2FWOB

Mhc class i h-2kd heavy chain in complex with beta-2microglobulin and peptide derived from influenza nucleoprotein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-D alpha chain
molecule tags Immune system/viral protein
source organism Mus musculus
publication title Structural Definition of the H-2Kd Peptide-binding Motif.
pubmed doi rcsb
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fwoB00
4Z0XA 1NCDH 3CFEA 1KJMA 2CJUH 5ITFB 2Y9RT 2MCPH 4R7DB 1KFAH 2JELH 4HULB 1HHGB 5CSZA 1TTFA 3ARBB 3D0LA 1H8SA 2BNQD 2YK1L 1M7DB 4OB5L 1CWVA 1U95A 4LLVB 4PLOB 4DWHA 1CD0A 1N5YL 5A3ID 3UPRB 2AGJL 1QA9B 3BP6B 4FTVA 4NBYB 1MCLA 4O5LL 4HMDA 3SDXE 4HX1A 5C07B 1T04A 4A6YA 1F6AA 4M8QB 5C0BD 1WBXA 1G9NL 4KV5F 4HT1L 3E1F1 5CP3H 4AEIH 1NDMA 3T0VA 5MEQB 1IGCH 1AGFA 1P4BH 4JRXE 4X83A 3SDXB 3ARGD 1FIGH 3L3KA 5C07E 3QUXB 4PUBH 1SM3L 1MAMH 1L0YA 2XPGB 3RWFB 1F58H 5B39A 1JTOA 4GMTL 4N0YL 2GT9B 1BFSA 3I6LE 4NJ9H 4MJ5A 2CD0A 3OF6A 5I30H 3C5ZA 2R2BA 1BJ8A 5IB2B 5IMLB 1UB5A 4NFCA 2ESVD 1K4CA 2WM0A 4JRYB 3CSBA 5D6DC 1NKRA 1FSKC 4YO0A 3T3ME 4HWZB 5E2UL 4G7VL 3MJ9L 4Z77A 4DUVA 1OF2A 3P4NA 4QHMB 4R90L 1BFOA 1XGTB 1NGQL 5SWQB 4XCNB 1G7QA 3L7EB 4KDTC 3MRDB 1OAXL 5E2WL 4WUUB 2MTPA 2ATPA 1LVEA 3IDUA 5IVXF 1QO3B 3GSUB 3CGTA 3ULUD 2F54E 3PDDA 1BQSA 1J88A 3WSQL 1P7KB 1PYWB 4YBQC 3MRLA 2E7CA 5CD5D 1OVZA 4MJ4A 3BIBX 1J8KA 4M5YL 3PWPA 1XZ0A 4JRXA 1IGFH 4U1MB 3FOLB 4JZJC 3WL9B 4OCXL 2I26N 4ONHA 1XEDA 2VQUA 5D93C 1DLFH 3ZKXC 1G6VK 1RU9L 5GRWA 3VE0A 4ESKA 3RTQA 3MV7E 3QEQB 4PRIE 4UBDC 2G9HB 3CFCH 4Y2DB 2HWZH 1FNEA 3U6RA 4NOBA 2BVYA 3HAEH 3SDYL 5EC2B 4XVJL 4HPYL 3QNXB 4LL9A 3WIIL 2EO1A 3OX8B 5B4MC 5JHLH 5EO1A 1HEZA 5CJXC 3GO1L 3W82A 4K55A 3MPCA 5F6IC 5KVGL 3OZ9L 2AV1A 3LKNB 3GBLA 2E5EA 1F8TL 5JOFB 3P0YH 5A16A 3KDMA 1S5IL 4TVSa 2JIXA 2I60H 5IM7B 2ADIA 1GJIA 1NMBH 1RZIB 3O9WD 3C8HA 2Q6WB 1AGDB 4QRRB 5D7IF 2F5BH 4OF8A 4WHDA 3NIDE 1RQ5A 4MZ3A 3U1SL 2NY5L 4AM0B 4JZOB 4M3JA 3LIZH 1QSEA 5I0DA 4KPHL 1KN2H 3TIDB 3VW3H 2UYLA 3SKNA 2X4SB 1NCCL 3B3IB 4PRPE 4XVUD 2E9JA 5T33H 1NCWL 4ZODA 4C4KO 4YHPB 4EEEA 5GJTL 4ZTPL 3G5ZB 3HC4L 1MWAA 3KLDA 5SV3A 4HHAB 4WFED 4PGBB 4PRPB 3EO1A 4OCSL 4I18B 1CQYA 1FN4B 4YHNA 2R0KH 3UTSB 3P3YA 1IQDB 2VC2L 4HKZB 1HZHH 4D0CB 4Z7VA 1BD2B 2XI9A 4FZ8H 5FGRA 4M6AA 3DUUA 2WNGA 4UNUA 4M43H 1XGYL 4DTGL 5ID1B 2WIIB 1DANT 3ZYZA 4C4KT 1R5WA 3GSVA 3VWKA 4PGEA 1MI5A 1CGWA 4F7EB 1BX2B 5DJYB 5AD0A 2ESVE 1U3JA 4PTTB 2IG2H 1T83A 3MRMB 3SKJH 2Y5TA 3MBXH 1QBLL 4CN1A 2VITB 1EDQA 3VXTB 4POZC 1QFHA 3GSXA 4GSDL 1U95B 4K3JL 2YBRA 5INDA 1BLNB 3WIHH 4L3EE 3JZ7A 3S88H 3WNPA 5E8EA 1EA9C 2ESVB 1T04B 4NM8H 2VZ3A 4OJFL 4KK6D 1NCTA 1MCBA 4LSSL 4OLUL 1J1PL 2F74B 5CWSA 4R4ND 4APQC 1LO2L 2NXZC 5AYQA 4YHYC 1KSRA 1A9EB 4MWFB 5JW5A 3FB7B 3X3GL 2VDNH 4I3RL 5C0AB 3ZSTA 5AAWA 5EWIH 1OP3H 5F96L 4MAUL 4OD3H 3TFKD 2H26B 2YPLE 3BMWA 4F58H 4K94L 4MQTB 2EYTA 2KKQA 4ZNCD 4HLZG 3OJDA 4RGNE 4HWZA 4NN7C 2FR4A 2AK4E 3PP4H 2VABB 3QHFL 4NQUA 1MHPH 2ZUQC 1KJ3H 4ELKB 1JFQL 3EYOB 5FKPA 5K9KA 3JV4A 1YMHA 4YFLF 5HHOD 1MCDA 3GM8A 1DN2A 1U8PA 2O26U 2VLME 2CDEB 4RZCB 4DUXA 5I74C 1M1SA 3KYKL 1P7QB 2FWOA 2PO6D 2HTLD 3L5WA 4F37K 2P5EE 2XZQH 4XP4L 1EZVY 4QRUA 3NFNA 5DLMH 3V4PL 1FJ1B 3OR6B 1NLBH 3ZLQC 4JM4H 3QPXL 1U8IA 1I9EA 2HH0H 4HH9B 5I74B 2EE9A 5ITBH 2VLRD 2QKIA 3GI9L 4CKVX 4L8CB 2Q1EA 3FRPA 3HZVB 1GGUA 4JPVH 5B38B 3HCVA 4JGUA 2YD8A 3QXTA 3U1SH 3D1MC 2A6KB 3KWWA 5D2LA 4BUGA 5KAQG 4DN3H 2XZAL 3AS2A 3PWPE 4KJPD 2W9EH 3O9WA 4J6RL 2XKNA 3TT1H 4MAYA 2HP4A 2EE6A 3FN3A 5EZIL 5D96C 3QQ4A 3FHQA 3AFLA 5E1AB 4JJHA 4WU7B 2APBA 3IRPX 1X5FA 3D69B 3OKMB 2H9GA 5JW4N 1F4YL 3O6ML 5KSUB 5HHME 3VXSA 4AZ8A 5I1HH 3QAZB 4JFDA 4LQFH 7FABL 4Y7MA 2R2EA 3QUZA 1YY9D 4JZJB 4NP4H 4PJXB 4OV5A 1DQJA 3GMMA 5A16B 5DUBA 2UZIH 4O00A 4OF7A 1K2DB 5IM7A 3LKSB 2EXWC 4M6NH 5IFAL 2P46B 1PD6A 1WAAA 3QXAA 1LE5A 2XA8H 3C08L 3KPPA 4QT5B 2YD6A 3SCMB 3HE6D 2KH2B 4CNIB 1UWEL 1GGCL 1ZSDA 3D25B 3EJZD 3C2SA 1X5LA 3MV7D 2W38A 1GRWA 1EXUA 1WQVT 3WNMA 2VDQL 5FUOH 1EVUA 1NKOA 4U1JB 3HB3C 4Y1AE 1MWAB 4LSRH 3X3FL 1R0AH 3ZKXB 2SEBB 2Z4QB 4LEXH 3B9VA 2IGFL 1A0QH 2CLZA 3HFMH 3HI6L 3ESUF 4I77H 1I1AB 4YE4H 4LASL 2ZP0T 1OTUC 4OFDA 1I3VA 2Q8AL 3TO2A 3C5ZD 5IBTH 3A6CH 4PGEB 4PJXF 3TLRA 1UCBL 1VFOA 5AD0B 5HGHB 2QADD 5CZXD 5GGRB 4CGTA 2DM3A 3L5JA 3P30H 2X4QB 3QUYA 4BZYA 2ZG3A 5EOQH 1CGVA 3JWDC 1JMZA 4KK6C 4OD2A 2D4FA 1CGSL 3S96A 3PV6B 1N8ZA 4KKLC 1R5VB 2EC9T 1HQRB 2F19L 3CSPA 1GGIL 2HVKA 2GJJA 1IC1A 4Z7WA 3RWEA 4JDZB 2HT2C 1AFVL 4NGHH 1QHOA 4XXCC 4NQCA 4PB0H 5E8NB 4NNYB 5JXAH 3UJJL 5CILL 1F6FB 1E4KA 1PGRB 2NLJA 3TEUA 3V0VA 1YNKH 4X4XB 1DQMH 2NR6C 4X6FB 3WDIA 4YHZL 2EDWA 3WHXB 2BP3A 2H6PB 4OCNC 3RWGB 3ULVL 1HI6B 1H3PL 2XG4A 3G9VA 1WWBX 5CZVH 5GSVA 3RHWF 3CXHK 1U92A 3PNWA 2YWZA 3CZFB 5IGXH 5H94A 1AXSA 4UDTB 4IIQC 4NKDB 5ERWA 3O6LH 4JFZH 4G9FE 1QSFB 2YA2A 4KK8D 3FCTB 5C2UB 3W9DB 1L9MA 1FVCA 1QBML 5CLTA 5J9PB 4KROD 2K1MA 1ZLVK 1G7JA 1F2XK 2Z31B 5JA8B 3KPRE 2DLFL 2CKNA 3CVHB 7FABH 3RIFF 1OD9A 3V7AE 1N6QL 5IW1A 2C1PB 3SN6N 3DTXB 1D5MA 1MCWM 3UMTA 1RVFL 2IPTL 1U8QA 3KR3H 4HH9A 1IGTB 2Z8VC 5T1LB 5DF0A 5J6HB 2D2OA 2XRAL 5DJ0B 4JFFA 4JFFE 2JB6B 4LHUG 3PQYD 4KY1H 3ETBF 5KVFH 2E7LC 4NKIL 3P9MA 2DQEL 3OAZH 4LDLB 2DN7A 3DSFL 1S7TA 4MZ2A 2YUVA 1T5XB 4NHCH 3MRBA 4JEGB 2V2WA 3EO9L 4HBQA 1TCMA 4YHKL 1T1WB 4KTDL 3N1QC 2YEZA 4RAHA 3KJ6H 5EUOE 4M48L 3CVIL 2BCKB 2GK0A 4HS8H 3OAYK 5FUCE 4KI5D 2N7BA 4FG6C 4U6VL 8FABB 3ARGA 3QXUA 1MFBH 2R2EB 3QUZB 4JZJA 4DN4H 1MIEH 4P2QB 4OV5B 4YHYB 4KJWC 1A7BA 3MV8D 3LD8C 1NBVH 1UQSB 4OLZH 4J1UA 3IFLH 4PUBL 4NO5A 4R3SB 2PYFB 4UDUB 1ORQA 4KUZL 4YPGB 4HG4J 1J0HA 2FX7L 1LDPH 1A1NA 5GIRB 1JPST 4WNQA 4ODBD 3S36L 1MLCB 1UCBH 2FB4L 3HI1A 4S1QL 1YQ2A 5F71A 1PG7X 1QFWL 5J11C 1JK8B 3U0TB 2DMBA 5T3ZL 3UYRL 1ACYH 5JW4M 1NC4B 5DXWA 3TNMB 3HZYA 1GGIH 3EYFA 1JYNA 2DF3A 2IBGA 4Z0BL 2B2XL 2DBLH 5LKNA 3IJYB 5F70A 2AJZA 4Y2DC 2X09A 4ELME 4IDLA 3V5DA 5EO9B 4FMFA 1TFHA 5C3LD 5ADPH 5HBBA 2JCCF 2XFXB 5DJ8A 4RGMB 4ZUTB 4PRAA 1RULL 2YXFA 4ELMB 5DRNB 3BGMB 2E27H 3PGDB 2VIRB 3GJFA 1TETH 4L4TE 4LLMA 4UIMA 1TJHL 4JJ5B 3VGAC 2WWKT 1AY1L 5DRXA 1J8HB 2OP4L 4ZS7L 4BH8B 3WIIH 4AEEA 2PTVA 4KGJA 4JFZL 4H25A 3VI4F 1P7HL 3PL6B 4NQEA 3CC5A 1ROWA 3PXHA 3R1GH 4ZS6C 2DQGH 2Y6SC 1NGQH 1Q9KA 5I75B 4ZXBD 1JI2A 4K3EL 4LSPH 5JIHA 2NTSP 1CDJA 4I4WB 1IKNC 3FQRA 4KU1A 4QXGH 2GSGA 2O61B 4LARH 5L7XH 1LEKB 2I60L 4FQJL 3WS6C 1EAPB 3DXAE 3BJLA 3P4OA 1CF8H 3TO4A 2QHLA 1NANI 5F1KC 3QJFA 3L3GB 2EIZB 1XGPB 1TIUA 5KS9B 4HH8A 4KHTH 1FVEA 3WJLA 5I1AA 1P4LB 1MCWW 4F7CB 5JUEH 1UJ3A 3IXTA 4KY1L 1YEDA 1XCTB 4OZIE 1SBSH 2DB8A 5I6XB 1RIUL 3AB0C 4NKMA 1RD6A 1FRGL 3BH8A 1UCTA 1IGMH 4EN3D 4EKXA 1HSAA 5GSVB 3DROA 1X44A 2DQEH 2OK0L 4L29A 2IQAB 5IHUL 4S1SH 5I66B 3A6OA 1YJDL 3MJ7B 3BEWA 4JM2A 2PO6B 2Q8BH 3BPLB 3MRNA 4GKZA 1QSFA 3D87B 2HVJB 4P49A 4RISH 2F54D 1DDHB 3VXMA 3W9DA 4OCRH 1MJ8L 4AL8L 2B1AL 3GMLB 5I1CL 3UO1H 2GW5A 3MLWL 3HC4H 4M7JH 3QH3A 5E2VL 4FFYL 4JO4H 4X9HA 3GO1H 1A6AA 2V9RA 3OKKA 4C59B 2KZ1B 3DTXA 1MIEL 3I9GL 2A6JA 4HKJB 4PJAF 2FCBA 2PR4L 3QHZH 3G6JB 3NPZB 5I76B 4U1GC 5FF6A 1NMBL 5HHXH 4LRIC 1TCRA 3G5VB 1Q0XL 2JB6A 4RAUB 1TPXC 4L9LB 3QI9D 4NT6B 3VD7A 1J12A 1DLHA 4K9EH 1FLRL 1NPUA 2IEPA 1M7XA 4QHKJ 1QFWH 5HI3C 5MENE 2XWTA 4DKDC 2DLIA 1HIMH 3V5HA 4YGVB 4FNLH 3NN8B 5ENWB 1X5ZA 3EHBC 4U33A 5SV4A 4MNHB 4AEHH 3T0EE 4RQQA 3VFRB 1MVUB 2FYYB 3LEYL 4PG9A 3FO1A 3BI9X 3B9KA 1I7RB 3EHBD 2HJKA 2ARJA 4GBXA 3ARGB 3GUTA 5ADPL 1CDUA 4YAQA 4RGND 3N85H 3GGWA 1TJGH 3JUZA 5FDWB 4UILL 1B4JH 2B7DT 3U0PB 1T7XA 5F7WC 4YXKL 4F15C 3QHFH 1AP2B 1G6RA 5T5NF 1BM3H 3FAWA 4YPGA 5F96H 2FX9H 3P77A 4ONGH 1W72B 4RFEA 4H1LH 4IOIA 3RTQD 3RPIB 1FC2D 4LCUA 1JPFA 5IJKC 1Y18B 5CEXA 3KJ4B 2Y36H 2OCFD 1GGYA 2FSEA 1CL7I 2CLVA 2CDGA 1HINH 4MJIA 1FL5B 2R29H 5F21B 5F7NC 3L9RB 2BSRB 3OV6A 5DVKA 3LRHA 1DE4A 1ES0A 4F33B 4LSSH 2ARJQ 5C0JB 2VXUH 3KPQA 3KYAA 3GJFK 1MJ7H 2B1HL 3ULVE 2VERN 4ZXBC 1LDSA 4KJYA 2AJSL 4D0BA 1CE1H 2OJZL 2V7NB 2P7TB 3I84A 4ODHH 1VA9A 1FFNA 4M61A 3CMGA 4MAUH 4HFWA 1ADQL 2OTUA 5F7KC 3GIZL 5JZ7D 1INEL 1A5FL 4TOYL 1VFUA 3MLVH 4PJIE 2VYRE 4L3ED 3O6MH 1R3LB 1G0YR 4G3YL 5F1IA 4PJFA 4NUGH 1ZGLM 2ITDB 5D7LB 1WZ1L 4H1LA 3IJHA 3PL6A 1YEIH 4MJ6A 5JQ6H 3CDGA 4HJJL 1HHJA 3TBTB 4EXPX 3BKJL 4NCDA 3BPOC 2X6MA 2YPVL 3T2NH 2VH5H 4MJ2A 2M26A 5JLZB 2CQVA 3WNOA 5HYEA 5IFAH 2PCPB 3FT2B 3MRJA 2NZ9C 4JPWL 3I2CH 2F53D 5DHXB 5I18L 2J8UE 1BZ7B 3EW3B 4O2FA 5FYJL 4F7PB 3VDBA 3MV11 2YSSA 3F58L 4K3DL 4RRPA 4TUJB 4Y5YB 3ARDD 4EOWL 4JPIB 4F9PC 3VXUA 1JHKH 3ROOA 2BRRL 4EVNB 1L9NA 2J8UB 4UOW0 2X4NB 3UX9B 3D39E 1QA9A 2W9EL 3BP6A 4J6RH 5DJ6A 3S35X 5DHVB 3GMPA 4WI8A 2DQFB 3NABH 4CN6A 4PJIA 1T89A 3MJ7A 4JM2B 4YDLC 3MRNB 5KG9A 5BJTB 4RGMC 4XCCH 2J12B 4AEHL 4PD4J 3LN9A 2CUMA 5F7EL 5D7KE 2FDBP 2EC8A 2XTJB 4HXBH 2X10A 3VWJB 4I77L 1TZIB 1J5OH 3MUZ1 3HMXA 4GAYB 3V4VH 1UZ8B 4G7YH 2CRYA 3QIWC 4CL7A 1HILA 1YC7A 2AJYH 4K7FB 1ZHKB 2X70B 2P8PA 3HE6C 5EU5B 5IBTL 5BQ7A 5LQBL 5I6XC 2BSSB 2H1PH 3RVUC 3QDGE 3MFFB 2WP3O 1TCRB 1URLA 4YE4L 4LLUB 2MKLC 1D6VL 2G5BA 3B83A 1BFOB 1XGTA 1Y6KR 1G6RL 3GK8L 3L7EA 3DOSA 3PABB 2XQBL 3WV0A 2A0LD 2XWTB 3T09A 1CT8A 4IHOB 4MVBC 5LGHL 5DYOB 1ZANH 2VLJB 1F42A 1X4ZA 4FZEH 3OKEA 3UJJH 4RMTA 3E2HC 1I9JH 4LIQH 1PKQB 1ZT7A 5D7KD 3RJDA 3VFWB 3QR2A 2J6EL 3CDFA 1XAUA 3PWJA 3QUYC 4N90E 4XMPH 3W81A 3K7UA 3QIWD 4GKNB 2BNQB 2C3VA 4X6EB 2B1HH 4O2EB 5I1IL 1EBPA 2O93L 2VLJD 3QHTC 2C26A 3CFJB 4D9RD 2AK1L 5C2BL 3DVNB 1O7SA 1R24A 3U0PA 1ADQH 1JMXA 1CLOH 4ODVH 3KS0J 2BNQE 1FNEB 2WWMC 5HD8D 3WLBB 4Q97A 3KYNA 1QBMH 5TE4L 5EBMA 3S37L 3Q6GL 3QFJD 4W4OA 4ZSOA 2I9TA 3OKNA 3FB6B 4NCC2 5LXGL 2F58L 5CEXB 5I8KL 3RX5A 1YEEH 3RDTA 2NNAA 3QUMB 2ICWI 5IFJA 2W0LA 3OR7A 4XPBH 2O5YH 1I3GL 3HMXL 5KANI 1FL5A 2VKWA 1LHZA 3KR3L 4PTUB 1LO5A 2F19H 3BIAX 3NA4A 3PJSB 3DWTA 1E6JL 1KNOA 3EO0B 3B9EA 3MLZL 1AGDA 5EC1B 3ZKND 4OLVH 1MCEA 1C16A 3VFGL 5ESAB 5HYFA 2B8OT 5IQ9B 2B4CL 1TITA 3UTTB 3IU4L 3VFPA 5HI4D 3TZVA 2V7NA 1FFNB 4JANA 3B5GA 2X5PA 4JQVC 3DVGA 3SPVA 5DQDL 2MPAL 2R23A 4OLWH 3L7FA 3DGGA 2D0GA 1JGDA 4ZOAA 2J7LA 2A83B 3H3PH 4HDIA 1RUKH 4CVXB 3MRGB 5C0DB 2YD9A 4BKLB 2R2CA 5F1IB 1INDL 3H42L 5JHDB 4JRYE 5ACLA 3EO1B 4U3HA 3LZFL 1V7NH 5DDHB 4NHCL 1KGCD 1TZHA 1GGBL 4P2RA 5DMGD 2EDTA 2OMBA 4J8RB 5F97E 3OG4B 4P2QD 4X98B 3UTPE 1WF5A 4WHYG 3BD4A 5GRZA 3QSKB 1PQZB 4G7YL 5JHDE 4WU5B 1J9CT 4HC1A 4HS8L 1CDIA 1EJOL 4JFOB 3CZJA 4WUUE 4PR5B 4AENB 2JLLA 3BQUA 3SDDA 1KB9K 1UC6A 2QLVB 4P4RA 1JYXA 4J4PD 1SY6A 4HC1L 3VMNA 3MRMA 1KXVC 2Y5TB 4RMVA 4TSAH 3CX5J 3ZDXE 3VXTA 4Y5XC 1KT2B 4DGIH 1UVQA 3LN5B 4P4KC 1G6RH 3HR5B 5EBGA 1QFWM 3BE1H 3EZJB 1AIFB 3K8LA 1R3KA 1YN7B 1K5NB 2IH1B 3ARSA 4PJIF 1H5BB 1AO7B 3QXDA 2PTTB 2ZCHH 2AJUH 2A6IA 4PBVC 1F4WH 1S7VB 3ES6A 4PJ5E 2IH3A 3MV7B 3QEQE 1QNZH 4MMZC 3FFCB 3X11A 1BZ9B 2J4WL 3D18A 3VFTB 4XMLL 4YZFF 5AEAA 2D7MA 1MWAH 4LLWA 4PB9L 5IHBA 1RUPH 3QG6A 1W72L 4M7ZC 5F3BA 1IRAY 1QRNB 4KKNA 2JJUA 4Y4FA 3PXJA 1DBML 1EFQA 2OR7A 3V4UL 1ZHKA 2VXVH 2V5TA 1IMHC 3C09C 4KJWD 3F6LA 2BVUA 4Y16C 4OLYH 5FAAA 4ONFH 1NCNA 1R5IA 3N1FC 2APWA 2FR4B 1A9BA 3BYTA 4H88H 1KB5B 2Y1VA 2ZSVA 3CFKB 1N2RA 3S36H 2VB5A 2V2TB 3U9UB 4PJDE 4RZCA 1GPOH 3J8F7 3E8UH 4HIJB 5J3HC 4X9GA 2EC9U 3NVQA 1K3IA 5FUCC 1ZT7B 4K71B 4AIXA 4HUVA 1J05B 2VDNL 2D4DA 2HKHL 4PJ8A 1WLHA 1ZS8A 3CK0H 5CIPB 4YX2H 4KROC 5E9DA 4U1SA 2VDOL 1TNNA 3P9LB 3B2UD 3O3AB 4X99A 1TZGL 5HGAB 3WN5B 2X4RB 4YNYA 1FO0H 1UA6L 4ODWB 3NA9H 5GXBB 1C5DA 1F11B 1CGTA 4FQ1H 4PRDB 4X7EC 1RK0B 3VCLB 4M62H 5DT1L 2AKRA 4KTEH 3EAKA 3FO9B 1P5VA 4MD0A 5CSGA 5C09B 3UTZB 3RWDA 3KLSA 3UO1L 5E2VH 3G6AA 4FQ2L 4XCYA 2R1WA 4AYFA 4P9MH 3QULA 1DSFH 5SWSB 3ZDYE 1CGYA 1D6EB 3UCRA 5I1GL 1NCAH 1NMAH 4OCLC 5I1EH 1KJ2H 2ICCA 3MV9D 4M4RA 3VXNB 3KS0H 5MENB 5C70A 5LBSH 2LV4A 4Y19E 5I8OL 5EC1A 1AC0A 1RUQL 4JLRA 4HAFA 2HMIC 5I30L 2X1PA 1U58A 5E03A 2ADFL 3KGRA 1YNLL 1DCLA 4RAVB 2W9LA 3D85D 4OTXL 4Y19B 1DBKH 1DFBH 3VG0H 4Z7OE 2FL5A 2R23B 1IGML 2P47B 1NUGA 3RWIB 2AGJH 1FZKB 4EN3B 2A83A 1W0WB 3GFUA 4HEPG 1LEGA 1OAKL 4LLAA 4OGZA 3W9EB 1CE6A 3TPKA 5FO9B 3OTTA 3HHRB 2IC2A 3IETA 4KQ3H 1ODAA 4C56D 4X5XB 3UYOD 2VR9A 1ZA3B 5GS2D 3F12A 3PQYE 4L8SB 2OLDA 4NN7B 4UTBL 1IKFH 2EKSA 5GISL 4Z0XB 4F37F 1BM3L 5IHLB 1WBZA 3IRZA 3I9GH 3K1KC 3KPMB 3T0DA 2DD8L 2DJ4A 4ZS6D 4G8IB 2HKFL 1FAIH 3QWRD 3E6FA 1RU9H 5HGHA 4LCCC 3SDCB 1OW0C 3SY0B 6CGTA 5E4IA 5BVJB 4L3AA 1OARL 1BOGA 3WFZA 4BA8A 4PLNC 3IDGB 4M8QA 3SDDD 1MFEH 1FC1A 4TUOB 4ZXBA 3K74B 1T5WB 5CJOH 3T0EA 3QPQC 3NACH 5F9DC 4J7RA 3LQAC 1FGNL 1PSKL 1ZA6B 3BN3B 3QWRA 4ORGA 4JHAL 3QDME 1NGWB 1WISA 1FV1A 1NLDH 1UYWL 4P46D 5EBLB 3Q1SL 2NY4C 4XPHL 3CJJA 1S78D 1I85C 4Y4FB 4MJ5B 1WBYB 1TZGH 4DOHB 1MRFH 1NGZB 2VDKH 1NMCC 3WXWL 4TSBL 4DZ8A 3V8CA 5E5RB 4P2OC 1FYTD 5TFSH 3QDMB 1AXSB 4FQ1L 4JE4B 3A67L 2CSPA 1A1MA 1A9BB 1DN0B 3HG1D 5DJCA 3RVVC 1VKXA 3VG9C 1ZVYA 4Q6IB 5JXEC 1OF2B 3V6OC 1YMME 4GRWH 1CGXA 2NY3D 5ISZB 1G7JB 4JFHD 5CEYA 1KXTB 1T1XB 3D9AL 1HHHB 1HQ4A 3NZ8B 1KPRB 3RNKB 3ZHLA 2YD4A 5ESVB 3O2WL 1OSPH 1GZQA 4NGHL 4L9DA 4NFDA 2RQ8A 1YEIL 1HH9B 3BUYB 5CILH 2ARWA 1K6QH 1SJVA 2Q86A 5IESH 5HYSA 4NHUB 2JCCA 4C83B 5J6HA 3C5SB 2V6HA 2VKXA 3EDFA 5LVEA 3FT3B 1HDMB 4XP6L 2CR3A 4NQDB 5C6WH 1WV7T 4M43L 4R8WH 2Y7QB 4JO1L 4FFZL 5A2FA 5MEPA 2NY6B 1E4XI 1RJLA 4HZLA 1CLYL 5GGQH 1OCWL 3QEQA 1XMWA 3SKJL 5T33L 1VHPA 5K9JL 3WFEL 1G1CA 4M7ZB 3ZE0F 2AXGA 3VRJA 1K8DB 1GC1H 2E8ZA 4CU6A 3WIHL 4IMLA 5F9OH 1I1FB 3T2OA 3V0WH 1QQDB 4FFVD 4TUKL 3RWDB 2K9UA 1B88A 3MXWH 4FA8A 3EDKA 3EJZC 2GCYA 5TH2B 4ZAKA 5I1LB 3N1MC 4P2QA 4KQ4L 1HZHL 2JK5A 3AXLB 4FQQB 2VH5L 2W1NA 2A74B 2WK2A 1UQSA 3RZCA 3IF1B 3CSYB 2ADIB 5MENA 4PRPD 2VXTH 4HIXL 2A9NL 4WNQB 5T3XH 4JY4A 1U8OA 4DCQB 2QHRH 4LGRB 1MCJA 2F9BT 2LU3A 2D9QB 5BZWB 2WLYA 2H32B 5FFLA 4JO2H 1I9JL 3HZYB 5IV2A 1D9KD 1OM3L 3VMPA 4Z8FL 1JYVA 4UTAH 4DKEL 5E8DL 3UP1A 2N1KA 2IMNA 4Y5YC 4BSVB 4MNGE 4QCIA 1I8MA 1AE6L 1RURH 1UXSB 4LRNL 4U7MA 4UQ2B 5IJVB 4FZEL 1D7FA 4LSDA 1UXWA 1FE8L 4WO4C 3LCYA 3MGOA 4JDTH 5IUSA 4OI7A 4ENED 1DUYB 4F2MA 3ARUA 3LS4L 4Y4KA 1KUMA 4PREB 1TTUA 1HYSC 3KPRB 5AWNL 1FZJB 1P1ZA 3S37H 5D9SA 1OAZH 1NJ9B 3RRQA 1MI5B 1S9WB 4F7EA 4U6TA 4PD4K 3PP4L 4BZ2H 1XCQB 3D3VB 2IFFH 3L5IA 4HUUB 2Z35B 3MLUH 3R8BB 3VD4A 1F4YH 1OWRM 1MI5E 1G7PA 5JHDD 4XCFL 3SDXF 3RWCB 2E8YA 4CU7A 3IDGA 4NYLB 3WFHB 3TO4B 4XNZC 1ZOXA 4KMTH 3JWDL 4PJBE 1XGPA 5D72H 1CBVH 5B3JF 3O2DH 5BOZG 2D31B 1U8LB 2GITB 3AAZB 4G42B 3H7BA 3T65A 1R3JB 2P1YA 3QRGH 2BNUA 3DROB 4U6YB 1VDGA 4L29B 4LLQB 1NFDF 4U7KA 1M05B 4WTZG 3T1WA 4ZS7H 1INDH 3H42H 4TTDD 1N0XH 3NCEB 2BHYA 1G9ML 3JVGC 2R1YB 2MPAH 1W0VB 3EYOA 1NFIA 2Z93B 3TF7C 4F15B 3HR6A 1IARB 1MFAH 1T1XA 3MBED 4HWBH 3S5LB 5I71B 5KSBE 5IP4A 1HQ4B 3NZ8A 4ODUA 2CDEA 2R0LL 4UU9B 4U0RB 3K4ZA 5DS8A 2CJUL 3HUJF 3FMGH 2PW2A 4NP4L 3QUML 4XC1L 4HKJA 4BFIB 4FFWC 3UZEA 4OZGA 4I1NB 1EO8L 1Q8MA 2DKSA 3ECBB 4LASH 3GIVA 1AC6A 4NO2A 1FPTH 2BC4A 3OJVC 3QA3B 5FO8B 3O81A 5JMOC 3WO3B 5DK3A 1NCBL 2ENSA 2HT3D 1EMTL 3ARPA 4JFXA 3GHBL 3PV7A 3JTSA 5FHBH 5SWSD 3QRFM 3KPNB 4E5XA 2COQA 4YHOL 4DGIL 1MY5A 1OM3H 2P5WE 4MNHA 5TDPA 1FIEA 4IMLB 3RZCD 4XMLH 3HNTL 4NNPH 2F53A 1I1FA 1R0AL 3MBEC 4WCYL 1X4YA 1J1OH 4WWKA 3MLWH 3G6JF 1JV5B 4QY8B 3O41A 3PGCA 4LPUA 5F9AC 4JFHE 4GBXB 1IGJA 2ITCB 1VEMA 3O3DB 3LS5H 1U6AH 4XTRD 3SQOL 3AXLA 4NZTH 3GMMB 1IL1B 5T1MA 5J7CC 4FQXA 3MGAA 4GBXC 4PJDB 4X6CA 1XGUB 1EJOH 1U3HC 1GZPB 1B90A 1JWMB 3HUJB 4P9HL 4W81A 5AAMA 3HG1B 4N0CD 3VXOA 1S8DB 3GSNL 3S7GA 3B9KC 1GGTA 2Z91A 5ESQB 2XY1A 3IU3A 3QYCA 5MERA 5L88L 1T2QH 2YD5A 5BRZE 1IT9H 4ODSL 1OD7A 3KPOB 3TVMB 3VFUB 4JVPA 1BVLA 1NCUA 3BHBA 3SOBL 3KPQB 1ADQA 3VJ6A 3O6KH 5CZKA 3ZMRA 3ZT5A 1N6QH 4UQ2A 2QSCL 3X17A 4YHZH 2V9TA 3S9DB 5C09E 5KOMC 1Q94A 1IM9B 5DC9B 3ULVH 1RHHB 2EH8H 2PF6A 1A6UH 4V2BA 5HY9B 1Z5LB 4JB9L 1JUFB 3WUWG 1NANH 1FZJA 3N1PC 2XTJC 1QLFB 1KPUA 3TNNA 4K8RC 4OLXL 2ITDA 2V9QA 1I8LC 3K8MA 4GRLD 4H1LB 3RVXD 3MO1B 4F57H 5JHLL 3QIBD 3IAPA 5EN2B 2OI9B 4PGZA 2X9YA 3GRWH 4N9GB 3PGFH 1HQRA 2FBOJ 2G2RB 1JF1A 3JV0A 3H9SE 1G7PB 3GKWH 5DK2A 5FA4A 1A6WL 4PJGE 4PRHB 3TJEH 3NTCL 5JW3L 2BVQB 3TIEA 3PWPD 3BJ91 2J5LC 1OHQA 5E8NA 1QSEE 5FKAB 4OZGE 1BVKA 1A6ZB 1UM6L 1DSFL 4FOMA 4KKCC 3VXQB 4X6FA 1A14H 4X6CE 7CGTA 1CICB 4PJAA 1FYHB 2YC1A 3CK0L 4F8TA 3DX8A 4K07A 5JORB 1YUHB 5CJQH 2J8UA 2FJHB 2DJUA 3MRQB 3RL2A 1NCWH 3C60C 4I48B 1U92B 4LLQA 3CZFA 3U7AA 3GI8L 1SEBB 3C9NA 1KN2L 1N64H 5HVFB 1DEEB 3DLQR 1L0XA 5BJTA 5T3ZH 1TTGA 1I7ZA 4O02L 4WHTA 4O51A 1LILA 5KSAB 2EDLA 4KTEL 4MDIB 4Z7OF 2AV7A 1ZHLB 4NNPL 4UMGA 5ICZA 4MQXD 1TZIA 1CU4H 1AKJA 3HB3D 4HS6B 4QHUA 3CCHB 1RZ7L 3PWLB 3BPLC 5J13B 4KTYA 1IEBA 4NJAH 4ZAKD 4PGCB 4BFIA 4QTHB 1UKSA 2BSSA 3BH9A 1V3MA 5ACZB 2Q3ZA 4FZ8L 4HFUH 2A38A 5KSAC 3FQWB 5T1LD 4YDIL 3GEWB 4NO2B 3FN0L 3M45A 3UXFA 3GJEA 5GGTH 1U8KB 5ETUB 2YPLA 4P0DA 3FAXA 4U1KB 2E7BA 3I6LD 3GSNA 4DGYH 4OZFH 1DBAL 5GGVL 2X1QA 3O4LB 3BWAB 3SGDI 1D5XB 5F9JA 2YEZB 5TDPB 5CIPH 3B2UC 4YWGH 5KSBF 1P6FA 2XG5A 2ID5A 4UINL 3SCMC 4BK5A 1D5BA 4G6KL 4OZIA 4WJ5B 4U1GB 2GAZB 1J1PH 3PG2A 4LHQB 3DMMA 2RCSH 1JGLH 4ERSH 4LSUH 1LO0H 1FDLH 2ICWA 4ZPVA 1JF5A 4E0RB 2Y6SD 4ZQKA 3OXSB 1NGXA 1A6UL 5JUEL 1BBJA 1EHAA 3TPUB 2J1KA 1LMKA 4FQIL 2IALA 2RR3A 1UM5H 32C2A 3SDAD 5HPOA 4LHUA 2NY2D 2NY4D 1JWMA 4LVHB 1XF3B 1G1YA 5IT2L 4Z78B 3U30C 5BV7L 1GOHA 1E28B 5AZ2H 2FEDD 3MBEA 4OUUA 3U0TA 2DQJH 3RDTB 1MLBB 3RU8H 3LEVH 4DQOL 3FHAA 4PJCE 3O0RH 4LSPL 2P5EA 1JGEA 3JV5A 1FVDB 1LO5B 3QIUA 3TCLB 3LV3B 3DARA 3OKLA 4HWBA 5H8DA 5BRZA 5GGTA 3BDYH 4LF3A 4KK9D 4NKQB 4XXDB 4NQVB 2AXJA 1U9KA 5EO9A 2OZ4L 3ZE2E 2AJVL 4EIGB 3UTTA 1FG2B 4GRMA 3PHQA 1U93A 1VFBA 3I3BA 4X5WB 4P57A 4POUB 4IOFC 5IKCB 2XTJE 1LK2B 4ELMA 3ILPB 4NN5C 5HY9A 5IF0A 5CP7A 4OZ4A 4DAGH 1JUFA 3BXNB 4OT1H 5TF0A 2BVOA 5D6CA 4X7TB 4MDJA 3VXRA 2EYSA 1WT5C 1YQVH 5J89A 1IGYB 3MO1A 3QQ9C 4Y4FD 4NQSA 4WI7A 3MNWB 2X4UA 4OF6A 3DO7B 1T7YA 2IPKB 3MRIA 3BP7A 1CFTA 5DD0H 4WU5A 1JNJA 5I8EB 1EAPA 5GS0D 12E8H 1NEZG 3SHSA 5M94B 3P4OB 2LVEA 1QHPA 3F7VB 4NJAL 3B6SA 2KQMA 4RA0C 1OP3K 1CVRA 1DQTA 4IRJD 4L4VA 4W70A 1KCSL 5ANMA 2X4TB 3L3IB 1PKQE 3LKQB 4RGNC 1AD9B 1CXLA 3C8KA 4JQIH 1JZ3A 4JGMA 1F4XH 5E7BA 5ICXB 1YN7A 2IH1A 3LD8B 4XWOC 4J4PA 4P2CG 5JIIA 2H3NB 5T3XL 3INUL 1IAIH 4GG6E 4NWUH 4RWHA 5GRJH 3DV6B 1DEEA 1RMFH 3UTTD 1VEPA 5K9JH 2VLKA 4MJID 4O51B 1AXIB 3W0WB 3FFCA 5FCUL 3X11B 2C3HA 3IGAA 3SDXA 5D7LD 1RZFH 4FP8H 3L3KB 2YZ8A 3GNML 1CDHA 1QFUL 5DD5H 3PP3K 2MSPA 3DBXA 1S7UA 4PRBA 3OKKB 3FO0L 4Z7UE 5C0ND 3SE3C 2DBJA 4KDTA 4JFPA 3QCVH 1H8OA 1AQDA 3D3VE 1FCCA 3A6CL 4LLDA 1K4CB 2B0SH 2MCG1 1A4KB 1AXTH 3Q2CA 2QV2A 4I0KA 5DEFB 4CJ0A 4TRPH 5HGGS 4JHZA 3S4SA 2E9BA 1ZWIA 2FX8L 4RAUA 4OB5H 4QHMA 4UV4L 5SWQA 5CBEA 1N2RB 4DVBB 3KYOB 1SMOA 2L7UA 4PJBB 3VRLE 5AZ2L 1K4DA 3R06B 1L7IH 1ZLWH 4WDIB 3ELAT 3WE6A 3DECA 3V5HB 1S3KL 3KAAA 1EGJH 3RAJH 1BFVH 1ZK9A 3BKYH 4LMQI 2FGZA 2IANE 2FHBA 1LK3H 5FO7A 5SX4I 2CK0H 5ECJE 3LEXB 3LKRA 4RFOH 2VL5A 1W72H 3DHJA 4JRXB 5C1MB 1MEXH 4JKPL 4OGXH 2FJFA 3DIFA 4E42B 3OSKA 4YNYB 4H8WC 4NQXA 1N0XL 4ZQKB 1CFQA 1FL6B 2NYYD 4P2QE 4HKXA 1MH5B 5JXEA 1T7ZA 1FORH 4U2YA 1KIQA 5C09A 2WANA 1TXKA 2AK4A 2ED9A 4L4JA 4LCUB 4XNXH 3RX8A 5DJAA 5E95B 5GQBA 2V5MA 4NM4H 3QFDB 2F8OA 1MLBA 3LRGA 4IIQB 2YPVH 2WQ8A 1P69B 5JPMA 2ZUTA 3ZKNC 5JW4Q 3FONA 1FYTA 3LDBB 1UWXK 2H45A 5EPMA 3ARFD 5FEBA 5J4MA 1FFPA 4HK0B 5FUZH 1FBIL 2X7LB 5LGJA 5DR5L 4XC1H 2E3VA 2XNAB 1A7QL 3PHQB 2P5ED 2H1PL 4P57B 5HHOA 5ICYA 5D2NE 1P4IH 4XZUA 3BAEL 4CW1A 2XY2A 4QTIL 5BRZD 3RWIA 1QRNE 4M00A 1XR8A 4WVRA 2VLLA 2DQTH 5D6CB 3P11H 1S7WA 4L4TB 3MCLH 2EYSB 4K8RH 4MNGA 4OLEA 4PY8J 1L7TL 1U3ZA 4M9OA 5IB5A 4ZO6A 4UT7L 2VO5A 1IQDA 4N8VA 4CDGC 3NMEA 1DBBL 2FEEI 4HUXA 1DBJL 2FJGB 1IC7H 3ULSA 1NBVL 2GFBB 1KJ2L 3QO1A 3WFBH 2R0LH 1PAMA 2M1KA 4RA3A 3GSWA 1WBZB 3VXSD 3QUMH 2V5YA 4O2FB 3CXDL 1SEQL 4UV7H 3UJTH 4HBCL 3LIZL 2FB4H 3AUVA 3GSNH 4TUJA 1CIUA 4Z5RA 4APQA 1I1AD 3NCBB 1BIIA 2AS5M 1YECL 4GW4B 4IRZL 4YXHH 3RY4A 5JPNA 1DFBL 1MCKA 2OQJA 3VG0L 3FT4A 1T2QL 1FNHA 1H5BC 5JNYA 1C12B 4Z7UF 1WWCA 4ENEC 1KJVA 4R4BB 1I4FA 4GUPB 1IEAA 4XAWH 3ALXA 4NRYA 1BF8A 2YMXH 4LPWA 3NCFB 4POYA 1B0RA 5J1SC 1MUJA 1C7TA 3DSNA 4ZO8A 2HJFA 2O5YL 4JHBA 2NW2A 4NN5B 3HNTH 2NXYD 4EUPH 3SCMD 3ZDZE 4HQQH 3S37X 5F7HA 4JHWL 4QEGA 4XP5L 2H26A 3Q6FA 5D5MB 3U46A 4I0PC 1NGZA 1ZEAL 4X7FC 4YHMH 4P4KB 3REVA 2VAAB 4AT6B 2EXYD 4MHHI 2VABA 3DPBA 3MV8A 5DJCB 2BOBB 4Q6IA 3ULUE 2H8PA 4WW1B 2EH8L 1FORL 4N5EC 4P5TC 4YLQT 1PDKA 5GGUA 4ELKA 4RWYL 2ZKHH 1YPZB 2G60L 4M6ML 5EOCJ 2F58H 5H37H 1QSED 4LKCA 5ESVA 4C55A 4I0PA 1R3HB 4KAQH 4XPBL 4U1HB 3O4OC 5JO5A 2OI9C 5D1QA 4KH2A 1YPZE 1MFDL 1JGUH 4V1DE 3VFWA 4C57C 1WFUA 1IM3B 3MUJA 5FO7B 4XNQA 3CPLA 3NTCH 1U3YA 1BFTA 1PG7W 1OAYH 1GHFH 2Y7QA 4XP9L 1MRFL 4C56E 1ZXQA 1T0NA 3GI8H 4NQXB 2K7QA 2NR6D 2YUZA 5EU4B 2WBJD 1G0XA 2XN9E 1EEUA 4Z7QE 3QUZD 5HSFA 4PJFE 5IMOA 4O02H 3VGBA 1BWMA 1RZ8B 1KTLB 4Y19D 4P99A 2WUBL 3RIAK 3QWQB 4ZSOB 3VFSB 2AK4B 1BJ1J 4WEUD 3QG7L 1I7UB 4EUPA 3L1OH 25C8H 4I3GA 1H0DB 4JRXD 1T22A 3GHEH 4PJCF 4ZFZA 1KG0B 4K3HA 2AXFA 4MNQD 1K6QL 4JKLA 2J4WH 2QSTA 1OGTB 1T7WA 1DQLH 3WN5C 1Q0XH 3IFOA 3PWVA 3QXAB 4G43B 1CDGA 4HFUL 5KSVB 4N0YH 3MNZA 1F3DH 5IQ9A 5TE6H 3O8XB 1A14L 1I1YB 1VFAB 1IAMA 3OL2A 4OGAC 4KVCL 3O11A 1QLRB 4QXUL 3ZT7A 3DV4A 2R56H 3QP3A 4LMQE 1MF2H 2VQ1A 1JTPA 2BRQA 5T1DL 1E4JA 3JWOC 1V3LA 2OXHA 2D7OA 4TVPD 2F8VA 3RA7L 4XNYH 3LKPA 3VXUD 4CUCA 4BSVA 2Z31C 4QCIB 2BVPB 2SEBA 1I8MB 3I02B 1G7HA 5EIVA 4HMEA 3MACH 1JGLL 4L8SC 4ERSL 4N8PA 2B4CC 1VESA 1BJMA 2FJGA 3QDHA 4ZPTA 1XF2A 1DTUA 3F7YB 3CFBB 2X9WA 3TO2B 4XP5H 3CFEB 5A2KH 2RJMA 5KANG 1ZLVH 2VXTL 5DJ2B 1S7XB 1U91A 4YK4B 3PL6D 1UJTA 5IQ7H 5J3HD 1B0GB 4DFIA 1NC2D 1BZQK 2BNRA 2FECL 5DFVD 4H20L 3O6FA 2DL2A 3HR5A 3P9WB 4C58B 1V3JA 1R3KB 1UM5L 5DA0B 1I8LA 3L3DB 4KKBD 3T77A 1I4FB 4Z8FH 4HS3B 1RFDH 4Z7WB 1SY6L 1GPOL 3EIFA 5IVOA 3D6GA 5E00A 5D4QA 3S34H 4A6YH 3MV7A 4HD9A 4LRNH 3LEVL 4DQOH 3IFPA 4QRPD 5BZDB 2QADB 3WHXA 3ZYJA 1WAAF 1MI5D 4ODHL 4RSVA 1LNUB 5F1SA 2FZ3B 4YX2L 3CX2A 4HWEL 2GSIA 1QRNA 2Y06L 6FABH 1AD0A 3KPRD 3Q6FB 4PJ9B 5D5MA 3C5ZB 1EEZA 1OTTC 2CPCA 5L9DH 5FOBA 2OZ4H 5EDXA 5KVEL 4X6DF 4AH2B 1Q9OB 4P2RE 2R1YA 4Z77B 3D5OF 4JFEB 1KB5A 4CVUA 3N0PB 1W8OA 4LLYA 4M7KL 5I1DB 5GGVY 1VPOH 2P8LA 4JKKA 1DP0A 3S5LA 3I6GB 1QRKA 2HFFB 1F90H 4UT6H 5TF1L 3VRLF 5EBWA 3VFVB 1PW3A 3QDJB 2EDBA 4CMMA 2DQJL 25C8L 3RUGF 4BQ9A 1RI8A 3MCG1 4NO3B 4XNUH 5L8JB 1X5HA 2DQHH 3T4AB 3SO5A 5D1QB 4Z9KB 3MZGB 5LAXA 3ARRA 2VLJE 4D9RE 2DM2A 4KXZH 4LVHC 3VD9A 1UT9A 1TVBB 2QEJA 1JE6A 3QDJE 3GIVB 4KRPC 4NO0D 4V1DA 1ZS8B 3DUSB 4XNMA 1JCKA 1QSVA 4WUKL 1TVDA 2UUDK 3ARDA 4U1MA 3WL9A 3P9LA 4O58L 4JPWH 5DJZB 2AJXH 5GS0C 3TH3T 1A7RH 2Z8WC 5FYJH 4EJ1C 5K9QI 4B53A 3INUH 3AY4C 1KCSH 3RTQB 1PFCA 3SKMB 1RK0A 4J3WA 1FFOA 4R4NC 4Y2DA 4APQD 5T3XD 4XCEA 1ZGLP 4EI5B 4GSDH 1RZ8A 4R4FL 4HF5H 2CXGA 4XT1C 1BQHA 1YQVL 3CIQA 3HZKB 3OX8A 4ZD3L 1JV5A 1BAFH 1MHEA 5AYUL 4U1LA 5F88B 2R1WB 3V52H 4GAGL 5F6HI 4OLUH 5D7JC 1WC7B 3QULB 5F3HA 3EFDH 3MACL 4MA3A 1RVFH 2ORBH 5SWZA 1A3RH 2FH8A 2Z31D 1A22B 4H26A 4M7LH 3QEUA 2Q6WA 4G43A 3JBG7 2X4PB 4E41B 1A1NB 2IBZX 1DQQA 2ZOKB 3GK8H 3LMJH 1E0OB 5MI0C 1QSFD 5C0NC 1FAIL 2GUOB 5C08A 3B5HA 3BIKA 3BVNB 5FYKL 2FATL 1JK8A 1AXTL 1BWWA 2W0KA 4WIQA 1KTDA 3SKNB 3DV4B 2PO6C 5GRXG 4K7PX 1XIWC 5DJDB 5DTFA 1VACA 3D9AH 1R6VA 2MHAB 3O3EB 2BVPA 3KYKH 4LVEA 2VDLL 4PRPA 4XAKD 3T1FB 1NGYB 1RIHH 2MMXA 3ULUC 2ZUQB 4JY6A 5DJ8B 1WCBA 1EHLL 2NY6D 2HH0L 5IESL 1BD2A 3RY5A 2VR5A 1IM9A 3DUUB 1XF2B 1EERB 1TVHA 4NFBA 3PIQB 3FO0H 1YEJL 3VGGA 4JN2B 1JPSL 3QQ9D 5EZJB 1J8HA 4DZBB 4BH8A 5E2TH 1TPXB 1KB9J 3E6FB 4TYUA 3MRKB 4NUJA 2E6QA 2ADGA 3PWNA 1Q9KB 2FGWH 2QQQA 4I4WA 1AR1D 2G2RA 1LEKA 3GB7A 3PF2A 4FTVD 4FQLL 4W68A 4MX7B 1S3KH 3W11D 3WUWB 3AM8A 4K23H 1AR2A 2MQ3A 5KS9A 2HG5A 1I3GH 1P4LA 4R2GD 1CICA 1NGWA 4H1LG 5DFTA 3PHOA 4IOFD 2FO4A 4WTXA 2ZNXA 3MFGB 4HXAL 1AD0B 4O58H 5I1JH 5TDOA 3SE9L 1HSAB 3TJHD 4JB9H 3THMH 4I48A 4X7CC 2GQHA 4OLVL 1XR9B 2Q76B 1ZLUH 2R4RH 1MCPL 4POZD 3C9NB 3OJDB 2OYPA 3STZB 4GMSL 1JWSA 3O45B 4M7LT 1BGXL 4GRWB 3HA0A 3G6DH 4QNPF 5KSAA 4OGYH 4X7SH 3FOMB 3SE8H 3MRFA 1ZHLA 1UKTA 3HI5H 3R0NA 2AEPL 1AKJB 1U8PB 5KAQF 2OMNA 1KPRA 3RNKA 1P7QA 3X3FH 4NM4L 3V52L 3OKOA 1M71A 4DW2L 5IW6B 5HDBF 2GJ6B 1CG9B 3LN4B 1NC2B 4QTHA 5EOCH 1A02N 3DVIA 1C5BL 3RHWK 1JZ4A 2EDFA 2OJEB 2DAVA 4C83A 4HC1H 2HYMA 4JDTL 4XHJD 4X6BB 1X3DA 3VFMB 4X6DA 3STLA 3K2UH 2HTKC 2A0LC 4G80B 4QRRD 4BJLA 4NRZA 4R2GB 5DR5H 1U8KA 5ETUA 4HZLB 3EGSB 1U8MB 3QBTB 1P5UA 3TWCH 5ENWA 1MNUH 3MR9B 1U8NA 1JZ5A 4KK5D 3F7RA 1OPGH 2H2PD 3UJIL 3MLUL 3C5ZC 4PY7B 2B1AH 3VXSB 3QO0B 3HZKA 3S3JA 4H5SB 1DBMH 1AI1L 5JDSB 2E9IA 2QADC 5CZXC 2WWMD 1I7TA 3TBVB 5C08D 2ICWB 2DKMA 4J3TA 4RFNB 1YEFL 1P4BL 3RZCB 4D94A 3PDOA 4UZGA 2HFEB 3BPOB 3BGAA 2HRLA 1G6RB 2EDRA 3QEUB 2UY7A 3TFKC 4YDIH 3GSQA 2C1OA 4X0KB 1PY9A 1SEQH 4OKVA 5EUKA 5IVNA 4JM2C 4YDLB 9CGTA 3MA7B 5DMYA 4DCQA 2BOCA 3GMNA 4XVJH 3SCMA 1ULVA 3QIBC 4ALAH 1HIML 1INQB 1MQ8A 1UENA 3D85A 3FO2A 2VZOA 5DO2D 1Z3GL 3AS1A 5DTFB 1F3JA 4M8VA 1Q0YL 2UVFA 4U1JA 4HWBL 1FH5H 2MHAA 3O3EA 4ODTL 5D2LF 4Y16A 2JJVA 3WNLA 4WI9A 4S1DC 5D72L 1FNSH 3E8UL 2DWEA 5ADOH 3H8NA 1UXWB 4NQCD 3IDYB 1I1AA 2MWCA 3LB6C 1WEJL 3IFNH 1HOCA 4PIRF 2W0FB 2G75B 5T3ZD 4HFWB 4UIKL 3VW3L 2OTUB 3P2TA 3QRGL 1YN6A 4P5KA 4J23A 4QHNB 1OAYL 4HIHA 1M6OB 4HPYH 4DZBA 1FP5A 2VDRH 3MRKA 1J87A 4LDEB 3CDGB 5FXCH 5DA4A 4X7SL 2X4UB 2ZKHL 3DO7A 5DQ9A 3PV6A 3G04B 3SDYH 4M1CD 5K93A 4ACPA 1IAOA 1NCAL 1XH3A 3MOBH 5C7XL 3H9SA 3RWCA 3V6OA 1RUMH 4F8QA 2CIKB 3BPCB 5EU6E 4UI2A 5KVMC 5I2IB 5C0CD 4KUCF 4YQXH 4LVNB 3PWUB 3O4LE 4I0CC 3X14B 5DWUH 1T7VA 2QR0B 5HXMA 3PHOB 4WHCA 5KS9F 3PQYA 5LBSL 3TBWA 5J1AA 2HA1A 3BO8A 5GS3A 4GS7B 3EYSL 4U6YA 5I8CA 5DUPH 1MPAH 3ARFA 1OAKH 4HCRL 3RL1B 2XXMB 1NCBH 1Q9WA 2NY5H 5IEKB 4IMKC 2Y25A 3HE6A 4PJEB 4YIQA 1OQXA 4G6JH 2YN5A 1IKNA 1XGQA 1XIWB 5DC0A 1PZ5B 4WY7H 1I8KA 4U6XA 2AABL 5C0IA 2EZ0C 2YUXA 2VC2H 3PL6C 3FOMA 2VTFA 2BSTB 1IKFL 2DIAA 3IDMA 5DD0L 1OW0A 4NZUL 4XTRC 4NOFA 3IYLW 1CD1B 2EDHA 4N0CC 3RGVB 1NAKL 3C6LA 2I5YH 1AQDB 2GK2A 1S9VA 2OM5A 2H2PC 4H8WL 4J4PC 5FYJE 3WNNA 3QNYB 2OJEA 2ATKB 4IS6B 2P48B 3QEHB 5EU6A 5HVWA 3H0TA 4PP2A 1VSCA 3IDJB 4XBEH 2ILLA 4NWTL 1EK3A 4Y2DD 4NQDE 4HK3N 4KWUA 3OMZA 4D9LH 3L5XL 4WDIA 3WE6B 1GOGA 2VAJA 2YUWA 4WFGD 5D93B 2FIRT 3BKCL 5I1KL 4FXLA 4Y5VB 5I16A 5L88H 5DK0A 1LO2H 2AEQH 4ZFFA 1IM9D 2DQGL 3S3SA 2MQCA 2GY5A 4RDQG 4XP4H 5CFHA 1T6WA 4P48A 1I3RA 4JO3L 3WNKA 4NO0A 5A2LH 1NLDL 5ITBL 4DUWA 1T1YB 3TCXA 4D8PA 3SKOB 5HHNA 5JDSA 3QCVL 4JFEE 2FRGP 4PBXA 3EOTH 4PJ5D 1WEJH 3MJ6A 4TRPL 1CFQB 1UG9A 3VG9B 5E08H 1ORQB 2R4SL 5CJQL 5C0RH 3BZFB 3I3DA 3DGCR 2XTLA 2ZG1A 3UAJC 1H3VA 3MUHL 2BOCB 3GMNB 1VADB 3MRHA 5LCVH 4X4YB 3QFDA 4F9PA 4H20H 1G7MB 4IIQA 2XZQL 3TA3D 1KCKA 1NBZB 3TNMA 3RUGB 3MOBL 5C7XH 4ODXA 2EDDA 4OCMC 4LGSB 1F3JB 1NAMA 4LHJB 5MEQA 3QUXC 3EO0A 5J6GA 5FYLL 5EPMB 2RFXB 3OKDB 4D3CL 5LGKA 1Y6MR 1HWHB 2EDYA 3DURA 4JKPH 2AJXL 2DI8A 3LHPL 3RUGE 3HPJA 3HPLB 3I75B 1F45A 4GQ9H 3TZVB 4S2SB 2OL3H 2BNRE 3O2VH 2NTFB 3TA3B 1KEMH 5IMLA 1OCWH 3DX6B 4KDVA 2P8MA 3DVGB 4JRYA 3QDAA 5DRNA 5D7JD 3BGMA 3PGDA 4CMHC 1SVCP 5FGBA 3V2AR 5HVHC 2D0FA 2VLKE 4HCRH 5L6YH 5C0DA 3Q6GH 3HE7A 1VERA 3MRRB 3NFPA 4OSUH 5B21A 3MRDA 3OF6D 4BQCA 4PRNA 5BW7C 4MNQE 1HHIA 3WFEH 3CH1A 4A2LA 1NUDA 4YDKH 3GZKA 4E41E 3G04A 4XWOD 3OHXB 1GYAA 3ULSB 1IAII 5B8CA 1X5JA 4WENB 5GZNC 3BEVB 3EYUL 5CD3A 5J1TC 1UM4H 2DLHA 4LCIH 4LIQE 4G6ML 2L0DA 5DUMH 2WIMA 1A6ZA 2FH6A 3SDDB 5C0BA 1AGCA 1XZ0B 4P4RB 3SGEI 3O4LD 1PVHA 4ONHB 4G5ZL 2ORBL 5ABDE 3S4SG 5DQJA 3BAEH 4KZDL 4BFBD 4PY8I 5GGTL 3BD3A 2VDQH 1CGSH 3U6RB 5TQ0H 2XA8L 2PTTA 4XGZA 2PO6A 3QNXA 5FYKH 2FHFA 1DVFD 1I7ZB 2YA1A 1RURL 1YZZA 5DEGB 1DDHA 4UT7H 3VXMB 3N06B 1CN4A 2BY1A 3QQNA 1NGPH 5KVFL 3MLPA 4NC1C 4PJHE 1GVIA 4P2OD 5CAYB 2IJ0C 2KQNA 1MCRA 1IZKA 5ILTH 4EBQL 1CD1A 1AE6H 1UB5B 1OAUH 3U7YL 2IGFH 4MS8C 2NY1D 2V2XA 4P4KA 4ZNEE 2C4FT 4YO0B 5DC4B 1QZ1A 1WZLA 3FFDA 3HMWH 4AM0A 3DETD 4Q9QL 2EE3A 4ZOCA 2EIDA 2Q8AH 3W2DH 1RIVH 4TNVF 5BV7H 2VMFA 2AJUL 4PJCA 1MHCA 1XF5A 2WINA 3P30L 3PE9A 4KKAD 5I16B 4K23L 1V5JA 4IEFB 1HXMB 3BWAA 5JW4R 4QOKA 4K2UH 3RBSA 1IM3A 1PLGH 1QOKA 2LTQC 3BDYL 3MMEB 2DQCL 3S3PA 3CPLB 4PJHA 2R8SL 2YPLD 2V5SA 2R2HA 3FL7A 4N5ED 2JB5L 4P5TD 1QR1B 1NFDE 2HFGH 2IPUG 4ZUUB 3N9GL 4LP5A 3PHSA 4KMTL 1N59A 1YNKL 1ZT1A 4V1DD 1AGEB 3VE0B 5EU4A 1D9KB 4BH7A 3VH8A 1HSBB 5EU3B 3OXSA 3C8DA 5TGBA 1JHKL 3FB8B 5F1NA 2BRRH 4OT1L 5BXFA 4QRPB 3VFOB 3BX7C 3BZFA 2VITA 1W2KT 3NGBC 5DRWB 3KPSD 3GSXB 4V2CB 3VFSA 3L5HA 1G7LB 4PJ7E 1Y18A 3U0WL 1E28A 1BREA 1AKJD 3MRHB 1QBBA 2WBWB 3HUJE 4OUUB 1P2CB 4CVZB 4QRPE 4CVWA 1REIA 4LK4A 2VDML 1OGTA 1QFOA 1RZFL 4FP8L 1S7SB 3S5LG 3SE8L 2BSRA 1OGAE 1I85A 5BRZB 4GAJL 1GAFH 4WFHE 3KJ4C 1ES0B 5J6GB 3QI9C 4QRRE 2ERJB 2RFXA 3VD3A 2DLFH 4Z7VF 4IRSD 2YS4A 4NQVA 1KB5H 2VWEE 4EIZC 4LGPB 3K4AA 4KUZH 4XP9H 1VFAA 5IOPB 1MQKH 1V05A 5HDBE 4PS4H 2OR9H 4M61B 3GHBH 3SE3A 1LEIB 1UH2A 1KTKE 2AP2A 3R4DA 1FZKA 4EN3A 5HYIA 4LPTA 1LEGB 4LSQL 1MCPH 1F4AA 1SJHA 4JPKH 4JRWA 4QRSB 1S7RA 4GAFB 3LKPB 1ZHBA 1H3TA 1JTTA 1SJXA 1EMTH 1OTUD 2DICA 3NFPB 2OL3B 2DQDH 1FN4A 2RIKA 4Y88A 2AJ3B 1MFBL 2YWYA 2FWOB 2EH7H 3GHEL 2XIDA 4QF1A 1JRHI 4W6YB 3UROR 2ZUYA 5ACMA 5IBUB 3DHMA 1A3QA 4MYWB 4IDJL 5B8CB 1JNNH 1XFPA 1CD8A 2CDFB 5I15L 3P4MB 1R5WB 4JKMA 4RIRA 3VWKB 3G6JE 4P9HH 4XMKH 3DI2B 5IFHL 2X4TA 3L3IA 5IK3B 5HYSG 1KV3A 1AD9A 1EO5A 1G0DA 2X89D 3MUGA 3OAUH 4XVTL 1CXHA 3FQUB 2I27N 5DVMA 1ZAGA 5DQJB 1WTGT 3UYRH 4KDWA 1EUUA 5BVJA 2DDQL 3ZSSA 1MF2L 3QQ4B 3QDMD 5E1AA 4DKFH 3GMPB 1VGKB 1FH5L 4QXGL 4XGZB 5IB1A 3DV6A 4ZDHA 3UPAA 1IGIL 2F74A 3WIFA 4Q7DA 2DIBA 4BSWA 4U3XA 3RY6A 2C9AA 1PLGL 4G6AD 2EDKA 4RMWA 2GJ6D 3CUPB 1X7QB 2QQKH 5HHQA 1VCAA 1FNLA 4ODTH 2UUDH 3P4LA 1TJHH 3SOBH 3W5NA 1EEZB 4Y4KC 4KVNL 3JXAA 2NY3C 1ZTXH 3KLHD 1FL3A 4OLXH 2PXYC 2BXYA 2VDRL 1ZWIB 5IG7B 5KTEH 1VKXB 4P5MA 2Q8BL 3VWJD 5I1DA 1UB6A 2RBLA 1WAAE 1LO3H 5ISZA 5JXED 3PGFL 5KW9H 2E7LA 3CFIC 2Y72A 3U83A 2VUYA 4TNVK 3L5WB 5C0CE 3T4AA 4MD5B 4LAJH 4GRLB 4NIKB 3T0WA 4X6CF 5LAXB 1GGBH 2Q86B 4KHTL 2W9DL 4TVPL 1OT1A 4I13B 5FB8A 3MMEA 3BPNC 4KC3B 4FQJH 5B38A 1NCDL 3HCVB 3RVTC 3MJ9H 3ARDB 1FRGH 1NEZB 2Y06H 2EZ0D 3OB8A 2A6KA 5D2LB 4EN3C 1T20A 5MEPB 2APXA 4ZTOL 2OK0H 2N4IA 5ALCH 1JHLL 5L9DL 4JN1H 3G5XA 4QRQA 5CINL 1D9KA 5TGBB 1JWUA 4NQED 1YMMA 4WU7A 3AREC 5E6IA 1SBSL 2AXGB 3VRJB 2HT4C 5FYLD 2P5WA 3OKMA 5CJ5A 3QUYB 1RZJH 2GTZB 1HHKB 1I9RH 2W59A 4OZHF 4JPKL 1A7NL 4Z7VE 3BFOA 5IB4B 2Q7NA 4IMKA 3OKNB 1G7LA 4XRCA 5C6PB 2UZXB 5DJAB 1TENA 4GXUM 5L2JB 4JFDB 3VDCA 5ISZE 5I1LA 4Y4HC 4FQQA 4WY7L 5GGSA 5DMIL 3WUZA 3LH2L 1FIGL 3AREB 3GSOB 2XKUA 4Z7WE 1MJUL 4JO4L 2ZOLA 3CFCL 5D1ZD 1C8PA 4JZNA 5C0GA 4E41A 4ZUWA 4XBPA 3DXAD 2A73B 4JO1H 1TQBB 4K9EL 2Y4SA 3MJ9A 5IOPA 3HC3L 3DMMD 2PETA 3GKZA 4NZDA 2JJSC 3MODH 4J3VA 5HHXL 4WV1C 2Y36L 1BHGA 5GGVH 4FABL 3LVEA 2DI7A 3AU1A 1E4WH 3DMMC 3QEQD 4OF0A 3OXRB 4HDIB 5KVDL 1SJHB 4RFNC 2VLLB 1HINL 4QRSA 1KIPA 5C8JA 1S7WB 4L4TA 3HS0B 4D9LL 2Z4QA 1KCVL 4L4TD 1BAFL 5AYUH 3IDNB 4Y2OA 1TZHB 4JY6B 3CVHA 4P2RB 4G8GA 1X5IA 3HZMA 5IHZA 1S9YB 4OZHB 3HC0B 1I8IA 2XTJD 2LABA 3PIQA 3EOBA 2DRUA 4UUJB 5T1LA 1DR9A 1NAKH 1KACB 2R4SH 2X40A 5ITFA 2W60A 5H2BA 4R7DA 4WUUD 1CL7L 3ZKSD 3BQUB 2A9NH 5CSZB 4I2XE 3SE4A 3WO4C 4I5BA 5IVXE 2GIYA 5IR1B 4NRXA 4F7MA 2FATH 3P9MB 4G3YH 4K94C 1B4JL 4ZUVA 1HKLL 4B41A 4ONOA 3ZL4H 4HJJH 4JO2L 3UPRA 4CU8A 4WI3A 2YPKB 1KJVB 3V7AG 4KKLD 1VGKA 3RWEB 2VQTA 4ZFOA 5EUOF 5DHYA 4GFTB 3FTGA 4MX7A 1LE9B 4NQCB 2FD6L 3WUWA 2BMKB 5KN5A 1KPVB 3ULVF 3JWOL 3ABZA 1NDMB 4LBEA 5MEOB 2HJFB 1AGFB 1F8TH 4G8EA 5I18H 3TN0B 4GQ9L 1J0KA 4EDXB 4Y5XA 1II4E 3ZTNH 3BZEA 4BUHA 2E7HA 1MCOH 4Y8AA 2GITA 4G8FB 4U31A 4JFFD 1GHFL 4M1GH 4ZNEA 3BW9B 5IB2A 1CXEA 4HIEA 3EKCA 4XB8A 5GGSY 5L6YL 4EI5D 4P5TB 5TE6L 3JTTB 5CINH 2VISA 4HGKC 4K9EC 4OZFA 4YXLL 3VXRE 4XNZB 1UEMA 3O2DA 3QB7C 3FCTA 1HNGA 5KJRH 3Q3GB 5IIEA 5CBAB 4XP1H 3P4NB 5GGUB 2Q7YA 4XCCL 2VZSA 1T2XA 5GSRA 1AQKH 2Z31A 1EVTC 3WIHA 4HXBL 4XCFH 4UU9A 2V5RA 3VA2C 1WIUA 5ELIA 4EDWH 1M71B 4U1HA 1CG9A 3LN4A 4GRLA 4ELMF 1BIHA 4LVOB 4UQ3A 3FN9A 1CBVL 3EYQD 3GMOA 3QUKA 1ZLUK 1CVSC 2D7PA 5CIPA 5GISH 2R0ZL 2A6DB 3FOLA 1F4XL 3QUZC 2XQYG 3O3AA 1T20B 1ETZB 4WW2F 3GBML 5C9JA 1JZ7A 2YRLA 3C2AH 1EX0A 4MCZA 5HDQH 3EGSA 3DYPA 4JJ5A 1YY8A 1A47A 2VJXA 5DRXB 4XVSH 3JTSB 3H3BC 3ZTJG 1U8NB 1G9MH 3VI4E 5E6IB 1KTLA 2GTZA 4NN6C 4XNYL 3RI5K 3V6ZB 3LSOB 5AG8A 2J6EH 4O4YH 3QUYD 4H5SA 4HKBB 3HRPA 2Y5EA 2GY7B 1T22B 3CU1A 5GGSB 2VUOA 1MHHB 1IL1A 1KIRA 2JKXA 4FXGB 5T1MB 3ROLB 5JR1L 3QJFB 3PDOB 2AK1H 5C2BH 3D0VA 4K71C 3KXFE 4DGVL 4OZIF 4IRJB 4ZUWB 5I9QC 4JAMA 5DI8A 3F5WA 1Z9SA 3WKML 1S8DA 3BH8B 2HAZA 3QFJB 3VGEA 4N8VG 2BK8A 2IQAA 4KKCD 2BDNL 3B3IA 1FNFA 3WCYA 5I1HL 5CUSL 4M7KH 2X2YA 5FGCE 2C4XA 1KOAA 4YUEH 4OFKA 2ZUXA 1X5KA 1PZUB 1LK3L 2WBKA 4HHAA 1QUNA 2DQCH 4Y16B 3WJJC 2XPGA 4GXVH 2HFGL 4JVUA 5CHNB 4OQTH 3QQ3B 5F7LB 2C7UB 5IHZB 3D2UB 3LKOB 5D6DA 2DQUH 5I75C 5IB3A 3WS3A 4HWEH 2G75A 5A3IC 1Y0LA 2EKSB 4PRIB 4ODVL 4UUJA 2B5IB 1UWEH 2ENYA 5H2BB 3VU2A 3U4BL 1TMCB 1QLFA 1JZ6A 4NT6A 3S8WA 3HMWL 3B4NA 5TPWH 1BJ1H 4M93C 4WGWB 1D5ZB 3RWJB 3EJJX 1A6VL 1C5CH 2XYCA 1QO3A 1IT9L 3GSUA 3OG6B 1IAOB 3NN8A 1TJIH 2O61A 1JF1B 2BY2A 5F9OL 3O8XC 1QACA 4OCYH 3P40A 1WGOA 1ZT4A 5FK9B 1KPVA 1T66C 3DRTB 4HUWA 4PJEF 4L1HA 2NY2B 4LBEB 4DEPB 5MEOA 4WV1B 3ARTA 1FVEB 5I1AB 3S35L 4Q74A 1T1ZB 2YOCA 3GUTB 3TM6A 4OIIL 4KZEL 1J1XL 2OR9L 3UPCA 1LNUA 3KHOA 5AUMA 1JIBA 3IFNL 4LNVA 3MLZH 3VXSE 2YKLH 2VLRA 2D7NA 2AI0H 3WHE0 3FZUC 1AP2A 5CP3A 5I66A 2EYTB 5D5ME 3EUUA 3V6FA 4YIQB 4GKSB 5TDNB 4AH2A 3BYYA 4F57L 4HJ0C 2P45B 3Q3GA 5IIEB 1PKOA 1EHXA 3IKCA 3IKKA 1IQWL 3L3HB 4KI1A 2I9LA 1ND0B 1IC7L 1HHHA 1BD2E 3K2MC 2BSTA 3QDJA 4CMMB 1V7MH 4MNQA 2NQCA 2JIXB 4N8CH 1EAJA 3BZDA 3EFDL 4LCCB 2NXYB 3QCUL 4F33A 3RX7A 4OM1L 1MAJA 3VXPB 4B7LA 1PEZA 1F02I 4KRMB 1HE7A 2EH7L 3EOYG 4R26L 3JV6A 1QSEB 5H37G 3IAGC 3QUKB 4ZOBA 3VFNA 4V1DB 4XNMB 2LU7A 3FQXB 3LS4H 1JNNL 4F7TB 2KDGA 2X4SA 3WKMH 3DX9B 2YPLB 4MAYB 4L3EB 4YK4C 1MJJB 1ZHNA 3SKMA 2XQYK 2YMXL 1I1CA 1N64L 4LNRA 2GYSA 1FFOB 1Y6NR 4NC1E 1RUAL 3TBYA 4XCEB 4MJ6B 1J86A 2PYEB 4NO0B 3MA9H 4PGJA 4PLJC 4HMCA 4D0CA 3TYFB 1SJEB 4U1LB 5F88A 8CGTA 1IGIH 2YRPA 4HT1H 1P9MC 2I5YL 3MRJB 3OQ3B 1PG7H 2Y23A 2DMCA 5EORH 5EZOL 5DUBB 2DQUL 3ZTJH 3MJ8A 3IF1A 4ONFL 1DLFL 5FECA 3T8XB 3IDIB 1L6XA 5KTEL 3TBSA 4JHWH 4GMTH 3P77B 4M62L 5C0CB 1W72A 4URTB 3V4UH 5CZVL 5HDOA 4XMKL 4OF3A 1BQUA 4XVTH 4R0LB 2LAGB 1H3WM 4IBLT 4M1DH 4X80H 3H2WA 2P5EB 3TH4T 4YHLH 2W91A 1DVFB 1FVDA 3DUHA 1P84K 2ICEB 1LO3L 3T0AA 4LPVA 1NMAL 1ORSB 1CXFA 1KLGA 1CYGA 1FZMB 2JIXD 4J3SA 1FG2A 3MROA 1JHLH 1VFBB 4PJXE 4KZEH 3K3QA 5E6ZA 3LRSA 3WS3B 4F2MB 2XN9A 4OZ4B 3U48A 4LOUD 4QGYA 3ZKMD 2GKIA 4FXKA 2VDOH 4NKIH 1P1ZB 4ZUSA 1JGVL 4R6UA 2OTPA 4U49A 3H7LA 1L4IA 3JV4B 1ONQB 4IRSC 1CFVH 4NUJB 2A77H 4FQCL 2DYPB 5BS0A 1Q72L 4HGWA 3S98A 5DMIH 4IRSB 1R5VA 3NH7H 4IRJC 5HVHB 3J7HA 3OR6A 5B3JE 1D5IL 3CMOL 1R3IL 1T4KB 2KL6A 4Y1AB 2QKIB 1ZT4B 4D3CH 1JJUA 1BZ7A 4U6VH 3FKUS 3M1BB 1TETL 4F7PA 3QEGH 1C5BH 2GJZA 5GS1A 1AGCB 1Z0MA 3MRCB 3VMOA 3QDGD 5CEZH 2VXQH 2OTWA 4MJIE 4RDQF 1J0YA 2IG2L 4P46A 2W65A 2HN7B 2JJTA 4Z7WF 3AROA 3D69A 2W0PA 4MB3A 1NBYB 4XAKE 5T1KD 1AHWB 5KSUA 4OTXH 2DM4A 3JUYA 4WEMB 2R56L 2P49B 3Q48A 3UJIH 4WEBH 4M6OL 1NFIB 1QKZL 5J13C 3MRFB 1BEYH 3NACL 4PJXA 5IVXB 1DQJB 1UZ8A 2A9ML 2EDQA 4BFEA 1JF6A 3NGBB 4WHYH 2NY0C 1T3FB 2IAMB 4K7FA 1KNOB 4FQXC 1MCQA 5E70A 4KJQC 5EU5A 3MLYH 4LLDB 4P23B 2ZUVA 1U8QB 1CLZL 4NC0B 4GS7C 2C4FU 1FGVL 3HRZA 2AK4D 3ULVC 4JQIL 2G5BB 5DFVC 5C0AD 1UACH 3ZL4L 4DVBA 1T21A 5FO8A 1KJ3L 4OCRL 2ZUSA 1Z9MA 3HC3H 2OP4H 2BHUA 5EH1A 1EXUB 5FM8A 1CT8B 4IHOA 4PV9B 1MJJA 3UBXG 5DYOA 4X8JB 5J0BA 1LGVA 5IMKB 2JCCE 3CFDB 3IB4A 3OKEB 2PXYA 4K3EH 2PYEA 2CLZB 4YHIA 4P2OB 4K7PH 2VL5B 3WDHA 1FCGA 4AIZA 3AM8C 4GKNA 2R2HB 5F89B 2BNQA 2R1XB 6FABL 2G5RA 2C3VB 4X6EA 2FD6H 4S0SD 4B7IA 2BERA 3TN0C 3DNKA 1J0JA 1JI1A 3TBVA 2CUHA 3CVHL 3ORJA 1J18A 1NH6A 2JJSA 3MJ8B 5K9OA 1SYSA 2JF1A 4R0LC 1IBGH 2C1OB 3ESVF 4JFQB 1GZPA 3SO3C 5GIRA 1VPOL 4OKVB 5EUKB 4F58L 3HG1A 4JDVB 2VDKL 3VXOB 3ZZ1A 5EO0A 3TT3L 4FTVB 1P2CA 3V0WL 1H5BA 5HI5D 4CVZA 3QXDB 4JVWA 5MERB 5HHPA 2A6IB 4BSJA 1CZ8H 2AABH 1RJZB 2NLJB 4MD4B 4GXUN 1GCFA 1E4XL 2OXGA 1BZ9A 2UZIL 3HAEG 4UILH 4TQEH 4MB5A 4Y4FC 3QEGL 4FFZH 4YDVA 2FX9L 3MROB 5HGBA 3ZTNL 5GPRA 5BMFH 3PNWB 3U36B 5HHOB 1VENA 4P23D 2QHRL 1SYVA 4M5ZH 3C60D 5E9DD 3RQ3A 2IAND 3GJFB 4N0UE 4R96A 1GGCH 3KPTA 4PJ8D 4FXKB 3RY6C 5EUOB 5A43C 2CRZA 2V7HA 2EEAA 1CR9L 3H9HB 5JHDA 4X9BA 3RVUD 5E8DH 5EU6D 1SVZA 3SDCC 4KQ4H 1MJ7L 4IRSA 5JOPE 1K3ZA 1XH3B 1KEGH 2GFBA 3HFML 2HFTA 4KI5C 4G6KH 4TUKH 2J88L 1OQOA 2CDFA 3U9PL 2X41A 1LP9F 2KUTA 3P4MA 4LQFL 4RIRB 5FKAA 5FOJA 3M1BA 3GIZH 5E0QA 1KB5L 3VXUE 5A2JH 1HCVA 2EIZA 2GJZB 5GS1B 3VXQA 3PWUA 2HRPL 4X99B 3MUGB 3BN9C 4GW4A 2X4RA 3FQUA 1YEDB 1KT2A 2OQJB 4NNXB 3RBGA 3FT4B 2BJML 4NKMB 5J1AB 5JQ6L 2W65B 5L8LB 4CADB 1OTTD 2PN5A 4DK3A 2HN7A 4YUEL 1FHGA 1AO7E 3RL1A 3WS6A 4A6YB 4RGOH 1F6AB 2AKRB 4ZDHB 4MD0B 3UTZA 3TVMD 5DD6A 3ES6B 1MRCH 4GKZB 4PJ5B 2XT1B 2NX5A 2DYPD 3O3BB 4QWWD 5DGRA 1AJ7H 2CO6B 3O0RL 3M8OL 2IFGA 5DZOA 4LLWB 1DQML 4PV8B 3QG6B 1JN6A 5FUOL 3RWFA 5B39B 1D6EA 5I9QB 4PLKD 2VXUL 3QDGA 4PGCA 4GXVL 3LHPH 4OQTL 2X05A 3ARZA 4QLRA 4GLRH 2GI7A 5I19H 2GJ6E 4ETQB 3CXHJ 1EEQA 5IG7A 5E08L 1U36A 4XPGH 1QFPA 3MYJA 1OSZB 3QUXD 3OGCB 1YEJH 2UVEA 2WMPA 4J3XA 2V2TA 4CRPA 4WUUA 1YDPB 4LKCB 5E2TL 5FM5O 2BDNH 3DXAB 1HH6A 4Q2ZA 3T3PF 4M4PA 2NY3B 2YA0A 5ISZD 4ZFFB 5CKGA 1EFXA 5JOPD 3V5DB 4R2GC 4HUVB 4X5XA 5M95B 3UTSA 4ORZC 3RGHA 3B9KB 2M2DA 2APVA 2FLRT 5CS7A 1X5AA 3HAEB 2HJKB 4OZIB 2L4OA 4HXAH 1T1YA 3VWJC 2GAZA 5F8QC 4KRPD 5L2KB 1A3LH 4LLMB 2X1OA 5JOEA 4KVNH 5ID1A 3G5XB 4ODWA 1LO4H 5D2NC 2D7TH 5E1HB 1JWUB 1J1XH 1BBJB 3Q0HA 4D9QD 2HLAA 4Q9BA 4YH6A 4H25B 1Q38A 2C5DC 5GS0H 3CC5B 4U05A 3SE9H 4JG1L 2G60H 2YBRB 5DURD 1G9NC 5INDB 5DRZA 5BV7B 4HZAA 3NCJH 3ALWA 2ZNWA 1IAKB 2ZCKL 1G7MA 4U1IB 4HV8B 4PYGA 4YDKL 2AXHA 3IDXH 1NBZA 1A1OB 5CWSB 4Y5VC 1MFDH 3MV8E 1KEGL 1T5WA 1IILE 3VXNA 3T0EB 3VH8G 4AY0A 1A9EA 1VEOA 3GNMH 4MWFA 4OCYL 4IM8A 3PWVB 3B2VH 1IC5L 5E5UB 4YPJA 1CLOL 1XCTA 2X9XA 4P59L 4YDVB 2WUCL 1U58B 3F65A 3QCUH 4TTGA 1N3NA 1JRHH 3SKUD 1OWWA 4WRLA 4DZ8B 4KRLB 2CIIA 1LK2A 2P8MB 1Z0NA 3RIFK 2YKLL 3T0ED 3FRUB 1DZBA 3A6BH 1KIPB 4PJFB 1B0WA 5I17B 2CO7B 2DTMH 3IJHB 3X13B 5FYJU 2QSVA 1HWGB 2NY7H 3N1GC 4WWKC 5E99H 1U42A 4HKZA 1A6AB 1G7IB 2UY6A 1GZQB 3O6KL 4NZTL 1SBBA 4K3GA 1UH3A 3T04D 3VWKC 4W4NA 4YBLC 4QRUB 3HC0A 5D7IA 1FJ1A 1I8IB 5D71L 3F7YA 2PKDA 4NSKB 3MA9L 1M7IB 4Z7UA 3BEVA 5CD3B 1MCNA 5GRVL 1OTSD 3QCTH 1P7QD 2Z9TA 3HZVA 1JNLL 5M7QA 2BHZA 4KI5F 3KWWB 3IFLL 4NNXA 1E4KC 4M1DL 5EIQA 1BLNA 3W2DL 2VR4A 3WLWD 1EV2E 3C6SB 3NFSL 3ARBD 2ZSWA 4PJIB 5BW7A 15C8H 3VFRA 3TZVD 3NAAL 3TV3H 1NSNH 2QQNH 5KG9B 5HHMB 3U2SA 3KPSA 2NX5B 1I7RA 5DEGA 3O3BA 1X5XA 5FIEA 3MZTA 3FB7A 1B2WL 2NXZB 3IFPB 4WO4D 5BZDA 1ZA6A 5ADOL 3BD5A 4ORGB 5J56B 1MREL 4Z0BH 1FZOB 2WBJB 2GTWA 5D70H 3KNBB 3BT2L 4JREC 4JFDE 5AG9A 3JTTA 5EORL 2Z8RA 3QDMA 5BQ7B 3BDXA 1P53A 2FEEL 1LO4L 3HN3A 4ZFGL 4OZFB 1X4XA 3MV9A 4WFGE 4KMLB 4I9WE 1P4IL 3BUTA 2C3WA 3MOAH 5GS0L 1OSZA 1CK0L 2IWGA 1YEKH 5FKPB 5GSRB 1C08B 3NIGE 5HTSA 2H32A 3NCJL 3WEXB 3BQUD 1XF1A 1A6WH 3L9RA 3MYZA 4NKOA 5IROA 3GMQB 2BFVH 4PJCB 4Q2ZB 1CXIA 1DE4B 2DQDL 3AMLA 1ZGLA 3R1GL 3E6HB 2A1WL 1U8IB 3WDJA 4S10A 2VXVL 5EZLB 5HYSB 4WWKD 1LP9A 3PWJB 4FHBD 4LARL 1KN4H 3LEXA 1HKFA 2VXSL 5L7XL 1S9XA 3DRQB 1QPPA 1MCOL 3BWUC 1KF9B 4XBGA 1BECA 1DUYA 1F58L 1WVZA 3RVWC 5D1XD 2MCPL 3EYSH 1X6NA 3QAZC 5JMRA 4MCZB 1IVLA 3KPRA 3DVNA 4BH7B 1R24B 4N0RA 3VH8B 5DWUL 3OAUL 1YECH 4OFPA 4YXHL 2VXQL 4XPAL 5DFWH 5GGRA 1RIUH 5IW3A 1DBAH 3T3MF 1XGRB 4FN0A 5CGTA 2APFA 5DMKB 5IHUH 4MQSB 3BQUC 2XXCB 1IAKA 2NY7L 2GCYB 5TH2A 1WZMA 1DVFC 3GRWA 1YYLL 5D71H 1S7SA 3N85L 3C5JB 2BNRD 2DTSA 4LSUL 4W6WB 4PB9H 1FYTB 5FYLE 2P4AB 2X4PA 2OR8A 4JFDD 4YXKH 2R0ZH 4ZFOL 4MA1C 1RZ7H 3D39A 2H6PA 4JAMB 1U8LA 1ZVSA 1XIWD 1ZEAH 2GUOA 3H7BB 4G42A 4NCC1 3D3VD 3MCKB 5DJ6B 1FYTE 4CNIA 1JHTB 1SMAA 5H94B 1FGVH 3KPLB 5BZWA 2Q3AA 2Q87A 4DK6A 4P9ML 3ILQD 3QDJD 1H15A 3NFSH 3MRGA 1QVOB 1S7RB 3L3OB 3P0YL 4YBHA 3ZE1E 1FLRH 2AEWA 4MNGB 5I17A 4KI5E 4EI6B 3CH8A 2YZ1A 1BQLL 3WBDA 3EJYD 4LPYA 4ODUB 5CHNA 4WEBL 2AEQL 4FRWA 2BX5A 1UADC 4LOUC 1PX4A 5D7JA 2UV3A 5D7IB 2FIKB 2NY0D 3FQNA 3QO1B 3EBAA 1M7IA 4Z7UB 4QRTA 1IGTA 4PREA 1JNHA 4K7PL 2EEDA 3ECBA 43C9A 4JFFB 3MLYL 3SDAC 3HKFA 5EZJA 3RVTD 3QNZA 3C87A 5D7IE 3TT3H 3MLVL 1A7OH 3PABA 5F6HJ 4HGMA 1I3UA 2DM7A 4OD2B 3PWNB 5DT1H 4JFXB 3RWHB 5F72S 1CZ8L 1T5XA 2VL4A 1C12A 4E41D 2HLFD 3C6SA 4GUPA 1YC8A 3I6KA 2AERT 2ZSWB 1IE5A 4NRYB 1C1EL 3DX7B 4RX4A 2BFVL 2GEEA 3ZKMC 2WSKA 3WFHA 4UOW1