQA 4WDIA 1LE5A 4PY8J 3E8UL 4ORGA 1NBQA 1NFDB 2AJUL 2O5YL 2R2EB 3ZKMD 2HFFA 2A2QT 4O51B 1EVTC 4CVZA 2DQCL 4PV8B 5BQ7A 4H88L 4IMLB 5EIIB 4DKAA 2OQJA 3NCMA 2Z31C 4JQVC 1R3LB 2DMBA 2BNRE 2VLKB 3N0PB 2HT4C 1IT9L 2C7UA 5KVFH 2VXUL 4NQDD 3U4EB 1EZVY 4XPFL 3BP4A 3MROA 3UYOD 4GAYB 1ACYH 4G7VL 4U1HB 3UTPE 4TUOB 3L3KA 1HKLL 1UM5L 2D7TH 4P2OD 1FV1A 4LF3A 5LCVL 4Y5XA 5I1IH 1N6QH 5CZVL 1K5NA 4U1NA 5KAQG 2OMBA 4NN5B 4YNYB 3DUUB 3L6FB 1WIPA 3KDMB 4XB7A 1S7RB 5SWQB 3HG1A 4HG4K 2HJFB 4RFNB 2YD8A 1T0MA 5K9OA 4M1GL 4POZC 2NY3B 1X4YA 1G7QA 3ABZA 4PJ5D 2YUXA 1MCIA 4P9MH 1MJJB 1LE9B 1H3WM 1F00I 3RIFK 3WJLA 5JDSB 2VLME 4FQHB 1N26A 4PFEA 4JQIH 5HDLA 2NTFB 4UU9B 5DJ8B 3RHWF 5DVLA 1FPTL 2YXMA 4LHUG 4TNVF 1EHAA 2WV3A 1LO0H 2QR0B 3QFJB 4P2QA 4JFEA 2ZSVB 3FMGL 3EJYC 4NQVA 4MWFB 1RUQH 3T1WA 1J0JA 2WP3T 1ZEAH 5I73C 3MBEC 4L4VD 3QUXB 3QEQE 1A4KA 2YMXL 2E27H 1KTLB 3LQZB 3PJSB 1Q1JL 3OZ9H 4XBEH 2AJZA 5AZ2H 3CSYA 3DECA 1JK8B 1RZ7L 1T1XA 1KT2B 4Q9CA 5K9JH 1JWUA 4HUXB 2WBJB 3MRJA 4KK5C 4IS6A 2IMNA 1EIBA 2BNUB 3KYMB 3MV9B 4PJXF 4PJ9A 1A1NA 3LY6A 4MNQE 5KG9A 5GRVK 1IAKB 2WWKO 2XN9A 4ALAH 1GOHA 5EORL 3DMMD 4JFXB 4NOBA 1PEZA 3BP7A 2AKRB 2QHRH 1A7NH 5FYLD 3N1PC 5IM7B 2R2BA 1IZJA 1YECL 3SOBH 4Q2ZB 2YPLD 4BJLA 4HS8L 2PXYC 4IMLA 5EIIA 3JUZA 1BQHB 4QYOB 2XKNB 1WAAF 3KS0J 1QHPA 1RIHH 5H8DA 3WKNA 2DYPB 5C08B 2VLKA 1A14L 5ADPH 5J1AB 5I71B 3RZCD 4XNMB 1F6AB 4GAYA 4U1HA 2Z0BA 3T0EE 3ZT6A 4RFEA 1NBVH 5GS0H 4MJIE 3QCUH 1YYML 4LPXA 4GLRH 3SE4A 5JXAL 2AK4B 4HJ0D 1NBYA 4KMQA 3VFTB 1XCTB 3MO1A 4ERSH 4EN3B 3BAEH 3DUUA 1YMHB 5C0AA 1FNLA 4PS4H 4BQCA 3WFEL 4Z76A 5IQ9B 2MFNA 1NGPH 1C7TA 1T2QH 5F9OL 1J05B 1SYVA 2YOCA 1MCNA 5F1KC 5KANI 3NA9L 1T03L 1LE9A 3QIUC 1S78C 3MRGB 2OR7A 4AEHH 2BFVH 1AY1L 5FGBC 2C3VB 4FQHA 4A2LA 2DF3A 3RWCB 5CINH 3QNYB 4HUUA 1T1ZA 3LN4B 1CLZL 5DJ8A 4ZXBC 4DUXA 1YMMD 3AM8C 3JV4B 3IDMB 2CKBH 1EJ6A 3SDDC 2QSTA 4NFBA 3RKDC 3MCLH 3AS1A 3GDBA 1E6JL 5GGSA 1MUJB 1QRND 4FG6D 4HSQA 4BZYA 2VKXA 3TVMD 5LGHL 4L4JA 3LQAC 4Y4FD 4OQTA 1NCUA 2H1PL 4XCNB 3X3FH 4DKDC 4FQ1H 3P9WB 1KTLA 2YD1A 3PJSA 4IHOB 4P5MA 3NN8A 4M1DH 3LIZL 3MOBL 4PJCA 1I8LC 1R6VA 5BV7C 3BWAB 4KI5F 1JK8A 4P9HL 2CDGA 5CBAB 5F7EH 1D5XB 4HUXA 5EBMA 1FFOB 4K2UL 5F8RC 1PKQB 2W9LA 3MV9A 2P7TB 4XPAL 2YA0A 1CD1B 1HILA 4PUBH 3SO3B 2BHZA 2EC9T 4NO3B 4NO0A 1S7QA 4ZNEA 2BX5A 4RAHA 4Y2DC 1VFAB 3ZYOA 2WUBH 4S1SH 4XPBL 1FO0A 1JJUA 2AKRA 1C7SA 2F54A 4NYLB 3DO3A 2NZIA 1L7TH 2XWTA 3ET9F 3G5YB 5CEZE 2OK0L 2XKNA 5FM4A 2FYYB 5IIEB 5L7XH 3SEPA 1QA9B 1U8OB 3QR2A 2OXHA 4L9LB 5J1AA 2LAGB 1TQBB 1F6AA 5CAYB 5E8DL 2JB6A 3I75A 3LKPA 2W0LA 2NNAB 1Q9KA 2OP4L 2P8LA 1J12A 4BQBA 5FB8B 2CRMA 1HOCA 3WN5A 4PP1D 3VI4F 5CILL 3VFTA 2NX5E 3SKMB 4ZSOB 4H25B 3ULVF 4EN3A 3MRCA 2H6PA 5KSAD 1U3HB 3PIQA 4PJDF 5IVOA 2DIAA 4YC2B 3UJIL 4XP1H 4MNHB 1BFVL 1INEH 1DDHB 4OFDA 4HHAB 1O7VA 4P59H 2X42A 4FFYL 4PG9B 2H8PA 1G7JB 3V7MA 2CLZA 4PGZA 1FVEB 4I48A 1BMGA 3RWCA 2LVEA 2R9HC 3K2UL 3H9ZA 2GAZB 2AI0H 4AQOA 5D71L 5DLML 5IBLC 1WISA 2A6KB 5J12C 2VDML 3WKMH 4YX2L 1TQCB 1LP9B 2B7DT 5DMGC 1FFRA 3AS0A 1MUJA 3GGWA 1ITBB 1T7XA 3F7YA 5IROA 4W6XB 2X89A 3R0NA 1MRFL 2V7HB 4X5XB 3RVXD 4XCNA 3MRRA 2Q6WA 4GLRI 1IGIH 4FQQB 4JG0L 3MRFA 3OQ3B 2HLAA 4PJXB 1KXVC 2ATPA 3HI5L 5D7KD 5CBAA 2DIBA 1D5XA 5I1KL 1FFOA 4NM8L 5IVNA 1WZLA 2NY3D 5FCSH 4U6TA 4JZNB 4XCYB 2QSQA 3MUZ1 3QBTB 4L4TA 2EECA 2YEZA 2E8ZA 4YDJB 4BSWA 2YUZA 1A6ZB 1A7RH 3G5XA 3L1OH 4FRWA 4D0BB 5GGVY 1ZLVK 2VXVH 3RBGA 1AR2A 4NYLA 5I8EA 4H0GA 15C8L 1RHHB 1ZSDB 4U3XA 5BOPA 5HYJE 4DKFL 1PYWA 5CHNA 5GXBB 3LPFA 3EYSL 3G5YA 2V2XA 2Q3AA 5I1GL 3WNKA 4U6HA 1A6UH 1P4IL 3QFJD 5IIEA 4TSCH 5CWSA 1U8OA 4D8PA 1Z9OA 3JV5A 1MOEA 5JHLL 2J8OA 1LO4L 1S9WB 2HRLA 2L7UA 1BQUA 2NNAA 2AEQL 1C5BH 3S36H 3CNKA 5C0EA 3QUXD 5F96L 1QLFA 3BPNC 3D0LB 3I3EA 5BV7H 3SHSA 3WS3B 4Z7OF 1NCBH 2YPVL 3KLSA 1UJ3B 4WGWB 1CTOA 2RCSL 2C1OB 1U3HA 2BNQA 3MREB 3P30H 2QL1A 4Q9RL 5GS2H 1A6TB 3SE9L 4JFFE 3MLSL 4EDWL 2DRUA 2YR3A 1YEKL 2XQBL 3I6LE 4F37K 4IIQC 6FABH 2HWZL 3G6JE 4XWGL 3U4BL 4PG9A 1FSKB 3T2NL 5C0DA 3NCFB 5DK0A 1IGMH 5D7IF 3KPSB 1OWWA 4KKAC 1FVEA 2WQRA 4Y89A 1YPZF 2HAZA 5GGUB 3O6FB 1IM9B 1JP5A 1UXSA 4LLDA 5DK3A 2PO6C 5HD8C 2E9IA 4LARL 4XVUD 2JCCE 5F7LB 4XP5H 4I77H 5IJKA 3OB0H 3SGKA 4PRPD 4QHUB 1FL3B 2C1PB 3VXRA 1P53A 1MF2L 2F5BH 1LDSA 2DYPD 2Y6SD 3RWHA 4HF5L 1P1ZB 3ARBC 5C07B 3W0WD 3SGJA 3VH8B 3DIFA 3NPZB 1QD0A 1F4AA 2VYRE 1KB5B 3KPMB 3WO4C 2V7HA 4KHXH 4X5XA 4HS3B 3V79C 2D7NA 1S7TB 4LVHC 4WFHE 5KSUA 4FQQA 2Z91B 1RZKC 1OD7A 4RDQF 2AK4D 4DFHA 4CGTA 2W60A 4PJXA 3BESR 2PUQT 3SY0B 4NC0B 4JGUA 2BOBB 3RVVC 1BLNA 1HQRB 3TNMB 1R3JB 4JZNA 3IDIB 5J57B 2N7BA 3KPRE 1NMCC 1NGZB 1KCUH 4GMTL 5L2KE 4X80H 4YDJA 3EYVB 2EDOA 1W0VB 1WAAA 3HNTL 4D0BA 1TXKA 4MCYB 2EDWA 5J6HA 1FYHB 2OI9B 4E41E 2GCYB 4UB0L 5E6IC 1A3LL 4GKNA 3V8CA 5JW3L 3MJGX 4ODSL 2AV7B 1F6LL 2Q8AL 2DN7A 1HHJB 1MLCA 2X44D 2AS5M 1OGTB 1D6VL 4J3WA 4U7MA 1X5GA 3BYTA 5A2LH 3Q6GL 1S9WA 2EYSA 4HQQH 3WIHL 2AV1B 1ND0B 1RUAH 4EEEA 4PJDB 4ZFZB 1F11B 2B5IC 3D0LA 1HIMH 3ARFC 4NZTH 1OP3H 3WS3A 4QTIH 3GBMH 3HZMB 2ZUQC 4IEFB 4R2GB 1Y6KR 4NKMB 3MREA 3D3VD 1U3JA 2Q20A 4JN2A 4RX4D 5D8JL 5ICXB 1A6TA 2R1YA 1FYTB 1CLCA 3RL1B 3IJHB 3QA3B 4OCSH 3IAGC 1BQHG 1XGPB 2NXZC 3NFNB 4P2RE 1UA6H 2IQ9H 3D6GA 2PYFB 1IC7H 3JWNC 5A2KH 4HV8A 4Z78A 4PJFE 4G9DA 3K1DA 1CXLA 3E6HA 1W2KT 3VXNB 4OD1L 4XC3L 5GGUA 3O6FA 3PWNB 1IM9A 3IAPA 4KUCF 1X3DA 4YK4B 1CE1H 4Y5YC 1I1FB 5LGJB 5EU5B 1D6EA 5GRYA 1RK1A 3B9KC 1Q72L 2DQHL 5CEYB 4QHUA 3HPLB 2FRGP 4U7KA 1KXTB 1M71A 1P1ZA 5C07A 3VXSB 3QULB 4O9HH 4OZHA 3VH8A 4ZPTA 4HKJA 5JUEL 3KPMA 4LSPL 2GK0B 3I3BA 3MRLA 4N8CL 1X5LA 5F9WB 4I0PC 4K23H 4KXZH 2DJSA 1S7TA 4P23D 3DV6A 3JBG7 1G6RL 1BWMA 1E0OB 4ZYKB 3SDXE 2RQ8A 3CPLA 3W9EB 3DETC 3RZWA 3O3DB 4HIIB 4OB5H 5E8EA 1F3RB 2EXYC 3F7PC 3SY0A 1HHHB 2BOBA 3SBWA 1HQRA 4G9FB 2ORBH 3TNMA 4PJIA 1MJUH 1KPRA 5JIPA 3RP1A 4RMSA 1TVHA 4U05A 3IXAB 2CK0L 4CW1A 5I76B 2DQIH 1U42A 2RFXB 2EEDA 3L3GB 4XMLL 4M62L 5ECJE 1MCKA 2F53D 3K3QA 5J3HD 5CZXD 1HINH 4H5SB 3P9LB 4LFHD 5KVDH 3PWPE 2COQA 2OR9H 2YD9A 4AH2A 2AV7A 2PW2B 1KEGH 1HHJA 2HJKB 2NXYB 1T3FB 1OTUD 1RFDL 2BSTB 1EBPA 3H9SB 5LJYH 2NY6B 5E8NB 4KUZH 5E00A 3OKEB 1AGBB 3EOYG 1REIA 2AV1A 5GISL 1P4BH 1DQJA 3C6LC 3ME0A 3RX8A 1OSPL 4PJDA 4ZFZA 1EBAA 12E8H 5JDJA 1F11A 1W0YT 4TTDC 2C3WA 2D7QA 4I5BB 4GMSH 5DJ2B 1XCQB 3HNSL 3LVEA 2R0WL 1ZHNB 3I3DA 1JYNA 2X70B 5FCUL 3GSNH 1N5AA 4EQ2A 1EVUA 1E28B 5DJZB 4NKMA 4AYFA 4OM1H 5L2JB 3V4UL 4DUWA 4KJPC 3RL1A 4YQXL 3LEXB 3IJHA 4JQXA 1A0QH 1MIML 5T3ZE 3NFNA 3SGDH 3ZZ1A 1KJ2H 5IHZB 2DBJA 1Q0YH 4KI1A 3BQUC 4FQIL 4IOFD 1N6UA 4BZ1H 3BDBA 4UOW0 4PLKD 1KJ3H 4KK8C 4WUUD 2VABB 1WBYA 1OB1A 1GPOH 3D9AH 4PRHE 4WW1B 1XAUA 4MB4A 3P0YL 3KLHD 4FOMA 4U6XB 4K3HA 2W9EH 4P46D 2Y5TB 4OJFH 5LWYL 1EFXA 4HCRA 1K4CA 5TH2B 3S35H 3LMJH 2X10A 4DZBB 3MJ9H 3F65A 3OHXA 3VXSA 3WD5L 43CAB 1GHFH 5D2LB 1F8TH 2A9MH 5BRZA 5IR1B 3HE6A 3IJSB 2FH6A 3PL6D 2F8VA 3FN0L 4KZDL 5GHWH 1I1AB 3MJ7B 4ZYKA 3VGBA 4CN4A 3W9EA 1GZQA 3QPXL 3O3DA 4HIIA 5DURB 2EYRB 5ETUA 2WZPD 4IJ3C 2XQYK 3P4LA 1YJDL 1PAMA 3OF6D 1HHHA 1MHEB 4LFHG 1ZGLA 4U6VL 5JR1H 4HLZG 1NCTA 1J0YA 2EE9A 2KUTA 3MBXH 1I7ZB 3LHPH 5KJRL 2GSGB 4LP4A 1ROWA 2CDFB 4YEEA 4CBPA 3C08L 4RWHA 4QRRD 1UJTA 3RNKA 1DVFC 3FO9A 5GGQH 4XNYL 5EPMA 3ULUD 1JNJA 3RUGB 4ETYA 5DD3H 4DJMA 1P4LB 1A4JA 4KV5E 4CJ0A 5C0ND 5IHBA 1EPFA 5D1ZD 3WIFA 4MXVE 2HJKA 2WM0A 4ELKB 4M5YH 2J5LC 3MRKB 1KCVH 2VXQL 3QG7L 3U7WH 4HKZB 1UVQA 5E8NA 7FABL 3L3JB 4UTAH 2IPTH 5B38A 3A6OA 2CLVB 4RQQB 1FDLH 1NBZA 1KG0B 1R5WB 1XCQA 4JFQB 3QUZA 4APQB 2F74A 2NR6C 3WJJC 2A6IA 4IRJB 3Q3GB 4LVOB 5HHOB 4HGWA 1CQYA 1FJ1A 1E28A 5DJZA 2BVPA 5HI5C 2GJ6B 1C08B 3I84A 1QLEH 1IARB 4EUPB 4ZDHB 3K8LA 5D7IA 1PX4A 4L5FH 2J7LA 5HDOA 1YPZA 4P3WA 1PFCA 2C5DC 4WI2A 1JUFA 4WY7H 1BVZA 4WHYH 3UDWA 3IKKA 5IHZA 3DOSA 1FZJB 3QJFA 4YHPA 2EDQA 4ZFFB 2ICWB 4QWWD 3KPQB 1UEMA 3PP3K 4RCAA 1HYSD 3EW3B 2FO1A 5DTFA 4Z0BL 3I02B 2EDHA 3DUSB 2VABA 3QI9A 4I3RL 2VDPH 4M6OH 5D1QD 4K55A 4H1LB 1CGYA 3NZ8A 4MA7L 2GKIA 2HKHH 4M93B 4WNQA 3BMWA 3BZEA 1JWSB 2VR5A 1EJOL 4FN0A 4L8CB 2DI7A 2Q86B 4X6CE 2E3VA 5CD5D 4FQ2H 43CAA 3OJ2C 2XA8L 3ZTJG 5ID0A 3IFNL 2MNUA 5I1CH 4KAQL 4OZIF 1VEPA 1ULVA 3RGVA 2K3TA 4K3DH 1WWAX 1QFWM 3CMOH 2HFEB 4LPVA 4DEPC 3DPBA 1S7WB 4JZJC 2YN5A 5HVHB 3Q6FB 2VOTA 3DBXA 1CICB 1FHGA 1MHEA 4RRPG 4MJ6B 5FO7B 1X5XA 3U0PA 1FYTD 3I6GB 4M6MH 3QQNA 4W4OC 1I7ZA 4ODXB 3O0RL 1JMXA 2WINB 1S7SA 3BEWB 5TQ2H 1A1OA 3MYJA 2PW1B 5DA4A 4GRLC 4JR9L 4O02H 2QQLH 1T83A 4KRPB 3VH8G 1K2DB 4DN4H 3QT2A 2Z8VC 4O00A 2G9HB 4JHAH 1KYOJ 1QFUL 2DAVA 3O11B 4WENB 5CEZH 1QO3A 3MRKA 4HKZA 4P3CL 2B1AH 3V2AR 1AC6A 4D9LL 1MCOL 1UM4L 2CLVA 4RQQA 4DOHE 2AXFB 1JV5A 1DFBL 1R5WA 3PGCA 4CDHA 4OT1L 1LDPL 2VUOA 3VD7A 4IRJA 3Q3GA 2CGRL 3BJLA 1OOAA 1DBML 3HMXH 1C08A 5FA4B 1H8SA 3QIBB 3DVGA 1A22B 4WU7B 4G9FD 4EUPA 4ZDHA 3HG1E 3C60C 3CUPB 1F4WH 4R4FH 2PKDA 4JFPB 3V6FA 3KPQA 1HKFA 1NSNH 3F6IA 3WFHB 4RBPH 3IDXH 5F44A 1U3YA 5T3ZL 3MCG1 1C5CH 3P9MA 3I02A 1ZLSL 1NCWL 2GTWB 4FZ8H 5KOMC 1PLGH 3FQXA 4W6YB 1FORL 4GBXB 1FBIL 3IDNA 5I75B 4ELMA 1KC5H 3EYOB 3G5ZB 2ERJB 4P2QE 3I85A 4K8RC 2NY6D 2CPCA 2H2SC 4JO1L 4Z77B 5MEPA 3TT3H 3B83A 1IC4H 5H37G 2J3SA 1UG9A 4JG1L 5GS1B 5DHXB 2KBGA 1AE6H 3PP4L 5ITFB 3VRLF 3TZVC 4KY1H 5FGCE 2HFEA 2A83A 3L5WB 5JPNB 3NIFE 4Z7VB 5EA0L 2FGWH 1F58L 1U8HA 3LB6C 2GITA 4Q6IB 4OLXH 2NY7H 3I6GA 2C9AA 5ALCL 4PJ7F 3UAJC 43C9B 3MX0A 3OAYH 2DM3A 5IW6A 2WINA 1KV3A 5DQ9B 4WO4A 3OBAA 1G1CA 5IB5A 5D2NB 2ARWA 1FZMA 1R5IB 4FTVB 3ULSA 3W82A 4OZ4B 5JNYB 3WEXA 3FCTA 2LU7A 5JOPD 1EAJA 1BQLH 1AFVH 1ES0B 1ZLUH 3TIEA 3VXTB 4AG4L 5ISZA 1XR9B 4JFDA 2MJWA 3RVUC 3LEYL 1GZPA 3O11A 4GW1A 1XMWA 3GI8L 4OD3L 3CDGB 5IBUB 3V6OC 1YY8B 4FHBD 2EDRA 4X6DB 4G80A 2AXGA 4HIEB 2VLKE 1A9EB 5E6YA 2X1XR 3OKMB 1EXUB 5C92A 4PRNB 5EUKB 4X4MA 5F6HI 2NY1D 1T0NA 3OJDA 2VDRH 3MLYL 1I1AD 2OX5A 4U1MA 4UT6H 4OCWL 3VDCA 3K80A 4Y4KB 1RVFL 1OW0A 4QCIA 4J23A 4QY8A 1CR9L 3V7AG 3KXFA 1RV6X 1AO7B 1NCCL 4ZMAT 5C0AE 3VFWB 3CUPA 5EWIL 1DANU 1OAZH 4KKBD 1ADQH 3BJ91 3EUUA 2VLJB 5DC4B 3S9DB 2NLJB 4OV6F 4GRMB 5FKAB 4C83A 1MCPL 3WFHA 1BIIB 3NABH 4OKVB 3ILQD 1FN4A 1FGVH 4KVNH 4ENED 5KSVB 5DRWB 3Q5YA 1S5HB 5TF0A 3VI3E 2AABH 4AIZB 4GBXA 1CL7H 1RU9H 3QFJE 3EYOA 2PTTA 4N5EC 4IRZH 4EDXA 5GGVH 4BFBD 2ZUSA 4XXCA 1TZIB 2OZ4L 2EIZA 2RGSA 2HVKA 3SGEH 3LKQB 4YDIL 2XG5A 5L9DH 5T1LB 2ZCHH 4DTGH 4S0TD 3FOMB 3J8F7 1BZ7A 5B8CA 4NKOB 5HHOD 1HDMA 1TFHA 3H0TB 4PBWD 3FO1B 2VLRB 4LQ1A 1INDH 2GJ6D 4LPTA 5F9AC 2IPUG 1CG9B 3X13A 5GSRB 3GHEL 4XP4L 3MV9E 1YN7A 5D2NA 4DQOH 5C0JB 4ZNEE 1KTKE 4FTVA 4P5TD 4RDQG 5AG8A 3LDBC 3W81A 2EDTA 2ZNXA 4OD2B 5E08L 1BX2A 4YXLH 3GMRA 4YFEA 4LAQL 6CGTA 1T4KB 4GRWH 2BHYA 2HA1A 1XR9A 2YD5A 4MQ7A 4LCCB 5D72L 3ZKMC 4C4KO 2B4CC 5GJSH 4ZUVA 2XRAL 3CDGA 3BYYA 2QADD 3EGSB 5C08E 4HIEA 1EXUA 3IDUA 3O4LA 4N8PA 4PJ8A 1U0QA 2JJTA 3B9DA 4ODTH 4XTRD 4G42B 4JHBA 5DD1L 5DJXB 4FQXB 3IRPX 4GW4A 4PG2A 2F58H 1TJGH 3OXRA 4MZ3A 2AK4E 4MS8D 1ZTXL 3FQUB 4WTZA 4Y4KA 3SDCC 3OPZL 5IB4B 5IEHB 5JMRA 4IRSB 1HSBA 1WBZA 4G7YH 1CICD 3IFPB 3O6LL 3C8KB 3RL2A 3RIFF 3BDYL 5TQ0H 1UQSA 4R8WH 5DQDL 2NW3B 3M8OH 4G6ML 1CBVH 2D3VA 2LU4A 4XZUB 4F8QA 5IUSA 1U8IB 5E4IA 3JWDL 2UZIH 2NLJA 3VRIA 1BIIA 5CFHA 4GXVL 2VDNL 1C5DB 4KRPD 3SCMB 4X4XB 1J87A 2QQQA 3DI2B 4JRWA 4F9PA 3V5DB 3AFLA 4S1QH 5BS0B 1GGTA 1FC1A 5C2BL 5FGSA 1JRHL 2XKSA 1RZGA 1HK6A 1XGUA 3HC3H 4OZIA 4XVJH 1NMBL 5F7DA 4PRBA 4TOYL 1B6UA 1J5OL 4Z7NF 3ARDD 5IF0B 2IALB 4EUPG 2ICWJ 1RZFH 2FATL 3CXDH 1TZIA 5L6YL 3CVHH 1OT1A 1F3JB 1CT8B 5EOCH 2X4TB 5TE4L 3MLUH 2I07A 1OP5K 1AGFB 1N8ZB 2BDNH 3R1GL 3FOMA 3PHOB 2NY2B 1P7QD 1HXYA 1J1OL 3M17B 2P5EA 1JHTB 5MEOA 1QSVA 2VLRA 4LDLB 1KCSH 2Z93B 3R0MA 2VNCA 3QIBD 1I7TB 1JHKL 1LO3H 3IDGA 4NFDA 4XWOD 5DZLA 3S35X 4H1LG 3QWOB 1NAMH 4Z5RB 3QNZB 3ZE0F 4OI8A 1X9QA 4MA3B 5GSRA 5MP6H 1JFQH 3PV7A 1F90H 3UZQA 1E4XH 4R7DA 4XRCB 2J6EA 5AYQA 4L4TE 3OKLB 5LG1A 3OAUH 5IVXF 1WCQA 3L3DB 1KPUB 4OD2A 5E24E 1S9KC 4OCRL 4OI7A 3O4OB 1EZVX 5DFTA 5JIHA 4GQ9L 2BXZA 1T7ZA 3TN0A 2LV4A 2BMKB 5DEFA 1CF8L 1RJLA 2WIMA 3X17A 1FH5H 3FRUB 5DZNA 4YHOL 4F58H 2DLHA 2WLZA 1L6XA 1HWGB 5C3TA 3QAZC 4OCNC 3INUH 1J10A 5CP7B 3CFDB 4ZS6D 2APWA 1ZK9A 3VGAB 1AQKH 1YNKL 4JRXD 1MJ8L 1IL1B 3EO9L 2VXTL 3RAJH 3RZCC 1F02I 4NBYB 5IEHA 1UFUA 3FQUA 3VW3L 5INCB 4ZSOE 1KXQE 3BZ4A 4Y16B 2BNQE 2ITDA 2NW3A 1DP0A 1DQDL 4HJ0C 4Y1AD 3U83A 3UX9B 1A8JH 3BKCL 4X6BB 3WE6B 1AHWA 3QDJB 3K4DA 5ILTL 5CIPH 2R1XA 3CFIC 4UUJB 3MLPA 1X5YA 1T5WB 5BS0A 4GG6F 1CZ8H 3TJHD 3V0VA 1ERNA 1QBML 3CDFA 1JPSL 4HS6A 5CUSL 4X0KB 5JHDA 1CLOH 3VXRE 4D2NA 1MCRA 1F5WA 2IALA 1IAIL 5DQJA 3TO4D 3P73A 3VFVB 1SEBA 3QXDB 2CMRH 2MQ0A 1AGFA 3GMPB 3AMKA 2DQDH 3PHOA 5T3XD 5I1JL 4PJ7A 4JKKA 3MA7B 1WWCA 5HXMA 1TETH 1JHTA 3V0WH 3TVMC 4PJXE 2Z31B 5D93C 1MFCH 1OAKH 4Y4FC 3LKRB 4RGNE 1SEQH 1AO7D 2OL3H 4OQTL 2I9LB 3QWOA 2AJSL 3QNZA 5GRUH 1LNUB 4XB8A 4D0DB 4X98A 4G8GD 1XIWC 1IGYB 2KKQA 4JFED 2H9GB 3KS0H 1JE6A 4M43L 4ZUTA 2JLLA 2CJUL 3HRZB 1UH2A 2CXGA 3IYLW 1KPUA 2W38A 3O3AB 1WAAE 3QDMA 3VGDA 3TA3C 1HZHL 5IMKB 1NLDL 5IHUL 3MCKB 5DR5L 4QXTB 3RNQB 1CFVH 1U8QB 3LRSA 3FRUA 1FO0L 4F7TB 1CE6B 3HRPA 3WFDH 4FQJH 4TVPE 4P4RA 3MV8B 5E99H 1OTSD 4Q9QL 3KJ6H 3KWWB 4HWNA 1IL1A 5HHVH 1YNLL 5T1LD 3GMLB 3QDHA 4PB0H 3VXMA 3U1SL 2XN9D 4PY8I 4DAGL 3D85A 2EDXA 5FKPB 1CFTA 1WWBX 2KQNA 1K8IB 1YN6A 4UOW1 4GXUN 3C2AL 3MUJA 3F5WB 3ZTNH 3FQWB 3RTQA 3B8SA 4CMMA 3NFSL 1NUNB 2UUDK 5KVEL 4UT7L 1UWXH 4ZAKD 4OCXL 3AS3A 3TYFB 4HWEL 2IBBA 1E4XI 5I73B 1S9YB 4NUGH 1GC1L 2VDLH 1JYWA 3MBEB 5IBUG 1Z3GH 2FZ3A 1BJ1H 3KPSE 5BZWA 1IC1A 1A5FL 2FD6H 1XR8A 4KZEL 3GBNH 1WFNA 3L5XH 5I1HH 4YBLC 5IB1B 5DHYA 4XMPH 3CK0L 5ITBL 4PBXA 4AEIL 3QO0B 5D5MF 4WTZG 5GJTH 2XOTA 4FABL 1CIUA 1H8NA 4HZLB 5C07E 1DANT 3QH3B 2AJUH 2O5YH 4O2FA 5BO1H 1F13A 4TN9A 4KI5E 3FQTB 1J0HA 3GMPA 4GFTB 5DRXB 4FQXD 1X5AA 3MA7A 1X5HA 4HX1B 5FGRA 5EU6B 1RULL 1II4E 2AJYL 2PXYB 4M4RA 1MPAL 3QHZH 5I8KL 1CI5A 1J9CT 1S3KL 4IRSD 1RUKL 4F7CA 3N85L 2J8UA 3GRWH 1W8NA 4BFIA 4P49A 5JXED 5IVXB 4MNGB 5C70A 3T0DA 1H3PL 4D0DA 4PB9H 4WFGE 5TF1H 1IGYA 1CGSL 4XAKD 1KB9J 1UM5H 2R69L 1DBBL 1MFDL 3QEGH 2JJWA 3PG2A 1EO5A 3GIZL 1DZBA 1MAMH 1RURL 4U1KB 3S37L 3O3AA 3O81A 3SCMD 1TJHL 4PRIA 5H2BB 5IMKA 4Z95L 1H3UA 3JWOH 4WTWA 3MCKA 3RNQA 4PGDB 5C0CB 3G04B 4P9HC 1U8QA 1CE6A 1JNNL 4YHML 4OLYL 1QFWI 3M45A 3VI4E 1Z2KA 3QIUB 4CDGC 3ULVE 4H20H 3KWWA 3MGTB 4PJDE 4ZUWB 4XP9H 3GMLA 3L3IA 4OGXH 3OKKB 4WI8A 4ZXBB 5ERWB 3E3QE 2WAHA 5I1DA 5MEQA 3PV6A 3CU7A 4PGEB 2ENSA 4F37F 4NP4L 2E8YA 3SDDB 2V9RA 1JNHB 3F5WA 2R4RL 2JELL 3GZKA 4BSVB 5EZJB 1FYTE 2CSPA 3A6BL 3TYFA 2OS7A 3D48R 3TV3L 3NH7L 2DKUA 3RGHA 1NMAH 1N5YH 4Y5VA 2LFGA 3EFDL 3MGAA 5DVKA 2AXJA 5C0RH 2DKMA 4URTB 2R0LL 5DK2B 1ORSB 3VMPA 5JORB 5DTFB 5IB1A 5BV7B 5BVJB 3OKOA 1FG2B 3UC0L 4DVBB 2P24B 4I1NB 4S1DD 4ZD3L 2APFA 2WP3O 1S9VB 1JGUH 1CIDA 3A67H 3NIDE 4QOKB 4MJ5B 3MNZA 1AD9B 3Q5OA 2GTZA 1MFBH 4JO3L 4Z7UF 3VXSE 3G6DL 4Y2DB 3HPJA 4KQ4L 5ID1A 3FQTA 3N06B 3CVIL 5DRXA 4BH8B 4LRIC 4CADB 2Y72A 5E8PB 2B2XH 4LASL 5ESAB 2PXYA 2BRRH 3HR5A 4AMKH 2QKIA 3P4MB 2ZUYA 2P8PB 3MJ6A 2IFFL 4DN3L 1U2HA 2A73A 4MHHI 2UUDH 1BGXH 3D39B 4G9FE 4OGYH 5IVXA 4KK6D 2DM4A 5EU7E 3VFMB 5C0BB 3V4VH 2WIIB 2DDQL 2HG5B 5FUZL 5JO5B 5HBBA 2Z92B 1J8KA 5TDNB 2DL9A 4LSUH 3BGMB 5DWUL 4CKVX 4X99A 2A74A 1BFTA 5D9SA 1G7HB 1JWMA 3QDJD 4U1KA 1E4JA 1T7VA 4CVWA 5JOFA 1I9IL 3QG6B 2R8SH 5H2BA 3QUML 1MQKL 1NFIA 3K8MA 4XP6H 5KVGL 3ARTA 1Q9OA 3WFEH 4F15C 5CCKH 3JV6A 1AGCB 5B4MC 5C0CA 2P1YA 1X4XA 2ADGB 4XPTL 2Y06H 1IC5H 4JGMA 4QTHA 1QNZL 1EHLH 3SKOB 3H9SE 3ZDZF 4F80A 3FB8B 4Z7OE 4XNUH 3QIUA 1PSKL 2P49B 4LLQB 4NJ9L 5C0FB 2MCPH 2ZOLB 1JNLH 3U48A 4YHLH 5FGBA 4Z0XB 4ZUUB 4M7LL 4LPUA 1BD2A 1NGYA 5I74C 4TQEL 3D18B 4TVPL 4MYWB 4UV4L 4ZXBA 3AM8A 4HK3J 4EIGB 4PGEA 2OMNA 4GKZB 1DBJH 3AMLA 2E9JA 2Z31D 1CGWA 5D7LA 4ODHL 3VDAA 5J12B 2O5XH 4BSVA 4GSDL 1A7QL 1BBDL 1B2WH 1NC4D 5EZJA 1Z9LA 4WCYH 5D7IE 3T8XA 2FIKA 1YPZE 1B6DA 4UIMA 25C8H 5F7YC 1X6NA 1XF4B 4CMHC 4GG6A 3H6JA 4MD4B 3WXWH 1BBJB 2X6MA 2R29L 1KEML 5D5MB 2DWDB 3QEHB 4TULH 5KS9F 2AGJH 3PWLB 4ZQKB 1IGCL 3NAAL 2LAAA 3ISWA 4MAYA 3GMMB 2PR4L 4LSRL 5IG7B 5BVJA 1BOGB 3WHXB 1X5KA 4I13B 1OQOA 5C3LD 4R0LA 5AG9A 4H8WL 1SHMA 5TE6H 2P24A 4OCYL 1WITA 1JTOA 4HBCH 4ZO7A 3P77A 5KTEH 5MENA 1PZ5B 5HPOA 1S9VA 1J0ZA 1GGUA 2EKSB 5L88L 4JJ5B 3VRJA 1UWGL 1R0AH 3MV8D 4HXBL 4PRDB 3C87A 3O45A 5C9JB 3HC4L 1NJ9B 5FYJD 4O2EB 3ZSTA 1RIVH 5CJQH 4P23C 4G6JL 3EJYD 1I7RB 3TBYB 3BN9D 1CFNA 3T4YA 2ID5A 3PHQA 2WIIA 2G5RA 3GNML 4ZS7L 5C86A 2YD4A 4FZEH 4KRMB 5TDNA 1KGCE 4EXPX 5E6ZA 3CC5B 4E42B 3BPNB 2CUIA 3L5HA 3UYRL 1G7HA 5TFSH 4ZFOB 4TSAH 1PG7H 4XVSL 3UO1L 3ARZA 1SBSH 5I19L 1V7NH 1RJZB 4HKBB 3OMZA 4UAOC 1AGCA 3LN5B 2YA1A 5C71A 4KK5D 3REVB 1QOKA 5CZXC 3TH4T 1AIFA 2K7QA 2VMFA 3SKOA 3HZYB 4IIQB 5B3JF 3FB8A 4B7LA 3VFNA 2YZ1A 1CDBA 2ZOLA 3DXAA 1IBGH 1OTUC 2VQTA 4ZUUA 2Q76B 3O6KL 4PREB 3D18A 1A9BA 1U8NB 1A7OL 5CD3A 2PO6B 5HHOE 1U6AL 3GK8H 3QXTA 5EBWA 3ULVL 3UTSD 4JREC 3EO0A 3PWVA 1CS6A 4HG4J 2ZP0T 1QFOA 5T5FL 1DQLL 4B0MM 2D7OA 1GL4B 5IGXH 4NWTL 5L8JB 3L95B 2XZQH 3WO4B 4L29A 1GIGH 4MD4A 3BVNA 2HVJB 4LVHB 1KULA 5DJ0A 5D5MA 1QSED 2ARJQ 5FHBH 2YUWA 4WFFE 2X05A 1OHQA 4OQ1A 3MLWL 5AZEH 4B5EA 4Z7UB 5GPRA 1DQMH 5FHAH 2ED7A 4PLKC 1PZ5A 3QP3A 4NQEB 1NMCB 4U1SB 4WI3A 3AREB 2DQFB 3R06B 1ZT7A 2YZ8A 4P46C 4PRDA 3VD5A 5I8CA 1U8JB 3CFJB 5C9JA 4P3DA 1T22B 5ENWB 1UKTA 4HCRL 5IMMA 1T0PB 5E6IB 1NJ9A 4MD5B 4JFYB 3BP5B 5I1GH 3CFBB 2AQ2A 3N1GC 4R3SA 3CLFL 3PL6C 5E70A 5E1AB 4WW2A 1MHHB 1WTGT 4FFVC 3RVTD 5F1IA 4L8BB 4C57C 2W0KA 4N8VA 1IQDB 3T1FB 5E94A 2FLBT 1DN0B 2B5IB 2FHBA 5KSBF 3ARFB 4PGCB 2ZUQB 2MMXA 1MFAL 2NY5H 3NVQA 2ADFH 3SDAA 3EYUL 3OR6A 1RJZA 4KPHH 1G9NL 3IFLH 4YXKH 3SE9H 1UZ6E 3EDDA 4FQCL 1F97A 4AL8L 4JFDE 2ESVA 1WFTA 2XQBH 2A77L 4TRPL 2BOCA 2CIIA 2NXZB 2DQUL 1BPVA 4IIQA 5TPWL 4QOKD 3TWCH 4U4BA 3V5KB 2Q1EA 5D1ZC 3EYFA 4Y2DD 4EI5C 3VFRB 4JY4B 1ODAA 4RMTA 4PREA 1L7IL 3UTTB 1U8NA 4M6NH 1SY6L 4Y5YB 2A6DB 3MV7B 3LRGA 3CZFB 3B9KB 1JIBA 2JIXB 4KHTL 1UWEL 4JPKL 1IMHC 5IMLA 2P47B 5T5NF 3CH1B 3D39D 4HF5H 2VDOH 5D6CA 1I85C 3ARBA 3PQYB 5D7JD 4ZTOH 4X9BA 5C0BD 4J3OC 3X14A 5KS9B 3LZFH 3L95A 4WI5A 3SJVB 1KYOK 4HEME 3CLEH 4Y19B 4X8XA 4I0PB 1EHXA 2DL2A 4JM2D 5DHVB 4HT1H 5FUCE 1N0XH 3U46A 4PV9A 3AY4A 2X4QB 3BKYL 1NGXA 4Z7UA 1U93A 4QWWC 1YY9D 3GSNA 5JOEA 5E2VH 1I8MB 4HLZH 2OTPA 4AJ0A 4WWKA 3X3GH 5T33L 5IQ7H 5DUPL 4F9LC 2DQJL 4NQEA 5D1QC 1JBJA 5HJ3B 2VUYA 3UMTA 5JW4Q 4I3SH 2FBJH 5JLZA 2DQFA 4MLIA 3R06A 4ETQB 3BUYB 1M7IA 5LXGL 1MCBA 1U8JA 1KJ2A 3CFJA 1RK0A 1XGRB 3CXHJ 3O3EB 4NIKB 4M61B 4R4NC 1T22A 2DWEB 5EOTB 3VFUB 5LBSL 1SMAA 5E6IA 3CJJA 3QWRD 4QXWA 4JFYA 3BP5A 1EEQA 5HHXL 3D2UB 3TCLB 3CFBA 5IBLD 3ARGD 3UXFA 5CMAB 1QYGH 1MHHA 2XZCL 5E1AA 2WWMD 4XPHH 4ODBD 2J8HA 4PD4J 5DMGD 3MUGA 3VCLB 4PTUA 2P5WB 3C6LB 4I0KA 4E0RA 3F12A 4C56A 1DN0A 5BJTB 3MJ9A 2BVUA 5D2NE 4FNLH 3IU4H 2AK1H 4FTVE 4AY0A 4MXWL 2R56L 3WSQL 5BRZD 4NNYB 3QEQA 1H5BC 3NCYP 4YUEL 4UBDD 3SKJL 4JDZB 4HIJA 1YJDC 1CFBA 2X4SB 4KRLB 5IBTH 4LBEB 1FLRH 3GSUB 3TYGL 2XPGA 4XNZC 1XEDA 3TBVA 3F8UB 5E8OB 3KYOA 1PKOA 3BQUB 1GRWA 2J88H 3QCVL 4JY4A 2X2YA 1QVOB 4MNQA 3GO1H 3M07A 1EMTL 4Y5YA 2A6DA 3MV7A 3L3HB 5F7HA 3CZFA 4JFHE 2A0LD 1W72H 4OZGF 5SWZA 2CO7B 3CH1A 3KPNB 1AO7E 3I9GL 1IEHA 1J1PL 1MJ7L 2WANA 1MRCL 2GK2A 3PQYA 2JJSA 1I9RL 5KS9A 3ZTJH 2Q8BL 1FNEA 4HUNB 3SJVA 3PGDB 1UXWB 1VESA 2A9NL 2AJVL 5CJOL 1RUML 2VH5L 4HJGA 4GRWF 2VLJE 3D0VB 2FWOB 4OZFB 4XBGB 4WRLA 3VG0L 3P4OB 3T0EA 1PY4A 4IJ3B 2X4QA 5HPMB 4KMTL 3ULUH 3JTSB 4K7PY 1NUDA 5TGBB 1I8MA 4O4YL 1IGJB 2ZCKL 4OZIE 5DJ6A 4XBPA 5JPMB 3PGFL 1FG9C 4G6KH 4KQ3H 3WXVL 3VWKC 2NZ9C 1NL0L 4HJJL 1DVFB 4X6FB 3T0WA 3RWDB 5IVZB 2QSCH 1KB5H 4O5LH 5LQBH 3VFUA 3VWJA 2FDBP 1RUPL 2PO6D 5HD8D 1IEAA 3V9FA 2P5EE 3O2VH 5E2UH 1UKQA 4UQ2B 2VLRE 4LGPB 2KL6A 3QI9D 5K9QI 5I1EL 2J5LB 4JRYD 4PJFF 4J3VA 3EOTH 1YEGH 3HS0B 1ZA3A 1NCDL 4LLMB 2P5WA 2VWEC 1MWAB 1F3DJ 3C6LA 4JPWL 1KTRL 1SM3H 5BJTA 1TDQA 4V1DD 3C5SB 8FABB 2ITCB 3TFKC 4OUOA 2A1WL 3FZUD 5DRZA 1HCFX 4NNYA 3TJEH 3QIWC 4YIQB 1ZA6B 2DLFL 4Z7QF 2Y36L 3RVVD 3DX9B 1FL5A 3V52H 2X4SA 4LBEA 4HUVB 1B88A 3GSUA 3IJYB 3O3BB 5FUOH 4EKXA 4HULB 3GSWA 1MI5B 3ZL4L 3ARXA 1MH5B 5E8OA 1TITA 3ARED 3H3PH 1ONQB 3BD5A 3KJ4C 1NGWB 1MREH 3B2VL 4Y4HC 3NZHH 4K94L 3BKJH 4QXUH 5ICYB 2NY1C 5DUBB 4X7TB 4Y0GA 5FA3B 2AW2A 4EOWH 5C7XH 4U0QB 1NDMB 4R90L 1Y18B 5FYKL 3GHBL 5LAXB 1D9KA 2VIRA 3LS5L 1S9XB 2UZXB 1CLYL 1UXWA 4L3EB 5H37H 3KR3H 4FMFA 4LSSL 3D0VA 3ARFD 2E9BA 4OZFA 3RI5K 2ZJSL 5L8KB 4XBGA 4HGKC 4DEPB 3ECBA 3P4OA 4JZJB 3QNXA 2MKLC 1CK0H 2OJEA 3DX6B 4LOUD 1G0DA 4JZOB 4K3JL 3MV11 5FAAA 5BS0E 4JPIA 3EHBC 3MV01 3DJ9A 3HMXA 4JO2H 3GSRB 1IGJA 1WK0A 4Q9BA 4NM4H 2X41A 1HN1A 5JHDE 4ENEC 4K3EH 3VRLE 4XNXL 3HN3A 5CSZB 4GRLB 5E5MA 1T66C 4X6FA 5BOZG 5IVZA 4N0RA 1P5UA 4JB9H 3TT1L 5C0IB 1EAPA 4YZFF 2OCFD 4PJ7E 3ROLB 5KN5B 4M6AA 3VXUB 2F19H 2YPKB 1OF2B 2VSDA 3B9KD 2D0GA 2JIXD 1NAKH 4ZFGL 1NDGB 5F3BA 5D7SL 5KSBA 5IFAL 5F7WC 2MCG1 1U8PB 4Q0XH 4LVOC 4X5WA 4LLMA 2CUHA 2G75A 4JAMB 1J86A 1UT9A 5FECA 4PPTA 4Y19D 1KJVB 3BPLC 5F70A 3O2DH 3H7LA 4XPGL 1U58B 1FZKB 5HY9A 3C5SA 3HAEG 1XF5B 2P45B 3DETD 1E6OL 1NGQL 3UBXA 4ONFH 3QDME 2EXYD 4YIQA 9CGTA 5BMFH 4JCMA 3UJTL 4GUPA 4MA8L 5ACLA 3KGRA 4P5TC 1Y0LB 1IQWL 4YHNB 3C60B 4HUVA 4Z8FL 3FAWA 1K3ZA 1Q38A 3O3BA 4FXKA 3VXPB 4PYHA 4JVWA 1IFHH 1YEFL 2V5SA 1F6FB 2W65A 3U36B 1ONQA 2ICES 2P42B 1T89C 3T0VA 2QADC 2V17H 3BEVB 3BD4A 4ZOCA 1E27A 2ZCLH 3O8XA 1IILE 1I1RA 5EOQL 1QKZL 3VXOB 3D2UD 4GXUM 1LEIB 4QRSA 3MXVL 4LLUB 1RD6A 4GRWB 1UB6A 2DBLH 2R23B 3OXSA 5HYJA 4R4BB 4MS8C 2XA8H 5JW5B 1A6VH 3VGGA 1KFAL 2ADIB 3S88L 5E56A 1QEWA 3B2UC 1S7VB 1EDQA 1GGCH 2PYEB 2EO9A 1GGYA 2JK5A 5B39B 3TZVB 3SE3C 1EEUA 3QDJE 3IFOA 1KLUB 4WV1A 5B3NA 2ICEB 4N0UB 5KW9H 3T77B 3MYZA 3DX6A 1A3QA 4NBZB 4O2CA 3O2WL 4KJPD 3GSRA 4QLRA 4W4NA 1JZ4A 1K6QL 3UROR 4MGXA 3KXFD 4YGAB 3RDTC 3BHBB 5AUMB 2EIDA 1HHIA 4BUGA 5CSZA 3WFCL 1BF8A 3S96B 1T21B 1TCRB 3BQUD 1ADQA 3IETA 4NNPL 3BMVA 4GO6B 3ARDC 3MOAH 3ROLA 5FDWB 1FGNL 5AD0A 1HHKB 1NDGA 2IGFL 5HGHA 4JDVB 4P3CH 1U8PA 4YPGB 1RZJH 3IKCB 3X12B 4M7KH 1GSMA 5DD5H 3K46A 4CVXB 4DWHA 1BM3L 2DQTL 4LU5L 4UDTB 4IDJL 1FZKA 2FO4B 5SWSD 3NFPA 4YE4H 2VZOA 1NPUA 4LSDA 4PRIE 2X40A 3QXAA 1LEKB 3LKSA 4U1IA 3FHQA 1BVLB 4XCFH 2J6EL 2O5ZL 5ESVB 3Q1SL 4HWZB 1OLLA 4G5ZL 4YHNA 4PRAB 1F4YL 2MPAH 3S37X 3VXPA 1CGXA 3FT2B 3P3YA 4DVRH 1NAMB 3MRBB 4IMKC 2X4NB 4OZGA 1DVFD 1K85A 3KPRA 5ALBL 5C09B 4RZCA 3R8BB 4ZUSB 3EFFA 2IBZX 2ZKHL 2MKWA 2F8OA 4HFUL 3QUKB 1H9VA 1YUHB 3QQ9D 1MHPH 3DLQR 1I3VA 4P48A 3F58L 4ZS6C 1LEIA 3TH2T 2W92A 4MSWA 3LS4H 3EIFA 2HTKD 4TTGA 2IG2H 1ZLWH 1FAIH 3DYOA 4WUKH 5FOBA 5JW5A 2VQ1B 2LABA 1S7VA 2PYEA 2DQGH 3BOVA 2DM7A 3TZVA 3O4LD 5TDOA 5DJAA 2NR6D 3V5HB 5BCAA 3QUYA 2AXHA 1Q9LB 1RZ8B 2IH3A 3T77A 1I9EA 5DVMA 5HI5D 1KCKA 4NKIH 4P4KA 2GW5A 4Z7NE 2VDQL 5KVFL 3H7BA 4H1LH 3QDGD 3QRGH 1ACYL 1YNTB 1MI5D 2KZ1B 3NCEB 2D7TL 4K9EC 4JN1H 4BFGA 4Y5XC 4OFVA 1QLRB 1F4XL 5I1IL 1N6QL 1T21A 1ZHKB 1A2YB 3L7EB 4PGJA 5F1NB 2DLIA 1SMOA 3QFDA 3LDBB 2AJXH 3NACH 4KDVA 4QT5B 1L4IA 4PJFA 1QR1B 5HHNB 4PY7B 2M26A 5EU6E 3ZE0E 3TO4C 3O41B 1RQ5A 3LEYH 3BFOA 4OZFG 5C8JB 4U49A 1HHKA 5CIPB 5HGDB 3AS2A 2ZPKL 2IEPA 1ACZA 4X9HA 2L0DA 4J1UB 1VGEH 3ZYZA 4YPGA 5IVXE 3IKCA 2JF1A 4MNGE 3X12A 4MB3A 2XQYG 4LHJB 1JYXA 4CVXA 4JQIL 4L3ED 4XMKH 2APTA 1EEZB 5BVPH 4UDTA 2VTFA 2H45A 3CVHA 5GGTH 4NQDB 1DE4A 3ZT5A 3DROA 4K71C 1MFEH 1QSFA 1LO0L 3F6LA 3HCVA 3SDCB 1LEKA 2HKFH 3QXWA 2YC1A 1RUQL 2VAJA 1JGVH 3RBSA 5C0CE 1ZEAL 4RISH 2CDEA 5EWIH 1WT5A 4UINH 3GM8A 2OL3B 1C1EH 4DGIH 3IF1A 3PWJA 5AWNH 3WMSA 2E27L 1NAMA 3MRBA 2YUVA 1U92B 3OZ9L 2R39A 4LCWD 4YXHH 4PJBF 2GT9B 4PJ5B 3NIFF 5AZ2L 2YSSB 2DB8A 1BD2E 3FN3A 1KB9K 5K9JL 3QUKA 1YUHA 3HC0B 5TDPA 3VXUD 4LCYB 1N0LA 1ZVSB 32C2B 4PJ9C 5HDBF 5D7LE 2R0KH 4J7RA 2D03L 3KPOA 4HH9B 4ALAL 2VQ1A 1KNOA 3OG6B 5T1DL 1NFDF 4NJAH 1KCRH 3PNWB 2QHRL 1A7NL 2V7NB 4Z9KB 4HPOH 1I1YB 3SOBL 3RY6C 4GG6E 2UWEB 4NRYB 4ZAKC 4G8FA 3V5HA 1Q9LA 1RZ8A 3K74B 3RRQA 1G9MH 4L4VB 1RIHL 3FB7B 5FO8B 5I17A 1AR1C 1HH9B 5ADPL 4LHUA 3EZJB 2PTUA 3C60D 4WFED 4QNPF 5HI3C 5GS0L 3QCUL 3SE4C 3QO1B 1QLRA 3C8DA 3TH3T 1BFOA 4NC1C 4EIZC 4OFKA 4LEXH 2VAAA 2Y07H 3L7EA 5E0QA 5F1NA 4K07A 4ERSL 4HFWA 3VD3A 3BAEL 1JYVA 5CEXA 3T0XA 3KPLA 4OM0L 1UADC 5EBGA 1D5MB 2P48B 4D9RD 4PS4L 5F9JB 2D31B 1NGPL 2BXYA 3ELAT 1T2QL 1UCBH 5H35A 5D72H 4M8VA 5CIPA 1MEXH 5HGDA 1FNSH 3V6BR 4EVNA 3FO2B 3D39E 4NNXA 2IADB 3QAZB 4PRHA 2YPLB 4K8RD 2BFVL 4NQSA 5EZIH 4AEHL 2H2SD 5C0BE 5CINL 2EDDA 2FHFA 1EEZA 1DJSA 5ABDE 5D96C 5EFIB 2YD7A 2Y25A 4X7FC 2IH1B 3FHAA 2CKBL 4NQDA 3RZCB 2ICWI 5TE7H 2XACC 4U3HA 5FO9A 3MCLL 3BH8B 2X4RA 1SYSB 4P2OA 1JF1B 2PCPB 3ALPA 1KN4H 4K9EH 4N0FB 1QSZA 4DZ8A 1P2CB 4EQ3A 5DRNA 5F97E 3GJEB 2OL3A 3X3FL 4FQ1L 1HH6A 2WMPA 3D25B 4QRTA 2I9TB 1TNMA 1ETZB 1U92A 1C12B 4G6AC 3IGAA 4M1DL 2GT9A 4NHUB 3OAZK 1DLHA 4PJ5A 3DXAE 3W5NA 1FQ9C 1U91B 2YSSA 5DD6A 5F7EL 2VR4A 2OSLA 1P7KB 5T3XH 1GOFA 5IMOB 2BJMH 3HC0A 5CP3H 5ADOH 1JRHH 4LCYA 3X11A 1ZVSA 2SEBA 3RVUD 4PUBL 5MI0B 3TBSB 1JHLH 2ED9A 4P99A 3RX7A 2ZUVA 1YMMB 4HH9A 4RFOH 5BZDB 1MRDL 5AAWA 1ZT1A 2WUBL 4S1SL 5MERB 2B0SL 1V5JA 3UYPA 4BUHA 2V7NA 5F1SA 3R1GH 4RNRB 3C5JB 5JQ6H 1L7TL 1R3KB 1LEGB 5D5ME 1I4FB 5J13C 3DVIA 3TVMB 1K4DB 5IB2A 4QKXB 4L4VA 4U1LB 1UKSA 4NQCB 4U6YB 5D93B 3UZEA 4Y4FB 5L7XL 1HH9A 1WF5A 3OKDB 4YWGH 4H0IA 5GZND 3THMH 1OL0A 3WN5C 2NPLX 1ORQB 1ZXQA 1XIWB 4JJHA 2YWZA 4JM4H 1VERA 1V8HA 2NMSA 5EO1A 1B4JH 3CCHA 1P5VA 1GC1C 1RAMA 1RZIB 1KPVB 3RWFB 4OGZA 4OCRH 5C09D 2DLEA 1ZANH 1D5MA 3TA3B 4M3KB 1DEDA 4U0RC 4FXGA 1NEZB 5B39G 3LKOB 4HMDA 3DMMA 4XP1L 5GS0D 4WVRA 1INEL 2FSEB 1HI6B 4DGVH 3HNVH 1FZOA 5ACZB 4P59L 3FO2A 4N5ED 1WUNT 5I66B 1KUMA 5E9DD 2C4FT 4ONGH 2VERN 4LMQI 1J8HD 2XTJD 3AU1B 4YO0A 4KK6C 2AI0L 3RZCA 1M7DB 4I18A 1XZ0B 3WKML 4FFWC 1MLBB 3C5ZD 3EOBB 4HDIA 2FH8A 5IROC 3FB5A 3NOIA 1ZS8B 3B6SB 5C6WH 1OAXH 5INDB 3GRWA 1YQ2A 1N2RA 4DCQB 5HGGS 2I9TA 1ETZA 1IGIL 2VXSH 2YXFA 1I3UA 4K7PH 2P8MB 1U91A 3E6FA 1S7UB 1X5JA 4YBLB 4WWID 5IMOA 5F88B 3U7YH 3LN9A 5J56B 5L8LB 4FP8H 5EZOH 2Z35B 3QISA 5BZDA 2AQ3A 1A7RL 3L1OL 5IK3A 4ORZC 2VXVL 1RIUH 1W0WB 4HXAH 3CMGA 1Q94A 1R3KA 1MQ8A 3DO7A 2HJLB 2Y7QA 2CO6B 4YH6A 1LEGA 1QRNA 1I4FA 3TVMA 1K4DA 3DX7B 3SDCD 2D9QB 1A6UL 4QHLB 3KNBA 1OSZA 4TSCL 3BXNB 1F45A 1JPFB 3L7FB 3OKDA 4Z7UE 1OAUH 3BH9B 4M00A 5CJ8A 1IGTB 1C5BL 4AIOA 3S36L 4NQEE 1N59B 4OV5B 4HIHB 1NCBL 4PJEB 3HUJB 4X7SH 4NPYA 3OAZH 1AXIB 4NT6B 5CBEB 1QACA 1M6OB 4DW2H 3RWFA 3N1FC 1AXTH 3IU3B 5DMIH 2V2WA 3P30L 3RHWK 3GIVB 1ZGLM 1U8LB 3U9UA 1NEZA 4NCC1 3LKOA 1JRHI 3BE1H 1FFNB 1OGAB 2KZWA 4M5ZH 3LSOA 3QQ3A 3JUYA 6FABL 4X7DC 3S4SB 3RWIB 3MRIA 1IGML 3MLTA 3OX8A 4O58H 4LVNC 2EDLA 5SV3A 4WJ5A 1LO5A 3AU1A 4OSUH 3J7HA 3W9DB 3LD8C 4C56E 4YDKH 1KIQA 3BN9C 2X4OA 1D5IH 1JZ7A 3DSFH 4I77L 1M7DA 4XP5L 3SGKC 1S8DB 3SE8H 1WCBB 1JPGA 1B0WA 2CRZA 5HGBB 1XZ0A 5IW1B 3C2AH 2X4UB 3I2CH 2R2HA 3ZDZE 2V5TA 5C6TH 2F5BL 1MLBA 3MRPA 3SGJC 3BPOB 4PJBA 1LP9F 5DT1H 3B6SA 3D87B 4KHXL 5DEGB 5KSAA 3DWTA 5GGRB 4AENA 5IJVB 3B4NA 4N90D 5M94B 3NBNA 2ZSWA 1B4RA 3OV6A 2W1NA 2P8MA 1V3KA 1FL6A 1M05B 2W91A 4RGNC 1MHCA 1WICA 2V2TB 2BNRB 3U0TB 3ARQA 3UTTE 4PJAF 1CDCA 2OR8A 3MV7E 1NFDA 2R2EA 4UNVA 2IAND 1Q0XH 4O51A 2X09A 5SWZE 1KCUL 5FXCH 2BY2A 2Z35A 4PV8A 3TPUB 4X80L 3FFCB 3PQYE 2A38A 5HHME 5KS9E 3SJVE 1EX0A 1R3LA 4PRPB 4LVEA 4Y19E 4D3CH 3VGHA 2HJLA 3ILPB 3W0WB 3U4EA 3DX7A 5E4EC 4LLWB 4B7IA 4QHLA 4TUOA 4A6YH 4F2MB 1PEWA 2ENYA 1XGYH 3BXNA 2NY0D 1YEIH 4OLEA 35C8L 1VEOA 4HQQL 1JTPA 1L6ZA 1RUAL 5EC1B 4YNYA 4LEOB 2OM5A 1MFDH 3L6FA 3KDMA 1HIML 1S7RA 4NZTL 5SWQA 4QTIL 3GBML 2HJFA 1R3HB 1NLBH 3FONB 1N64H 5CBEA 4OLUH 4JKWA 3OG4B 1LWRA 2WNGA 3VG9C 1MJJA 1CN4A 2D0FA 3FT4B 1U8LA 5JA9A 4F15B 1I9JH 5JDSA 4OCSL 4QRPD 5C1MB 4NZUH 1UA6L 2IQ9L 3WFBH 2NTFA 1IC7L 1VACB 4H8WC 4UU9A 3RWIA 1JZ8A 1JZ6A 2FX9H 5IHLB 1ZAGA 3OKYA 3WNNA 4WI6A 2P5WE 4IBLT 2QR0A 5GS2D 4MHHG 3QFJA 3ULUF 1UB5B 1CE1L 2RR3A 2ZSVA 3WL9B 1HWHB 3RVTC 4MWFA 5I74B 1WCBA 1YC7A 4MLSA 4UMGA 5IW1A 5B3JE 4NQCD 3QUXA 4Y2OA 1J0IA 1I3GH 3PHSA 5IW3A 3V8OA 3A6BH 3CXHK 3LQZA 2G5BB 4HMCA 1ZKAA 4AM0B 4F7EB 1XIWD 1KT2A 3D3VB 4K23L 4KMLB 4MQTB 4CMHB 1D5ZB 3H3KA 4PGBB 1F2QA 2WBJA 2YRLA 1GAFH 4KH2A 4OB5L 1M05A 2BNUA 3KYMA 1N3NB 4PD4K 2FECL 3MGOB 3N1QC 3TA3D 1IAKA 1I3RB 2ORBL 3U0TA 1MJUL 2EXWD 1N4XH 3MZGB 1U36A 2FEEL 3QXUA 4JFXA 5E2TH 1IKFH 3MLZH 3WS6C 5FYJH 2XYCA 1X44A 5IM7A 4RWYH 2DKSA 5AEAA 3K4AA 4Q2ZA 1A21A 3BIKB 3TPUA 1FLTX 3G6DH 3MPCA 1N7MH 1BQHA 1XGQB 3U9PL 4QYOA 1OAYH 3NPSC 1HINL 4PRPA 3UP1A 4GG8B 5KVDL 2DYPA 5C08A 2OR9L 4OLWH 4LKXB 5D7JC 1C16B 4XNMA 4WU5B 1KLGB 4F2MA 3KYKH 3D1MC 4P23B 4JM2C 4KUZL 2AK4A 3H9HB 1P4BL 1XCTA 4LCUB 5LVEA 3S3JA 4DGYH 12E8L 1H0DB 1JGLH 4PTTB 3TO2B 4QHNB 2GY5A 1YMHA 3E3QC 3WUWB 4GMSL 1YY9C 5T1KB 1I7UB 3KLDA 5IQ9A 1A1MB 5I15H 2O61B 3GSNL 3QPQC 2XA3A 1J05A 1U8KB 3QUMH 4OM1L 2ZZUT 3SKUD 3FT4A 4JQXC 3MRGA 4UAOB 4UV7H 4U2ZA 3BRGC 1IRAY 1A0QL 2C3VA 4BSJA 3KYNB 2F53B 1QNZH 1X7QB 4ZG1A 3QNYA 1KJ2L 3LN4A 4MD0B 1GYAA 5DJDB 1FNGB 5KSBE 1AGDB 1Q0YL 3JV4A 5I8OH 3IDMA 4OIBA 5JW4N 1RJYB 4XCCH 4BZ1L 2DOCA 4J2XA 3ARGC 3T3PF 1KJ3L 3VU2A 1UB5A 2MQ3A 4OAWB 3STLB 2WWMC 1GPOL 3BD3A 1Z5LB 3D9AL 1MIEH 1HEZB 2W9EL 3MLVH 5FK9B 4JREB 4OJFL 5HHPB 5CSGA 4GSDH 1A7QH 1BBDH 3S35L 3NIDF 2MWCA 4R7NB 4OLZH 4IHOA 1NEZG 1GHFL 2G5BA 4AT6B 3HE6C 1OP9A 1KJMB 2HN7B 3BWAA 1F8TL 2A9ML 4AM0A 2XY1A 3D3VA 4RX4A 4UBDC 4PJAB 3UTQB 1URLA 1BAFH 1KEMH 1PKQA 1JCKA 2P7TA 1N3NA 1CD1A 2R0ZH 3MGOA 5C2UB 4NO3A 1I3RA 3HZVB 5JR1L 4QRQB 2YRZA 3HE7D 3S8WA 1OGAD 1VFAA 4HWBH 5IESH 1KIPB 1G9NC 3OSKA 3LHPL 4WUUB 5L88H 3P0VH 3GBLA 4UQ3B 3E2HC 2X9YA 2A0LC 5GGQL 5HVGB 2ZUUA 4P46B 3MC0A 4L3EE 2PETA 2FYYA 2J12B 5DD3L 1OY3B 5HYSB 1QA9A 3DRQB 5J11C 4L9LA 2D9CA 4JVUA 1EERB 4LKXA 3LQAH 5IKCB 2MOVA 5FM5M 4WU5A 2BVEA 1BEYH 4M5YL 5FB8A 1KCVL 3PL6B 3U7WL 4UTAL 4NZRL 2IPTL 3PF2A 3SKMA 4ZS7H 1W72B 4ZSOA 5HI4D 4H25A 1FDLL 3HI6H 3TO2A 4QHNA 1OTTC 3QUZC 3BT2H 5D1XB 1A1MA 1INQB 3R4DA 4MNHA 2QQKH 1DDHA 4N1CA 2BNRD 1G6RB 1QLEL 4HHAA 1ZGLP 1XGTB 4QRRB 1G7JA 2M1KA 3ZO0A 4L5FL 2VZTA 3VXUE 1DQTA 5HYQB 2F53A 3UDWC 4MMXC 4WY7L 3TBTB 2G60H 4MD0A 1AGDA 2FB4H 2GAZA 1H15B 3HI1B 4KKLD 3FFCD 5D1ZB 4KTYA 2A6JB 2A6KA 4EI5B 3FTGB 3QI9C 3LH2H 2VDPL 4M6OL 1LP9A 1Z5LA 2HKHL 4CAGA 1AJ7H 2B1HH 1JN6B 1HEZA 2CKNA 1OPGH 4Z7WF 5A1AA 5FK9A 4UIKH 3VE0B 3MA9H 2QSVA 1AI1H 4ZTPH 4FQ2L 1FIGH 2VLMD 3FZUC 4AT6A 5I1CL 1VENA 4S11A 5D2LF 3RGVC 4GAGH 4WFEE 1DL7H 1UYWH 4PJAA 4K3DL 3S4SG 2OYPA 3KHQA 4OZGE 3BKMH 4XCYA 3DV4B 1DBKL 1AQDB 4KVCH 4OUUB 3ZYJA 3HZVA 3AREC 4M6ML 4CU8A 5B4MD 5BXFB 4MVBD 4LDOB 1A6ZA 2HLFD 3QEQD 4WUUA 2JTDA 4L9DA 2F5AH 5TQ2L 5D1QB 1RHHA 4GRWE 1ZSDA 3B9VA 4EXKA 2DQEL 1KSRA 4KTDH 2H26B 1CVSC 2QQLL 5BW7C 4P46A 1FE8H 4GAJH 2PYEE 5HYSA 3RUGF 4NUJB 3DRQA 4JFFB 4DN4L 2O93L 2D4FA 4JHAL 1TLKA 5IKCA 4ZO8A 5CEZL 5EU4B 2N7AA 3L5JA 2JB5H 3G6JB 4MNQD 4N0UE 2B1AL 4X9GA 1S5IH 3S5LB 1UJ3A 2PN5A 3DSNA 1CD0A 1W72A 2E7CA 2FX7H 4LL9A 3W2DH 2C1OA 3OF6A 1LQSR 3C2SA 4LOUC 3C6SB 5J6GB 1INQA 5IB3B 2HH0H 4KDTA 3TC9A 3HMXL 4X6EB 1WEJH 1MNUH 1F3DH 1U3ZA 1XGTA 2GQHA 4QRRA 4FQCH 1H5BB 3QZWB 4I3GA 1F4WL 3KPSA 2I5YH 5F89B 3UJJH 1ZLVH 1XF2B 4MJID 3TBTA 4R4FL 4RRPA 4XNZB 4JE4B 1H15A 1NSNL 3HI1A 3UEZA 3IDXL 5D1ZA 4J4PD 3HHRB 3WUZA 1C5CL 3FTGA 3VFGH 1CWVA 2XT1B 1FL3A 2C1PA 4Z7QE 1G7PB 3DNKA 4MA1C 1IM3B 4FZ8L 4U1JB 4NGHH 5ANMB 2EE3A 1TPXC 1QSFE 3GJFK 4JPKH 4LQFH 1KB5A 3RWEB 4HS3A 2EEBA 3DRTB 4NN7C 1HE7A 3UTOA 1KC5L 2Z91A 4HC1H 3S3SA 1TZGH 2AJ3B 3TT3L 1QQDB 1IC4L 3VMNA 2OTWB 1AE6L 3GSQB 1OAQH 4LSTH 5T1KD 1YEEL 4KY1L 4XNQB 3WBDA 1R3JA 4M03A 1TCMA 2FGWL 3IDIA 3H8NA 2GEEA 3DV4A 3G08B 1NGZA 2FJGB 2NY7L 4OLXL 3CZJA 4CJ1A 1EEYB 3EYVA 1W0VA 4I0CC 4TUKH 2C26A 4WO4C 4MCYA 4F9LA 1TVBB 4G3YH 2GCYA 2YWYA 4OFYD 3MODH 4W6WB 3VWKB 5EO9B 5CJBA 2H26A 2K9UA 3IT8D 1OGTA 1BQLL 4UT9H 5CJXA 3ESUF 3CFCH 5IFJB 4QEGA 1UZ6F 3B5GA 5EU4A 2EDNA 1ND0A 1RZKH 3FQRB 3R8QA 5JA8B 3IS0X 4H0HB 3HZMA 4XGZB 4JANB 1CXEA 1EGJH 3I50H 2VDRL 4YZFE 5ICXA 3DYMA 1FYTA 2BERA 4UT6L 5EUOF 3WHE0 5CEZD 3QA3A 4XH2B 4RSVA 1XGPA 2GFBB 5I2IB 3HAEH 2IFGA 2PYFA 2Z4QB 4X4YB 3QIWB 4XC1H 3T3ME 1HHGB 3QZWA 4LLAA 4YJZL 2W0PA 3VXNA 5F89A 1OAZL 3PWNA 1ADQL 2UV3A 4DFIA 3GMNB 3MFGB 1I1FA 5LGJA 2NX5D 3NABL 4JKPH 2WUCH 4RMWA 1UM6H 5EU5A 4Z7WB 1KF9B 5CEYA 4JFOB 1FGVL 4KVNL 5K9QG 3HPLA 3KJ4B 1G7PA 4HLJA 3WUWG 3ZDXE 4U1JA 4Y4HB 3QHFH 2YKLH 3QULA 4NQDE 4UTBH 1CL7L 1RU9L 2GK0A 3RWEA 3DRTA 2NY1B 3ZKND 4IRZL 3GUTB 5GGVL 4XXCC 4FFVD 2EZ0D 4CU6A 1QQDA 2OTWA 4YAQB 3HMWH 3KLAB 4DTGL 4F57H 3GSQA 2XIDA 1T5XB 4M02A 5D1XD 2J4WL 4G9FA 5B8CC 3ZE1E 1LK3H 4MXQC 1CQKA 2XICA 3MRHB 4PJ5E 5FDYA 4Z7VF 1FVCB 1INDL 3IXAA 3EDFA 5I76A 2FJGA 3O2DA 1X6LA 4KK9C 1EO8H 2RFXA 5JIIA 3L3GA 3SO5A 2BRQA 1VADB 4X4ZA 2DJ4A 4X9FA 3L3OB 5CGTA 4H5SA 3P9LA 4DQOL 2W0FB 3QQ9C 2UZYB 5EBLB 2PW2A 5EO9A 1EH9A 1VPOH 3KG5A 2UY6A 1T3FA 4EI5D 4YXLL 4LLVB 1RMFL 2BSTA 3H9SA 1NC2D 2HTKC 4B41A 2VL5B 4HUWB 2DMCA 3OKEA 1AGBA 5DHVH 4PIRF 3GJFH 2I26N 3FQRA 4U31A 1QHOA 5GJSL 4L4VE 2E6JA 5A3ID 1QTYT 4QF1B 4I5BA 5DJ2A 4PJ8C 4X6DF 4NBXB 4XGZA 1WZ1H 1ZHNA 2E7HA 4JANA 2JJTC 2X70A 1AC0A 3G5VB 3S98A 4ODTL 1LVEA 5L2JA 5I18H 1KACB 5JW4R 1PQZB 4LKCB 3BPLB 4N90E 5IFHH 1QBLH 2R4SH 3LEXA 4B50A 1GCFA 1YYLH 3NTCH 2GFBA 5I2IA 3FKUS 3NIGF 3UPRB 5J1TC 2Z4QA 4UI2A 3BSZH 5HYSG 5TQ0L 4R8WL 1RY7B 5DMKB 3H42H 4KJYB 4P5TB 3M8OL 4XXDB 5EIVA 1CBVL 1J7VR 1FNFA 4QHMB 4F7PB 3ZL4H 3LRHA 5FYLE 2FX8L 3LOWA 2IQAB 4KU1A 4WW1A 1G7LB 2YPLE 4Z7WA 4NQUA 4U6XA 1KCLA 2Y5TA 4L3CB 5K33A 3ZDYF 3GM0A 5TH2A 4JFFD 4S1QL 2QADB 4R4ND 1ZVHA 4DZBA 4EI6B 3T4AB 1BOYA 5D2LA 3I6LD 4IOSD 3HC3L 2ZUWA 4XVJL 3MRDB 5IR1A 4EZMA 3IJSA 3VXQB 3GUTA 1I1AA 1EV2E 3MJ7A 3WNMA 1RZFL 3CXDL 2D0HA 3CVHL 4RIRB 2EYRA 5EOCL 4YAQA 3LV3B 3KLAA 3MLUL 1FVDB 2G2RB 2BDNL 1R3IH 3U4AA 1JPTH 5HDQH 4NSKB 4LGRB 4NKQB 3MRHA 1CXIA 1OM3H 1KCSL 2NYYD 2GSGA 4MCZB 2CDFA 3DGGB 1LO3L 3MJ8B 1KBGH 1B0RB 2E6QA 3WLWC 1DEEB 1XT5A 1NAML 2DLTA 4XAWH 3VA6A 4A2MA 4KDWA 5MP6L 1JFQL 2XFXB 4M48H 1E4XL 1NCAL 4LSQH 3RUGA 1P4LA 2W0FA 4WFHD 3RDTB 1YMME 5EBLA 3OAUL 2QV2A 4D0CB 4ELKA 2UYLB 2HFTA 1VFMA 3SQOH 3K2MC 3TN0C 3ARDB 3L3JA 3GB7B 1QRNE 2F9BT 3KPRD 4OZFH 1FH5L 3MQIA 2ICCA 4F58L 5L2KD 1JGDB 5IT2H 4JFQA 1KG0A 3REWB 1P7QB 1A7BA 3INUL 1T80A 4JDTH 5EUOB 3MR9B 2IAMD 4PR5B 4ACPA 4APQA 2BP3A 3G5VA 4ONHB 5HHOA 1G7IB 1AQKL 2E7LA 4FFZH 2GJ6A 4E41D 3DHMA 3BW9B 4M1CC 4YFDB 3RAJL 4NWUL 2DD8H 4QXGL 4X6CB 5KVMC 1CCZA 4I4WB 3S36X 2P43B 1KELH 4BK5A 3O3UN 1FZJA 2AP2A 4ZFFA 2ICWA 5DUMH 2IPKB 4RA3A 4YHIB 1FRGH 1RHFA 4JPVH 4YDVB 3IRZA 3DUSA 3AXLB 4XVTH 4H1LA 2IQAA 3NA4A 1G7LA 3S5LG 3VWKD 2NZ9D 3HA0A 4NCDA 4HBQA 4JKMA 1JWSA 3EDEA 4L3CA 3QEUB 4L8CA 4BH7B 1KENH 1MWAH 4DKEH 2Q86A 3GKWH 5EO0B 3SPVB 3T4AA 1CZ8L 2OJZL 2VR9A 4P2RD 4HIXH 4PJCF 4JRXB 1CLOL 4WDIB 3VXQA 1LE5B 5HHQB 4PJBE 3QZWG 5E2WH 1UACH 4RIRA 3K8KA 1S7WA 3BDXA 2HFFB 1BQSA 3Q6FA 1FVDA 1CICA 2CMRL 3QCTH 4JY5H 4CVZB 2DQDL 3DX8B 1G0XA 1K3IA 4MJ6A 4OTXH 5FO7A 5BQ7B 4KROC 1CU4H 2FCBA 2OQJB 3V0WL 4Y1AB 3SE3A 5HDBE 4ODXA 4PLNC 3BEWA 3TFKD 1MFCL 1OAKL 3AGVA 1J1XH 5A43C 1SEQL 3QIWD 2OL3L 2E9WA 1DEEA 2PW1A 4NHCH 2X4PB 1H3VA 5GGTA 5GRUL 2QQNH 3PP3H 3BP4B 2XFXA 1K6QH 1NFDE 3NCJH 2ILLA 1YQVH 2RAMA 1MCCA 2CR6A 3A6CH 3L3KB 1K2DA 1FV1B 4LF3B 4Y5XB 1FC2D 1K5NB 4U1NB 2G9HA 2L7JA 4D0CA 1HNFA 4ZOAA 3HG1B 3ARDA 5EZLB 4Y4HD 5K9OB 1CFVL 4J3UA 3U0WH 1FGNH 1G7QB 3GB7A 3TO4B 4QNPE 1JL8A 3RU8H 2LTQC 5GGRY 3MLXH 2AXFA 3WFDL 4FQJL 4I2XB 4ZPVB 3REWA 5EUOA 3MR9A 4PR5A 4ONHA 5E99L 1P6AB 4KTEH 5JZ7C 3KJ6L 2D4DA 5FA4A 5HHVL 3BW9A 1PBYA 4OFPA 4PB0L 3QIBA 3PWPD 5D7KE 4WU7A 2XXCB 5J9PB 5GZNC 4PJEE 1UZ8B 3HUJE 4RMQA 4U2YA 2DTMH 3S97C 4K71B 3RTQC 4G8GB 4JFEB 3ZTNL 4NQVB 4BZ2H 3ARPA 4F7MB 4JFPA 4FQLH 4LSVH 1T1YB 3P11H 3EHBD 2AAVA 1AKJD 2VSCA 4NKDB 5DF0A 3MLRH 2C3GA 1JF6A 2VDLL 4YDVA 1A4KB 1JI2A 3AXLA 1Z3GL 2GTWA 4LHUD 1JVKA 1P6FA 5GS0C 3U82B 3WYRA 5HVWA 3CSYB 3GBNL 3O6MH 3QEUA 1T66D 4S1RH 1T1XB 4N0CC 5I1HL 3G5ZA 2ZKHH 1U95B 5EO0A 2PF6A 1JWUB 4XMPL 3MRJB 4IS6B 4OLVH 5T3ZD 3NGBC 4Z77A 1T6WA 5GJTL 1A6WH 2XTJC 1A1NB 4PJ9B 5KG9B 5GS1A 2AVGA 5HHQA 4N68A 1OD9A 5ITFA 1HYRC 2H2PD 2XN9B 3L5WA 5JPNA 1TJIH 5BO1L 4Z7VA 3BP7B 2R2BB 3DX8A 4Q6IA 3C5ZC 4PRHD 3EAKA 4Y1AA 4ZAKB 3W11D 43C9A 3QHZL 5IV2B 2EH7H 3BX7C 5DQ9A 3GRWL 4YHZH 5I30L 2X4PA 2VDQH 1V7MH 2IC2A 1R5IA 3BWUC 4PB9L 5D6DA 2HFGH 4OZ4A 5JNYA 4GOSA 5TF1L 4U1GC 4RFEB 3QEGL 1ES0A 3VXTA 4ZOBA 3Q5TA 1F2XK 1F4XH 4RGOH 1YEHH 3ZHDA 1MAML 1NBYB 1DLFH 3FFCE 4K8RH 1PVHA 3MO1B 4JHWH 1VGKB 4PRPE 5C0AB 1YY8A 4WI9A 4X6DA 3JWOL 4Z76B 5EZLA 1A9EA 3OKMA 3ZKXC 3TO4A 3W0WE 1SYVB 4EBQH 1Z0NA 1F42A 1WIUA 4PRNA 5EUKA 2ZPKH 1TZHB 4I2XA 4ZPVA 5CP3A 2RJMA 4FXLA 4H20L 2XNAB 4UILH 4HUUB 1T1ZB 1WSST 1D7FA 3MACH 4XP9L 2B8OT 4YGVB 4OGXL 3B2UD 2PNDA 1AO7A 5D96B 1NUGA 5J9PA 3VFWA 1UZ8A 3EKCA 4C55A 4POYA 1CXKA 4OIIH 5F6IC 3RJDA 4G8GA 4OI9A 4YHKH 3MRMB 1MCHA 4XT1C 4F7MA 2VLJA 5GGSB 4CVUA 4GRMA 5FKAA 1T1YA 4OKVA 4NKDA 4Y5VC 1L0XA 1NMAL 1N5YL 5CKGA 2ZUTA 2MQCA 2I27N 5JW4M 5DD0L 3RDTD 5KSVA 5DRWA 5C0RL 1S5HA 4P5MB 4AIZA 3NN8B 2UVEA 5AYUH 4PJCB 3VD4A 1BJMA 1BVKB 2CDGB 1QBBA 1U95A 5EBMB 2ZUXA 1T2JA 3G9AB 5HYEA 3SDYH 2ADJB 3K7UA 3LKQA 1HILB 1JGUL 3A67L 5T1LA 4NO0B 1S7QB 4TSBL 2D03H 1E4WH 4M4PA 1WBXB 3GI9H 1MFBL 1DBAH 3U79A 4NQXB 4NKOA 5FFLA 5T1DH 3H0TA 1FO0B 3FO1A 1UH4A 4MB5A 2F54B 3HFMH 3MXWH 1CDJA 3D3VE 3O9WD 3WNOA 3RY6A 2B2XL 1CG9A 2XWTB 4ZAKA 2BRRL 5DA0B 4AMKL 5IV2A 2ZNWA 1PKQE 5J13B 3QJHB 4LCIH 5HYFA 1BGXL 5C0JA 4OGYL 1YEJH 4KWUA 2JB6B 3I75B 3LKPB 4KJQD 3V4VL 1Q9KB 2P8LB 1GGIH 4J6RH 1HOCB 2DS4A 3WN5B 4LSUL 1DN2A 5EG6C 1T4KA 4LCCA 4WEBH 1OT2A 2R8SL 1VGKA 3MRCB 2H6PB 2XG4A 3PIQB 4OM0H 1B90A 2VN7A 4XP6L 2VC2H 3V4PH 3EGSA 5CCKL 4L3AA 5K59F 4U0RB 4ODVH 2Y06L 1IC5L 4G42A 1TZHA 1EHLL 5DJXA 1LO2L 1A7PH 1UEYA 2H8PB 4FQXA 4XNUL 1GGBH 2CLZB 2MCPL 1JNLL 2OXGA 5GRJH 1J11A 4I48B 2XNAA 4RMUA 3W39B 4YHLL 1IGFL 5IB4A 4IRSA 4YGVA 2NY0C 3IFPA 4FMKA 3C8KA 5HYIA 5JXEA 2I60H 1DBJL 5KZCD 4XZUA 1U8IA 3MRMA 2O5XL 1BJ1J 1B2WL 1QPPA 4WCYL 4ONOA 3GGWB 2VZSA 4XHQA 3F7YB 1C5DA 3SCMA 4X4XA 3GSOB 4A6YB 4PLOB 2F53E 2KH2B 25C8L 2FBOJ 3MRRB 1ITCA 2B4CH 2Q6WB 1X5ZA 3V5DA 3ZLQC 3WXWL 1TMCB 3MRFB 3P2TA 2HLAB 4OZHF 4MAYC 1BVKA 2AEPH 2ATPB 3JXAA 2AGJL 4TULL 3TEUA 5MI0C 3LKNB 4R0LC 3HG1D 4JFZH 1LP9E 1QFWH 4I9WD 5IF0A 3FO0H 5TE6L 2ADJA 2EH8H