2FXAA

Structure of the protease production regulatory protein hpr from bacillus subtilis.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
156
Chain Sequence
b'PPYDVKEALVFTQKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRTYVQLTEEGTEVFWSLLEEFDPTRNAVFKGSQPLYHLFGKFPEVAEMMCMIRHIYGDDFMEIFETS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease production regulatory protein hpr
molecule tags Transcription
source organism Bacillus subtilis
publication title Structure of the Protease Production Regulatory Protein hpr from Bacillus subtilis.
rcsb
total genus 50
structure length 156
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fxaA00
1MD0A 2WC2A 5KK1A 1MGTA 3F8NA 3KLNA 3BP8A 2ELHA 1FZPB 3GLXA 3AAFA 2O03A 4U88A 1JHHA 2W24A 4DQ2A 3WG9A 2EFNA 4I0AA 1SFXA 2FQ3A 3V7SA 2LF7A 1BC8C 4G7HF 3ZMTA 4MTDA 2GAUA 4OINF 1L3LA 2K27A 2OAZA 1ZH5A 2FEZA 2H27A 5LRSA 3COAC 4HDUA 4GCVA 4BH9A 3K69A 3I71A 2CGPA 1ZG1A 3TDZC 1TW2A 4P9FA 5AIQA 5HDGA 2FBKA 1R1UA 2HOEA 2V79A 2ISYA 2KKOA 3HRUA 3SXYA 2OQGA 1MZBA 1MDMA 4I98B 4YIIA 1BJAA 4ZYGA 4Z2YA 4L0YB 1ZRDA 1O7FA 1W5TA 4KMUX 4QLCU 2HTJA 2QBYA 5IT3A 3K1PA 4KNYA 2VT2A 2E1CA 3WTYC 5CVJA 3FM3A 3QU6A 2EK5A 5E1ZB 5J6XA 3TQNA 3I59B 1HKTA 1FYKA 4AVPA 4EM0B 1Z05A 5LBQA 2GA2A 1L0OC 2ZNYA 2VN2A 2F5DA 4P5OA 2VBWA 1KYWA 3CUQB 2PLYA 2P5VA 4EMSA 1USTA 3M7GA 3HHHA 1U5TA 5E8GA 5ICCA 3QPHA 2XAFA 4LFUA 1K79A 4UV8A 2GXGA 4HLYA 5BS6A 5BOXA 3DP7A 2VBXA 2LNBA 2H94A 4RB0A 1P6RA 2EA2A 3EYIA 3F8BA 2GIVA 2IVMA 2P7VB 3GFIA 2MH9A 4RB2C 4UVCA 5TRDA 1XCVA 1BI0A 1HW5A 2FXAA 4G7OF 2KIUA 1AWCA 5AIPA 3CO7C 4CHUA 3REOA 2HR3A 5CJ9A 3VEPA 4M74A 1YO5C 3V7RA 3KE2A 1EH6A 4TV7A 4ASNA 2FF4A 1SMTA 2VE8A 1IW7F 1PP7U 2V9VA 1O7LA 2D2WA 3NRVA 2HYGD 3P9IA 3ROUA 1SAXA 3U1DA 3IKVA 1DUXC 4CZZA 1CGPA 1TQMA 3OV8A 3O3KA 2G9WA 3R60A 4G94A 5E1XA 2VBZA 2EFPA 3RJPA 3WGHA 1XDSA 4PGGA 3BY6A 1FSHA 2X0LA 1YS6A 4WXCA 5DEQA 4XRFA 3ZN1A 3KP3A 2Y75A 1U78A 3IC7A 3T5XA 1S8NA 4LLLA 1ZHFA 1ZLJA 5H6RA 4L5IA 4Q48A 3R6SA 1LEAA 2HEOA 4A6DA 4CGZA 1B59A 3KETA 3L2CA 3DPLC 2PI0A 1EH8A 1Z6TA 4HLXA 2IA1A 3E6DA 5HS8A 2ZMEB 5D8LB 2AS5F 3TKYA 2F5CA 5HS7A 3BOQA 4O3MA 3P9CA 1BIAA 2EA4A 1IUYA 3FXUA 3KP6A 3SZPA 1FYMA 5DCMB 3K1MA 4I02A 1BI2A 1XN7A 3V7CA 4RGXA 4G9YA 1X3UA 1FLIA 5E18F 1SMYF 1O3QA 4G7ZF 2FMYA 2Y0MA 1F4KA 3IWZA 1IAWA 3GFLA 2KRFA 2NNNA 3SZTA 4GYIA 5D8KB 2LSOA 3MQ0A 2RV8A 1RUOA 5L3FA 1LJ9A 2GWRA 4BXUA 2HYFA 1QGPA 2W84A 1FOKA 3FWEA 2O8XA 1FPQA 5DYMA 2IA0A 1RI7A 1EV7A 4A0XA 1LDDA 2M5WA 3E5UA 5E20A 4U0WA 2P7CB 3LQQA 1FYLA 3GW2A 2RDPA 4MQVA 2XVCA 4MEYF 2QBYB 3WTUC 3R4KA 2OZUA 3LFKA 2W85A 4Q47A 3E97A 4ENMA 1I1GA 1WSUA 2XGXA 3MZYA 4Q4ZF 1HW2A 4NB5A 4IRHA 1LDKB 1XGSA 3LA2A 2L02A 3E6CC 4HX7A 1OMIA 3GFMA 2YX7A 2YPRA 2A68F 3I54A 3T8TA 1J9IA 2MA3A 4A0YA 4BAYA 2DK5A 3LAPA 1KU3A 2D1HA 3D0SA 2ZXJA 1IZ1A 2BEOA 3V8LA 4U0YA 3F8MA 2DAOA 4EJUA 5CVIA 1ODDA 2VE9A 3RKWA 1R5GA 4WK8F 1BM9A 1W4MA 2B0LA 3KP5A 4KN4X 4ZYEA 4HQMA 4M6YA 1V4RA 5D5XB 2Z9OA 1S6LA 4KIFA 4FX0A 3KP2A 2DBBA 4BHPA 2DI3A 2HGCA 1F5TA 4HV5A 4AIKA 3MAJA 2KIMA 2L54A 1WWXA 4WX9A 5D6EA 3JSPA 2ACJA 3WTXC 1KU2A 1ON1A 2DT5A 2EV0A 4LK1F 4A0ZA 2ZCWA 3SQNA 2STTA 3GVAA 2FA5A 3CO6C 3DV8A 2EFWA 4EQQA 4MNUA 1SFUA 2DTRA 3RI4A 1FY7A 2HS5A 3IHUA 4FX4A 3KFWX 1IXCA 2DPDA 4Q5SF 3IRQA 4KYWA 1K78B 4IVNA 1J75A 1S7AA 1K6OA 5FLXZ 3EDPA 4CDGA 1BI3A 3GFJA 2J5PA 2M1BA 2BYVE 1IN8A 2HKOA 1SD5A 4YFXF 2FRHA 1U6GA 1IN4A 1FBUA 5BPIA 2ZNZA 4D0PA 1Z9CA 4LD5A 2O6GE 4JBAA 3BDDA 4HX8A 4Y17A 5ILVA 2MLGA 2QWWA 4OMYA 2H6BA 2A5YB 2M30A 1I1SA 2D45A 1OR7A 3L09A 2P6SA 2DFIA 1OYIA 1B9NA 2BE5F 2M8EA 2K02A 3RPUA 5DD4A 2PMUA 4YFNF 1KGSA 5HLIA 4R79A 3WTTC 4LLNA 4N9IA 3LWFA 1BN5A 3GX4X 2LKPA 4Y13A 2E7WA 2FSWA 1Q1HA 1TLHB 4U7BA 3KP7A 2P5LC 1YTYA 4EM1A 4ESFA 4HBLA 1QBJA 1MDMB 4WWCA 4M73A 2A07F 5AONA 2Z33A 4P96A 2KJCA 2MBFA 4ZH4F 3FHZA 4ZYDA 3IKTA 2F5EA 3K1NA 4BYYA 1SD6A 2IT0A 5D5UB 2VONA 3P9KA 3V8KA 3ZQ7A 2Y48A 1LQ1A 1UCRA 4ON0A 1K7AA 5FFXA 4ZYHA 1ZRFA 5CVVA 1FX7A 4ZZLA 4KDPA 5HVQC 2VC1A 2PJPA 2K86A 2K4JA 3LQRA 4HX4A 1WQ2A 2L4AA 2X4HA 5J8CA 1D5VA 4ENNA 2JPBA 2QM3A 3CUQA 2J5OA 3H92A 1ONVA 4RB1A 2IA2A 2PN6A 3EETA 1QO0D 1R58A 1WI9A 4KIBA 4AIJA 3HRTA 2ETHA 1U3EM 2W57A 2DW4A 4AD9A 2A61A 1JXSA 2DQRA 4GXOA 4EM2A 2ADUA 1HKSA 4GYGA 2VXZA 5D5VB 2JT1A 3R0AA 1SD4A 1K78A 4H0EA 1W7PD 2CWEA 3O2PE 4PCQA 1PDNC 3VODA 2MC3A 2NYXA 2ZMEA 1R1TA 1MKMA 4OU0A 4RS8A 2O61A 3K9TA 3QOPA 2CFXA 1P4AA 1XDUA 4HV6A 1REPC 3B02A 2H09A 1FNNA 1XMAA 4Y15A 3U9GA 5K5OA 1B1BA 2ZO4A 3WU0A 2YU3A 2Q8KA 4EJWA 4MTEA 5HDKA 1J2XA 4UVBA 5K5QA 1GVJA 1LNWA 1LB2A 1B4AA 1ZGJA 3TOAA 1XSXA 3F6VA 5CLSA 5A2QZ 4B8XA 2QVOA 1T0FA 4IPAA 5CVUA 1HXDA 3F72A 2JSCA 4XBFA 4L9JA 3RPQA 3Q5FA 2F5FA 1OKRA 1SD7A 1UFMA 5F6FA 3J81Z 1VTNC 1YW7A 3HOTA 3G73A 3E3VA 5D4RA 1QZZA 4HAMA 4ESBA 4HA8A 1UHWA 4KFCA 3MEXA 4DNCA 3PQJA 1G4DA 3W6KB 2XRNA 5BQTA 3BJ6A 1LVAA 1JHFA 1JE8A 4M71A 3H3UA 5HDNA 1YW9A 4R8HA 1W5SA 5JHUA 3E5QA 4A5MA 2P6TA 4LG0B 3BWGA 2EB7A 1DPRA 1HQCA 2R7DA 2EJRA 4QWQA 1FP2A 1MJAA 1Z1DA 1S7OA 4A2UA 2V1DA 2QQBA 3J80Z 5LLQA 3MWMA 5K5RA 2OQRA 5D5WB 5JR3A 5CVRA 5LRRA 3CUQC 1IN5A 1I5ZA 4GGGA 2FNPA 4GO1A 3WODF 1J5YA 1IF1A 3DXJF 5LGTA 1BI1A 5E8IA 4I7HA 4XSZF 3KEQA 2TDXA 3ELKA 2GQQA 5DD8A 1O3SA 1F1ZA 4HZFA 4RAYA 2QQ9A 1KU9A 1YQAA 1O3TA 2M87A 3ABTA 3WTZA 1R00A 3C7JA 1ON2A 3M8FA 4M9ZA 4A12A 4ESJA 3GO5A 3E5XA 1E2XA 1T38A 4IHTA 3RTRA 1W7PB 2VOPA 3NQOA 3LA7A 2BV6A 3NEUA 3HRSA 4OIOF 3I0TA 5DCMA 3QPTA 2R3SA 1R5HA 1BIBA 1ZRCA 3WTVC 5ED4A 1H0MA 4IF4A 4N0BA 5DUKA 3F23A 4A6EA 3BJAA 1LDJA 2V6CA 2G7HA 5HOOA 1Z6RA 2NAZA 2WWYA 1DDNA 3DFGA 3M9AA 2V1XA 2IJLA 3RYPA 5L3CA 4I09A 4WCGA 1DPUA 5LHGA 3K2ZA 4F7ZA 1HBXG 3O6BB 4EJVA 4BHBA 3J81K 5L3BA 2R7FA 5FLXK 2COMA 3P7NA 4LG0A 5J8FA 3KCCA 3TDUC 2PBIA 4N9HA 1XGMA 2LDUA 1G3WA 1F9NA 3HYIA 1LEBA 1YW8A 5IT9Z 3KP4A 1ULYA 2DPUA 4KMFA 2RKHA 3T8RA 1TNSA 4L9VA 2XKOA 4KA4A 2YSRA 1S29A 3FZVA 2XASA 4XLNF 3DF8A 3R61A 4WF2A 4M6XA 1O57A 4OIRF 3TOBA 3EUHA 2W25A 2OZ6A 2PQ8A 3CJNA 3LAJA 1XGOA 4KICA 1RZ4A 6PAXA 2Q0OA 1T6SA 3F21A 3ISPA 2OD5A 4U7DA 3KEOA 4HOBA 4ENKA 4RAZA 3MFKA 5L3EA 2O3FA 2RQPA 3ZPLA 4RB3C 2FNAA 5LGUA 4LB6B 4MEXF 2Z99A 3WE3A 3I59A 3HRMA 3GF2A 1MJBA 2HKXA 1R1VA 3E6MA 4M9XA 1FP1D 1TQIA 3BROA 2EFOA 5LGNA 3CDHA 3LA3A 4ETSA 1IRGA 2UWMA 4AWXB 2HQNA 1ZGAA 4I2OA 1FSEA 3V8JA 2RN7A 4P9UA 2HDCA 2HFHA 1P4XA 3WGGA 1D8KA 3CUOA 1W7PA 1OYWA 2C6YA 2IP2A 1YG2A 3ULQB 4BQAA 1J59A 4MHGA 4I01A 4E70A 1B9MA 2QLZA 4AIHA 3SFZA 2DLLA 4R1HA 3RKYA 2L01A 3ZMSA 2P8TA 2ZJ2A 2ZBKA 4MGRA 4HDVA 3PQKA 3B73A 5K1YA 1T39A 1BBYA 4IRGA 3D5LA 3DQVC 2HZTA 3EYYA 2BBYA 1IN6A 4KIGA 4IXAA 3L7WA 1USSA 3IRRA 3C3WA 3MZHA 2F2EA 2QENA 1HW1A 5JVTA 1XGNA 2MH2A 1T2KA 5ILUA 3ZMZA 2RC4A 3QP5A 1ZREA 1S3JA 4RGUA 5ICEA 3F3XA 3Q9VA 1ZAOA 3I58A 5FD5A 3BPXA 3BJOA 4M9SA 2HTSA 5JI6A 4NHJA 1U8RA 1Z91A 4WXDA 3T1BA 1RIOH 2YX4A 1G3YA 3JAMK 1J7KA 2V1UA 1KQ8A 1TNTA 1NHAA 5E1WA 1A04A 2RVCA 4L0ZB 4IJAA 2KIFA 1SFEA 1FT9A 1XSVA 3VFZA 5LEKA 2Z5UA 1U5TC 1XMKA 4I0BA 4BHCA 5HLHA 1BOAA 3DEUA 1P2FA 5A2QK 4EGYA 1IXSB 2CW0F 3N97A 2H6CA 2RNJA 1OYYA 5FB2A 2CSOA 5BPDA 1CF7A 4HQEA 4P55A 3WE2A 2G7UA 1OPCA 2NNYA 2P5KA 3KZYA 3HIFA 1ZYRF 2A3SA 4PDKA 1P92A 3HTSB 1RUNA 4O5VA 1U2WA 5FO5A 2JRTA 2FOKA 3VOEA 1IXRC 3U2RA 4LMYA 2VODA 3FXRA 1GXQA 2IW5A 3QAHA 1IN7A 2DK8A 4UHTA 3HHGA 4NQWA 3I5UA 3F8FA 3GYHX 1WRJA 1V3FA 3IWFA 2CO5A 2XAQA 4PZJA 2CG4A 3JW4A 1KYZA 4EJOA 3ZN0A 2FBHA 2XAJA 2CYYA 2XUBA 1QNTA 1KU7A 3ECOA 4S04A 1I6XA 2Z3YA 5HS9A 5H6QA 2JZYA 5D4SA 4FT8A 2FE3A 3PFIA 3GUDA 3R0JA 2FBIA 5IT9K 3TGNA 4CYDA 3WTWC 5L3GA 3QRFF 3QU3A 5ILSA 3H3ZA 4FHTA 3RDIA 4CICA 4ZZDA 1FBSA 3ZMVA 1XB4A 1D8JA 3F6OA 1ZG5A 2WV0A 1GXPA 5ERIA 2ISZA 5H20A 3FMQA 1BC7C 1HSJA 2OU2A 3BZ6A 1H9TA 1R22A 3ECHA 2CQKA 1I27A 2VC0A 2VT3A 4YFKF 5FGMA 3L9FA 3F8CA 1QQIA 5DV5A 4JK1X 2FMLA 3ZP5A 3GXOA 2AXLA 5FFZA 4YIFA 2OBPA 5DUIA 1RNLA 5DDGA 2UZKA 1TBXA 4ENJA 4L18B 3ABUA 1C0WA 2PFBA 1TW3A 2A6HF 3KZZA 1G3SA 1YIOA 4K2EA 3GWZA 2VBYA 5ICGA 1G3TA 2XROA 3FX3A 2DU9A 2L3DA 2E1NA 1FWZA 2ESHA 4LJZF 1UB9A 4O6JA 3WGIA 4EVIA 3I53A 4RGSA 2IPQX 2D1VA 1EH7A 4HYEA 5JFRA 1R7JA 2NRAC 3VB2A 4S05A 3HTUA 3FF5A 1ZN2A 4A5NA 2O0YA 2UXNA 3FMRA 5TJJA 2PEXA 3ERED 2ESNA 5HLGA 1DP7P 3C18A 4OOIA 5FD6A 2QZ8A 4YG2F 3OOPA 3C1DA 2EV5A 5L3DA 2DQLA 1MJ9A 4G6DA 1ZLKA 3JSOA 4XSXF 3GEZA 2BGCA 4KUMA 2LF8A 3K0LA 3LSTA 5KVRA 3S2WA 3J7AO 4JQFA 3FMSA 3E6BA 3BPVA 3GZ6A 3GZ5A 3TO6A 1U5TB 1UHMA 4L9NA 4OIQF 2A69F 3HOSA 2DO7A 3WU1B 2UXXA 3FM5A 2HQRA 4OIPF 3T0YA 2EV6A 2XAGA 1FC3A 5E17F 1ZG3A 3MCZA 5CYVA 2FU4A 3JTHA 3RIRA 2RGVA 2EWNA 3J80K 4HF2A 2ZKZA 3CLOA 2YR2A 1YFHA 2EFQA 2OA4A 1HSTA 1PUEE 1AOYA 1Z7UA 3DPTA 4IRIA 1PP8F 3I4PA 1KQ0A 1XSDA 3KLOA 4UUVA 4HW0A 3ML6A 1STZA 4UV9A 2JTVA 2K7LA 3F22A 3N4MA 3JAMZ 3TO9A 3G3ZA 4UVAA 3RKXA 3Q9SA 1KA8A 3RYRA 4BNCA 1JGSA 2HWVA 3M1EA 1KQ9A 2E7XA 2MLKA 2A6EF 1H9GA 5D6FA 2KJBA 1XCBA 2NS0A 3M8EA 3IL2A 1G6NA 5LHHA 2QUFA 4LB5A 2IRFG 2MD5A 1TTYA 4HF0A 4HF1A 3FXQA 1YLFA 3WTSC 3HSEA 2XAHA 4LK0F 5DCFA 4KN7X 2PG4A 5LHIA 1ZARA 5EEHA 3V4GA 4EV0A 4IHSA 1QZYA 3TO7A 4WXHA 3EQLF 1WKMA 2ZFWA 2PMHA 4LLGF 5F1RA 1YS7A 4PGHA 5ICFA 4LGWA 5LEJA 3ZMUA 3ZMDA 1XD7A 4XLPF 4UXNA 2WTEA 3CTAA 4MQ9F 4B09A 4CO8A 4EGZA 2XKPA 1HKQA 3L00A 2QYOA 4RGRA 3HUGA 1J0RA 1CF7B 4L9TA 3QP6A 1R23A 3SHFA 2Q2EA 4U0VA 2XHKA 4OMZA 2M45A 4UNOA 1QPMA 4G8XA 1D3YA 3HSRA 3HSFA 4CXFA 1O3RA 5F64A 4G6QA 2K4BA 2XIGA 3I64A 2L4MA 4M72A 2STWA 1Y0UA 1YYVA 2P4WA 2XV4S 2GA1A 3DKWA 1TQPA 2GZWA 2QQAA 2VOOA 4KT5C 1FBQA 2JPCA 3W6JB 1P4WA 1IRFA 4L5JA 5BMZA 1B6AA 4EJTA 1R36A 5EEGA 1T98A 3JTGA 2GXBA 1GHCA 1E17A
chains in the Genus database with same CATH superfamily
4E7HA 1OCCH 2HPIA 1HCRA 1IGNA 1MD0A 1WGXA 2WC2A 5KK1A 1MGTA 3F8NA 3KLNA 4JOMA 3BP8A 2ELHA 4MLOA 1FZPB 4MFDA 1Y0NA 3GLXA 2OJED 3AAFA 2O03A 3ZQHA 4U88A 1YRNB 1JHHA 3OS0A 2BY1A 2V1NA 2W24A 3HGYA 4DQ2A 3WG9A 5FLMJ 1RR8C 1PJRA 3SEQA 2EFNA 4I0AA 1SFXA 2FQ3A 2MD0A 3H36A 3V7SA 2LF7A 5DM7F 1BC8C 4G7HF 4II2A 3ZMTA 2NVYJ 4MTDA 1XPXA 1F43A 2GAUA 2X1EA 4OINF 1L3LA 5C3EJ 4KT6A 4MFEA 3UKGA 2LG4A 2K27A 4B3XA 2OAZA 2VQCA 1HDPA 1ZH5A 2FEZA 2H27A 5LRSA 1WJBA 3COAC 4HDUA 4GCVA 4BH9A 2R4GA 4ZTJA 1MBHA 4M3DA 3K69A 5EYRA 3I71A 2CGPA 1RC9A 1NH3A 1ZG1A 5EEAA 3PFYA 3TDZC 3GTKJ 2CV2A 1TW2A 4P9FA 4Y7NJ 1X3ZB 1TT0A 5AIQA 1X1DA 2AQEA 2DFHA 1I3QJ 2FBKA 5HDGA 4CCNA 4IX7A 1R1UA 2MFZA 3HJEA 2RAEA 3OYJA 2VLAA 2HOEA 2EBIA 3RQ4A 2CMPA 2V79A 2ISYA 2KKOA 3HRUA 3SXYA 2OQGA 4AYBA 1YIJI 4E7JA 2NS7A 2AO9A 1MZBA 2LTPA 2JA8J 5J1UA 1MDMA 1U9OA 2ZFUA 4I98B 4YIIA 1JTXA 1BJAA 4XKVA 2Y9YA 2M0CA 2JWTA 5IYBJ 4ZYGA 3ZQGA 3A0HC 4Z2YA 3KEYA 3H0DA 4D5CA 2LKXA 4L0YB 2E60A 4CYCB 4JX6A 1WH7A 1O7FA 1W5TA 1ZRDA 5F08A 4A3GJ 4KMUX 4QLCU 2HTJA 3GTOJ 2QBYA 4NC6A 1WJDA 5IT3A 4XKCA 3K1PA 4CA0A 2VT2A 4KNYA 2E1CA 2JRMA 4AM3A 3WTYC 5CVJA 2K9NA 5B66C 3HOYJ 2WADA 5CQEA 2CUZA 3TMOA 1A6IA 5GTIC 3FM3A 3QU6A 4M6VA 2VKHA 4EEFG 2EK5A 5E1ZB 5J6XA 3TQNA 1X4OA 3I59B 1HKTA 2QA4I 1WVRA 1YITI 2EQRA 2M8GX 1FYKA 4AVPA 4EM0B 2QKMB 4CCMA 3W2AA 1Z05A 1R4NB 5LBQA 2GA2A 5B1AH 1L0OC 2ZNYA 3AFHA 2VN2A 2F5DA 4P5OA 4P1WA 3OYNA 3SJMA 2VBWA 1KYWA 3CUQB 3S3MA 2PLYA 3S16J 5M5YJ 5EDNA 1A35A 3FISA 1W36D 3K70D 2F4OB 2P5VA 3OWTA 5IY5H 3TP3A 3OYAA 4EMSA 1USTA 4NDLA 2MYSA 5F0HA 4UUSA 3OS1A 3U21A 1S9HA 3CC7I 2Z16A 3M7GA 3HHHA 5IYDJ 1U5TA 2CRGA 5E8GA 3CC2I 2QCOA 3CCLI 5ICCA 4FASD 3QPHA 2XAFA 4LFUA 1K79A 1ZGWA 4UV8A 4NQWB 3HL2A 2GXGA 1CQTA 4HLYA 5BS6A 2DMQA 5BOXA 3CZ6A 3I9V2 3DP7A 4A3KJ 2VBXA 3CCJI 2LNBA 2OPTA 3Q0VA 1IO2A 2H94A 3ZXSA 4RB0A 1P6RA 3PNYA 2EA2A 3FKIJ 3EYIA 3F8BA 1LFBA 1I6HJ 2GIVA 2IVMA 3C2GA 3JRDA 2P7VB 3HPGA 1MMSA 2DOAA 1P7JA 1EA3A 3GFIA 4LIVA 2MH9A 1POGA 3WHBA 1Y56A 4XRMA 4RB2C 4UVCA 4V19K 5TRDA 1XCVA 1BI0A 1HW5A 2FXAA 2VJJA 1PUFB 4G7OF 3L2QA 4CCOA 2KIUA 3CP2A 4Y52J 1SEUA 4I76A 2V26A 4PSWA 4IZZA 3ASNH 5AIPA 3CO7C 1AWCA 3HKZA 3REOA 1OCRH 2HR3A 2DOFA 3CMAI 5CJ9A 3VEPA 1PUFA 4M74A 3OIQA 2JA7J 1YO5C 3V7RA 3KE2A 1VQ5I 1EH6A 4TV7A 3S2DJ 2L9SA 4ASNA 2FF4A 1SMTA 2VE8A 1IW7F 3J7YJ 4A3MJ 1DU6A 3LSRA 4NC7A 4XLAA 1PP7U 2V9VA 1E3OC 3HDDA 2FUG2 3GCMA 1O7LA 4FETA 1R5ID 3GLLA 2LLKA 2D2WA 3NRVA 2XF6A 2HYGD 3P9IA 3ROUA 3HGGA 4ANJA 1SAXA 4BXXJ 3U1DA 2WBMA 3BTCA 3IKVA 1DUXC 2XRLA 4QSHA 1X1CA 4CZZA 1CGPA 1TQMA 4RLQA 4S0HB 3VYUB 4Z6YA 3OV8A 2EILH 3O3KA 2E2HJ 4IKFA 2G9WA 1V5GA 4A3IJ 4M3EA 3R60A 4G94A 5E1XA 2K9SA 2VBZA 1IJWC 2IS4A 2EFPA 3RJPA 3WGHA 3E1SA 3QWLA 1XDSA 4PGGA 3BR1A 3BY6A 3K7AJ 1FSHA 2X0LA 1YS6A 4WXCA 5DEQA 4XRFA 5HNHA 4DOZA 3ZN1A 3RZOJ 2R7WA 3KP3A 3L2RA 3MKYB 2Y75A 1U78A 1MH3A 2NOJB 3IC7A 1DGWY 1NG6A 3T5XA 1S8NA 5H6RA 1ZHFA 1ZLJA 3BCAA 4LLLA 4L5IA 1NK3P 4Q48A 1IUFA 1LEAA 3R6SA 1D5YA 2HEOA 4A6DA 2X1DA 2GIZA 4CGZA 1B59A 2L5QA 3KETA 2BHZA 3L2CA 3DPLC 2MC4A 2PI0A 1EH8A 1Z6TA 3AL0C 4HLXA 2IA1A 2EINH 1BR4A 3E6DA 5FROA 3JRBA 3BR3A 5HS8A 2QKLB 2ZMEB 2DYRH 5D8LB 2AS5F 3TKYA 1RETA 2F5CA 5HS7A 1AA7A 3BOQA 4O3MA 3P9CA 1BIAA 2EA4A 2NVTJ 1IUYA 2E71A 3FXUA 3KP6A 3SZPA 1FYMA 5DCMB 2IS6A 3K1MA 3RPUD 4I6ZA 3ZQQA 1YX3A 3F0CA 4XN0A 1N77A 2E1OA 4XMYA 2M9HA 4I02A 3PIOF 1BI2A 1XN7A 3V7CA 5IP7J 1S72I 4RGXA 4G9YA 1DGRM 3CD6I 2HXIA 4XOPA 1SFKA 1X3UA 1VQNI 2ID3A 5F27A 3HOVJ 1WFXA 1FLIA 4BBRJ 5HODA 5E18F 2CH0A 1SMYF 3SDGA 1O3QA 4G7ZF 2FMYA 2Y0MA 2R5YA 4UUSB 1F4KA 3IWZA 3O8GA 1IAWA 1ZK8A 4IHVA 3GFLA 2KRFA 4A3DJ 2NNNA 3SZTA 4X6AJ 4GYIA 5D8KB 2R7RA 2KLOA 2KQRA 2GOXB 2LSOA 3MQ0A 2RV8A 1RUOA 2Y30A 5L3FA 1LJ9A 2GWRA 1VI0A 5F0CA 4BXUA 2HYFA 1QGPA 3BZKA 2W84A 3KX2A 1FOKA 3FWEA 2UUZA 4BL0B 1MMGA 1K4TA 2O8XA 1FPQA 4A3LJ 5DYMA 2IA0A 1RI7A 1EV7A 4A0XA 3GTQJ 1LDDA 2M5WA 2ZJRF 3E5UA 3DTKA 5E20A 3BG6A 4U0WA 3NWTA 3ABKH 2P7CB 3LQQA 1FYLA 1ACIA 4BUPA 2ZB9A 3GW2A 3K4CA 2RDPA 3AKZA 2WAQN 4MQVA 2XVCA 3BG5A 4MEYF 2QBYB 3WTUC 4B43A 3RKQA 3R4KA 1D1CA 2OZUA 3LFKA 1VQ6I 2W85A 4Q47A 3E97A 1YRNA 4ENMA 1S5LC 4V2FA 1I3AA 1N75A 2BXYA 1A31A 1Y8QB 1X19A 2XAUA 2Q2EB 1I1GA 1YOVB 1WSUA 2XGXA 1JKQC 4L5EA 2E34A 1NTCA 1IV8A 3U1KA 5J3LA 3K70C 2E5ZA 4BQQA 3MZYA 1OCZH 4Q4ZF 1HW2A 4NB5A 3CQZJ 3DBLB 4IRHA 1LDKB 2Y2ZA 2R7SA 1XGSA 3DLAA 1UHSA 3LA2A 1S7EA 2HQ5A 4E7IA 2L02A 2MSYA 3H1CA 3E6CC 1JJ6C 2FOWA 4HX7A 4LIUA 1OMIA 3GFMA 2EZLA 2YX7A 2QSFX 2YPRA 1SVOA 5C4JJ 3ZQLA 2A68F 2K3PA 3I54A 3T8TA 1J9IA 3AL0B 2MA3A 4A0YA 4BAYA 3HOWJ 3I4MJ 2DK5A 2X1CA 1EJ9A 3LAPA 3OOUA 4C3HJ 3H3VK 1TWCJ 1KU3A 2D1HA 2NXNB 2HPMA 3D0SA 3AG2H 3CCYA 2ZXJA 1IZ1A 2BEOA 3CLQA 4IOCF 2LVSA 2TCTA 3V8LA 2LP0A 5FKOA 4U0YA 3F8MA 3OYLA 2DAOA 4EJUA 5CVIA 1ODDA 1SAUA 2Z1DA 3CESA 3LSPA 2BZTA 2VE9A 3RKWA 1R5GA 4WK8F 1BM9A 2VI6A 4A93J 1W4MA 4XORA 2B0LA 1JTYA 2LH9A 3S15J 3ASOH 3M4OJ 1VQPI 4XONA 3KP5A 2L7MP 3KYDB 2EIMH 4KN4X 4ZYEA 2R93J 1W36C 4HQMA 2G0EA 3CJTB 1IC8A 4M6YA 1V4RA 5D5XB 3VWBA 2Z9OA 4GDFA 1S6LA 4KIFA 3EUKL 2K9LA 4FX0A 4HSTA 2F48A 3KP2A 1QA6A 2DBBA 4BHPA 2DI3A 4XLCA 2HGCA 5KAFC 1F5TA 4HV5A 1Q1VA 4AIKA 3MAJA 3PSIA 2KIMA 2L54A 1WWXA 1KZHA 4WX9A 5D6EA 3JSPA 2ACJA 2I10A 3WTXC 4IHWA 1OJLA 2H1LA 1KU2A 1ON1A 1TP4A 3S8PA 2DT5A 3D5RC 2EV0A 4LK1F 4A0ZA 2ZCWA 3SQNA 2STTA 4OAYA 3GVAA 2FA5A 3CO6C 3DV8A 2EFWA 3A02A 4EQQA 4CSWA 4MNUA 1SFUA 5GPCA 2DTRA 2CV1A 3CCMI 3RI4A 1N78A 5F04A 3L2UA 1FY7A 2W4SA 2ECBA 2HS5A 3IHUA 4FX4A 3PNTA 5GAGJ 2JUCA 3KFWX 3KPHA 1IXCA 2DPDA 3GTGJ 4Q5SF 3TP0A 1ETOA 3IRQA 3G2BA 2NVQJ 2L9VA 4KYWA 3QPLA 1K78B 4IVNA 1J75A 1S7AA 5HLTA 1JI8A 3O8HA 4ZDPA 1E3HA 1K6OA 5FLXZ 3LL7A 3EDPA 4CDGA 3OMYA 1BI3A 3QOEA 3GFJA 2J5PA 2M1BA 2BYVE 3GBGA 3GTLJ 1HF0A 3TW7A 5EZHA 3G71I 4RMNA 3BC8A 2OTLI 1D1AA 1IN8A 4C9YA 3ERMA 2HKOA 1SD5A 2BOLA 4YFXF 2FRHA 1U6GA 1IN4A 3BG9A 1FBUA 3GTJJ 2ZNZA 4D0PA 3VYTB 5BPIA 1Z9CA 3CC4I 4LD5A 2O6GE 1HA8A 1UAAA 2XF5A 2E19A 2M4GA 3OYKA 4JBAA 3BDDA 3BCBA 3H0GJ 2Y69H 4HX8A 4EATA 4Y17A 2ECCA 5ILVA 2MLGA 2QWWA 4OMYA 1LFUP 2H6BA 1Y1VJ 2A5YB 4D1QA 2M30A 1V5EA 1ZR4A 1I1SA 2D45A 1OR7A 3L09A 2P6SA 1ZKGA 2DFIA 3FXLA 1OYIA 2VKEA 1BR2A 3OR1C 2Y31A 1B9NA 2X6WA 2BE5F 3HM5A 2EH3A 2M8EA 2K02A 2EPFA 3K4BA 4JX4A 3JRAA 3RPUA 1YE9A 4F92B 5DD4A 1ORKA 2PMUA 4UB6C 2O7OA 4YFNF 3ABLH 1KGSA 1VQKI 2F4MB 3S1QJ 5HLIA 4R79A 2KDZA 3WTTC 4LLNA 4N9IA 1KONA 1E0EA 3LWFA 1VQ4I 1BN5A 4DBQA 3GX4X 3ZR8X 3BR2A 2LKPA 2HDDA 2XGDA 1YX5A 2LC2A 4IO9F 1A36A 3DWLE 4Y13A 2E7WA 2FSWA 3DTEA 1Q1HA 1TLHB 4U7BA 1MBGA 3KP7A 2QEXI 2P5LC 1YTYA 4EM1A 4ESFA 4HBLA 4C30A 3L2VA 5B3SH 1MDMB 1QBJA 1VQ7I 4WWCA 4M73A 2LY9A 2V9KA 2W00A 2A07F 2KP6A 2XPUA 4PFPA 5AONA 2Z33A 2Y9ZA 5DTDA 3C2BA 4P96A 2KJCA 5KAIC 2VJIA 2MBFA 4ZH4F 3FHZA 9ANTA 2I8DA 2L7ZA 4PJLA 4ZYDA 3IKTA 2TRTA 1P7IA 2F5EA 3K1NA 2WB1A 4BYYA 3JRIA 1SD6A 2DA2A 2KRHA 3HBLA 2DMPA 2IT0A 2EZHA 5D5UB 2VONA 5J1RA 1T0FC 3DEWA 3P9KA 3V8KA 3ZQ7A 1IDZA 2Y48A 1LQ1A 1IV6A 1UCRA 4ON0A 3IAM2 1K7AA 1FOXA 5FFXA 1ENHA 1BW5A 2H1KA 4ZYHA 1ZRFA 3K4NA 1FX7A 3K10A 5CVVA 4ZZLA 4KDPA 5HVQC 2LBFA 1HDDC 2VC1A 2BXZA 1IG7A 4UUTA 2PJPA 2K86A 5B5EC 2K4JA 1GUUA 3LQRA 4HX4A 5EF6A 3BG7A 1WQ2A 2ZSHB 2L4AA 2X4HA 5J8CA 1D5VA 4Y3OA 4ENNA 4PFOA 2E36A 2JPBA 2QM3A 4ZC3A 3CUQA 2J5OA 3H92A 2DTZA 2NVXJ 1MMDA 4V2GA 1ONVA 5K7FA 4RB1A 2LY1A 2IA2A 3CDLA 4F55A 2PN6A 3EETA 1QO0D 1FEXA 1R58A 1ETKA 1WI9A 3N05A 3VYSB 2GXAA 1Z67A 4KIBA 2LKSA 4AIJA 3HRTA 3D1NI 2ETHA 4II3A 1U3EM 4E7KA 2W57A 3G1OA 2DDAA 2XB0X 4ITVA 1WZ2A 2DA1A 1P9QC 4M3GA 2DW4A 4AD9A 1A5JA 1QVTA 2A61A 1JXSA 3HOXJ 4J00A 2DQRA 4GXOA 1EKEA 4EM2A 2ADUA 1HKSA 3PNVA 4GYGA 2NS8A 2VXZA 2E2IJ 2DMUA 4BY1J 5D5VB 3DU5A 2JT1A 4ABZA 3R0AA 3CJQB 1SD4A 2DMNA 1RESA 1K78A 4H0EA 1W7PD 2CWEA 1G2HA 4RDUA 3O2PE 4PCQA 4DYRA 1MMNA 3A01A 2ZJPF 1PDNC 1ETXA 4IHYA 3OIPA 1TC3C 3HEFA 3VODA 2MC3A 2NYXA 4JX5A 4E7SA 2ZMEA 1R1TA 1MKMA 2M7AA 3CDIA 4OU0A 1MBKA 4RS8A 2O61A 3HPHA 4XQFA 3K9TA 4AUXA 5GPAA 3IH2A 3QOPA 3FK6A 4D9JA 1P4AA 2CFXA 4ZDLA 2V7FA 3ZQFA 3QQAA 1XDUA 2BHYA 2B7EA 4HV6A 1X1AA 3S3NA 1REPC 3B02A 2H09A 1MNEA 1FNNA 4XOTA 1XMAA 4Y15A 1O4XA 3U9GA 1VQ8I 2DJIA 5K5OA 1B1BA 2L2OA 4KJZA 2VKDA 4HNTA 2EZIA 4D7NA 2ZO4A 1XX5A 2DT6A 3WU0A 3QYBA 2YU3A 2Q8KA 4EJWA 4MTEA 5HDKA 1WI3A 1J2XA 4NNJA 4UVBA 5IOZA 5K5QA 1GVJA 1ZQ3P 3FK7A 1LNWA 2WB1N 4E6KG 1LB2A 1B4AA 4A3JJ 1ZGJA 3TOAA 1XSXA 3F6VA 1ITYA 5CLSA 5A2QZ 4B8XA 2BW3A 1SFOJ 2K3FA 2LK2A 3HKZN 2QVOA 1T0FA 4IPAA 5CVUA 2R7ZJ 3C2HA 1K4SA 1HXDA 4BACA 3F72A 2JSCA 2DN0A 4BQNA 1JKPC 4BE0A 4XBFA 4L9JA 3RPQA 5FRMA 3Q5FA 1OISA 2F5FA 4XLFA 1OKRA 1SD7A 1UFMA 5F6FA 3J81Z 1VTNC 4J01A 3I4NJ 2A05A 1YW7A 4DZJA 3HOTA 5M5XJ 2O9LA 3E3VA 3G73A 5D4RA 1QZZA 4HAMA 2LOOA 2KIQA 3A03A 4ESBA 4HA8A 1UHWA 4KFCA 3MEXA 5J40A 4DNCA 2ME0A 3PQJA 1G4DA 3W6KB 2HVQA 2UV1A 2XRNA 4PJ0C 5BQTA 3PL8A 4LOCA 3BJ6A 4ZYAA 1LVAA 1JHFA 3G1MA 1WJ5A 5KCMA 1SVMA 1JE8A 4M71A 4PJNA 1Y39A 2W1OA 4YIRX 3H3UA 5HDNA 1YW9A 4R8HA 1EF4A 1W5SA 2M3AA 5J4YA 5JHUA 3E5QA 3RZDJ 4A5MA 3E0JB 1TT5B 3SZGA 3MN2A 2P6TA 4IHXA 4LG0B 3BWGA 1OCOH 1Z77A 3K4KA 2EB7A 1RRJA 1DPRA 1HQCA 1Z21A 3H9GA 4BDYA 4PUSA 2R7DA 3VYRB 4Y33A 5FKMA 2EJRA 1ETYA 4QWQA 4BE1A 4RM2A 1FP2A 1MJAA 2JN6A 1Z1DA 3S14J 3H9JA 1S7OA 4C2MJ 4A2UA 5FRNA 1FJLA 3BTLA 4B44A 1AKHA 2V1DA 2QQBA 3J80Z 5LLQA 3MWMA 5K5RA 2OQRA 5D5WB 3UNGC 2K5CA 5JR3A 5CVRA 3CUQC 1IN5A 1I5ZA 5LRRA 2VJ4A 1QPIA 4ZJZA 4GGGA 2K9QA 2FNPA 4GO1A 3WODF 5IP6A 1J5YA 4FQGA 1IF1A 3DXJF 5LGTA 1BI1A 5E8IA 4I7HA 4XSZF 3KEQA 2TDXA 4YELA 1MH4A 1K83J 3ELKA 2F6CA 5JLWA 2RREA 1HC8A 2OV7A 2GQQA 5DD8A 2IGKA 2O8KA 1O3SA 2LY2A 2CU7A 4LG3A 1F1ZA 1VQMI 4HZFA 4RAYA 2QQ9A 4GRIA 2L7FP 2M4KA 1E3PA 3BR0A 1T95A 1KU9A 1YQAA 5CKTA 2M87A 3ABTA 1O3TA 3WTZA 1R00A 1MW7A 5H2FC 3C7JA 1ON2A 2DA5A 3M8FA 4M9ZA 2DA4A 4A12A 3L1PA 4ESJA 2E5NA 2HQAA 3GO5A 4BNCA 3E5XA 1E2XA 3WHCA 1T38A 4IHTA 3RTRA 1W7PB 2VOPA 3NQOA 3LA7A 2VQLA 1IRXA 1MSFC 1IRZA 2BV6A 3NEUA 1V5FA 3HRSA 3K4JA 3MKLA 2DOEA 4OIOF 3CCRI 3I0TA 1PVEA 1SVLA 4HNVA 2VPRA 4CH7A 5DCMA 3VSKA 2IGMA 3QPTA 4A3FJ 2XPWA 3PSFA 2R3SA 1R5HA 1WJAA 4W1UA 1T33A 2XDVA 5EG0A 4BEHA 1BIBA 1OR7C 1ZRCA 3WTVC 3NAUA 4RBOA 2R7TA 5ED4A 1XC5A 2EIJH 1H0MA 4IF4A 2GOMA 1ZR2A 4N0BA 2VQGA 3FBIB 5DUKA 4F3QA 4OAZA 4JP0A 3F23A 1OLTA 4A6EA 3BJAA 2MW8A 2OCCH 1G59A 1MBFA 1LDJA 3BQZA 3HOUJ 2DYSH 2V6CA 2W82A 1M1EB 2G7HA 5DS9A 5HOOA 2LRDA 3FXKA 4QIWN 4QPOA 1Z6RA 4F91B 4RLFA 2YU9J 2NAZA 2WWYA 1DDNA 3A2KA 1MBEA 2IAIA 3DFGA 3M9AA 2V1XA 4NBQA 4MO7A 2A6TA 3VDXA 2IJLA 3RYPA 5L3CA 3OYEA 4I09A 1Z0XA 2Z2SB 4WCGA 1DPUA 5LHGA 2OUMA 3K2ZA 4F7ZA 3JRHA 3OS2A 4DYCA 1D1BA 1RKWA 1HBXG 1DU0A 1VQ9I 4XKWA 3O6BB 4EJVA 1U0JA 4BHBA 3FDYA 3J81K 5L3BA 3LSJA 2R7FA 5FLXK 4OWRB 2DDBA 1T56A 2COMA 3P7NA 4B48A 1UJ8A 4LG0A 2KRCA 4AYBN 5J8FA 4HEA2 3HOZJ 3KCCA 3KZIC 3OYMA 3LMMA 3TDUC 2PBIA 2HOTA 3HB9A 2GBYA 4N9HA 5GTHC 1XGMA 2LDUA 4J19A 1G3WA 2R7UA 5DM6F 1F9NA 3HYIA 5EJCA 1Y1WJ 3MKZA 1LEBA 1YW8A 5IT9Z 5B1BH 3AG1H 3KP4A 1ULYA 2HU9A 2DPUA 5FJ8J 1X2NA 4KMFA 2RKHA 3T8RA 1TNSA 4L9VA 1V55H 2L7KA 3LOCA 2XKOA 4PK4A 4KA4A 1LVKA 2Q1ZB 4LITA 1QU3A 4I99C 2YSRA 3EUHC 2DCEA 1S29A 4XK4A 3FZVA 1MIJA 2XASA 3PO2J 4AC0A 4XLNF 3FHNA 1MSEC 2QQ8A 3CMEI 3DF8A 4D7MA 3WU2C 3MMYB 3R61A 4XN3A 4WF2A 4M6XA 3DKYA 1O57A 4OIRF 2BW3B 3TOBA 3EUHA 3W2VA 1R71A 1H88C 5TGTA 1Y6IA 2W25A 4XM3A 2OZ6A 2AHQA 2PQ8A 3CJNA 3LAJA 1U8BA 1H89C 1XGOA 3CJRB 4KICA 3OSFA 4YRVA 1RZ4A 2V4JC 6PAXA 2Q0OA 3UR3C 1FMVA 1T6SA 4XKBA 3F21A 2W7NA 3ISPA 2VQHA 1JUPA 2OD5A 2VB6A 3NWSA 4U7DA 3KEOA 4HOBA 2ZC2A 2FD5A 4ENKA 4RAZA 3MFKA 5L3EA 2DA7A 3VPRA 3JRGA 1X1BA 3A4CA 2QSHX 1X2MA 2O3FA 2RQPA 3SEZA 3S32A 3ZPLA 1FOWA 4C3JJ 4RB3C 3HZJA 3PJRA 1H8AC 2CUJA 3HUGB 2FNAA 5LGUA 2F5VA 3DCFA 3OL3A 2VPLA 5IOYA 4LB6B 1R4MB 4XICA 3OYBA 2DA3A 4MEXF 2Z99A 3WE3A 3I59A 2XSJC 3HRMA 1K61A 4JYKA 3GF2A 1DP3A 1MJBA 2HKXA 1R1VA 1D0ZA 3E6MA 4M9XA 1FP1D 4DIQA 1TQIA 2BY0A 3BROA 3IV5A 2EFOA 5LGNA 3RCOA 3G4SI 4BE2A 3H5RA 3B6CA 4QTRA 3CDHA 1XTAA 4FE7A 4C2UA 3DBRB 2JSPA 1JUSA 4CZCA 2DA6A 4DGWB 3LA3A 4M3FA 4ETSA 3K4MA 1IRGA 2UWMA 3PUBA 4AWXB 2CUFA 2HQNA 1ZGAA 4H4KC 4I2OA 2R5ZB 2XC7A 1FSEA 2NOGA 3V8JA 2RN7A 4P9UA 1J09A 2HDCA 3LSGA 2HFHA 4PSXA 4B1RA 1P4XA 3WGGA 1D8KA 3CUOA 1W7PA 1OYWA 2AQFA 2ZJQF 3BTIA 2C6YA 2IP2A 1YG2A 2ID6A 2DXIA 3ULQB 4BQAA 1J59A 4MHGA 3LFUA 4G12A 4I01A 4E70A 2ME6A 5E3OA 1B9MA 4BGDA 2GLOA 2QLZA 4XL9A 2HI3A 1D0XA 4HSRA 4AIHA 1LE8B 3SFZA 2DLLA 4R1HA 3I3LA 3CMYA 1ZELA 3RKYA 1OCTC 2L01A 4B4CA 3ZMSA 4YEJA 3CCUI 2P8TA 1ETVA 5E3LA 2ZJ2A 1MMAA 5KHDA 3Q3SA 3J7ZI 2ZBKA 1RPWA 4MGRA 4HDVA 1MNMC 3PQKA 3B73A 5HNFA 5K1YA 1T39A 5FKLA 1APLC 1BBYA 4IRGA 1W0TA 3W6VA 3D5LA 3DQVC 3DEEA 3FKJA 3VSLA 2ZSIB 5EG0B 5M5WJ 2HZTA 3EYYA 2VUMJ 5IPAA 2BBYA 5M3MJ 2VKVA 1IN6A 1SC7A 2XB5A 3JRFA 4KIGA 4XRSA 5CQGA 1QRYA 1QVUA 4D5FA 4IXAA 4XNFA 3L7WA 1MNDA 1USSA 2HZDA 2DT7B 3IRRA 3C3WA 3MZHA 4UB8C 4IQJA 2F2EA 2MGQA 2QENA 1HW1A 5JVTA 5E3MA 1XGNA 2MH2A 1T2KA 3LSHA 5ILUA 2A5WA 3ZMZA 2RC4A 1XG1A 2ZXHA 3QP5A 1ZREA 2R5YB 1S3JA 1NG7A 3KYCB 4RGUA 1OFCX 5ICEA 3F3XA 3Q9VA 2R0QC 1ZAOA 1R49A 1JUMA 2GM4A 3I58A 2OTJI 5FD5A 3BPXA 3BJOA 3ONQA 4CCJA 2COBA 3AG4H 4M9SA 4BQOA 2HTSA 1IDYA 5JVGF 5JI6A 2MG4A 4NHJA 1U8RA 1Z91A 4WXDA 3MD2A 4KITB 1WCMJ 3T1BA 1RIOH 2YX4A 1G3YA 1J7KA 3JAMK 2V1UA 2P81A 3CCVI 2CW8A 1KQ8A 1BW6A 5K7HA 4BEHB 1TNTA 1NHAA 3OSGA 4Y4RA 5E1WA 1FTTA 2K40A 5EZGA 3GTPJ 1A04A 2KT0A 2RVCA 4L0ZB 4IJAA 2KIFA 1SFEA 1FT9A 2CFOA 1XSVA 2XGEA 3VFZA 5LEKA 2Z5UA 2X6XA 1U5TC 4IOAF 1T08B 5EGOB 1XMKA 4A3EJ 4I0BA 3LSIA 2CQXA 4BHCA 5HLHA 1BOAA 3S3OA 2JK3A 3DEUA 1P2FA 5A2QK 3WG7H 4EGYA 3S17J 1IXSB 3X2QH 1B8IB 2CW0F 3N97A 2ZXWH 2V6EA 2H6CA 2RNJA 2OC6A 1OYYA 2R7XA 5FB2A 2CSOA 2PX9A 3FXMA 5BPDA 5GAEJ 1CF7A 3PUFA 4HQEA 1ERDA 4P55A 4ZDOA 3WE2A 2G7UA 1OPCA 5K7ZA 3S1MJ 2JA2A 2NNYA 1YHQI 3JREA 5C44J 1HOMA 2L0KA 3J7AY 3DLLF 2P5KA 3KZYA 1V54H 2E1MC 3ZRGA 3HIFA 1ZYRF 2KMUA 2A3SA 3FBNB 2IBDA 4PDKA 1P92A 2CW7A 2AXTC 3HTSB 1RUNA 3S2HJ 3CP8A 3F9KA 4NUBA 1ETQA 4O5VA 3M8JA 2E2JJ 1U2WA 5FO5A 3PO3J 2JRTA 4A69C 2FOKA 3VOEA 2L9RA 3BQYA 1IXRC 3U2RA 4LMYA 2VODA 2KDOA 2ZXIA 3CF5F 2IGOA 3FXRA 2VL8A 5E79C 1FOYA 3M3YJ 3FXOA 2QGUA 1GXQA 1W1WE 2IW5A 2HNHA 3QAHA 2B9SA 1FTZA 2WY7Q 2ZMEC 3NARA 1IN7A 2DK8A 4UHTA 3HHGA 4NQWA 4DYQA 5FKKA 2R7OA 3I5UA 3F8FA 3GYHX 1YI2I 3FIWA 4G6TB 1WRJA 3PIPF 3L2WA 4FTHA 1V3FA 3IWFA 1TZLA 2CO5A 2XAQA 3OIOA 4PZJA 2CG4A 2IGNA 3JW4A 3TL4X 1KYZA 2X6YA 5BNGA 1T8IA 2D5VA 5JLXA 3ZQIA 2LD5A 4U87A 4EJOA 3ZN0A 1X3WB 1BL0A 2WAQA 2JQ7A 2FBHA 2XAJA 2CYYA 2XUBA 1QNTA 1UG2A 2YUSA 3ZCOA 1KU7A 3ECOA 4S04A 1UELB 2PJRB 3H5AA 4HNUA 2KISA 1I6XA 2Z3YA 5HS9A 1RKTA 5H6QA 2RNGA 2JZYA 4E7ZA 5D4SA 4FT8A 1R6RA 3KYLA 2ELJA 5IP9J 2YS9A 5F1JA 1GT0C 2EIKH 2FE3A 2VASA 3PFIA 4C2TA 3GUDA 3R0JA 2FBIA 5IT9K 4FISA 4RAGA 3TGNA 2N8GA 4CYDA 5EGOA 3WTWC 2H8WA 5L3GA 3IH4A 3QRFF 3QU3A 5ILSA 3H3ZA 5IYCJ 3OYDA 4FHTA 3RDIA 4CICA 4KISA 3IAS2 2XF7A 1DQUA 3S1NJ 4ZZDA 1FBSA 3ZMVA 1XB4A 3QODA 1D8JA 3F6OA 3S93A 1ZG5A 2WV0A 1GXPA 1AU7A 5ERIA 2ISZA 3LSMA 4BJ5C 5H20A 3FMQA 1BC7C 1HSJA 2R92J 2OU2A 1FIAA 1Z3XA 3BZ6A 1H9TA 1R22A 1ETWA 3ECHA 3QYFA 2HVRA 3KIOA 1WJEA 2KZVA 2CQKA 1TWAJ 4FCYA 1I27A 1VF9A 2VC0A 1WHUA 2VT3A 4YFKF 3K2AA 3L9FA 5FGMA 3V42A 1JKOC 3F8CA 1QQIA 5DV5A 4JK1X 4B47A 4XIDA 2FMLA 3ZP5A 1F36A 3GXOA 3CCQI 2AXLA 2ICWG 5FFZA 1SANA 4YIFA 3I55I 1BR1A 4BJ6C 3DPUA 2OBPA 4N4NB 5DUIA 2X51A 3A01B 1RNLA 2L9NA 5DDGA 2CQQA 2M0MA 3OYCA 2UZKA 1HLVA 1TBXA 1R9TJ 4ENJA 4BDZA 2V9PA 3ABUA 1C0WA 1JJ8C 4L18B 2PFBA 1TWHJ 1TW3A 4BKXA 2A6HF 4BU2A 3KZZA 1G3SA 2HYJA 1YIOA 4K2EA 3GWZA 2VBYA 5ICGA 1TWFJ 4HRIA 2R7QA 1VQLI 1G3TA 2XROA 1WJCA 3FX3A 2DU9A 2LMDA 3S1RJ 1B8IA 2L3DA 3ZOBA 2E1NA 1FWZA 2EZKA 2E35A 2H8RA 2ESHA 4LJZF 4CCKA 1Z7LA 1UB9A 1LKXA 3OY9A 4O6JA 1W5CC 2O5RA 2IEKA 3WGIA 3Q0UA 4EVIA 2JA5J 3I53A 3MZ8A 2IPQX 4HPQA 1X58A 4RGSA 2JUGA 2D1VA 2DJNA 1EH7A 1WH5A 4HYEA 5CPRB 4QPQA 5JFRA 1R7JA 2NRAC 2HOAA 3VB2A 4S05A 3HTUA 2KHMA 2XSDC 1PYVA 3FF5A 1ZN2A 4A5NA 2BVMA 2O0YA 2UXNA 3FMRA 3JCUC 5TJJA 1B72A 2PEXA 3ERED 2ESNA 5HLGA 1Z3YA 1QHHD 3TBIA 1DP7P 1AHDP 5FLVA 3IUOA 2DODA 3A1YA 3C18A 3OYGA 4OOIA 1JT6A 5FD6A 4XR6A 3LNQA 5M3FJ 3SDBA 5E3NA 2QZ8A 4YG2F 3OOPA 2PMZN 5GP9A 2X48A 3C1DA 4IL6C 5J47A 2EV5A 5L3DA 2DQLA 3BTJA 3G6EI 2IS2A 1MJ9A 3W3CA 1GV5A 2Y0SN 4G6DA 3CCSI 1ZLKA 4N4OB 4ZTFA 3P5JA 2VIXA 3JSOA 4XSXF 2JA6J 3SFIA 4W97A 3GEZA 2PMZA 2LBFB 2BGCA 4KUMA 2LF8A 4MIMA 3BZCA 2FQ4A 1ZTRA 3HC7A 3K0LA 3EUAA 1U9NA 3LSTA 5KVRA 3ZQCA 2HOSA 1UZCA 3S2WA 1YJNI 3J7AO 4BY7J 2LYCA 2LFBA 2OCEA 2WAEA 4CYCA 4JQFA 2CQ7A 3BR6A 3FMSA 3E6BA 2NVUB 4BXFA 4AIDA 3BPVA 1GVDA 3GZ6A 3TEDA 3JRCA 1I50J 2HXOA 3GZ5A 5KNLA 2BVLA 3TO6A 1U5TB 1UHMA 4L9NA 1WJFA 1X4PA 4OIQF 2X6OA 2A69F 3HOSA 2JJ7A 2CJJA 2DO7A 3QYEA 2UXXA 3WU1B 3FM5A 4IQ4A 4CCLA 2HQRA 1B72B 4OIPF 4HG2A 3T0YA 2EV6A 4RA2A 2BY3A 3ESWB 2XAGA 1FC3A 3CCEI 1I39A 5E17F 2XGCA 2F4IA 2X85A 1RR7A 1ZG3A 1GDTA 3MCZA 3MVPA 5CYVA 3M1CA 2FU4A 3JTHA 3RIRA 1FIPA 2RGVA 2EWNA 4XLHA 5F0FA 4F52A 3J80K 4HF2A 2M2EA 2ZKZA 3CLOA 2KFDA 4XRSG 2YR2A 1A6QA 3JR9A 1AKHB 5J4VA 1YFHA 2EFQA 5GADJ 2E1MB 2LREA 3HG9A 3HXLA 3FXJA 2VXDA 2OA4A 5TISC 5J1YA 3D5SC 2W48A 1HSTA 1PUEE 3B6AA 1AOYA 2WV1A 1JKRC 3K4LA 1Z7UA 3DPTA 4IRIA 1XMXA 1PP8F 3I4PA 1KQ0A 3AG3H 1TWGJ 1XSDA 1WPKA 3KLOA 3OR2C 1VZ0A 2FX0A 4UUVA 4PJJA 4HW0A 3ML6A 1STZA 4UV9A 5JHFA 2JTVA 2K7LA 2M7BA 1GV2A 3M07A 3F22A 3N4MA 3ABMH 1LE8A 3BR5A 2WAFA 3JAMZ 3TO9A 3G3ZA 4UVAA 1NK2P 1X1PA 1TL8A 4PJMA 2RQQA 3RKXA 3OL4A 2VJ5A 2CQNA 3Q9SA 3BLYA 2R7VA 1KA8A 5GAHJ 4X1EA 3RYRA 2PJRA 4BBSJ 3GZNB 1Y8RB 1JGSA 2HWVA 3M1EA 1KQ9A 3Q0WA 3TW6A 4BS9A 2E7XA 1LFPA 2MLKA 4UY8I 5C4XJ 2A6EF 3DU6A 3GMEA 1JGGA 1H9GA 3E7LA 3DBHB 2WY8Q 4M3BA 5D6FA 3OYHA 3GTMJ 2KJBA 1XCBA 2NS0A 3OYFA 2B63J 4FE4A 2Y0SA 3M8EA 2MABA 3SYTA 2OF7A 3H35A 3IL2A 1G6NA 3QPSA 1YJWI 5LHHA 3MKWB 2QUFA 2IRFG 3DTIA 4LB5A 2MD5A 3CF2A 1TTYA 1MBJA 1BA5A 4HF0A 3FXQA 4HF1A 2CS3A 1YLFA 3HSEA 2XAHA 4LK0F 3WTSC 5DCFA 4KN7X 2DMTA 2PG4A 1ZARA 3K6GA 5EEHA 5LHIA 3V4GA 4AU7A 2R5ZA 5LD2C 3H9QA 4EV0A 4NC8A 1N25A 4CUGA 2BY2A 4RAFA 4IHSA 2CV0A 1QZYA 3TO7A 2CUEA 2DFFA 3A0BC 2KL4A 1OCPA 2ELKA 4WXHA 3H5NA 4AVZA 4XLEA 4E4HA 3EQLF 1QZEA 1WKMA 3LSKA 4DJAA 2ZFWA 3IP4B 2PMHA 3DKXA 3EPZA 3OYIA 3BT9A 4LLGF 5F1RA 1YS7A 1LPQA 2JVGA 2JVHA 4PGHA 5ICFA 4LGWA 5LEJA 3ZMUA 3ZMDA 1XD7A 4XLPF 1D0YA 4C3IJ 4UXNA 2WTEA 2FJ1A 2XPVA 3CTAA 2K85A 1BOBA 4B3AA 2WA0A 4MQ9F 2DFEA 4B09A 2QF7A 4CO8A 4EGZA 2XKPA 1HKQA 3L00A 2LR8A 2KPMA 2QYOA 1VFCA 4RGRA 3HUGA 1J0RA 3G1LA 1CF7B 1VNDA 4L9TA 3QP6A 1R23A 3SHFA 2Q2EA 4U0VA 2HDWA 3RSNA 4A3BJ 2XHKA 4OMZA 4A3CJ 1BJZA 2IXSA 3ZGKA 1QHGA 4CHUA 2M45A 4UNOA 1QPMA 2X9DA 2JMWA 1G8XA 4G8XA 3W2WA 4DZPA 1D3YA 5FKNA 4X0GA 5LFAA 3HSRA 4GFBA 3HSFA 4CXFA 1O3RA 1UMQA 5F64A 2IS1A 1JT0A 1YJ9I 2K9MA 4G6QA 2K4BA 4DW6A 1UG0A 2XIGA 2P0WA 3CMMA 3I64A 4IEJA 1VQOI 2L4MA 4E7LA 4M72A 2QSGX 1Y0UA 1YYVA 2M34A 1XS9A 2STWA 2P4WA 2XV4S 2GA1A 3DKWA 1TQPA 3BG3A 2HVSA 2GZWA 2KZGA 2QQAA 2VOOA 1K6YA 1GLNA 4KT5C 1LUJB 1W0UA 1FBQA 2I5UA 2JPCA 3W6JB 1P4WA 1IRFA 1FMWA 4RM3A 4L5JA 5BMZA 3I56I 1B6AA 4EJTA 3RQIA 4F93B 1R36A 4DBRA 5EEGA 3IH3A 1T98A 3JTGA 2GXBA 1GHCA 4BJTA 1E17A 1OQYA 3PM1A
chains in the Genus database with same CATH topology
1MD0A 2WC2A 5KK1A 1MGTA 3F8NA 3KLNA 3BP8A 2ELHA 1FZPB 3GLXA 3AAFA 2O03A 4U88A 1JHHA 2W24A 4DQ2A 3WG9A 2EFNA 4I0AA 1SFXA 2FQ3A 3V7SA 2LF7A 1BC8C 4G7HF 3ZMTA 4MTDA 2GAUA 4OINF 1L3LA 2K27A 2OAZA 1ZH5A 2FEZA 2H27A 5LRSA 3COAC 4HDUA 4GCVA 4BH9A 3K69A 3I71A 2CGPA 1ZG1A 3TDZC 1TW2A 4P9FA 5AIQA 5HDGA 2FBKA 1R1UA 2HOEA 2V79A 2ISYA 2KKOA 3HRUA 3SXYA 2OQGA 1MZBA 1MDMA 4I98B 4YIIA 1BJAA 4ZYGA 4Z2YA 4L0YB 1ZRDA 1O7FA 1W5TA 4KMUX 4QLCU 2HTJA 2QBYA 5IT3A 3K1PA 4KNYA 2VT2A 2E1CA 3WTYC 5CVJA 3FM3A 3QU6A 2EK5A 5E1ZB 5J6XA 3TQNA 3I59B 1HKTA 1FYKA 4AVPA 4EM0B 1Z05A 5LBQA 2GA2A 1L0OC 2ZNYA 2VN2A 2F5DA 4P5OA 2VBWA 1KYWA 3CUQB 2PLYA 2P5VA 4EMSA 1USTA 3M7GA 3HHHA 1U5TA 5E8GA 5ICCA 3QPHA 2XAFA 4LFUA 1K79A 4UV8A 2GXGA 4HLYA 5BS6A 5BOXA 3DP7A 2VBXA 2LNBA 2H94A 4RB0A 1P6RA 2EA2A 3EYIA 3F8BA 2GIVA 2IVMA 2P7VB 3GFIA 2MH9A 4RB2C 4UVCA 5TRDA 1XCVA 1BI0A 1HW5A 2FXAA 4G7OF 2KIUA 1AWCA 5AIPA 3CO7C 4CHUA 3REOA 2HR3A 5CJ9A 3VEPA 4M74A 1YO5C 3V7RA 3KE2A 1EH6A 4TV7A 4ASNA 2FF4A 1SMTA 2VE8A 1IW7F 1PP7U 2V9VA 1O7LA 2D2WA 3NRVA 2HYGD 3P9IA 3ROUA 1SAXA 3U1DA 3IKVA 1DUXC 4CZZA 1CGPA 1TQMA 3OV8A 3O3KA 2G9WA 3R60A 4G94A 5E1XA 2VBZA 2EFPA 3RJPA 3WGHA 1XDSA 4PGGA 3BY6A 1FSHA 2X0LA 1YS6A 4WXCA 5DEQA 4XRFA 3ZN1A 3KP3A 2Y75A 1U78A 3IC7A 3T5XA 1S8NA 4LLLA 1ZHFA 1ZLJA 5H6RA 4L5IA 4Q48A 3R6SA 1LEAA 2HEOA 4A6DA 4CGZA 1B59A 3KETA 3L2CA 3DPLC 2PI0A 1EH8A 1Z6TA 4HLXA 2IA1A 3E6DA 5HS8A 2ZMEB 5D8LB 2AS5F 3TKYA 2F5CA 5HS7A 3BOQA 4O3MA 3P9CA 1BIAA 2EA4A 1IUYA 3FXUA 3KP6A 3SZPA 1FYMA 5DCMB 3K1MA 4I02A 1BI2A 1XN7A 3V7CA 4RGXA 4G9YA 1X3UA 1FLIA 5E18F 1SMYF 1O3QA 4G7ZF 2FMYA 2Y0MA 1F4KA 3IWZA 1IAWA 3GFLA 2KRFA 2NNNA 3SZTA 4GYIA 5D8KB 2LSOA 3MQ0A 2RV8A 1RUOA 5L3FA 1LJ9A 2GWRA 4BXUA 2HYFA 1QGPA 2W84A 1FOKA 3FWEA 2O8XA 1FPQA 5DYMA 2IA0A 1RI7A 1EV7A 4A0XA 1LDDA 2M5WA 3E5UA 5E20A 4U0WA 2P7CB 3LQQA 1FYLA 3GW2A 2RDPA 4MQVA 2XVCA 4MEYF 2QBYB 3WTUC 3R4KA 2OZUA 3LFKA 2W85A 4Q47A 3E97A 4ENMA 1I1GA 1WSUA 2XGXA 3MZYA 4Q4ZF 1HW2A 4NB5A 4IRHA 1LDKB 1XGSA 3LA2A 2L02A 3E6CC 4HX7A 1OMIA 3GFMA 2YX7A 2YPRA 2A68F 3I54A 3T8TA 1J9IA 2MA3A 4A0YA 4BAYA 2DK5A 3LAPA 1KU3A 2D1HA 3D0SA 2ZXJA 1IZ1A 2BEOA 3V8LA 4U0YA 3F8MA 2DAOA 4EJUA 5CVIA 1ODDA 2VE9A 3RKWA 1R5GA 4WK8F 1BM9A 1W4MA 2B0LA 3KP5A 4KN4X 4ZYEA 4HQMA 4M6YA 1V4RA 5D5XB 2Z9OA 1S6LA 4KIFA 4FX0A 3KP2A 2DBBA 4BHPA 2DI3A 2HGCA 1F5TA 4HV5A 4AIKA 3MAJA 2KIMA 2L54A 1WWXA 4WX9A 5D6EA 3JSPA 2ACJA 3WTXC 1KU2A 1ON1A 2DT5A 2EV0A 4LK1F 4A0ZA 2ZCWA 3SQNA 2STTA 3GVAA 2FA5A 3CO6C 3DV8A 2EFWA 4EQQA 4MNUA 1SFUA 2DTRA 3RI4A 1FY7A 2HS5A 3IHUA 4FX4A 3KFWX 1IXCA 2DPDA 4Q5SF 3IRQA 4KYWA 1K78B 4IVNA 1J75A 1S7AA 1K6OA 5FLXZ 3EDPA 4CDGA 1BI3A 3GFJA 2J5PA 2M1BA 2BYVE 1IN8A 2HKOA 1SD5A 4YFXF 2FRHA 1U6GA 1IN4A 1FBUA 5BPIA 2ZNZA 4D0PA 1Z9CA 4LD5A 2O6GE 4JBAA 3BDDA 4HX8A 4Y17A 5ILVA 2MLGA 2QWWA 4OMYA 2H6BA 2A5YB 2M30A 1I1SA 2D45A 1OR7A 3L09A 2P6SA 2DFIA 1OYIA 1B9NA 2BE5F 2M8EA 2K02A 3RPUA 5DD4A 2PMUA 4YFNF 1KGSA 5HLIA 4R79A 3WTTC 4LLNA 4N9IA 3LWFA 1BN5A 3GX4X 2LKPA 4Y13A 2E7WA 2FSWA 1Q1HA 1TLHB 4U7BA 3KP7A 2P5LC 1YTYA 4EM1A 4ESFA 4HBLA 1QBJA 1MDMB 4WWCA 4M73A 2A07F 5AONA 2Z33A 4P96A 2KJCA 2MBFA 4ZH4F 3FHZA 4ZYDA 3IKTA 2F5EA 3K1NA 4BYYA 1SD6A 2IT0A 5D5UB 2VONA 3P9KA 3V8KA 3ZQ7A 2Y48A 1LQ1A 1UCRA 4ON0A 1K7AA 5FFXA 4ZYHA 1ZRFA 5CVVA 1FX7A 4ZZLA 4KDPA 5HVQC 2VC1A 2PJPA 2K86A 2K4JA 3LQRA 4HX4A 1WQ2A 2L4AA 2X4HA 5J8CA 1D5VA 4ENNA 2JPBA 2QM3A 3CUQA 2J5OA 3H92A 1ONVA 4RB1A 2IA2A 2PN6A 3EETA 1QO0D 1R58A 1WI9A 4KIBA 4AIJA 3HRTA 2ETHA 1U3EM 2W57A 2DW4A 4AD9A 2A61A 1JXSA 2DQRA 4GXOA 4EM2A 2ADUA 1HKSA 4GYGA 2VXZA 5D5VB 2JT1A 3R0AA 1SD4A 1K78A 4H0EA 1W7PD 2CWEA 3O2PE 4PCQA 1PDNC 3VODA 2MC3A 2NYXA 2ZMEA 1R1TA 1MKMA 4OU0A 4RS8A 2O61A 3K9TA 3QOPA 2CFXA 1P4AA 1XDUA 4HV6A 1REPC 3B02A 2H09A 1FNNA 1XMAA 4Y15A 3U9GA 5K5OA 1B1BA 2ZO4A 3WU0A 2YU3A 2Q8KA 4EJWA 4MTEA 5HDKA 1J2XA 4UVBA 5K5QA 1GVJA 1LNWA 1LB2A 1B4AA 1ZGJA 3TOAA 1XSXA 3F6VA 5CLSA 5A2QZ 4B8XA 2QVOA 1T0FA 4IPAA 5CVUA 1HXDA 3F72A 2JSCA 4XBFA 4L9JA 3RPQA 3Q5FA 2F5FA 1OKRA 1SD7A 1UFMA 5F6FA 3J81Z 1VTNC 1YW7A 3HOTA 3G73A 3E3VA 5D4RA 1QZZA 4HAMA 4ESBA 4HA8A 1UHWA 4KFCA 3MEXA 4DNCA 3PQJA 1G4DA 3W6KB 2XRNA 5BQTA 3BJ6A 1LVAA 1JHFA 1JE8A 4M71A 3H3UA 5HDNA 1YW9A 4R8HA 1W5SA 5JHUA 3E5QA 4A5MA 2P6TA 4LG0B 3BWGA 2EB7A 1DPRA 1HQCA 2R7DA 2EJRA 4QWQA 1FP2A 1MJAA 1Z1DA 1S7OA 4A2UA 2V1DA 2QQBA 3J80Z 5LLQA 3MWMA 5K5RA 2OQRA 5D5WB 5JR3A 5CVRA 5LRRA 3CUQC 1IN5A 1I5ZA 4GGGA 2FNPA 4GO1A 3WODF 1J5YA 1IF1A 3DXJF 5LGTA 1BI1A 5E8IA 4I7HA 4XSZF 3KEQA 2TDXA 3ELKA 2GQQA 5DD8A 1O3SA 1F1ZA 4HZFA 4RAYA 2QQ9A 1KU9A 1YQAA 1O3TA 2M87A 3ABTA 3WTZA 1R00A 3C7JA 1ON2A 3M8FA 4M9ZA 4A12A 4ESJA 3GO5A 3E5XA 1E2XA 1T38A 4IHTA 3RTRA 1W7PB 2VOPA 3NQOA 3LA7A 2BV6A 3NEUA 3HRSA 4OIOF 3I0TA 5DCMA 3QPTA 2R3SA 1R5HA 1BIBA 1ZRCA 3WTVC 5ED4A 1H0MA 4IF4A 4N0BA 5DUKA 3F23A 4A6EA 3BJAA 1LDJA 2V6CA 2G7HA 5HOOA 1Z6RA 2NAZA 2WWYA 1DDNA 3DFGA 3M9AA 2V1XA 2IJLA 3RYPA 5L3CA 4I09A 4WCGA 1DPUA 5LHGA 3K2ZA 4F7ZA 1HBXG 3O6BB 4EJVA 4BHBA 3J81K 5L3BA 2R7FA 5FLXK 2COMA 3P7NA 4LG0A 5J8FA 3KCCA 3TDUC 2PBIA 4N9HA 1XGMA 2LDUA 1G3WA 1F9NA 3HYIA 1LEBA 1YW8A 5IT9Z 3KP4A 1ULYA 2DPUA 4KMFA 2RKHA 3T8RA 1TNSA 4L9VA 2XKOA 4KA4A 2YSRA 1S29A 3FZVA 2XASA 4XLNF 3DF8A 3R61A 4WF2A 4M6XA 1O57A 4OIRF 3TOBA 3EUHA 2W25A 2OZ6A 2PQ8A 3CJNA 3LAJA 1XGOA 4KICA 1RZ4A 6PAXA 2Q0OA 1T6SA 3F21A 3ISPA 2OD5A 4U7DA 3KEOA 4HOBA 4ENKA 4RAZA 3MFKA 5L3EA 2O3FA 2RQPA 3ZPLA 4RB3C 2FNAA 5LGUA 4LB6B 4MEXF 2Z99A 3WE3A 3I59A 3HRMA 3GF2A 1MJBA 2HKXA 1R1VA 3E6MA 4M9XA 1FP1D 1TQIA 3BROA 2EFOA 5LGNA 3CDHA 3LA3A 4ETSA 1IRGA 2UWMA 4AWXB 2HQNA 1ZGAA 4I2OA 1FSEA 3V8JA 2RN7A 4P9UA 2HDCA 2HFHA 1P4XA 3WGGA 1D8KA 3CUOA 1W7PA 1OYWA 2C6YA 2IP2A 1YG2A 3ULQB 4BQAA 1J59A 4MHGA 4I01A 4E70A 1B9MA 2QLZA 4AIHA 3SFZA 2DLLA 4R1HA 3RKYA 2L01A 3ZMSA 2P8TA 2ZJ2A 2ZBKA 4MGRA 4HDVA 3PQKA 3B73A 5K1YA 1T39A 1BBYA 4IRGA 3D5LA 3DQVC 2HZTA 3EYYA 2BBYA 1IN6A 4KIGA 4IXAA 3L7WA 1USSA 3IRRA 3C3WA 3MZHA 2F2EA 2QENA 1HW1A 5JVTA 1XGNA 2MH2A 1T2KA 5ILUA 3ZMZA 2RC4A 3QP5A 1ZREA 1S3JA 4RGUA 5ICEA 3F3XA 3Q9VA 1ZAOA 3I58A 5FD5A 3BPXA 3BJOA 4M9SA 2HTSA 5JI6A 4NHJA 1U8RA 1Z91A 4WXDA 3T1BA 1RIOH 2YX4A 1G3YA 3JAMK 1J7KA 2V1UA 1KQ8A 1TNTA 1NHAA 5E1WA 1A04A 2RVCA 4L0ZB 4IJAA 2KIFA 1SFEA 1FT9A 1XSVA 3VFZA 5LEKA 2Z5UA 1U5TC 1XMKA 4I0BA 4BHCA 5HLHA 1BOAA 3DEUA 1P2FA 5A2QK 4EGYA 1IXSB 2CW0F 3N97A 2H6CA 2RNJA 1OYYA 5FB2A 2CSOA 5BPDA 1CF7A 4HQEA 4P55A 3WE2A 2G7UA 1OPCA 2NNYA 2P5KA 3KZYA 3HIFA 1ZYRF 2A3SA 4PDKA 1P92A 3HTSB 1RUNA 4O5VA 1U2WA 5FO5A 2JRTA 2FOKA 3VOEA 1IXRC 3U2RA 4LMYA 2VODA 3FXRA 1GXQA 2IW5A 3QAHA 1IN7A 2DK8A 4UHTA 3HHGA 4NQWA 3I5UA 3F8FA 3GYHX 1WRJA 1V3FA 3IWFA 2CO5A 2XAQA 4PZJA 2CG4A 3JW4A 1KYZA 4EJOA 3ZN0A 2FBHA 2XAJA 2CYYA 2XUBA 1QNTA 1KU7A 3ECOA 4S04A 1I6XA 2Z3YA 5HS9A 5H6QA 2JZYA 5D4SA 4FT8A 2FE3A 3PFIA 3GUDA 3R0JA 2FBIA 5IT9K 3TGNA 4CYDA 3WTWC 5L3GA 3QRFF 3QU3A 5ILSA 3H3ZA 4FHTA 3RDIA 4CICA 4ZZDA 1FBSA 3ZMVA 1XB4A 1D8JA 3F6OA 1ZG5A 2WV0A 1GXPA 5ERIA 2ISZA 5H20A 3FMQA 1BC7C 1HSJA 2OU2A 3BZ6A 1H9TA 1R22A 3ECHA 2CQKA 1I27A 2VC0A 2VT3A 4YFKF 5FGMA 3L9FA 3F8CA 1QQIA 5DV5A 4JK1X 2FMLA 3ZP5A 3GXOA 2AXLA 5FFZA 4YIFA 2OBPA 5DUIA 1RNLA 5DDGA 2UZKA 1TBXA 4ENJA 4L18B 3ABUA 1C0WA 2PFBA 1TW3A 2A6HF 3KZZA 1G3SA 1YIOA 4K2EA 3GWZA 2VBYA 5ICGA 1G3TA 2XROA 3FX3A 2DU9A 2L3DA 2E1NA 1FWZA 2ESHA 4LJZF 1UB9A 4O6JA 3WGIA 4EVIA 3I53A 4RGSA 2IPQX 2D1VA 1EH7A 4HYEA 5JFRA 1R7JA 2NRAC 3VB2A 4S05A 3HTUA 3FF5A 1ZN2A 4A5NA 2O0YA 2UXNA 3FMRA 5TJJA 2PEXA 3ERED 2ESNA 5HLGA 1DP7P 3C18A 4OOIA 5FD6A 2QZ8A 4YG2F 3OOPA 3C1DA 2EV5A 5L3DA 2DQLA 1MJ9A 4G6DA 1ZLKA 3JSOA 4XSXF 3GEZA 2BGCA 4KUMA 2LF8A 3K0LA 3LSTA 5KVRA 3S2WA 3J7AO 4JQFA 3FMSA 3E6BA 3BPVA 3GZ6A 3GZ5A 3TO6A 1U5TB 1UHMA 4L9NA 4OIQF 2A69F 3HOSA 2DO7A 3WU1B 2UXXA 3FM5A 2HQRA 4OIPF 3T0YA 2EV6A 2XAGA 1FC3A 5E17F 1ZG3A 3MCZA 5CYVA 2FU4A 3JTHA 3RIRA 2RGVA 2EWNA 3J80K 4HF2A 2ZKZA 3CLOA 2YR2A 1YFHA 2EFQA 2OA4A 1HSTA 1PUEE 1AOYA 1Z7UA 3DPTA 4IRIA 1PP8F 3I4PA 1KQ0A 1XSDA 3KLOA 4UUVA 4HW0A 3ML6A 1STZA 4UV9A 2JTVA 2K7LA 3F22A 3N4MA 3JAMZ 3TO9A 3G3ZA 4UVAA 3RKXA 3Q9SA 1KA8A 3RYRA 4BNCA 1JGSA 2HWVA 3M1EA 1KQ9A 2E7XA 2MLKA 2A6EF 1H9GA 5D6FA 2KJBA 1XCBA 2NS0A 3M8EA 3IL2A 1G6NA 5LHHA 2QUFA 4LB5A 2IRFG 2MD5A 1TTYA 4HF0A 4HF1A 3FXQA 1YLFA 3WTSC 3HSEA 2XAHA 4LK0F 5DCFA 4KN7X 2PG4A 5LHIA 1ZARA 5EEHA 3V4GA 4EV0A 4IHSA 1QZYA 3TO7A 4WXHA 3EQLF 1WKMA 2ZFWA 2PMHA 4LLGF 5F1RA 1YS7A 4PGHA 5ICFA 4LGWA 5LEJA 3ZMUA 3ZMDA 1XD7A 4XLPF 4UXNA 2WTEA 3CTAA 4MQ9F 4B09A 4CO8A 4EGZA 2XKPA 1HKQA 3L00A 2QYOA 4RGRA 3HUGA 1J0RA 1CF7B 4L9TA 3QP6A 1R23A 3SHFA 2Q2EA 4U0VA 2XHKA 4OMZA 2M45A 4UNOA 1QPMA 4G8XA 1D3YA 3HSRA 3HSFA 4CXFA 1O3RA 5F64A 4G6QA 2K4BA 2XIGA 3I64A 2L4MA 4M72A 2STWA 1Y0UA 1YYVA 2P4WA 2XV4S 2GA1A 3DKWA 1TQPA 2GZWA 2QQAA 2VOOA 4KT5C 1FBQA 2JPCA 3W6JB 1P4WA 1IRFA 4L5JA 5BMZA 1B6AA 4EJTA 1R36A 5EEGA 1T98A 3JTGA 2GXBA 1GHCA 1E17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MD0 A;  2WC2 A;  5KK1 A;  1MGT A;  3F8N A;  3KLN A;  3BP8 A;  2ELH A;  1FZP B;  3GLX A;  3AAF A;  2O03 A;  4U88 A;  1JHH A;  2W24 A;  4DQ2 A;  3WG9 A;  2EFN A;  4I0A A;  1SFX A;  2FQ3 A;  3V7S A;  2LF7 A;  1BC8 C;  4G7H F;  3ZMT A;  4MTD A;  2GAU A;  4OIN F;  1L3L A;  2K27 A;  2OAZ A;  1ZH5 A;  2FEZ A;  2H27 A;  5LRS A;  3COA C;  4HDU A;  4GCV A;  4BH9 A;  3K69 A;  3I71 A;  2CGP A;  1ZG1 A;  3TDZ C;  1TW2 A;  4P9F A;  5AIQ A;  5HDG A;  2FBK A;  1R1U A;  2HOE A;  2V79 A;  2ISY A;  2KKO A;  3HRU A;  3SXY A;  2OQG A;  1MZB A;  1MDM A;  4I98 B;  4YII A;  1BJA A;  4ZYG A;  4Z2Y A;  4L0Y B;  1ZRD A;  1O7F A;  1W5T A;  4KMU X;  4QLC U;  2HTJ A;  2QBY A;  5IT3 A;  3K1P A;  4KNY A;  2VT2 A;  2E1C A;  3WTY C;  5CVJ A;  3FM3 A;  3QU6 A;  2EK5 A;  5E1Z B;  5J6X A;  3TQN A;  3I59 B;  1HKT A;  1FYK A;  4AVP A;  4EM0 B;  1Z05 A;  5LBQ A;  2GA2 A;  1L0O C;  2ZNY A;  2VN2 A;  2F5D A;  4P5O A;  2VBW A;  1KYW A;  3CUQ B;  2PLY A;  2P5V A;  4EMS A;  1UST A;  3M7G A;  3HHH A;  1U5T A;  5E8G A;  5ICC A;  3QPH A;  2XAF A;  4LFU A;  1K79 A;  4UV8 A;  2GXG A;  4HLY A;  5BS6 A;  5BOX A;  3DP7 A;  2VBX A;  2LNB A;  2H94 A;  4RB0 A;  1P6R A;  2EA2 A;  3EYI A;  3F8B A;  2GIV A;  2IVM A;  2P7V B;  3GFI A;  2MH9 A;  4RB2 C;  4UVC A;  5TRD A;  1XCV A;  1BI0 A;  1HW5 A;  2FXA A;  4G7O F;  2KIU A;  1AWC A;  5AIP A;  3CO7 C;  4CHU A;  3REO A;  2HR3 A;  5CJ9 A;  3VEP A;  4M74 A;  1YO5 C;  3V7R A;  3KE2 A;  1EH6 A;  4TV7 A;  4ASN A;  2FF4 A;  1SMT A;  2VE8 A;  1IW7 F;  1PP7 U;  2V9V A;  1O7L A;  2D2W A;  3NRV A;  2HYG D;  3P9I A;  3ROU A;  1SAX A;  3U1D A;  3IKV A;  1DUX C;  4CZZ A;  1CGP A;  1TQM A;  3OV8 A;  3O3K A;  2G9W A;  3R60 A;  4G94 A;  5E1X A;  2VBZ A;  2EFP A;  3RJP A;  3WGH A;  1XDS A;  4PGG A;  3BY6 A;  1FSH A;  2X0L A;  1YS6 A;  4WXC A;  5DEQ A;  4XRF A;  3ZN1 A;  3KP3 A;  2Y75 A;  1U78 A;  3IC7 A;  3T5X A;  1S8N A;  4LLL A;  1ZHF A;  1ZLJ A;  5H6R A;  4L5I A;  4Q48 A;  3R6S A;  1LEA A;  2HEO A;  4A6D A;  4CGZ A;  1B59 A;  3KET A;  3L2C A;  3DPL C;  2PI0 A;  1EH8 A;  1Z6T A;  4HLX A;  2IA1 A;  3E6D A;  5HS8 A;  2ZME B;  5D8L B;  2AS5 F;  3TKY A;  2F5C A;  5HS7 A;  3BOQ A;  4O3M A;  3P9C A;  1BIA A;  2EA4 A;  1IUY A;  3FXU A;  3KP6 A;  3SZP A;  1FYM A;  5DCM B;  3K1M A;  4I02 A;  1BI2 A;  1XN7 A;  3V7C A;  4RGX A;  4G9Y A;  1X3U A;  1FLI A;  5E18 F;  1SMY F;  1O3Q A;  4G7Z F;  2FMY A;  2Y0M A;  1F4K A;  3IWZ A;  1IAW A;  3GFL A;  2KRF A;  2NNN A;  3SZT A;  4GYI A;  5D8K B;  2LSO A;  3MQ0 A;  2RV8 A;  1RUO A;  5L3F A;  1LJ9 A;  2GWR A;  4BXU A;  2HYF A;  1QGP A;  2W84 A;  1FOK A;  3FWE A;  2O8X A;  1FPQ A;  5DYM A;  2IA0 A;  1RI7 A;  1EV7 A;  4A0X A;  1LDD A;  2M5W A;  3E5U A;  5E20 A;  4U0W A;  2P7C B;  3LQQ A;  1FYL A;  3GW2 A;  2RDP A;  4MQV A;  2XVC A;  4MEY F;  2QBY B;  3WTU C;  3R4K A;  2OZU A;  3LFK A;  2W85 A;  4Q47 A;  3E97 A;  4ENM A;  1I1G A;  1WSU A;  2XGX A;  3MZY A;  4Q4Z F;  1HW2 A;  4NB5 A;  4IRH A;  1LDK B;  1XGS A;  3LA2 A;  2L02 A;  3E6C C;  4HX7 A;  1OMI A;  3GFM A;  2YX7 A;  2YPR A;  2A68 F;  3I54 A;  3T8T A;  1J9I A;  2MA3 A;  4A0Y A;  4BAY A;  2DK5 A;  3LAP A;  1KU3 A;  2D1H A;  3D0S A;  2ZXJ A;  1IZ1 A;  2BEO A;  3V8L A;  4U0Y A;  3F8M A;  2DAO A;  4EJU A;  5CVI A;  1ODD A;  2VE9 A;  3RKW A;  1R5G A;  4WK8 F;  1BM9 A;  1W4M A;  2B0L A;  3KP5 A;  4KN4 X;  4ZYE A;  4HQM A;  4M6Y A;  1V4R A;  5D5X B;  2Z9O A;  1S6L A;  4KIF A;  4FX0 A;  3KP2 A;  2DBB A;  4BHP A;  2DI3 A;  2HGC A;  1F5T A;  4HV5 A;  4AIK A;  3MAJ A;  2KIM A;  2L54 A;  1WWX A;  4WX9 A;  5D6E A;  3JSP A;  2ACJ A;  3WTX C;  1KU2 A;  1ON1 A;  2DT5 A;  2EV0 A;  4LK1 F;  4A0Z A;  2ZCW A;  3SQN A;  2STT A;  3GVA A;  2FA5 A;  3CO6 C;  3DV8 A;  2EFW A;  4EQQ A;  4MNU A;  1SFU A;  2DTR A;  3RI4 A;  1FY7 A;  2HS5 A;  3IHU A;  4FX4 A;  3KFW X;  1IXC A;  2DPD A;  4Q5S F;  3IRQ A;  4KYW A;  1K78 B;  4IVN A;  1J75 A;  1S7A A;  1K6O A;  5FLX Z;  3EDP A;  4CDG A;  1BI3 A;  3GFJ A;  2J5P A;  2M1B A;  2BYV E;  1IN8 A;  2HKO A;  1SD5 A;  4YFX F;  2FRH A;  1U6G A;  1IN4 A;  1FBU A;  5BPI A;  2ZNZ A;  4D0P A;  1Z9C A;  4LD5 A;  2O6G E;  4JBA A;  3BDD A;  4HX8 A;  4Y17 A;  5ILV A;  2MLG A;  2QWW A;  4OMY A;  2H6B A;  2A5Y B;  2M30 A;  1I1S A;  2D45 A;  1OR7 A;  3L09 A;  2P6S A;  2DFI A;  1OYI A;  1B9N A;  2BE5 F;  2M8E A;  2K02 A;  3RPU A;  5DD4 A;  2PMU A;  4YFN F;  1KGS A;  5HLI A;  4R79 A;  3WTT C;  4LLN A;  4N9I A;  3LWF A;  1BN5 A;  3GX4 X;  2LKP A;  4Y13 A;  2E7W A;  2FSW A;  1Q1H A;  1TLH B;  4U7B A;  3KP7 A;  2P5L C;  1YTY A;  4EM1 A;  4ESF A;  4HBL A;  1QBJ A;  1MDM B;  4WWC A;  4M73 A;  2A07 F;  5AON A;  2Z33 A;  4P96 A;  2KJC A;  2MBF A;  4ZH4 F;  3FHZ A;  4ZYD A;  3IKT A;  2F5E A;  3K1N A;  4BYY A;  1SD6 A;  2IT0 A;  5D5U B;  2VON A;  3P9K A;  3V8K A;  3ZQ7 A;  2Y48 A;  1LQ1 A;  1UCR A;  4ON0 A;  1K7A A;  5FFX A;  4ZYH A;  1ZRF A;  5CVV A;  1FX7 A;  4ZZL A;  4KDP A;  5HVQ C;  2VC1 A;  2PJP A;  2K86 A;  2K4J A;  3LQR A;  4HX4 A;  1WQ2 A;  2L4A A;  2X4H A;  5J8C A;  1D5V A;  4ENN A;  2JPB A;  2QM3 A;  3CUQ A;  2J5O A;  3H92 A;  1ONV A;  4RB1 A;  2IA2 A;  2PN6 A;  3EET A;  1QO0 D;  1R58 A;  1WI9 A;  4KIB A;  4AIJ A;  3HRT A;  2ETH A;  1U3E M;  2W57 A;  2DW4 A;  4AD9 A;  2A61 A;  1JXS A;  2DQR A;  4GXO A;  4EM2 A;  2ADU A;  1HKS A;  4GYG A;  2VXZ A;  5D5V B;  2JT1 A;  3R0A A;  1SD4 A;  1K78 A;  4H0E A;  1W7P D;  2CWE A;  3O2P E;  4PCQ A;  1PDN C;  3VOD A;  2MC3 A;  2NYX A;  2ZME A;  1R1T A;  1MKM A;  4OU0 A;  4RS8 A;  2O61 A;  3K9T A;  3QOP A;  2CFX A;  1P4A A;  1XDU A;  4HV6 A;  1REP C;  3B02 A;  2H09 A;  1FNN A;  1XMA A;  4Y15 A;  3U9G A;  5K5O A;  1B1B A;  2ZO4 A;  3WU0 A;  2YU3 A;  2Q8K A;  4EJW A;  4MTE A;  5HDK A;  1J2X A;  4UVB A;  5K5Q A;  1GVJ A;  1LNW A;  1LB2 A;  1B4A A;  1ZGJ A;  3TOA A;  1XSX A;  3F6V A;  5CLS A;  5A2Q Z;  4B8X A;  2QVO A;  1T0F A;  4IPA A;  5CVU A;  1HXD A;  3F72 A;  2JSC A;  4XBF A;  4L9J A;  3RPQ A;  3Q5F A;  2F5F A;  1OKR A;  1SD7 A;  1UFM A;  5F6F A;  3J81 Z;  1VTN C;  1YW7 A;  3HOT A;  3G73 A;  3E3V A;  5D4R A;  1QZZ A;  4HAM A;  4ESB A;  4HA8 A;  1UHW A;  4KFC A;  3MEX A;  4DNC A;  3PQJ A;  1G4D A;  3W6K B;  2XRN A;  5BQT A;  3BJ6 A;  1LVA A;  1JHF A;  1JE8 A;  4M71 A;  3H3U A;  5HDN A;  1YW9 A;  4R8H A;  1W5S A;  5JHU A;  3E5Q A;  4A5M A;  2P6T A;  4LG0 B;  3BWG A;  2EB7 A;  1DPR A;  1HQC A;  2R7D A;  2EJR A;  4QWQ A;  1FP2 A;  1MJA A;  1Z1D A;  1S7O A;  4A2U A;  2V1D A;  2QQB A;  3J80 Z;  5LLQ A;  3MWM A;  5K5R A;  2OQR A;  5D5W B;  5JR3 A;  5CVR A;  5LRR A;  3CUQ C;  1IN5 A;  1I5Z A;  4GGG A;  2FNP A;  4GO1 A;  3WOD F;  1J5Y A;  1IF1 A;  3DXJ F;  5LGT A;  1BI1 A;  5E8I A;  4I7H A;  4XSZ F;  3KEQ A;  2TDX A;  3ELK A;  2GQQ A;  5DD8 A;  1O3S A;  1F1Z A;  4HZF A;  4RAY A;  2QQ9 A;  1KU9 A;  1YQA A;  1O3T A;  2M87 A;  3ABT A;  3WTZ A;  1R00 A;  3C7J A;  1ON2 A;  3M8F A;  4M9Z A;  4A12 A;  4ESJ A;  3GO5 A;  3E5X A;  1E2X A;  1T38 A;  4IHT A;  3RTR A;  1W7P B;  2VOP A;  3NQO A;  3LA7 A;  2BV6 A;  3NEU A;  3HRS A;  4OIO F;  3I0T A;  5DCM A;  3QPT A;  2R3S A;  1R5H A;  1BIB A;  1ZRC A;  3WTV C;  5ED4 A;  1H0M A;  4IF4 A;  4N0B A;  5DUK A;  3F23 A;  4A6E A;  3BJA A;  1LDJ A;  2V6C A;  2G7H A;  5HOO A;  1Z6R A;  2NAZ A;  2WWY A;  1DDN A;  3DFG A;  3M9A A;  2V1X A;  2IJL A;  3RYP A;  5L3C A;  4I09 A;  4WCG A;  1DPU A;  5LHG A;  3K2Z A;  4F7Z A;  1HBX G;  3O6B B;  4EJV A;  4BHB A;  3J81 K;  5L3B A;  2R7F A;  5FLX K;  2COM A;  3P7N A;  4LG0 A;  5J8F A;  3KCC A;  3TDU C;  2PBI A;  4N9H A;  1XGM A;  2LDU A;  1G3W A;  1F9N A;  3HYI A;  1LEB A;  1YW8 A;  5IT9 Z;  3KP4 A;  1ULY A;  2DPU A;  4KMF A;  2RKH A;  3T8R A;  1TNS A;  4L9V A;  2XKO A;  4KA4 A;  2YSR A;  1S29 A;  3FZV A;  2XAS A;  4XLN F;  3DF8 A;  3R61 A;  4WF2 A;  4M6X A;  1O57 A;  4OIR F;  3TOB A;  3EUH A;  2W25 A;  2OZ6 A;  2PQ8 A;  3CJN A;  3LAJ A;  1XGO A;  4KIC A;  1RZ4 A;  6PAX A;  2Q0O A;  1T6S A;  3F21 A;  3ISP A;  2OD5 A;  4U7D A;  3KEO A;  4HOB A;  4ENK A;  4RAZ A;  3MFK A;  5L3E A;  2O3F A;  2RQP A;  3ZPL A;  4RB3 C;  2FNA A;  5LGU A;  4LB6 B;  4MEX F;  2Z99 A;  3WE3 A;  3I59 A;  3HRM A;  3GF2 A;  1MJB A;  2HKX A;  1R1V A;  3E6M A;  4M9X A;  1FP1 D;  1TQI A;  3BRO A;  2EFO A;  5LGN A;  3CDH A;  3LA3 A;  4ETS A;  1IRG A;  2UWM A;  4AWX B;  2HQN A;  1ZGA A;  4I2O A;  1FSE A;  3V8J A;  2RN7 A;  4P9U A;  2HDC A;  2HFH A;  1P4X A;  3WGG A;  1D8K A;  3CUO A;  1W7P A;  1OYW A;  2C6Y A;  2IP2 A;  1YG2 A;  3ULQ B;  4BQA A;  1J59 A;  4MHG A;  4I01 A;  4E70 A;  1B9M A;  2QLZ A;  4AIH A;  3SFZ A;  2DLL A;  4R1H A;  3RKY A;  2L01 A;  3ZMS A;  2P8T A;  2ZJ2 A;  2ZBK A;  4MGR A;  4HDV A;  3PQK A;  3B73 A;  5K1Y A;  1T39 A;  1BBY A;  4IRG A;  3D5L A;  3DQV C;  2HZT A;  3EYY A;  2BBY A;  1IN6 A;  4KIG A;  4IXA A;  3L7W A;  1USS A;  3IRR A;  3C3W A;  3MZH A;  2F2E A;  2QEN A;  1HW1 A;  5JVT A;  1XGN A;  2MH2 A;  1T2K A;  5ILU A;  3ZMZ A;  2RC4 A;  3QP5 A;  1ZRE A;  1S3J A;  4RGU A;  5ICE A;  3F3X A;  3Q9V A;  1ZAO A;  3I58 A;  5FD5 A;  3BPX A;  3BJO A;  4M9S A;  2HTS A;  5JI6 A;  4NHJ A;  1U8R A;  1Z91 A;  4WXD A;  3T1B A;  1RIO H;  2YX4 A;  1G3Y A;  3JAM K;  1J7K A;  2V1U A;  1KQ8 A;  1TNT A;  1NHA A;  5E1W A;  1A04 A;  2RVC A;  4L0Z B;  4IJA A;  2KIF A;  1SFE A;  1FT9 A;  1XSV A;  3VFZ A;  5LEK A;  2Z5U A;  1U5T C;  1XMK A;  4I0B A;  4BHC A;  5HLH A;  1BOA A;  3DEU A;  1P2F A;  5A2Q K;  4EGY A;  1IXS B;  2CW0 F;  3N97 A;  2H6C A;  2RNJ A;  1OYY A;  5FB2 A;  2CSO A;  5BPD A;  1CF7 A;  4HQE A;  4P55 A;  3WE2 A;  2G7U A;  1OPC A;  2NNY A;  2P5K A;  3KZY A;  3HIF A;  1ZYR F;  2A3S A;  4PDK A;  1P92 A;  3HTS B;  1RUN A;  4O5V A;  1U2W A;  5FO5 A;  2JRT A;  2FOK A;  3VOE A;  1IXR C;  3U2R A;  4LMY A;  2VOD A;  3FXR A;  1GXQ A;  2IW5 A;  3QAH A;  1IN7 A;  2DK8 A;  4UHT A;  3HHG A;  4NQW A;  3I5U A;  3F8F A;  3GYH X;  1WRJ A;  1V3F A;  3IWF A;  2CO5 A;  2XAQ A;  4PZJ A;  2CG4 A;  3JW4 A;  1KYZ A;  4EJO A;  3ZN0 A;  2FBH A;  2XAJ A;  2CYY A;  2XUB A;  1QNT A;  1KU7 A;  3ECO A;  4S04 A;  1I6X A;  2Z3Y A;  5HS9 A;  5H6Q A;  2JZY A;  5D4S A;  4FT8 A;  2FE3 A;  3PFI A;  3GUD A;  3R0J A;  2FBI A;  5IT9 K;  3TGN A;  4CYD A;  3WTW C;  5L3G A;  3QRF F;  3QU3 A;  5ILS A;  3H3Z A;  4FHT A;  3RDI A;  4CIC A;  4ZZD A;  1FBS A;  3ZMV A;  1XB4 A;  1D8J A;  3F6O A;  1ZG5 A;  2WV0 A;  1GXP A;  5ERI A;  2ISZ A;  5H20 A;  3FMQ A;  1BC7 C;  1HSJ A;  2OU2 A;  3BZ6 A;  1H9T A;  1R22 A;  3ECH A;  2CQK A;  1I27 A;  2VC0 A;  2VT3 A;  4YFK F;  5FGM A;  3L9F A;  3F8C A;  1QQI A;  5DV5 A;  4JK1 X;  2FML A;  3ZP5 A;  3GXO A;  2AXL A;  5FFZ A;  4YIF A;  2OBP A;  5DUI A;  1RNL A;  5DDG A;  2UZK A;  1TBX A;  4ENJ A;  4L18 B;  3ABU A;  1C0W A;  2PFB A;  1TW3 A;  2A6H F;  3KZZ A;  1G3S A;  1YIO A;  4K2E A;  3GWZ A;  2VBY A;  5ICG A;  1G3T A;  2XRO A;  3FX3 A;  2DU9 A;  2L3D A;  2E1N A;  1FWZ A;  2ESH A;  4LJZ F;  1UB9 A;  4O6J A;  3WGI A;  4EVI A;  3I53 A;  4RGS A;  2IPQ X;  2D1V A;  1EH7 A;  4HYE A;  5JFR A;  1R7J A;  2NRA C;  3VB2 A;  4S05 A;  3HTU A;  3FF5 A;  1ZN2 A;  4A5N A;  2O0Y A;  2UXN A;  3FMR A;  5TJJ A;  2PEX A;  3ERE D;  2ESN A;  5HLG A;  1DP7 P;  3C18 A;  4OOI A;  5FD6 A;  2QZ8 A;  4YG2 F;  3OOP A;  3C1D A;  2EV5 A;  5L3D A;  2DQL A;  1MJ9 A;  4G6D A;  1ZLK A;  3JSO A;  4XSX F;  3GEZ A;  2BGC A;  4KUM A;  2LF8 A;  3K0L A;  3LST A;  5KVR A;  3S2W A;  3J7A O;  4JQF A;  3FMS A;  3E6B A;  3BPV A;  3GZ6 A;  3GZ5 A;  3TO6 A;  1U5T B;  1UHM A;  4L9N A;  4OIQ F;  2A69 F;  3HOS A;  2DO7 A;  3WU1 B;  2UXX A;  3FM5 A;  2HQR A;  4OIP F;  3T0Y A;  2EV6 A;  2XAG A;  1FC3 A;  5E17 F;  1ZG3 A;  3MCZ A;  5CYV A;  2FU4 A;  3JTH A;  3RIR A;  2RGV A;  2EWN A;  3J80 K;  4HF2 A;  2ZKZ A;  3CLO A;  2YR2 A;  1YFH A;  2EFQ A;  2OA4 A;  1HST A;  1PUE E;  1AOY A;  1Z7U A;  3DPT A;  4IRI A;  1PP8 F;  3I4P A;  1KQ0 A;  1XSD A;  3KLO A;  4UUV A;  4HW0 A;  3ML6 A;  1STZ A;  4UV9 A;  2JTV A;  2K7L A;  3F22 A;  3N4M A;  3JAM Z;  3TO9 A;  3G3Z A;  4UVA A;  3RKX A;  3Q9S A;  1KA8 A;  3RYR A;  4BNC A;  1JGS A;  2HWV A;  3M1E A;  1KQ9 A;  2E7X A;  2MLK A;  2A6E F;  1H9G A;  5D6F A;  2KJB A;  1XCB A;  2NS0 A;  3M8E A;  3IL2 A;  1G6N A;  5LHH A;  2QUF A;  4LB5 A;  2IRF G;  2MD5 A;  1TTY A;  4HF0 A;  4HF1 A;  3FXQ A;  1YLF A;  3WTS C;  3HSE A;  2XAH A;  4LK0 F;  5DCF A;  4KN7 X;  2PG4 A;  5LHI A;  1ZAR A;  5EEH A;  3V4G A;  4EV0 A;  4IHS A;  1QZY A;  3TO7 A;  4WXH A;  3EQL F;  1WKM A;  2ZFW A;  2PMH A;  4LLG F;  5F1R A;  1YS7 A;  4PGH A;  5ICF A;  4LGW A;  5LEJ A;  3ZMU A;  3ZMD A;  1XD7 A;  4XLP F;  4UXN A;  2WTE A;  3CTA A;  4MQ9 F;  4B09 A;  4CO8 A;  4EGZ A;  2XKP A;  1HKQ A;  3L00 A;  2QYO A;  4RGR A;  3HUG A;  1J0R A;  1CF7 B;  4L9T A;  3QP6 A;  1R23 A;  3SHF A;  2Q2E A;  4U0V A;  2XHK A;  4OMZ A;  2M45 A;  4UNO A;  1QPM A;  4G8X A;  1D3Y A;  3HSR A;  3HSF A;  4CXF A;  1O3R A;  5F64 A;  4G6Q A;  2K4B A;  2XIG A;  3I64 A;  2L4M A;  4M72 A;  2STW A;  1Y0U A;  1YYV A;  2P4W A;  2XV4 S;  2GA1 A;  3DKW A;  1TQP A;  2GZW A;  2QQA A;  2VOO A;  4KT5 C;  1FBQ A;  2JPC A;  3W6J B;  1P4W A;  1IRF A;  4L5J A;  5BMZ A;  1B6A A;  4EJT A;  1R36 A;  5EEG A;  1T98 A;  3JTG A;  2GXB A;  1GHC A;  1E17 A; 
#chains in the Genus database with same CATH topology
 4E7H A;  1OCC H;  2HPI A;  1HCR A;  1IGN A;  1MD0 A;  1WGX A;  2WC2 A;  5KK1 A;  1MGT A;  3F8N A;  3KLN A;  4JOM A;  3BP8 A;  2ELH A;  4MLO A;  1FZP B;  4MFD A;  1Y0N A;  3GLX A;  2OJE D;  3AAF A;  2O03 A;  3ZQH A;  4U88 A;  1YRN B;  1JHH A;  3OS0 A;  2BY1 A;  2V1N A;  2W24 A;  3HGY A;  4DQ2 A;  3WG9 A;  5FLM J;  1RR8 C;  1PJR A;  3SEQ A;  2EFN A;  4I0A A;  1SFX A;  2FQ3 A;  2MD0 A;  3H36 A;  3V7S A;  2LF7 A;  5DM7 F;  1BC8 C;  4G7H F;  4II2 A;  3ZMT A;  2NVY J;  4MTD A;  1XPX A;  1F43 A;  2GAU A;  2X1E A;  4OIN F;  1L3L A;  5C3E J;  4KT6 A;  4MFE A;  3UKG A;  2LG4 A;  2K27 A;  4B3X A;  2OAZ A;  2VQC A;  1HDP A;  1ZH5 A;  2FEZ A;  2H27 A;  5LRS A;  1WJB A;  3COA C;  4HDU A;  4GCV A;  4BH9 A;  2R4G A;  4ZTJ A;  1MBH A;  4M3D A;  3K69 A;  5EYR A;  3I71 A;  2CGP A;  1RC9 A;  1NH3 A;  1ZG1 A;  5EEA A;  3PFY A;  3TDZ C;  3GTK J;  2CV2 A;  1TW2 A;  4P9F A;  4Y7N J;  1X3Z B;  1TT0 A;  5AIQ A;  1X1D A;  2AQE A;  2DFH A;  1I3Q J;  2FBK A;  5HDG A;  4CCN A;  4IX7 A;  1R1U A;  2MFZ A;  3HJE A;  2RAE A;  3OYJ A;  2VLA A;  2HOE A;  2EBI A;  3RQ4 A;  2CMP A;  2V79 A;  2ISY A;  2KKO A;  3HRU A;  3SXY A;  2OQG A;  4AYB A;  1YIJ I;  4E7J A;  2NS7 A;  2AO9 A;  1MZB A;  2LTP A;  2JA8 J;  5J1U A;  1MDM A;  1U9O A;  2ZFU A;  4I98 B;  4YII A;  1JTX A;  1BJA A;  4XKV A;  2Y9Y A;  2M0C A;  2JWT A;  5IYB J;  4ZYG A;  3ZQG A;  3A0H C;  4Z2Y A;  3KEY A;  3H0D A;  4D5C A;  2LKX A;  4L0Y B;  2E60 A;  4CYC B;  4JX6 A;  1WH7 A;  1O7F A;  1W5T A;  1ZRD A;  5F08 A;  4A3G J;  4KMU X;  4QLC U;  2HTJ A;  3GTO J;  2QBY A;  4NC6 A;  1WJD A;  5IT3 A;  4XKC A;  3K1P A;  4CA0 A;  2VT2 A;  4KNY A;  2E1C A;  2JRM A;  4AM3 A;  3WTY C;  5CVJ A;  2K9N A;  5B66 C;  3HOY J;  2WAD A;  5CQE A;  2CUZ A;  3TMO A;  1A6I A;  5GTI C;  3FM3 A;  3QU6 A;  4M6V A;  2VKH A;  4EEF G;  2EK5 A;  5E1Z B;  5J6X A;  3TQN A;  1X4O A;  3I59 B;  1HKT A;  2QA4 I;  1WVR A;  1YIT I;  2EQR A;  2M8G X;  1FYK A;  4AVP A;  4EM0 B;  2QKM B;  4CCM A;  3W2A A;  1Z05 A;  1R4N B;  5LBQ A;  2GA2 A;  5B1A H;  1L0O C;  2ZNY A;  3AFH A;  2VN2 A;  2F5D A;  4P5O A;  4P1W A;  3OYN A;  3SJM A;  2VBW A;  1KYW A;  3CUQ B;  3S3M A;  2PLY A;  3S16 J;  5M5Y J;  5EDN A;  1A35 A;  3FIS A;  1W36 D;  3K70 D;  2F4O B;  2P5V A;  3OWT A;  5IY5 H;  3TP3 A;  3OYA A;  4EMS A;  1UST A;  4NDL A;  2MYS A;  5F0H A;  4UUS A;  3OS1 A;  3U21 A;  1S9H A;  3CC7 I;  2Z16 A;  3M7G A;  3HHH A;  5IYD J;  1U5T A;  2CRG A;  5E8G A;  3CC2 I;  2QCO A;  3CCL I;  5ICC A;  4FAS D;  3QPH A;  2XAF A;  4LFU A;  1K79 A;  1ZGW A;  4UV8 A;  4NQW B;  3HL2 A;  2GXG A;  1CQT A;  4HLY A;  5BS6 A;  2DMQ A;  5BOX A;  3CZ6 A;  3I9V 2;  3DP7 A;  4A3K J;  2VBX A;  3CCJ I;  2LNB A;  2OPT A;  3Q0V A;  1IO2 A;  2H94 A;  3ZXS A;  4RB0 A;  1P6R A;  3PNY A;  2EA2 A;  3FKI J;  3EYI A;  3F8B A;  1LFB A;  1I6H J;  2GIV A;  2IVM A;  3C2G A;  3JRD A;  2P7V B;  3HPG A;  1MMS A;  2DOA A;  1P7J A;  1EA3 A;  3GFI A;  4LIV A;  2MH9 A;  1POG A;  3WHB A;  1Y56 A;  4XRM A;  4RB2 C;  4UVC A;  4V19 K;  5TRD A;  1XCV A;  1BI0 A;  1HW5 A;  2FXA A;  2VJJ A;  1PUF B;  4G7O F;  3L2Q A;  4CCO A;  2KIU A;  3CP2 A;  4Y52 J;  1SEU A;  4I76 A;  2V26 A;  4PSW A;  4IZZ A;  3ASN H;  5AIP A;  3CO7 C;  1AWC A;  3HKZ A;  3REO A;  1OCR H;  2HR3 A;  2DOF A;  3CMA I;  5CJ9 A;  3VEP A;  1PUF A;  4M74 A;  3OIQ A;  2JA7 J;  1YO5 C;  3V7R A;  3KE2 A;  1VQ5 I;  1EH6 A;  4TV7 A;  3S2D J;  2L9S A;  4ASN A;  2FF4 A;  1SMT A;  2VE8 A;  1IW7 F;  3J7Y J;  4A3M J;  1DU6 A;  3LSR A;  4NC7 A;  4XLA A;  1PP7 U;  2V9V A;  1E3O C;  3HDD A;  2FUG 2;  3GCM A;  1O7L A;  4FET A;  1R5I D;  3GLL A;  2LLK A;  2D2W A;  3NRV A;  2XF6 A;  2HYG D;  3P9I A;  3ROU A;  3HGG A;  4ANJ A;  1SAX A;  4BXX J;  3U1D A;  2WBM A;  3BTC A;  3IKV A;  1DUX C;  2XRL A;  4QSH A;  1X1C A;  4CZZ A;  1CGP A;  1TQM A;  4RLQ A;  4S0H B;  3VYU B;  4Z6Y A;  3OV8 A;  2EIL H;  3O3K A;  2E2H J;  4IKF A;  2G9W A;  1V5G A;  4A3I J;  4M3E A;  3R60 A;  4G94 A;  5E1X A;  2K9S A;  2VBZ A;  1IJW C;  2IS4 A;  2EFP A;  3RJP A;  3WGH A;  3E1S A;  3QWL A;  1XDS A;  4PGG A;  3BR1 A;  3BY6 A;  3K7A J;  1FSH A;  2X0L A;  1YS6 A;  4WXC A;  5DEQ A;  4XRF A;  5HNH A;  4DOZ A;  3ZN1 A;  3RZO J;  2R7W A;  3KP3 A;  3L2R A;  3MKY B;  2Y75 A;  1U78 A;  1MH3 A;  2NOJ B;  3IC7 A;  1DGW Y;  1NG6 A;  3T5X A;  1S8N A;  5H6R A;  1ZHF A;  1ZLJ A;  3BCA A;  4LLL A;  4L5I A;  1NK3 P;  4Q48 A;  1IUF A;  1LEA A;  3R6S A;  1D5Y A;  2HEO A;  4A6D A;  2X1D A;  2GIZ A;  4CGZ A;  1B59 A;  2L5Q A;  3KET A;  2BHZ A;  3L2C A;  3DPL C;  2MC4 A;  2PI0 A;  1EH8 A;  1Z6T A;  3AL0 C;  4HLX A;  2IA1 A;  2EIN H;  1BR4 A;  3E6D A;  5FRO A;  3JRB A;  3BR3 A;  5HS8 A;  2QKL B;  2ZME B;  2DYR H;  5D8L B;  2AS5 F;  3TKY A;  1RET A;  2F5C A;  5HS7 A;  1AA7 A;  3BOQ A;  4O3M A;  3P9C A;  1BIA A;  2EA4 A;  2NVT J;  1IUY A;  2E71 A;  3FXU A;  3KP6 A;  3SZP A;  1FYM A;  5DCM B;  2IS6 A;  3K1M A;  3RPU D;  4I6Z A;  3ZQQ A;  1YX3 A;  3F0C A;  4XN0 A;  1N77 A;  2E1O A;  4XMY A;  2M9H A;  4I02 A;  3PIO F;  1BI2 A;  1XN7 A;  3V7C A;  5IP7 J;  1S72 I;  4RGX A;  4G9Y A;  1DGR M;  3CD6 I;  2HXI A;  4XOP A;  1SFK A;  1X3U A;  1VQN I;  2ID3 A;  5F27 A;  3HOV J;  1WFX A;  1FLI A;  4BBR J;  5HOD A;  5E18 F;  2CH0 A;  1SMY F;  3SDG A;  1O3Q A;  4G7Z F;  2FMY A;  2Y0M A;  2R5Y A;  4UUS B;  1F4K A;  3IWZ A;  3O8G A;  1IAW A;  1ZK8 A;  4IHV A;  3GFL A;  2KRF A;  4A3D J;  2NNN A;  3SZT A;  4X6A J;  4GYI A;  5D8K B;  2R7R A;  2KLO A;  2KQR A;  2GOX B;  2LSO A;  3MQ0 A;  2RV8 A;  1RUO A;  2Y30 A;  5L3F A;  1LJ9 A;  2GWR A;  1VI0 A;  5F0C A;  4BXU A;  2HYF A;  1QGP A;  3BZK A;  2W84 A;  3KX2 A;  1FOK A;  3FWE A;  2UUZ A;  4BL0 B;  1MMG A;  1K4T A;  2O8X A;  1FPQ A;  4A3L J;  5DYM A;  2IA0 A;  1RI7 A;  1EV7 A;  4A0X A;  3GTQ J;  1LDD A;  2M5W A;  2ZJR F;  3E5U A;  3DTK A;  5E20 A;  3BG6 A;  4U0W A;  3NWT A;  3ABK H;  2P7C B;  3LQQ A;  1FYL A;  1ACI A;  4BUP A;  2ZB9 A;  3GW2 A;  3K4C A;  2RDP A;  3AKZ A;  2WAQ N;  4MQV A;  2XVC A;  3BG5 A;  4MEY F;  2QBY B;  3WTU C;  4B43 A;  3RKQ A;  3R4K A;  1D1C A;  2OZU A;  3LFK A;  1VQ6 I;  2W85 A;  4Q47 A;  3E97 A;  1YRN A;  4ENM A;  1S5L C;  4V2F A;  1I3A A;  1N75 A;  2BXY A;  1A31 A;  1Y8Q B;  1X19 A;  2XAU A;  2Q2E B;  1I1G A;  1YOV B;  1WSU A;  2XGX A;  1JKQ C;  4L5E A;  2E34 A;  1NTC A;  1IV8 A;  3U1K A;  5J3L A;  3K70 C;  2E5Z A;  4BQQ A;  3MZY A;  1OCZ H;  4Q4Z F;  1HW2 A;  4NB5 A;  3CQZ J;  3DBL B;  4IRH A;  1LDK B;  2Y2Z A;  2R7S A;  1XGS A;  3DLA A;  1UHS A;  3LA2 A;  1S7E A;  2HQ5 A;  4E7I A;  2L02 A;  2MSY A;  3H1C A;  3E6C C;  1JJ6 C;  2FOW A;  4HX7 A;  4LIU A;  1OMI A;  3GFM A;  2EZL A;  2YX7 A;  2QSF X;  2YPR A;  1SVO A;  5C4J J;  3ZQL A;  2A68 F;  2K3P A;  3I54 A;  3T8T A;  1J9I A;  3AL0 B;  2MA3 A;  4A0Y A;  4BAY A;  3HOW J;  3I4M J;  2DK5 A;  2X1C A;  1EJ9 A;  3LAP A;  3OOU A;  4C3H J;  3H3V K;  1TWC J;  1KU3 A;  2D1H A;  2NXN B;  2HPM A;  3D0S A;  3AG2 H;  3CCY A;  2ZXJ A;  1IZ1 A;  2BEO A;  3CLQ A;  4IOC F;  2LVS A;  2TCT A;  3V8L A;  2LP0 A;  5FKO A;  4U0Y A;  3F8M A;  3OYL A;  2DAO A;  4EJU A;  5CVI A;  1ODD A;  1SAU A;  2Z1D A;  3CES A;  3LSP A;  2BZT A;  2VE9 A;  3RKW A;  1R5G A;  4WK8 F;  1BM9 A;  2VI6 A;  4A93 J;  1W4M A;  4XOR A;  2B0L A;  1JTY A;  2LH9 A;  3S15 J;  3ASO H;  3M4O J;  1VQP I;  4XON A;  3KP5 A;  2L7M P;  3KYD B;  2EIM H;  4KN4 X;  4ZYE A;  2R93 J;  1W36 C;  4HQM A;  2G0E A;  3CJT B;  1IC8 A;  4M6Y A;  1V4R A;  5D5X B;  3VWB A;  2Z9O A;  4GDF A;  1S6L A;  4KIF A;  3EUK L;  2K9L A;  4FX0 A;  4HST A;  2F48 A;  3KP2 A;  1QA6 A;  2DBB A;  4BHP A;  2DI3 A;  4XLC A;  2HGC A;  5KAF C;  1F5T A;  4HV5 A;  1Q1V A;  4AIK A;  3MAJ A;  3PSI A;  2KIM A;  2L54 A;  1WWX A;  1KZH A;  4WX9 A;  5D6E A;  3JSP A;  2ACJ A;  2I10 A;  3WTX C;  4IHW A;  1OJL A;  2H1L A;  1KU2 A;  1ON1 A;  1TP4 A;  3S8P A;  2DT5 A;  3D5R C;  2EV0 A;  4LK1 F;  4A0Z A;  2ZCW A;  3SQN A;  2STT A;  4OAY A;  3GVA A;  2FA5 A;  3CO6 C;  3DV8 A;  2EFW A;  3A02 A;  4EQQ A;  4CSW A;  4MNU A;  1SFU A;  5GPC A;  2DTR A;  2CV1 A;  3CCM I;  3RI4 A;  1N78 A;  5F04 A;  3L2U A;  1FY7 A;  2W4S A;  2ECB A;  2HS5 A;  3IHU A;  4FX4 A;  3PNT A;  5GAG J;  2JUC A;  3KFW X;  3KPH A;  1IXC A;  2DPD A;  3GTG J;  4Q5S F;  3TP0 A;  1ETO A;  3IRQ A;  3G2B A;  2NVQ J;  2L9V A;  4KYW A;  3QPL A;  1K78 B;  4IVN A;  1J75 A;  1S7A A;  5HLT A;  1JI8 A;  3O8H A;  4ZDP A;  1E3H A;  1K6O A;  5FLX Z;  3LL7 A;  3EDP A;  4CDG A;  3OMY A;  1BI3 A;  3QOE A;  3GFJ A;  2J5P A;  2M1B A;  2BYV E;  3GBG A;  3GTL J;  1HF0 A;  3TW7 A;  5EZH A;  3G71 I;  4RMN A;  3BC8 A;  2OTL I;  1D1A A;  1IN8 A;  4C9Y A;  3ERM A;  2HKO A;  1SD5 A;  2BOL A;  4YFX F;  2FRH A;  1U6G A;  1IN4 A;  3BG9 A;  1FBU A;  3GTJ J;  2ZNZ A;  4D0P A;  3VYT B;  5BPI A;  1Z9C A;  3CC4 I;  4LD5 A;  2O6G E;  1HA8 A;  1UAA A;  2XF5 A;  2E19 A;  2M4G A;  3OYK A;  4JBA A;  3BDD A;  3BCB A;  3H0G J;  2Y69 H;  4HX8 A;  4EAT A;  4Y17 A;  2ECC A;  5ILV A;  2MLG A;  2QWW A;  4OMY A;  1LFU P;  2H6B A;  1Y1V J;  2A5Y B;  4D1Q A;  2M30 A;  1V5E A;  1ZR4 A;  1I1S A;  2D45 A;  1OR7 A;  3L09 A;  2P6S A;  1ZKG A;  2DFI A;  3FXL A;  1OYI A;  2VKE A;  1BR2 A;  3OR1 C;  2Y31 A;  1B9N A;  2X6W A;  2BE5 F;  3HM5 A;  2EH3 A;  2M8E A;  2K02 A;  2EPF A;  3K4B A;  4JX4 A;  3JRA A;  3RPU A;  1YE9 A;  4F92 B;  5DD4 A;  1ORK A;  2PMU A;  4UB6 C;  2O7O A;  4YFN F;  3ABL H;  1KGS A;  1VQK I;  2F4M B;  3S1Q J;  5HLI A;  4R79 A;  2KDZ A;  3WTT C;  4LLN A;  4N9I A;  1KON A;  1E0E A;  3LWF A;  1VQ4 I;  1BN5 A;  4DBQ A;  3GX4 X;  3ZR8 X;  3BR2 A;  2LKP A;  2HDD A;  2XGD A;  1YX5 A;  2LC2 A;  4IO9 F;  1A36 A;  3DWL E;  4Y13 A;  2E7W A;  2FSW A;  3DTE A;  1Q1H A;  1TLH B;  4U7B A;  1MBG A;  3KP7 A;  2QEX I;  2P5L C;  1YTY A;  4EM1 A;  4ESF A;  4HBL A;  4C30 A;  3L2V A;  5B3S H;  1MDM B;  1QBJ A;  1VQ7 I;  4WWC A;  4M73 A;  2LY9 A;  2V9K A;  2W00 A;  2A07 F;  2KP6 A;  2XPU A;  4PFP A;  5AON A;  2Z33 A;  2Y9Z A;  5DTD A;  3C2B A;  4P96 A;  2KJC A;  5KAI C;  2VJI A;  2MBF A;  4ZH4 F;  3FHZ A;  9ANT A;  2I8D A;  2L7Z A;  4PJL A;  4ZYD A;  3IKT A;  2TRT A;  1P7I A;  2F5E A;  3K1N A;  2WB1 A;  4BYY A;  3JRI A;  1SD6 A;  2DA2 A;  2KRH A;  3HBL A;  2DMP A;  2IT0 A;  2EZH A;  5D5U B;  2VON A;  5J1R A;  1T0F C;  3DEW A;  3P9K A;  3V8K A;  3ZQ7 A;  1IDZ A;  2Y48 A;  1LQ1 A;  1IV6 A;  1UCR A;  4ON0 A;  3IAM 2;  1K7A A;  1FOX A;  5FFX A;  1ENH A;  1BW5 A;  2H1K A;  4ZYH A;  1ZRF A;  3K4N A;  1FX7 A;  3K10 A;  5CVV A;  4ZZL A;  4KDP A;  5HVQ C;  2LBF A;  1HDD C;  2VC1 A;  2BXZ A;  1IG7 A;  4UUT A;  2PJP A;  2K86 A;  5B5E C;  2K4J A;  1GUU A;  3LQR A;  4HX4 A;  5EF6 A;  3BG7 A;  1WQ2 A;  2ZSH B;  2L4A A;  2X4H A;  5J8C A;  1D5V A;  4Y3O A;  4ENN A;  4PFO A;  2E36 A;  2JPB A;  2QM3 A;  4ZC3 A;  3CUQ A;  2J5O A;  3H92 A;  2DTZ A;  2NVX J;  1MMD A;  4V2G A;  1ONV A;  5K7F A;  4RB1 A;  2LY1 A;  2IA2 A;  3CDL A;  4F55 A;  2PN6 A;  3EET A;  1QO0 D;  1FEX A;  1R58 A;  1ETK A;  1WI9 A;  3N05 A;  3VYS B;  2GXA A;  1Z67 A;  4KIB A;  2LKS A;  4AIJ A;  3HRT A;  3D1N I;  2ETH A;  4II3 A;  1U3E M;  4E7K A;  2W57 A;  3G1O A;  2DDA A;  2XB0 X;  4ITV A;  1WZ2 A;  2DA1 A;  1P9Q C;  4M3G A;  2DW4 A;  4AD9 A;  1A5J A;  1QVT A;  2A61 A;  1JXS A;  3HOX J;  4J00 A;  2DQR A;  4GXO A;  1EKE A;  4EM2 A;  2ADU A;  1HKS A;  3PNV A;  4GYG A;  2NS8 A;  2VXZ A;  2E2I J;  2DMU A;  4BY1 J;  5D5V B;  3DU5 A;  2JT1 A;  4ABZ A;  3R0A A;  3CJQ B;  1SD4 A;  2DMN A;  1RES A;  1K78 A;  4H0E A;  1W7P D;  2CWE A;  1G2H A;  4RDU A;  3O2P E;  4PCQ A;  4DYR A;  1MMN A;  3A01 A;  2ZJP F;  1PDN C;  1ETX A;  4IHY A;  3OIP A;  1TC3 C;  3HEF A;  3VOD A;  2MC3 A;  2NYX A;  4JX5 A;  4E7S A;  2ZME A;  1R1T A;  1MKM A;  2M7A A;  3CDI A;  4OU0 A;  1MBK A;  4RS8 A;  2O61 A;  3HPH A;  4XQF A;  3K9T A;  4AUX A;  5GPA A;  3IH2 A;  3QOP A;  3FK6 A;  4D9J A;  1P4A A;  2CFX A;  4ZDL A;  2V7F A;  3ZQF A;  3QQA A;  1XDU A;  2BHY A;  2B7E A;  4HV6 A;  1X1A A;  3S3N A;  1REP C;  3B02 A;  2H09 A;  1MNE A;  1FNN A;  4XOT A;  1XMA A;  4Y15 A;  1O4X A;  3U9G A;  1VQ8 I;  2DJI A;  5K5O A;  1B1B A;  2L2O A;  4KJZ A;  2VKD A;  4HNT A;  2EZI A;  4D7N A;  2ZO4 A;  1XX5 A;  2DT6 A;  3WU0 A;  3QYB A;  2YU3 A;  2Q8K A;  4EJW A;  4MTE A;  5HDK A;  1WI3 A;  1J2X A;  4NNJ A;  4UVB A;  5IOZ A;  5K5Q A;  1GVJ A;  1ZQ3 P;  3FK7 A;  1LNW A;  2WB1 N;  4E6K G;  1LB2 A;  1B4A A;  4A3J J;  1ZGJ A;  3TOA A;  1XSX A;  3F6V A;  1ITY A;  5CLS A;  5A2Q Z;  4B8X A;  2BW3 A;  1SFO J;  2K3F A;  2LK2 A;  3HKZ N;  2QVO A;  1T0F A;  4IPA A;  5CVU A;  2R7Z J;  3C2H A;  1K4S A;  1HXD A;  4BAC A;  3F72 A;  2JSC A;  2DN0 A;  4BQN A;  1JKP C;  4BE0 A;  4XBF A;  4L9J A;  3RPQ A;  5FRM A;  3Q5F A;  1OIS A;  2F5F A;  4XLF A;  1OKR A;  1SD7 A;  1UFM A;  5F6F A;  3J81 Z;  1VTN C;  4J01 A;  3I4N J;  2A05 A;  1YW7 A;  4DZJ A;  3HOT A;  5M5X J;  2O9L A;  3E3V A;  3G73 A;  5D4R A;  1QZZ A;  4HAM A;  2LOO A;  2KIQ A;  3A03 A;  4ESB A;  4HA8 A;  1UHW A;  4KFC A;  3MEX A;  5J40 A;  4DNC A;  2ME0 A;  3PQJ A;  1G4D A;  3W6K B;  2HVQ A;  2UV1 A;  2XRN A;  4PJ0 C;  5BQT A;  3PL8 A;  4LOC A;  3BJ6 A;  4ZYA A;  1LVA A;  1JHF A;  3G1M A;  1WJ5 A;  5KCM A;  1SVM A;  1JE8 A;  4M71 A;  4PJN A;  1Y39 A;  2W1O A;  4YIR X;  3H3U A;  5HDN A;  1YW9 A;  4R8H A;  1EF4 A;  1W5S A;  2M3A A;  5J4Y A;  5JHU A;  3E5Q A;  3RZD J;  4A5M A;  3E0J B;  1TT5 B;  3SZG A;  3MN2 A;  2P6T A;  4IHX A;  4LG0 B;  3BWG A;  1OCO H;  1Z77 A;  3K4K A;  2EB7 A;  1RRJ A;  1DPR A;  1HQC A;  1Z21 A;  3H9G A;  4BDY A;  4PUS A;  2R7D A;  3VYR B;  4Y33 A;  5FKM A;  2EJR A;  1ETY A;  4QWQ A;  4BE1 A;  4RM2 A;  1FP2 A;  1MJA A;  2JN6 A;  1Z1D A;  3S14 J;  3H9J A;  1S7O A;  4C2M J;  4A2U A;  5FRN A;  1FJL A;  3BTL A;  4B44 A;  1AKH A;  2V1D A;  2QQB A;  3J80 Z;  5LLQ A;  3MWM A;  5K5R A;  2OQR A;  5D5W B;  3UNG C;  2K5C A;  5JR3 A;  5CVR A;  3CUQ C;  1IN5 A;  1I5Z A;  5LRR A;  2VJ4 A;  1QPI A;  4ZJZ A;  4GGG A;  2K9Q A;  2FNP A;  4GO1 A;  3WOD F;  5IP6 A;  1J5Y A;  4FQG A;  1IF1 A;  3DXJ F;  5LGT A;  1BI1 A;  5E8I A;  4I7H A;  4XSZ F;  3KEQ A;  2TDX A;  4YEL A;  1MH4 A;  1K83 J;  3ELK A;  2F6C A;  5JLW A;  2RRE A;  1HC8 A;  2OV7 A;  2GQQ A;  5DD8 A;  2IGK A;  2O8K A;  1O3S A;  2LY2 A;  2CU7 A;  4LG3 A;  1F1Z A;  1VQM I;  4HZF A;  4RAY A;  2QQ9 A;  4GRI A;  2L7F P;  2M4K A;  1E3P A;  3BR0 A;  1T95 A;  1KU9 A;  1YQA A;  5CKT A;  2M87 A;  3ABT A;  1O3T A;  3WTZ A;  1R00 A;  1MW7 A;  5H2F C;  3C7J A;  1ON2 A;  2DA5 A;  3M8F A;  4M9Z A;  2DA4 A;  4A12 A;  3L1P A;  4ESJ A;  2E5N A;  2HQA A;  3GO5 A;  4BNC A;  3E5X A;  1E2X A;  3WHC A;  1T38 A;  4IHT A;  3RTR A;  1W7P B;  2VOP A;  3NQO A;  3LA7 A;  2VQL A;  1IRX A;  1MSF C;  1IRZ A;  2BV6 A;  3NEU A;  1V5F A;  3HRS A;  3K4J A;  3MKL A;  2DOE A;  4OIO F;  3CCR I;  3I0T A;  1PVE A;  1SVL A;  4HNV A;  2VPR A;  4CH7 A;  5DCM A;  3VSK A;  2IGM A;  3QPT A;  4A3F J;  2XPW A;  3PSF A;  2R3S A;  1R5H A;  1WJA A;  4W1U A;  1T33 A;  2XDV A;  5EG0 A;  4BEH A;  1BIB A;  1OR7 C;  1ZRC A;  3WTV C;  3NAU A;  4RBO A;  2R7T A;  5ED4 A;  1XC5 A;  2EIJ H;  1H0M A;  4IF4 A;  2GOM A;  1ZR2 A;  4N0B A;  2VQG A;  3FBI B;  5DUK A;  4F3Q A;  4OAZ A;  4JP0 A;  3F23 A;  1OLT A;  4A6E A;  3BJA A;  2MW8 A;  2OCC H;  1G59 A;  1MBF A;  1LDJ A;  3BQZ A;  3HOU J;  2DYS H;  2V6C A;  2W82 A;  1M1E B;  2G7H A;  5DS9 A;  5HOO A;  2LRD A;  3FXK A;  4QIW N;  4QPO A;  1Z6R A;  4F91 B;  4RLF A;  2YU9 J;  2NAZ A;  2WWY A;  1DDN A;  3A2K A;  1MBE A;  2IAI A;  3DFG A;  3M9A A;  2V1X A;  4NBQ A;  4MO7 A;  2A6T A;  3VDX A;  2IJL A;  3RYP A;  5L3C A;  3OYE A;  4I09 A;  1Z0X A;  2Z2S B;  4WCG A;  1DPU A;  5LHG A;  2OUM A;  3K2Z A;  4F7Z A;  3JRH A;  3OS2 A;  4DYC A;  1D1B A;  1RKW A;  1HBX G;  1DU0 A;  1VQ9 I;  4XKW A;  3O6B B;  4EJV A;  1U0J A;  4BHB A;  3FDY A;  3J81 K;  5L3B A;  3LSJ A;  2R7F A;  5FLX K;  4OWR B;  2DDB A;  1T56 A;  2COM A;  3P7N A;  4B48 A;  1UJ8 A;  4LG0 A;  2KRC A;  4AYB N;  5J8F A;  4HEA 2;  3HOZ J;  3KCC A;  3KZI C;  3OYM A;  3LMM A;  3TDU C;  2PBI A;  2HOT A;  3HB9 A;  2GBY A;  4N9H A;  5GTH C;  1XGM A;  2LDU A;  4J19 A;  1G3W A;  2R7U A;  5DM6 F;  1F9N A;  3HYI A;  5EJC A;  1Y1W J;  3MKZ A;  1LEB A;  1YW8 A;  5IT9 Z;  5B1B H;  3AG1 H;  3KP4 A;  1ULY A;  2HU9 A;  2DPU A;  5FJ8 J;  1X2N A;  4KMF A;  2RKH A;  3T8R A;  1TNS A;  4L9V A;  1V55 H;  2L7K A;  3LOC A;  2XKO A;  4PK4 A;  4KA4 A;  1LVK A;  2Q1Z B;  4LIT A;  1QU3 A;  4I99 C;  2YSR A;  3EUH C;  2DCE A;  1S29 A;  4XK4 A;  3FZV A;  1MIJ A;  2XAS A;  3PO2 J;  4AC0 A;  4XLN F;  3FHN A;  1MSE C;  2QQ8 A;  3CME I;  3DF8 A;  4D7M A;  3WU2 C;  3MMY B;  3R61 A;  4XN3 A;  4WF2 A;  4M6X A;  3DKY A;  1O57 A;  4OIR F;  2BW3 B;  3TOB A;  3EUH A;  3W2V A;  1R71 A;  1H88 C;  5TGT A;  1Y6I A;  2W25 A;  4XM3 A;  2OZ6 A;  2AHQ A;  2PQ8 A;  3CJN A;  3LAJ A;  1U8B A;  1H89 C;  1XGO A;  3CJR B;  4KIC A;  3OSF A;  4YRV A;  1RZ4 A;  2V4J C;  6PAX A;  2Q0O A;  3UR3 C;  1FMV A;  1T6S A;  4XKB A;  3F21 A;  2W7N A;  3ISP A;  2VQH A;  1JUP A;  2OD5 A;  2VB6 A;  3NWS A;  4U7D A;  3KEO A;  4HOB A;  2ZC2 A;  2FD5 A;  4ENK A;  4RAZ A;  3MFK A;  5L3E A;  2DA7 A;  3VPR A;  3JRG A;  1X1B A;  3A4C A;  2QSH X;  1X2M A;  2O3F A;  2RQP A;  3SEZ A;  3S32 A;  3ZPL A;  1FOW A;  4C3J J;  4RB3 C;  3HZJ A;  3PJR A;  1H8A C;  2CUJ A;  3HUG B;  2FNA A;  5LGU A;  2F5V A;  3DCF A;  3OL3 A;  2VPL A;  5IOY A;  4LB6 B;  1R4M B;  4XIC A;  3OYB A;  2DA3 A;  4MEX F;  2Z99 A;  3WE3 A;  3I59 A;  2XSJ C;  3HRM A;  1K61 A;  4JYK A;  3GF2 A;  1DP3 A;  1MJB A;  2HKX A;  1R1V A;  1D0Z A;  3E6M A;  4M9X A;  1FP1 D;  4DIQ A;  1TQI A;  2BY0 A;  3BRO A;  3IV5 A;  2EFO A;  5LGN A;  3RCO A;  3G4S I;  4BE2 A;  3H5R A;  3B6C A;  4QTR A;  3CDH A;  1XTA A;  4FE7 A;  4C2U A;  3DBR B;  2JSP A;  1JUS A;  4CZC A;  2DA6 A;  4DGW B;  3LA3 A;  4M3F A;  4ETS A;  3K4M A;  1IRG A;  2UWM A;  3PUB A;  4AWX B;  2CUF A;  2HQN A;  1ZGA A;  4H4K C;  4I2O A;  2R5Z B;  2XC7 A;  1FSE A;  2NOG A;  3V8J A;  2RN7 A;  4P9U A;  1J09 A;  2HDC A;  3LSG A;  2HFH A;  4PSX A;  4B1R A;  1P4X A;  3WGG A;  1D8K A;  3CUO A;  1W7P A;  1OYW A;  2AQF A;  2ZJQ F;  3BTI A;  2C6Y A;  2IP2 A;  1YG2 A;  2ID6 A;  2DXI A;  3ULQ B;  4BQA A;  1J59 A;  4MHG A;  3LFU A;  4G12 A;  4I01 A;  4E70 A;  2ME6 A;  5E3O A;  1B9M A;  4BGD A;  2GLO A;  2QLZ A;  4XL9 A;  2HI3 A;  1D0X A;  4HSR A;  4AIH A;  1LE8 B;  3SFZ A;  2DLL A;  4R1H A;  3I3L A;  3CMY A;  1ZEL A;  3RKY A;  1OCT C;  2L01 A;  4B4C A;  3ZMS A;  4YEJ A;  3CCU I;  2P8T A;  1ETV A;  5E3L A;  2ZJ2 A;  1MMA A;  5KHD A;  3Q3S A;  3J7Z I;  2ZBK A;  1RPW A;  4MGR A;  4HDV A;  1MNM C;  3PQK A;  3B73 A;  5HNF A;  5K1Y A;  1T39 A;  5FKL A;  1APL C;  1BBY A;  4IRG A;  1W0T A;  3W6V A;  3D5L A;  3DQV C;  3DEE A;  3FKJ A;  3VSL A;  2ZSI B;  5EG0 B;  5M5W J;  2HZT A;  3EYY A;  2VUM J;  5IPA A;  2BBY A;  5M3M J;  2VKV A;  1IN6 A;  1SC7 A;  2XB5 A;  3JRF A;  4KIG A;  4XRS A;  5CQG A;  1QRY A;  1QVU A;  4D5F A;  4IXA A;  4XNF A;  3L7W A;  1MND A;  1USS A;  2HZD A;  2DT7 B;  3IRR A;  3C3W A;  3MZH A;  4UB8 C;  4IQJ A;  2F2E A;  2MGQ A;  2QEN A;  1HW1 A;  5JVT A;  5E3M A;  1XGN A;  2MH2 A;  1T2K A;  3LSH A;  5ILU A;  2A5W A;  3ZMZ A;  2RC4 A;  1XG1 A;  2ZXH A;  3QP5 A;  1ZRE A;  2R5Y B;  1S3J A;  1NG7 A;  3KYC B;  4RGU A;  1OFC X;  5ICE A;  3F3X A;  3Q9V A;  2R0Q C;  1ZAO A;  1R49 A;  1JUM A;  2GM4 A;  3I58 A;  2OTJ I;  5FD5 A;  3BPX A;  3BJO A;  3ONQ A;  4CCJ A;  2COB A;  3AG4 H;  4M9S A;  4BQO A;  2HTS A;  1IDY A;  5JVG F;  5JI6 A;  2MG4 A;  4NHJ A;  1U8R A;  1Z91 A;  4WXD A;  3MD2 A;  4KIT B;  1WCM J;  3T1B A;  1RIO H;  2YX4 A;  1G3Y A;  1J7K A;  3JAM K;  2V1U A;  2P81 A;  3CCV I;  2CW8 A;  1KQ8 A;  1BW6 A;  5K7H A;  4BEH B;  1TNT A;  1NHA A;  3OSG A;  4Y4R A;  5E1W A;  1FTT A;  2K40 A;  5EZG A;  3GTP J;  1A04 A;  2KT0 A;  2RVC A;  4L0Z B;  4IJA A;  2KIF A;  1SFE A;  1FT9 A;  2CFO A;  1XSV A;  2XGE A;  3VFZ A;  5LEK A;  2Z5U A;  2X6X A;  1U5T C;  4IOA F;  1T08 B;  5EGO B;  1XMK A;  4A3E J;  4I0B A;  3LSI A;  2CQX A;  4BHC A;  5HLH A;  1BOA A;  3S3O A;  2JK3 A;  3DEU A;  1P2F A;  5A2Q K;  3WG7 H;  4EGY A;  3S17 J;  1IXS B;  3X2Q H;  1B8I B;  2CW0 F;  3N97 A;  2ZXW H;  2V6E A;  2H6C A;  2RNJ A;  2OC6 A;  1OYY A;  2R7X A;  5FB2 A;  2CSO A;  2PX9 A;  3FXM A;  5BPD A;  5GAE J;  1CF7 A;  3PUF A;  4HQE A;  1ERD A;  4P55 A;  4ZDO A;  3WE2 A;  2G7U A;  1OPC A;  5K7Z A;  3S1M J;  2JA2 A;  2NNY A;  1YHQ I;  3JRE A;  5C44 J;  1HOM A;  2L0K A;  3J7A Y;  3DLL F;  2P5K A;  3KZY A;  1V54 H;  2E1M C;  3ZRG A;  3HIF A;  1ZYR F;  2KMU A;  2A3S A;  3FBN B;  2IBD A;  4PDK A;  1P92 A;  2CW7 A;  2AXT C;  3HTS B;  1RUN A;  3S2H J;  3CP8 A;  3F9K A;  4NUB A;  1ETQ A;  4O5V A;  3M8J A;  2E2J J;  1U2W A;  5FO5 A;  3PO3 J;  2JRT A;  4A69 C;  2FOK A;  3VOE A;  2L9R A;  3BQY A;  1IXR C;  3U2R A;  4LMY A;  2VOD A;  2KDO A;  2ZXI A;  3CF5 F;  2IGO A;  3FXR A;  2VL8 A;  5E79 C;  1FOY A;  3M3Y J;  3FXO A;  2QGU A;  1GXQ A;  1W1W E;  2IW5 A;  2HNH A;  3QAH A;  2B9S A;  1FTZ A;  2WY7 Q;  2ZME C;  3NAR A;  1IN7 A;  2DK8 A;  4UHT A;  3HHG A;  4NQW A;  4DYQ A;  5FKK A;  2R7O A;  3I5U A;  3F8F A;  3GYH X;  1YI2 I;  3FIW A;  4G6T B;  1WRJ A;  3PIP F;  3L2W A;  4FTH A;  1V3F A;  3IWF A;  1TZL A;  2CO5 A;  2XAQ A;  3OIO A;  4PZJ A;  2CG4 A;  2IGN A;  3JW4 A;  3TL4 X;  1KYZ A;  2X6Y A;  5BNG A;  1T8I A;  2D5V A;  5JLX A;  3ZQI A;  2LD5 A;  4U87 A;  4EJO A;  3ZN0 A;  1X3W B;  1BL0 A;  2WAQ A;  2JQ7 A;  2FBH A;  2XAJ A;  2CYY A;  2XUB A;  1QNT A;  1UG2 A;  2YUS A;  3ZCO A;  1KU7 A;  3ECO A;  4S04 A;  1UEL B;  2PJR B;  3H5A A;  4HNU A;  2KIS A;  1I6X A;  2Z3Y A;  5HS9 A;  1RKT A;  5H6Q A;  2RNG A;  2JZY A;  4E7Z A;  5D4S A;  4FT8 A;  1R6R A;  3KYL A;  2ELJ A;  5IP9 J;  2YS9 A;  5F1J A;  1GT0 C;  2EIK H;  2FE3 A;  2VAS A;  3PFI A;  4C2T A;  3GUD A;  3R0J A;  2FBI A;  5IT9 K;  4FIS A;  4RAG A;  3TGN A;  2N8G A;  4CYD A;  5EGO A;  3WTW C;  2H8W A;  5L3G A;  3IH4 A;  3QRF F;  3QU3 A;  5ILS A;  3H3Z A;  5IYC J;  3OYD A;  4FHT A;  3RDI A;  4CIC A;  4KIS A;  3IAS 2;  2XF7 A;  1DQU A;  3S1N J;  4ZZD A;  1FBS A;  3ZMV A;  1XB4 A;  3QOD A;  1D8J A;  3F6O A;  3S93 A;  1ZG5 A;  2WV0 A;  1GXP A;  1AU7 A;  5ERI A;  2ISZ A;  3LSM A;  4BJ5 C;  5H20 A;  3FMQ A;  1BC7 C;  1HSJ A;  2R92 J;  2OU2 A;  1FIA A;  1Z3X A;  3BZ6 A;  1H9T A;  1R22 A;  1ETW A;  3ECH A;  3QYF A;  2HVR A;  3KIO A;  1WJE A;  2KZV A;  2CQK A;  1TWA J;  4FCY A;  1I27 A;  1VF9 A;  2VC0 A;  1WHU A;  2VT3 A;  4YFK F;  3K2A A;  3L9F A;  5FGM A;  3V42 A;  1JKO C;  3F8C A;  1QQI A;  5DV5 A;  4JK1 X;  4B47 A;  4XID A;  2FML A;  3ZP5 A;  1F36 A;  3GXO A;  3CCQ I;  2AXL A;  2ICW G;  5FFZ A;  1SAN A;  4YIF A;  3I55 I;  1BR1 A;  4BJ6 C;  3DPU A;  2OBP A;  4N4N B;  5DUI A;  2X51 A;  3A01 B;  1RNL A;  2L9N A;  5DDG A;  2CQQ A;  2M0M A;  3OYC A;  2UZK A;  1HLV A;  1TBX A;  1R9T J;  4ENJ A;  4BDZ A;  2V9P A;  3ABU A;  1C0W A;  1JJ8 C;  4L18 B;  2PFB A;  1TWH J;  1TW3 A;  4BKX A;  2A6H F;  4BU2 A;  3KZZ A;  1G3S A;  2HYJ A;  1YIO A;  4K2E A;  3GWZ A;  2VBY A;  5ICG A;  1TWF J;  4HRI A;  2R7Q A;  1VQL I;  1G3T A;  2XRO A;  1WJC A;  3FX3 A;  2DU9 A;  2LMD A;  3S1R J;  1B8I A;  2L3D A;  3ZOB A;  2E1N A;  1FWZ A;  2EZK A;  2E35 A;  2H8R A;  2ESH A;  4LJZ F;  4CCK A;  1Z7L A;  1UB9 A;  1LKX A;  3OY9 A;  4O6J A;  1W5C C;  2O5R A;  2IEK A;  3WGI A;  3Q0U A;  4EVI A;  2JA5 J;  3I53 A;  3MZ8 A;  2IPQ X;  4HPQ A;  1X58 A;  4RGS A;  2JUG A;  2D1V A;  2DJN A;  1EH7 A;  1WH5 A;  4HYE A;  5CPR B;  4QPQ A;  5JFR A;  1R7J A;  2NRA C;  2HOA A;  3VB2 A;  4S05 A;  3HTU A;  2KHM A;  2XSD C;  1PYV A;  3FF5 A;  1ZN2 A;  4A5N A;  2BVM A;  2O0Y A;  2UXN A;  3FMR A;  3JCU C;  5TJJ A;  1B72 A;  2PEX A;  3ERE D;  2ESN A;  5HLG A;  1Z3Y A;  1QHH D;  3TBI A;  1DP7 P;  1AHD P;  5FLV A;  3IUO A;  2DOD A;  3A1Y A;  3C18 A;  3OYG A;  4OOI A;  1JT6 A;  5FD6 A;  4XR6 A;  3LNQ A;  5M3F J;  3SDB A;  5E3N A;  2QZ8 A;  4YG2 F;  3OOP A;  2PMZ N;  5GP9 A;  2X48 A;  3C1D A;  4IL6 C;  5J47 A;  2EV5 A;  5L3D A;  2DQL A;  3BTJ A;  3G6E I;  2IS2 A;  1MJ9 A;  3W3C A;  1GV5 A;  2Y0S N;  4G6D A;  3CCS I;  1ZLK A;  4N4O B;  4ZTF A;  3P5J A;  2VIX A;  3JSO A;  4XSX F;  2JA6 J;  3SFI A;  4W97 A;  3GEZ A;  2PMZ A;  2LBF B;  2BGC A;  4KUM A;  2LF8 A;  4MIM A;  3BZC A;  2FQ4 A;  1ZTR A;  3HC7 A;  3K0L A;  3EUA A;  1U9N A;  3LST A;  5KVR A;  3ZQC A;  2HOS A;  1UZC A;  3S2W A;  1YJN I;  3J7A O;  4BY7 J;  2LYC A;  2LFB A;  2OCE A;  2WAE A;  4CYC A;  4JQF A;  2CQ7 A;  3BR6 A;  3FMS A;  3E6B A;  2NVU B;  4BXF A;  4AID A;  3BPV A;  1GVD A;  3GZ6 A;  3TED A;  3JRC A;  1I50 J;  2HXO A;  3GZ5 A;  5KNL A;  2BVL A;  3TO6 A;  1U5T B;  1UHM A;  4L9N A;  1WJF A;  1X4P A;  4OIQ F;  2X6O A;  2A69 F;  3HOS A;  2JJ7 A;  2CJJ A;  2DO7 A;  3QYE A;  2UXX A;  3WU1 B;  3FM5 A;  4IQ4 A;  4CCL A;  2HQR A;  1B72 B;  4OIP F;  4HG2 A;  3T0Y A;  2EV6 A;  4RA2 A;  2BY3 A;  3ESW B;  2XAG A;  1FC3 A;  3CCE I;  1I39 A;  5E17 F;  2XGC A;  2F4I A;  2X85 A;  1RR7 A;  1ZG3 A;  1GDT A;  3MCZ A;  3MVP A;  5CYV A;  3M1C A;  2FU4 A;  3JTH A;  3RIR A;  1FIP A;  2RGV A;  2EWN A;  4XLH A;  5F0F A;  4F52 A;  3J80 K;  4HF2 A;  2M2E A;  2ZKZ A;  3CLO A;  2KFD A;  4XRS G;  2YR2 A;  1A6Q A;  3JR9 A;  1AKH B;  5J4V A;  1YFH A;  2EFQ A;  5GAD J;  2E1M B;  2LRE A;  3HG9 A;  3HXL A;  3FXJ A;  2VXD A;  2OA4 A;  5TIS C;  5J1Y A;  3D5S C;  2W48 A;  1HST A;  1PUE E;  3B6A A;  1AOY A;  2WV1 A;  1JKR C;  3K4L A;  1Z7U A;  3DPT A;  4IRI A;  1XMX A;  1PP8 F;  3I4P A;  1KQ0 A;  3AG3 H;  1TWG J;  1XSD A;  1WPK A;  3KLO A;  3OR2 C;  1VZ0 A;  2FX0 A;  4UUV A;  4PJJ A;  4HW0 A;  3ML6 A;  1STZ A;  4UV9 A;  5JHF A;  2JTV A;  2K7L A;  2M7B A;  1GV2 A;  3M07 A;  3F22 A;  3N4M A;  3ABM H;  1LE8 A;  3BR5 A;  2WAF A;  3JAM Z;  3TO9 A;  3G3Z A;  4UVA A;  1NK2 P;  1X1P A;  1TL8 A;  4PJM A;  2RQQ A;  3RKX A;  3OL4 A;  2VJ5 A;  2CQN A;  3Q9S A;  3BLY A;  2R7V A;  1KA8 A;  5GAH J;  4X1E A;  3RYR A;  2PJR A;  4BBS J;  3GZN B;  1Y8R B;  1JGS A;  2HWV A;  3M1E A;  1KQ9 A;  3Q0W A;  3TW6 A;  4BS9 A;  2E7X A;  1LFP A;  2MLK A;  4UY8 I;  5C4X J;  2A6E F;  3DU6 A;  3GME A;  1JGG A;  1H9G A;  3E7L A;  3DBH B;  2WY8 Q;  4M3B A;  5D6F A;  3OYH A;  3GTM J;  2KJB A;  1XCB A;  2NS0 A;  3OYF A;  2B63 J;  4FE4 A;  2Y0S A;  3M8E A;  2MAB A;  3SYT A;  2OF7 A;  3H35 A;  3IL2 A;  1G6N A;  3QPS A;  1YJW I;  5LHH A;  3MKW B;  2QUF A;  2IRF G;  3DTI A;  4LB5 A;  2MD5 A;  3CF2 A;  1TTY A;  1MBJ A;  1BA5 A;  4HF0 A;  3FXQ A;  4HF1 A;  2CS3 A;  1YLF A;  3HSE A;  2XAH A;  4LK0 F;  3WTS C;  5DCF A;  4KN7 X;  2DMT A;  2PG4 A;  1ZAR A;  3K6G A;  5EEH A;  5LHI A;  3V4G A;  4AU7 A;  2R5Z A;  5LD2 C;  3H9Q A;  4EV0 A;  4NC8 A;  1N25 A;  4CUG A;  2BY2 A;  4RAF A;  4IHS A;  2CV0 A;  1QZY A;  3TO7 A;  2CUE A;  2DFF A;  3A0B C;  2KL4 A;  1OCP A;  2ELK A;  4WXH A;  3H5N A;  4AVZ A;  4XLE A;  4E4H A;  3EQL F;  1QZE A;  1WKM A;  3LSK A;  4DJA A;  2ZFW A;  3IP4 B;  2PMH A;  3DKX A;  3EPZ A;  3OYI A;  3BT9 A;  4LLG F;  5F1R A;  1YS7 A;  1LPQ A;  2JVG A;  2JVH A;  4PGH A;  5ICF A;  4LGW A;  5LEJ A;  3ZMU A;  3ZMD A;  1XD7 A;  4XLP F;  1D0Y A;  4C3I J;  4UXN A;  2WTE A;  2FJ1 A;  2XPV A;  3CTA A;  2K85 A;  1BOB A;  4B3A A;  2WA0 A;  4MQ9 F;  2DFE A;  4B09 A;  2QF7 A;  4CO8 A;  4EGZ A;  2XKP A;  1HKQ A;  3L00 A;  2LR8 A;  2KPM A;  2QYO A;  1VFC A;  4RGR A;  3HUG A;  1J0R A;  3G1L A;  1CF7 B;  1VND A;  4L9T A;  3QP6 A;  1R23 A;  3SHF A;  2Q2E A;  4U0V A;  2HDW A;  3RSN A;  4A3B J;  2XHK A;  4OMZ A;  4A3C J;  1BJZ A;  2IXS A;  3ZGK A;  1QHG A;  4CHU A;  2M45 A;  4UNO A;  1QPM A;  2X9D A;  2JMW A;  1G8X A;  4G8X A;  3W2W A;  4DZP A;  1D3Y A;  5FKN A;  4X0G A;  5LFA A;  3HSR A;  4GFB A;  3HSF A;  4CXF A;  1O3R A;  1UMQ A;  5F64 A;  2IS1 A;  1JT0 A;  1YJ9 I;  2K9M A;  4G6Q A;  2K4B A;  4DW6 A;  1UG0 A;  2XIG A;  2P0W A;  3CMM A;  3I64 A;  4IEJ A;  1VQO I;  2L4M A;  4E7L A;  4M72 A;  2QSG X;  1Y0U A;  1YYV A;  2M34 A;  1XS9 A;  2STW A;  2P4W A;  2XV4 S;  2GA1 A;  3DKW A;  1TQP A;  3BG3 A;  2HVS A;  2GZW A;  2KZG A;  2QQA A;  2VOO A;  1K6Y A;  1GLN A;  4KT5 C;  1LUJ B;  1W0U A;  1FBQ A;  2I5U A;  2JPC A;  3W6J B;  1P4W A;  1IRF A;  1FMW A;  4RM3 A;  4L5J A;  5BMZ A;  3I56 I;  1B6A A;  4EJT A;  3RQI A;  4F93 B;  1R36 A;  4DBR A;  5EEG A;  3IH3 A;  1T98 A;  3JTG A;  2GXB A;  1GHC A;  4BJT A;  1E17 A;  1OQY A;  3PM1 A; 
#chains in the Genus database with same CATH homology
 1MD0 A;  2WC2 A;  5KK1 A;  1MGT A;  3F8N A;  3KLN A;  3BP8 A;  2ELH A;  1FZP B;  3GLX A;  3AAF A;  2O03 A;  4U88 A;  1JHH A;  2W24 A;  4DQ2 A;  3WG9 A;  2EFN A;  4I0A A;  1SFX A;  2FQ3 A;  3V7S A;  2LF7 A;  1BC8 C;  4G7H F;  3ZMT A;  4MTD A;  2GAU A;  4OIN F;  1L3L A;  2K27 A;  2OAZ A;  1ZH5 A;  2FEZ A;  2H27 A;  5LRS A;  3COA C;  4HDU A;  4GCV A;  4BH9 A;  3K69 A;  3I71 A;  2CGP A;  1ZG1 A;  3TDZ C;  1TW2 A;  4P9F A;  5AIQ A;  5HDG A;  2FBK A;  1R1U A;  2HOE A;  2V79 A;  2ISY A;  2KKO A;  3HRU A;  3SXY A;  2OQG A;  1MZB A;  1MDM A;  4I98 B;  4YII A;  1BJA A;  4ZYG A;  4Z2Y A;  4L0Y B;  1ZRD A;  1O7F A;  1W5T A;  4KMU X;  4QLC U;  2HTJ A;  2QBY A;  5IT3 A;  3K1P A;  4KNY A;  2VT2 A;  2E1C A;  3WTY C;  5CVJ A;  3FM3 A;  3QU6 A;  2EK5 A;  5E1Z B;  5J6X A;  3TQN A;  3I59 B;  1HKT A;  1FYK A;  4AVP A;  4EM0 B;  1Z05 A;  5LBQ A;  2GA2 A;  1L0O C;  2ZNY A;  2VN2 A;  2F5D A;  4P5O A;  2VBW A;  1KYW A;  3CUQ B;  2PLY A;  2P5V A;  4EMS A;  1UST A;  3M7G A;  3HHH A;  1U5T A;  5E8G A;  5ICC A;  3QPH A;  2XAF A;  4LFU A;  1K79 A;  4UV8 A;  2GXG A;  4HLY A;  5BS6 A;  5BOX A;  3DP7 A;  2VBX A;  2LNB A;  2H94 A;  4RB0 A;  1P6R A;  2EA2 A;  3EYI A;  3F8B A;  2GIV A;  2IVM A;  2P7V B;  3GFI A;  2MH9 A;  4RB2 C;  4UVC A;  5TRD A;  1XCV A;  1BI0 A;  1HW5 A;  2FXA A;  4G7O F;  2KIU A;  1AWC A;  5AIP A;  3CO7 C;  4CHU A;  3REO A;  2HR3 A;  5CJ9 A;  3VEP A;  4M74 A;  1YO5 C;  3V7R A;  3KE2 A;  1EH6 A;  4TV7 A;  4ASN A;  2FF4 A;  1SMT A;  2VE8 A;  1IW7 F;  1PP7 U;  2V9V A;  1O7L A;  2D2W A;  3NRV A;  2HYG D;  3P9I A;  3ROU A;  1SAX A;  3U1D A;  3IKV A;  1DUX C;  4CZZ A;  1CGP A;  1TQM A;  3OV8 A;  3O3K A;  2G9W A;  3R60 A;  4G94 A;  5E1X A;  2VBZ A;  2EFP A;  3RJP A;  3WGH A;  1XDS A;  4PGG A;  3BY6 A;  1FSH A;  2X0L A;  1YS6 A;  4WXC A;  5DEQ A;  4XRF A;  3ZN1 A;  3KP3 A;  2Y75 A;  1U78 A;  3IC7 A;  3T5X A;  1S8N A;  4LLL A;  1ZHF A;  1ZLJ A;  5H6R A;  4L5I A;  4Q48 A;  3R6S A;  1LEA A;  2HEO A;  4A6D A;  4CGZ A;  1B59 A;  3KET A;  3L2C A;  3DPL C;  2PI0 A;  1EH8 A;  1Z6T A;  4HLX A;  2IA1 A;  3E6D A;  5HS8 A;  2ZME B;  5D8L B;  2AS5 F;  3TKY A;  2F5C A;  5HS7 A;  3BOQ A;  4O3M A;  3P9C A;  1BIA A;  2EA4 A;  1IUY A;  3FXU A;  3KP6 A;  3SZP A;  1FYM A;  5DCM B;  3K1M A;  4I02 A;  1BI2 A;  1XN7 A;  3V7C A;  4RGX A;  4G9Y A;  1X3U A;  1FLI A;  5E18 F;  1SMY F;  1O3Q A;  4G7Z F;  2FMY A;  2Y0M A;  1F4K A;  3IWZ A;  1IAW A;  3GFL A;  2KRF A;  2NNN A;  3SZT A;  4GYI A;  5D8K B;  2LSO A;  3MQ0 A;  2RV8 A;  1RUO A;  5L3F A;  1LJ9 A;  2GWR A;  4BXU A;  2HYF A;  1QGP A;  2W84 A;  1FOK A;  3FWE A;  2O8X A;  1FPQ A;  5DYM A;  2IA0 A;  1RI7 A;  1EV7 A;  4A0X A;  1LDD A;  2M5W A;  3E5U A;  5E20 A;  4U0W A;  2P7C B;  3LQQ A;  1FYL A;  3GW2 A;  2RDP A;  4MQV A;  2XVC A;  4MEY F;  2QBY B;  3WTU C;  3R4K A;  2OZU A;  3LFK A;  2W85 A;  4Q47 A;  3E97 A;  4ENM A;  1I1G A;  1WSU A;  2XGX A;  3MZY A;  4Q4Z F;  1HW2 A;  4NB5 A;  4IRH A;  1LDK B;  1XGS A;  3LA2 A;  2L02 A;  3E6C C;  4HX7 A;  1OMI A;  3GFM A;  2YX7 A;  2YPR A;  2A68 F;  3I54 A;  3T8T A;  1J9I A;  2MA3 A;  4A0Y A;  4BAY A;  2DK5 A;  3LAP A;  1KU3 A;  2D1H A;  3D0S A;  2ZXJ A;  1IZ1 A;  2BEO A;  3V8L A;  4U0Y A;  3F8M A;  2DAO A;  4EJU A;  5CVI A;  1ODD A;  2VE9 A;  3RKW A;  1R5G A;  4WK8 F;  1BM9 A;  1W4M A;  2B0L A;  3KP5 A;  4KN4 X;  4ZYE A;  4HQM A;  4M6Y A;  1V4R A;  5D5X B;  2Z9O A;  1S6L A;  4KIF A;  4FX0 A;  3KP2 A;  2DBB A;  4BHP A;  2DI3 A;  2HGC A;  1F5T A;  4HV5 A;  4AIK A;  3MAJ A;  2KIM A;  2L54 A;  1WWX A;  4WX9 A;  5D6E A;  3JSP A;  2ACJ A;  3WTX C;  1KU2 A;  1ON1 A;  2DT5 A;  2EV0 A;  4LK1 F;  4A0Z A;  2ZCW A;  3SQN A;  2STT A;  3GVA A;  2FA5 A;  3CO6 C;  3DV8 A;  2EFW A;  4EQQ A;  4MNU A;  1SFU A;  2DTR A;  3RI4 A;  1FY7 A;  2HS5 A;  3IHU A;  4FX4 A;  3KFW X;  1IXC A;  2DPD A;  4Q5S F;  3IRQ A;  4KYW A;  1K78 B;  4IVN A;  1J75 A;  1S7A A;  1K6O A;  5FLX Z;  3EDP A;  4CDG A;  1BI3 A;  3GFJ A;  2J5P A;  2M1B A;  2BYV E;  1IN8 A;  2HKO A;  1SD5 A;  4YFX F;  2FRH A;  1U6G A;  1IN4 A;  1FBU A;  5BPI A;  2ZNZ A;  4D0P A;  1Z9C A;  4LD5 A;  2O6G E;  4JBA A;  3BDD A;  4HX8 A;  4Y17 A;  5ILV A;  2MLG A;  2QWW A;  4OMY A;  2H6B A;  2A5Y B;  2M30 A;  1I1S A;  2D45 A;  1OR7 A;  3L09 A;  2P6S A;  2DFI A;  1OYI A;  1B9N A;  2BE5 F;  2M8E A;  2K02 A;  3RPU A;  5DD4 A;  2PMU A;  4YFN F;  1KGS A;  5HLI A;  4R79 A;  3WTT C;  4LLN A;  4N9I A;  3LWF A;  1BN5 A;  3GX4 X;  2LKP A;  4Y13 A;  2E7W A;  2FSW A;  1Q1H A;  1TLH B;  4U7B A;  3KP7 A;  2P5L C;  1YTY A;  4EM1 A;  4ESF A;  4HBL A;  1QBJ A;  1MDM B;  4WWC A;  4M73 A;  2A07 F;  5AON A;  2Z33 A;  4P96 A;  2KJC A;  2MBF A;  4ZH4 F;  3FHZ A;  4ZYD A;  3IKT A;  2F5E A;  3K1N A;  4BYY A;  1SD6 A;  2IT0 A;  5D5U B;  2VON A;  3P9K A;  3V8K A;  3ZQ7 A;  2Y48 A;  1LQ1 A;  1UCR A;  4ON0 A;  1K7A A;  5FFX A;  4ZYH A;  1ZRF A;  5CVV A;  1FX7 A;  4ZZL A;  4KDP A;  5HVQ C;  2VC1 A;  2PJP A;  2K86 A;  2K4J A;  3LQR A;  4HX4 A;  1WQ2 A;  2L4A A;  2X4H A;  5J8C A;  1D5V A;  4ENN A;  2JPB A;  2QM3 A;  3CUQ A;  2J5O A;  3H92 A;  1ONV A;  4RB1 A;  2IA2 A;  2PN6 A;  3EET A;  1QO0 D;  1R58 A;  1WI9 A;  4KIB A;  4AIJ A;  3HRT A;  2ETH A;  1U3E M;  2W57 A;  2DW4 A;  4AD9 A;  2A61 A;  1JXS A;  2DQR A;  4GXO A;  4EM2 A;  2ADU A;  1HKS A;  4GYG A;  2VXZ A;  5D5V B;  2JT1 A;  3R0A A;  1SD4 A;  1K78 A;  4H0E A;  1W7P D;  2CWE A;  3O2P E;  4PCQ A;  1PDN C;  3VOD A;  2MC3 A;  2NYX A;  2ZME A;  1R1T A;  1MKM A;  4OU0 A;  4RS8 A;  2O61 A;  3K9T A;  3QOP A;  2CFX A;  1P4A A;  1XDU A;  4HV6 A;  1REP C;  3B02 A;  2H09 A;  1FNN A;  1XMA A;  4Y15 A;  3U9G A;  5K5O A;  1B1B A;  2ZO4 A;  3WU0 A;  2YU3 A;  2Q8K A;  4EJW A;  4MTE A;  5HDK A;  1J2X A;  4UVB A;  5K5Q A;  1GVJ A;  1LNW A;  1LB2 A;  1B4A A;  1ZGJ A;  3TOA A;  1XSX A;  3F6V A;  5CLS A;  5A2Q Z;  4B8X A;  2QVO A;  1T0F A;  4IPA A;  5CVU A;  1HXD A;  3F72 A;  2JSC A;  4XBF A;  4L9J A;  3RPQ A;  3Q5F A;  2F5F A;  1OKR A;  1SD7 A;  1UFM A;  5F6F A;  3J81 Z;  1VTN C;  1YW7 A;  3HOT A;  3G73 A;  3E3V A;  5D4R A;  1QZZ A;  4HAM A;  4ESB A;  4HA8 A;  1UHW A;  4KFC A;  3MEX A;  4DNC A;  3PQJ A;  1G4D A;  3W6K B;  2XRN A;  5BQT A;  3BJ6 A;  1LVA A;  1JHF A;  1JE8 A;  4M71 A;  3H3U A;  5HDN A;  1YW9 A;  4R8H A;  1W5S A;  5JHU A;  3E5Q A;  4A5M A;  2P6T A;  4LG0 B;  3BWG A;  2EB7 A;  1DPR A;  1HQC A;  2R7D A;  2EJR A;  4QWQ A;  1FP2 A;  1MJA A;  1Z1D A;  1S7O A;  4A2U A;  2V1D A;  2QQB A;  3J80 Z;  5LLQ A;  3MWM A;  5K5R A;  2OQR A;  5D5W B;  5JR3 A;  5CVR A;  5LRR A;  3CUQ C;  1IN5 A;  1I5Z A;  4GGG A;  2FNP A;  4GO1 A;  3WOD F;  1J5Y A;  1IF1 A;  3DXJ F;  5LGT A;  1BI1 A;  5E8I A;  4I7H A;  4XSZ F;  3KEQ A;  2TDX A;  3ELK A;  2GQQ A;  5DD8 A;  1O3S A;  1F1Z A;  4HZF A;  4RAY A;  2QQ9 A;  1KU9 A;  1YQA A;  1O3T A;  2M87 A;  3ABT A;  3WTZ A;  1R00 A;  3C7J A;  1ON2 A;  3M8F A;  4M9Z A;  4A12 A;  4ESJ A;  3GO5 A;  3E5X A;  1E2X A;  1T38 A;  4IHT A;  3RTR A;  1W7P B;  2VOP A;  3NQO A;  3LA7 A;  2BV6 A;  3NEU A;  3HRS A;  4OIO F;  3I0T A;  5DCM A;  3QPT A;  2R3S A;  1R5H A;  1BIB A;  1ZRC A;  3WTV C;  5ED4 A;  1H0M A;  4IF4 A;  4N0B A;  5DUK A;  3F23 A;  4A6E A;  3BJA A;  1LDJ A;  2V6C A;  2G7H A;  5HOO A;  1Z6R A;  2NAZ A;  2WWY A;  1DDN A;  3DFG A;  3M9A A;  2V1X A;  2IJL A;  3RYP A;  5L3C A;  4I09 A;  4WCG A;  1DPU A;  5LHG A;  3K2Z A;  4F7Z A;  1HBX G;  3O6B B;  4EJV A;  4BHB A;  3J81 K;  5L3B A;  2R7F A;  5FLX K;  2COM A;  3P7N A;  4LG0 A;  5J8F A;  3KCC A;  3TDU C;  2PBI A;  4N9H A;  1XGM A;  2LDU A;  1G3W A;  1F9N A;  3HYI A;  1LEB A;  1YW8 A;  5IT9 Z;  3KP4 A;  1ULY A;  2DPU A;  4KMF A;  2RKH A;  3T8R A;  1TNS A;  4L9V A;  2XKO A;  4KA4 A;  2YSR A;  1S29 A;  3FZV A;  2XAS A;  4XLN F;  3DF8 A;  3R61 A;  4WF2 A;  4M6X A;  1O57 A;  4OIR F;  3TOB A;  3EUH A;  2W25 A;  2OZ6 A;  2PQ8 A;  3CJN A;  3LAJ A;  1XGO A;  4KIC A;  1RZ4 A;  6PAX A;  2Q0O A;  1T6S A;  3F21 A;  3ISP A;  2OD5 A;  4U7D A;  3KEO A;  4HOB A;  4ENK A;  4RAZ A;  3MFK A;  5L3E A;  2O3F A;  2RQP A;  3ZPL A;  4RB3 C;  2FNA A;  5LGU A;  4LB6 B;  4MEX F;  2Z99 A;  3WE3 A;  3I59 A;  3HRM A;  3GF2 A;  1MJB A;  2HKX A;  1R1V A;  3E6M A;  4M9X A;  1FP1 D;  1TQI A;  3BRO A;  2EFO A;  5LGN A;  3CDH A;  3LA3 A;  4ETS A;  1IRG A;  2UWM A;  4AWX B;  2HQN A;  1ZGA A;  4I2O A;  1FSE A;  3V8J A;  2RN7 A;  4P9U A;  2HDC A;  2HFH A;  1P4X A;  3WGG A;  1D8K A;  3CUO A;  1W7P A;  1OYW A;  2C6Y A;  2IP2 A;  1YG2 A;  3ULQ B;  4BQA A;  1J59 A;  4MHG A;  4I01 A;  4E70 A;  1B9M A;  2QLZ A;  4AIH A;  3SFZ A;  2DLL A;  4R1H A;  3RKY A;  2L01 A;  3ZMS A;  2P8T A;  2ZJ2 A;  2ZBK A;  4MGR A;  4HDV A;  3PQK A;  3B73 A;  5K1Y A;  1T39 A;  1BBY A;  4IRG A;  3D5L A;  3DQV C;  2HZT A;  3EYY A;  2BBY A;  1IN6 A;  4KIG A;  4IXA A;  3L7W A;  1USS A;  3IRR A;  3C3W A;  3MZH A;  2F2E A;  2QEN A;  1HW1 A;  5JVT A;  1XGN A;  2MH2 A;  1T2K A;  5ILU A;  3ZMZ A;  2RC4 A;  3QP5 A;  1ZRE A;  1S3J A;  4RGU A;  5ICE A;  3F3X A;  3Q9V A;  1ZAO A;  3I58 A;  5FD5 A;  3BPX A;  3BJO A;  4M9S A;  2HTS A;  5JI6 A;  4NHJ A;  1U8R A;  1Z91 A;  4WXD A;  3T1B A;  1RIO H;  2YX4 A;  1G3Y A;  3JAM K;  1J7K A;  2V1U A;  1KQ8 A;  1TNT A;  1NHA A;  5E1W A;  1A04 A;  2RVC A;  4L0Z B;  4IJA A;  2KIF A;  1SFE A;  1FT9 A;  1XSV A;  3VFZ A;  5LEK A;  2Z5U A;  1U5T C;  1XMK A;  4I0B A;  4BHC A;  5HLH A;  1BOA A;  3DEU A;  1P2F A;  5A2Q K;  4EGY A;  1IXS B;  2CW0 F;  3N97 A;  2H6C A;  2RNJ A;  1OYY A;  5FB2 A;  2CSO A;  5BPD A;  1CF7 A;  4HQE A;  4P55 A;  3WE2 A;  2G7U A;  1OPC A;  2NNY A;  2P5K A;  3KZY A;  3HIF A;  1ZYR F;  2A3S A;  4PDK A;  1P92 A;  3HTS B;  1RUN A;  4O5V A;  1U2W A;  5FO5 A;  2JRT A;  2FOK A;  3VOE A;  1IXR C;  3U2R A;  4LMY A;  2VOD A;  3FXR A;  1GXQ A;  2IW5 A;  3QAH A;  1IN7 A;  2DK8 A;  4UHT A;  3HHG A;  4NQW A;  3I5U A;  3F8F A;  3GYH X;  1WRJ A;  1V3F A;  3IWF A;  2CO5 A;  2XAQ A;  4PZJ A;  2CG4 A;  3JW4 A;  1KYZ A;  4EJO A;  3ZN0 A;  2FBH A;  2XAJ A;  2CYY A;  2XUB A;  1QNT A;  1KU7 A;  3ECO A;  4S04 A;  1I6X A;  2Z3Y A;  5HS9 A;  5H6Q A;  2JZY A;  5D4S A;  4FT8 A;  2FE3 A;  3PFI A;  3GUD A;  3R0J A;  2FBI A;  5IT9 K;  3TGN A;  4CYD A;  3WTW C;  5L3G A;  3QRF F;  3QU3 A;  5ILS A;  3H3Z A;  4FHT A;  3RDI A;  4CIC A;  4ZZD A;  1FBS A;  3ZMV A;  1XB4 A;  1D8J A;  3F6O A;  1ZG5 A;  2WV0 A;  1GXP A;  5ERI A;  2ISZ A;  5H20 A;  3FMQ A;  1BC7 C;  1HSJ A;  2OU2 A;  3BZ6 A;  1H9T A;  1R22 A;  3ECH A;  2CQK A;  1I27 A;  2VC0 A;  2VT3 A;  4YFK F;  5FGM A;  3L9F A;  3F8C A;  1QQI A;  5DV5 A;  4JK1 X;  2FML A;  3ZP5 A;  3GXO A;  2AXL A;  5FFZ A;  4YIF A;  2OBP A;  5DUI A;  1RNL A;  5DDG A;  2UZK A;  1TBX A;  4ENJ A;  4L18 B;  3ABU A;  1C0W A;  2PFB A;  1TW3 A;  2A6H F;  3KZZ A;  1G3S A;  1YIO A;  4K2E A;  3GWZ A;  2VBY A;  5ICG A;  1G3T A;  2XRO A;  3FX3 A;  2DU9 A;  2L3D A;  2E1N A;  1FWZ A;  2ESH A;  4LJZ F;  1UB9 A;  4O6J A;  3WGI A;  4EVI A;  3I53 A;  4RGS A;  2IPQ X;  2D1V A;  1EH7 A;  4HYE A;  5JFR A;  1R7J A;  2NRA C;  3VB2 A;  4S05 A;  3HTU A;  3FF5 A;  1ZN2 A;  4A5N A;  2O0Y A;  2UXN A;  3FMR A;  5TJJ A;  2PEX A;  3ERE D;  2ESN A;  5HLG A;  1DP7 P;  3C18 A;  4OOI A;  5FD6 A;  2QZ8 A;  4YG2 F;  3OOP A;  3C1D A;  2EV5 A;  5L3D A;  2DQL A;  1MJ9 A;  4G6D A;  1ZLK A;  3JSO A;  4XSX F;  3GEZ A;  2BGC A;  4KUM A;  2LF8 A;  3K0L A;  3LST A;  5KVR A;  3S2W A;  3J7A O;  4JQF A;  3FMS A;  3E6B A;  3BPV A;  3GZ6 A;  3GZ5 A;  3TO6 A;  1U5T B;  1UHM A;  4L9N A;  4OIQ F;  2A69 F;  3HOS A;  2DO7 A;  3WU1 B;  2UXX A;  3FM5 A;  2HQR A;  4OIP F;  3T0Y A;  2EV6 A;  2XAG A;  1FC3 A;  5E17 F;  1ZG3 A;  3MCZ A;  5CYV A;  2FU4 A;  3JTH A;  3RIR A;  2RGV A;  2EWN A;  3J80 K;  4HF2 A;  2ZKZ A;  3CLO A;  2YR2 A;  1YFH A;  2EFQ A;  2OA4 A;  1HST A;  1PUE E;  1AOY A;  1Z7U A;  3DPT A;  4IRI A;  1PP8 F;  3I4P A;  1KQ0 A;  1XSD A;  3KLO A;  4UUV A;  4HW0 A;  3ML6 A;  1STZ A;  4UV9 A;  2JTV A;  2K7L A;  3F22 A;  3N4M A;  3JAM Z;  3TO9 A;  3G3Z A;  4UVA A;  3RKX A;  3Q9S A;  1KA8 A;  3RYR A;  4BNC A;  1JGS A;  2HWV A;  3M1E A;  1KQ9 A;  2E7X A;  2MLK A;  2A6E F;  1H9G A;  5D6F A;  2KJB A;  1XCB A;  2NS0 A;  3M8E A;  3IL2 A;  1G6N A;  5LHH A;  2QUF A;  4LB5 A;  2IRF G;  2MD5 A;  1TTY A;  4HF0 A;  4HF1 A;  3FXQ A;  1YLF A;  3WTS C;  3HSE A;  2XAH A;  4LK0 F;  5DCF A;  4KN7 X;  2PG4 A;  5LHI A;  1ZAR A;  5EEH A;  3V4G A;  4EV0 A;  4IHS A;  1QZY A;  3TO7 A;  4WXH A;  3EQL F;  1WKM A;  2ZFW A;  2PMH A;  4LLG F;  5F1R A;  1YS7 A;  4PGH A;  5ICF A;  4LGW A;  5LEJ A;  3ZMU A;  3ZMD A;  1XD7 A;  4XLP F;  4UXN A;  2WTE A;  3CTA A;  4MQ9 F;  4B09 A;  4CO8 A;  4EGZ A;  2XKP A;  1HKQ A;  3L00 A;  2QYO A;  4RGR A;  3HUG A;  1J0R A;  1CF7 B;  4L9T A;  3QP6 A;  1R23 A;  3SHF A;  2Q2E A;  4U0V A;  2XHK A;  4OMZ A;  2M45 A;  4UNO A;  1QPM A;  4G8X A;  1D3Y A;  3HSR A;  3HSF A;  4CXF A;  1O3R A;  5F64 A;  4G6Q A;  2K4B A;  2XIG A;  3I64 A;  2L4M A;  4M72 A;  2STW A;  1Y0U A;  1YYV A;  2P4W A;  2XV4 S;  2GA1 A;  3DKW A;  1TQP A;  2GZW A;  2QQA A;  2VOO A;  4KT5 C;  1FBQ A;  2JPC A;  3W6J B;  1P4W A;  1IRF A;  4L5J A;  5BMZ A;  1B6A A;  4EJT A;  1R36 A;  5EEG A;  1T98 A;  3JTG A;  2GXB A;  1GHC A;  1E17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...