2FXAA

Structure of the protease production regulatory protein hpr from bacillus subtilis.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
156
Chain Sequence
b'PPYDVKEALVFTQKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRTYVQLTEEGTEVFWSLLEEFDPTRNAVFKGSQPLYHLFGKFPEVAEMMCMIRHIYGDDFMEIFETS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease production regulatory protein hpr
publication title Structure of the Protease Production Regulatory Protein hpr from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 50
structure length 156
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fxaA00
1FBSA 3ABUA 4GCVA 4HF0A 1FYLA 4ZYHA 3MZYA 3RKWA 4BHCA 3L9FA 3BROA 3TO9A 4TV7A 3ELKA 3BPVA 4A0YA 3E5UA 1XCBA 4M73A 1YYVA 5HS7A 3HHGA 3W6JB 2IA1A 4Q48A 3RIRA 4JBAA 3RYRA 5ILVA 2W25A 5HDNA 4A6DA 4ESJA 3F8BA 5L3CA 4U0WA 1IW7F 1W5TA 1ZREA 5FFZA 2XGXA 2QQ9A 2HYGD 3DEUA 1XDSA 4IHTA 2RC4A 4M74A 4GGGA 3ZP5A 3K69A 1SMYF 2JPCA 3M8EA 1ULYA 2VOOA 1ON1A 4HZFA 2OQGA 1XN7A 3F3XA 3MQ0A 2Q8KA 4G6DA 4G8XA 3JAMK 3FWEA 2K86A 3GZ6A 3GFJA 4R1HA 1TBXA 2PN6A 3MAJA 2ZMEB 2VBXA 3K1NA 3HRMA 2Y75A 1S7OA 4UVAA 3SZTA 1CGPA 3I54A 2QBYB 3F8MA 1MZBA 2B0LA 2IW5A 3IC7A 5AIQA 4RB3C 3HTSB 5L3DA 3ECOA 3L09A 2ADUA 3V7RA 2ESNA 3O2PE 3LFKA 3BJAA 2ZXJA 2E7WA 4KICA 3QAHA 5ICGA 2FSWA 3T8RA 4PCQA 4GXOA 1Q1HA 2NRAC 4WCGA 4P5OA 1QBJA 5H20A 4WXHA 2A6EF 3CO6C 4UVCA 1NHAA 2ZNYA 2O03A 2HS5A 1STZA 2XVCA 2O61A 1UB9A 5DCMB 4HLYA 3J81K 2H6BA 5ICEA 1KU2A 1PDNC 4I2OA 2IVMA 2DQLA 1QQIA 5BPIA 3F8NA 2D1VA 3I0TA 2M8EA 3M9AA 3WU1B 2XROA 3T8TA 3V8KA 4IRIA 5D5UB 1PP7U 3F6OA 3V8LA 5JR3A 3LQRA 4Y15A 1HW2A 3S2WA 4XSXF 1R23A 1TW2A 5IT9Z 5LHGA 2K7LA 1Z9CA 1R1TA 5A2QZ 4LLNA 1BI3A 2XHKA 4L0ZB 2OA4A 4OIQF 3QPTA 1WWXA 1W7PD 4Q5SF 4AD9A 3HRUA 3IRRA 4M6XA 4ON0A 4F7ZA 4PGGA 5FGMA 3QPHA 4MHGA 3KEQA 4HAMA 5DEQA 3B02A 3EQLF 5D4SA 3RI4A 2Z9OA 5DUKA 5E1WA 2RNJA 4L18B 5L3EA 1ZN2A 4I01A 1ZRCA 4EGYA 2HWVA 3GLXA 4ZH4F 3HHHA 2XAGA 3M8FA 3DKWA 4G7HF 4MEYF 5AONA 3ZQ7A 1G3TA 2ETHA 4U7DA 1FZPB 4BYYA 4EJTA 5CVJA 4ENMA 2UWMA 2CWEA 4S05A 1IN8A 5F1RA 1WKMA 2CO5A 2JT1A 2D2WA 2HQRA 5DYMA 4ZZDA 1KQ9A 1ZH5A 3WTYC 4KN4X 4FX0A 1OPCA 4KNYA 1B9MA 2XRNA 3KP2A 1DPRA 2DTRA 3B73A 1U5TA 4KUMA 1LEAA 3IKVA 1RIOH 1WRJA 1EH6A 3F72A 2V9VA 4H0EA 4LG0B 2F5FA 2BV6A 4YG2F 1P4WA 2Q0OA 1W4MA 3CUQB 3KP7A 4EV0A 4ENNA 1IXCA 2H94A 1B4AA 3WE2A 1HSTA 4CO8A 1BI0A 1S29A 3D5LA 4KA4A 3I64A 3DFGA 1T38A 1R1VA 1UHWA 2QENA 5J8FA 1JHFA 5BOXA 1I6XA 1UCRA 1TNSA 2MA3A 3MZHA 1MJBA 2HGCA 4RB2C 2GXBA 3CJNA 1YG2A 5KK1A 2FBIA 2STTA 5LLQA 1HQCA 5DD4A 1O7FA 2A5YB 2YSRA 1U5TC 1XGOA 2A61A 4NB5A 5A2QK 2UZKA 3E5QA 1REPC 4L9TA 2RKHA 4M9ZA 2OBPA 2GA2A 1WQ2A 5TRDA 3GWZA 1IXRC 2H6CA 1KA8A 3RKXA 1Z91A 1J5YA 3KCCA 3PFIA 3MCZA 3IRQA 1VTNC 3GXOA 2DAOA 5H6RA 3BY6A 3IHUA 5FLXK 5FD6A 4KIBA 1IN7A 4OIOF 3V7CA 2VODA 4I02A 2OU2A 2P6TA 3T0YA 1IXSB 4AVPA 5ILUA 1P4AA 4A0XA 2A68F 3QU6A 3RDIA 2DI3A 5CLSA 1BI1A 3IWZA 2IRFG 3GO5A 3P9IA 1IN6A 4KFCA 4PZJA 2VOPA 3VODA 1UFMA 3LA7A 5CVRA 1G3YA 1O3RA 2P5KA 4AWXB 1SD7A 2X4HA 1Z6TA 3EDPA 1S8NA 1LB2A 4OIPF 3SZPA 2WC2A 3HTUA 1G4DA 3JW4A 1ZGAA 3SXYA 1AOYA 4LD5A 2P7CB 5JVTA 2FMLA 4YIFA 3H92A 1KU7A 3EETA 2IPQX 1P4XA 2FXAA 1BOAA 1FOKA 1T39A 1HXDA 4BNCA 4XBFA 4ENJA 3TOAA 4OU0A 1OYYA 1XSDA 3R4KA 3ML6A 1R7JA 4R79A 2GA1A 3FMRA 4G7OF 2ZNZA 1LDDA 2Y0MA 2QQBA 2HKXA 2EFNA 1K6OA 1J9IA 2W85A 3WGGA 2JPBA 4WXDA 2VBZA 5L3FA 3N97A 1IN5A 4CICA 2J5PA 3DPLC 2KIFA 1ZGJA 2O3FA 4EM0B 3BZ6A 3DXJF 5LBQA 3O3KA 2FMYA 2O8XA 3TO6A 1K78B 4EJWA 2DT5A 3HRTA 1AWCA 1QPMA 4LB6B 1JGSA 1P92A 2VBWA 2PEXA 3LA3A 1D5VA 4CDGA 3I59B 4AIHA 3EYIA 1MDMB 3VFZA 1UHMA 2P4WA 2EJRA 3KP6A 3CLOA 3HRSA 1U6GA 3EYYA 2FBKA 3J81Z 2LDUA 5E8GA 1S3JA 3QU3A 1BN5A 4DNCA 2VXZA 5CYVA 1MGTA 4LJZF 3RPQA 2FOKA 1K79A 4IHSA 5F6FA 5HLIA 4OINF 4M9SA 2AXLA 4A12A 2CQKA 3BJOA 4Y13A 1YO5C 1HW5A 2Q2EA 3E6CC 3J80K 1J59A 4EM2A 1O3SA 1ZG3A 3WTVC 2W24A 3FXUA 2MLKA 2TDXA 1LQ1A 2HOEA 1T2KA 3E3VA 3ZMZA 4RB0A 3TQNA 4XLNF 2DPUA 3O6BB 4CXFA 2Y48A 4UHTA 1R00A 3WTTC 1F5TA 4ASNA 2KIMA 1MJAA 2FU4A 4IRGA 1BI2A 3D0SA 1XMKA 2O6GE 1XCVA 3F23A 1J75A 4HF1A 1QNTA 1FY7A 4O3MA 3E6MA 3J7AO 3AAFA 4G7ZF 3KP4A 2PLYA 4BXUA 2IA2A 2MD5A 3RPUA 3CO7C 2Z3YA 3HSRA 3REOA 3KP5A 2GXGA 2EA4A 5BQTA 3M1EA 3G3ZA 4KYWA 3VOEA 2ACJA 2DK5A 2L01A 1IF1A 3Q9VA 3CDHA 2HR3A 2F5EA 3MWMA 2V1UA 3F8FA 3OOPA 2RDPA 5LGTA 3FMQA 1T98A 2ZKZA 1YS7A 1BIAA 5LRSA 2D1HA 3HUGA 2QM3A 5J6XA 2DLLA 2HYFA 3C7JA 4LLGF 4BHBA 2OZ6A 4D0PA 1GHCA 2KJBA 5D4RA 3P9CA 3HSEA 4L9JA 2EB7A 4U88A 1I5ZA 4MTDA 3QP6A 4A5NA 1FC3A 1ZLKA 3Q9SA 1FSEA 2P5VA 3I5UA 2PI0A 1R1UA 4GYGA 1KYZA 4CHUA 3LA2A 3C1DA 1U78A 1FBUA 1SAXA 3R0JA 2P5LC 2DQRA 2M30A 2PJPA 2Z33A 2QVOA 3R60A 2XKOA 2MBFA 1BJAA 2MH9A 4RAYA 4ESFA 2YX4A 2D45A 2PFBA 2HDCA 3JTGA 1TW3A 2ZJ2A 2VT2A 1OKRA 5HDGA 1O3TA 3V8JA 1RNLA 3WTZA 5K5OA 1T6SA 3WTXC 4EVIA 3DQVC 3GYHX 2XAJA 1EV7A 2KRFA 1TTYA 5JI6A 4M72A 4P9FA 2Z5UA 1KGSA 2W57A 5FLXZ 1ODDA 1V4RA 4P9UA 5K5QA 1C0WA 2GIVA 2XV4S 2HQNA 4OOIA 2ESHA 1DP7P 5ILSA 3GX4X 1G6NA 2QBYA 3ZMSA 1QGPA 5FO5A 2XIGA 3RKYA 1FWZA 4MGRA 1LEBA 3WTSC 3M7GA 4HX8A 4ZYDA 1W5SA 3WGIA 4UUVA 4JQFA 1FP2A 3T1BA 1B59A 2EWNA 1G3SA 5LGUA 1TQMA 3I71A 5JHUA 2WV0A 4XLPF 3R0AA 2NNNA 4AIKA 2A07F 2ZCWA 4Z2YA 5EEGA 2QYOA 2JTVA 3QP5A 5BS6A 5CJ9A 2CG4A 4U0YA 2A3SA 1ZG1A 4N0BA 1LDJA 3E6BA 5DCMA 1H9GA 3DF8A 4NQWA 1GXQA 4Q4ZF 5F64A 2EV5A 4R8HA 4LLLA 4DQ2A 4HQMA 3GVAA 5H6QA 1Z6RA 2PMUA 4HQEA 1TQPA 4E70A 1D3YA 2RN7A 2L4AA 3HOTA 2PG4A 5E18F 3TDZC 2VN2A 1HSJA 2BYVE 2EFQA 1RUNA 1YW8A 5ICFA 1IN4A 4BH9A 1BC8C 2VT3A 1S7AA 2ELHA 3F8CA 4EJOA 2CFXA 1XGNA 3GEZA 4FX4A 1V3FA 2ZBKA 2M5WA 2UXXA 4N9IA 2P6SA 2R3SA 3LSTA 4MQ9F 1H0MA 1BM9A 1CF7A 2G9WA 1O57A 4OIRF 2YU3A 3KZZA 1JHHA 2FBHA 5TJJA 2FEZA 5K1YA 5L3BA 2FQ3A 4UVBA 2FE3A 1DPUA 1D8KA 3RYPA 3U2RA 3I58A 3GZ5A 3KEOA 1P2FA 1HKTA 4KDPA 4HOBA 3KETA 5LHHA 1X3UA 2HKOA 1YS6A 4L0YB 1QZYA 3F21A 3P9KA 4PGHA 3FF5A 2VC1A 4UNOA 4RGSA 1H9TA 1ZLJA 3WGHA 1IRGA 2LF7A 3J80Z 2DBBA 4LG0A 1Z1DA 5FD5A 1QZZA 2C6YA 2XAQA 4HW0A 3CUQA 4G9YA 5HS9A 1WI9A 5K5RA 5D5VB 4S04A 3GF2A 2F5DA 3DPTA 2XKPA 4I7HA 2VE9A 4A6EA 1O3QA 3F22A 2MC3A 3CUOA 5LEKA 3V7SA 3GW2A 4RGUA 5LHIA 1OYIA 4U0VA 5DCFA 1EH8A 5E1ZB 2V1XA 3FMSA 2CYYA 1KQ0A 3K9TA 4LGWA 4QWQA 1G3WA 5DUIA 2YPRA 4HDUA 1IRFA 1LDKB 2QLZA 1TQIA 1A04A 2IP2A 2M87A 4ZZLA 4OMZA 5D5WB 4IPAA 3H3ZA 1XSXA 2DPDA 4MTEA 1XSVA 2L3DA 3N4MA 2JSCA 4CGZA 4RS8A 4UXNA 3CUQC 2XASA 3HYIA 2LKPA 1IZ1A 3PQJA 6PAXA 1U8RA 4HDVA 3FHZA 4WXCA 3V4GA 3Q5FA 4BAYA 3E97A 3C3WA 2K02A 5HS8A 4I0BA 4EGZA 3PQKA 3EUHA 4Q47A 3TDUC 2DW4A 1LJ9A 2HTSA 4KIFA 2A69F 5HLHA 1QO0D 3R6SA 4GO1A 3VB2A 3WTUC 2GZWA 4L5IA 2GAUA 1XDUA 3ZMVA 2WWYA 5FFXA 2CGPA 4IF4A 1ZAOA 4IRHA 2K27A 3KLOA 2G7UA 1YW9A 3I4PA 1ZG5A 5ED4A 4HBLA 4MQVA 3IKTA 3COAC 4LFUA 1LNWA 4IXAA 4I0AA 4XSZF 1I1SA 4YIIA 4KN7X 4WK8F 4GYIA 2OD5A 2LNBA 2ZFWA 3WODF 3IL2A 1LVAA 4KMFA 1B1BA 1FYMA 1FBQA 3BP8A 1USTA 4K2EA 4MEXF 1FX7A 2OZUA 4CZZA 2XAFA 4JK1X 2PMHA 2BE5F 5BPDA 4QLCU 2IA0A 1R36A 5LRRA 1RI7A 3K2ZA 1BC7C 2FNAA 3BWGA 4MNUA 1B9NA 3SFZA 1SD6A 2NNYA 1B6AA 1GXPA 1IAWA 3HIFA 2YX7A 1DUXC 1W7PA 2EFOA 1KU9A 1WSUA 5HOOA 3WTWC 1F1ZA 4XRFA 5D8LB 2BEOA 4PDKA 1K7AA 3NQOA 4ESBA 4P55A 3P7NA 4RGXA 4IVNA 3FX3A 5D6EA 1SD4A 4NHJA 1I1GA 2M45A 5IT3A 1K78A 5D8KB 3TKYA 2HEOA 5E20A 1U5TB 4YFNF 2IT0A 1FPQA 2CW0F 2UXNA 3I53A 3OV8A 2KKOA 1YW7A 1R58A 4A2UA 3BOQA 2CSOA 2IJLA 3I59A 1MDMA 4FHTA 3RTRA 3WG9A 3RJPA 3DP7A 2H09A 2L4MA 1YLFA 4CYDA 4LK0F 3K0LA 2RVCA 3ULQB 3LWFA 2X0LA 3WE3A 4ETSA 3T5XA 3TGNA 3FM3A 4BQAA 3SQNA 4HLXA 3K1PA 2EA2A 5LGNA 2KIUA 3FXQA 3HOSA 2JZYA 1YQAA 4EQQA 1TNTA 1U2WA 3WU0A 1MJ9A 3MFKA 2EV6A 3ZMDA 4KMUX 4AIJA 4EJUA 4HA8A 1I27A 2LSOA 2DO7A 3F6VA 4IJAA 2EFPA 2V79A 1ZARA 4U7BA 1OYWA 3E5XA 1R22A 1XD7A 4LK1F 3LAPA 4G6QA 1RUOA 3GFLA 1SFEA 4Y17A 4M6YA 3LQQA 1IUYA 2W84A 4M71A 2FA5A 3ZMTA 4L5JA 1HKQA 2A6HF 4ENKA 4OMYA 3JTHA 2ZMEA 1T0FA 1CF7B 4KIGA 4HYEA 2FRHA 3CTAA 1JE8A 3E6DA 4LMYA 2RV8A 1YFHA 1U3EM 3KE2A 1XGMA 3KFWX 1OMIA 4KT5C 1L0OC 4WF2A 3LAJA 2R7DA 3VEPA 2DK8A 1F9NA 1R5GA 1HKSA 3GFIA 1SFUA 5J8CA 2OQRA 4UV8A 2YR2A 4N9HA 2BGCA 2XUBA 5FB2A 4HX4A 3ZN0A 4A0ZA 2COMA 3NEUA 4YFKF 3QOPA 1FSHA 4G94A 2P8TA 3ERED 2F5CA 1KQ8A 3IWFA 3ISPA 3BDDA 1HBXG 4EM1A 3QRFF 2E7XA 2HZTA 2BBYA 1O7LA 1BBYA 2R7FA 2L02A 4HV6A 1ON2A 1J2XA 5ERIA 2KJCA 5CVUA 1HW1A 2JRTA 2HFHA 1FP1D 3NRVA 3BJ6A 2GWRA 1S6LA 2K4JA 3ROUA 2XAHA 3MEXA 5E8IA 2STWA 3KLNA 4FT8A 3ECHA 1Y0UA 5CVVA 3FXRA 2MLGA 2WTEA 1DDNA 3GFMA 3JSOA 2L54A 4EJVA 2LF8A 3R61A 4HF2A 4ZYEA 5IT9K 1MKMA 2ZO4A 2ISYA 1FNNA 4B8XA 2AS5F 2GQQA 5DDGA 3ZPLA 1XMAA 1ZRFA 2VE8A 4WX9A 5DD8A 1TLHB 3W6KB 2E1NA 3H3UA 2DFIA 3HSFA 4EMSA 1F4KA 1PUEE 2EK5A 1YIOA 1ZYRF 5AIPA 5DV5A 4UV9A 2OAZA 4I98B 2ISZA 4L9NA 2EFWA 3C18A 1JXSA 1GVJA 1Z05A 2QQAA 2G7HA 2NAZA 4O6JA 1J7KA 1FT9A 2FNPA 3KZYA 3ZN1A 4HX7A 3JSPA 1BIBA 4I09A 5D5XB 5CVIA 2RGVA 2E1CA 1E2XA 1L3LA 5D6FA 2J5OA 3L2CA 1ONVA 3DV8A 4L9VA 1OR7A 5BMZA 5E1XA 2M1BA 1MD0A 2V6CA 5HLGA 3L7WA 3FM5A 5JFRA 3G73A 4RGRA 2PBIA 3BPXA 1PP8F 1ZRDA 2RQPA 2VBYA 2H27A 5HDKA 1SMTA 1KYWA 2NS0A 1RZ4A 1SD5A 5E17F 2QUFA 4YFXF 2QZ8A 4HV5A 3K1MA 2EV0A 3FZVA 4ZYGA 3ABTA 2O0YA 2PQ8A 3GUDA 1KU3A 2F2EA 4RAZA 4A5MA 4O5VA 2Z99A 2QWWA 3TO7A 1YTYA 1XGSA 1USSA 5HVQC 3TOBA 3JAMZ 2FF4A 2K4BA 2VC0A 4M9XA 1EH7A 1FYKA 4P96A 1W7PB 5EEHA 1P6RA 2V1DA 2DU9A 1Z7UA 4LB5A 2VONA 1R5HA 3U1DA 1E17A 2NYXA 5ICCA 1XB4A 1ZHFA 2HTJA 1FLIA 4B09A 4RB1A 4BHPA 2MH2A 5LEJA 1J0RA 1D8JA 3KP3A 5KVRA 3ZMUA 3SHFA 2P7VB 4WWCA 3U9GA 5L3GA 1SFXA 3L00A
chains in the Genus database with same CATH superfamily
1FBSA 3ABUA 2R7VA 4GCVA 2L2OA 4W1UA 2DA3A 1X4PA 5GAEJ 3BR0A 2E1OA 3KYLA 3L2QA 4HF0A 1FYLA 4ZYHA 3MZYA 3RKWA 2ME0A 4BHCA 1H88C 2PX9A 4KISA 3L9FA 3BROA 2DODA 1X1PA 4A3MJ 3TO9A 1ENHA 4TV7A 2R7TA 2EZKA 3ELKA 4E6KG 2Y0SN 3BPVA 4A0YA 1DGRM 3E5UA 2JSPA 4CCMA 2HPIA 4DBQA 4GDFA 1XCBA 4M73A 3BR3A 1YYVA 5HS7A 5J1UA 4KT6A 4F52A 3K4CA 4C2MJ 3HHGA 5FRMA 3W6JB 2IA1A 4I6ZA 1VQKI 2YS9A 4Q48A 2M9HA 3RIRA 2E19A 2TCTA 4JBAA 1WJBA 2WY7Q 1ETKA 3RYRA 1E3OC 2GLOA 1P9QC 3S8PA 3FHNA 5ILVA 2W25A 2AQEA 2OC6A 5HDNA 1G8XA 4A6DA 4ESJA 3F8BA 1R5ID 5L3CA 2XGEA 2DCEA 2OUMA 4U0WA 2H1KA 3MKLA 1IW7F 3TBIA 1W5TA 3TW7A 1MH4A 1ZREA 5FFZA 2Y69H 2XGXA 4DYRA 2CU7A 2QQ9A 2HYGD 4NDLA 3DEUA 1XDSA 4IHTA 3OYCA 3UNGC 2R7XA 1MW7A 3OYBA 2RC4A 4M74A 3I4NJ 2X6OA 4GGGA 3ZP5A 1I3QJ 1WPKA 3IUOA 3K69A 1UHSA 3N05A 1SMYF 2JPCA 3K6GA 1OCTC 2E60A 1OCRH 2RNGA 3M8EA 1ULYA 4XLFA 2VOOA 1ON1A 1RKWA 4HZFA 1I3AA 2LLKA 2OQGA 1XN7A 1BL0A 3F3XA 3MQ0A 2Q8KA 4G6DA 2JWTA 2OTJI 4G8XA 3JAMK 3FWEA 2ZJPF 1G2HA 5M5YJ 4LITA 1UG2A 2K86A 3GZ6A 2QSGX 4E4HA 3GFJA 4R1HA 1TBXA 2PN6A 2X1DA 3FXJA 3MAJA 4NNJA 2ZMEB 4XOTA 1MMSA 2VBXA 3K1NA 3HRMA 2BXYA 4FE7A 3CD6I 2LBFA 2Y75A 2QF7A 1S7OA 2M4GA 4UVAA 1FTZA 3SZTA 1YJWI 1CGPA 3O8GA 1YIJI 1B8IA 5LFAA 3I54A 3LSHA 2QBYB 3F8MA 3U1KA 1MZBA 2B0LA 2IW5A 3IC7A 5AIQA 4RB3C 2X48A 3HTSB 2CRGA 5L3DA 3MKZA 2LVSA 5F27A 4F91B 2HQ5A 3ECOA 3L09A 4OAYA 4HPQA 3JRIA 3A01B 3OYNA 3W2VA 2DOAA 2ADUA 2VJ4A 3V7RA 1QHGA 2ESNA 1E3PA 2ID6A 5FKOA 2LK2A 4CA0A 3O2PE 2V4JC 3LFKA 3OYGA 2B7EA 4XORA 2F4IA 1ZELA 3BJAA 3GTLJ 2ZXJA 1MBHA 2E7WA 2DDBA 2EBIA 4KICA 4PUSA 1BW5A 3QAHA 1Q1VA 4ZC3A 5ICGA 2KHMA 3J7AY 2FX0A 2FSWA 3ZQHA 4CUGA 1MSFC 3T8RA 4PCQA 2K9NA 4GXOA 2FOWA 1Q1HA 3CCUI 2NRAC 4WCGA 4P5OA 1QBJA 2XDVA 1LE8A 1X4OA 5H20A 3HBLA 2NXNB 4WXHA 2A6EF 3OIOA 3CO6C 4UVCA 1TT0A 1XG1A 2R7WA 1NHAA 2ZNYA 4XN0A 2O03A 2HS5A 3LMMA 4AUXA 3K4JA 1STZA 3QPLA 1OJLA 2XVCA 2O61A 1IUFA 1UB9A 5DCMB 1Y39A 4HLYA 2R7QA 2HNHA 4NQWB 3J81K 2H6BA 5ICEA 1KU2A 1PDNC 2ZC2A 4I2OA 2IVMA 2DQLA 1QQIA 4DBRA 3BCAA 1F43A 5BPIA 1I39A 3F8NA 1MH3A 2D1VA 4IX7A 1CQTA 1MMGA 3I0TA 2M8EA 3M9AA 3WU1B 2XROA 3T8TA 2AO9A 1SC7A 2ZXIA 1VQOI 1SANA 1SFKA 3V8KA 1OCOH 4IRIA 5D5UB 2E36A 1PP7U 4IOCF 2W1OA 3DTEA 3F6OA 1XPXA 3V8LA 5JR3A 2DA5A 3LQRA 3K4LA 1QU3A 4Y15A 1TL8A 4RDUA 3SEZA 1VQMI 1HW2A 1WJ5A 3S2WA 4XSXF 1R23A 1TW2A 1DP3A 5IT9Z 5LHGA 4XR6A 1VQ5I 1VNDA 1MIJA 2K7LA 3H5NA 1EA3A 4BY7J 3NWTA 2E34A 3IAM2 4F55A 3PIPF 3CDLA 3TL4X 1Z9CA 1R1TA 4IL6C 3AG3H 2LKSA 5A2QZ 2EZLA 4LLNA 1BI3A 4XM3A 2XHKA 4L0ZB 1TC3C 2OA4A 4OIQF 3QPTA 1WWXA 3GTOJ 1W7PD 4Q5SF 4AD9A 3HJEA 4CYCA 2R5YA 2XF7A 5IP9J 3HRUA 3IRRA 2BVLA 1T8IA 4M6XA 4GFBA 2MABA 4ON0A 2ZSIB 4BJ6C 4F7ZA 1TWCJ 2M0MA 4M6VA 3S1QJ 2KDZA 4PGGA 5FGMA 1ERDA 1VF9A 3QPHA 4MHGA 3KEQA 4HAMA 5DEQA 4B48A 1D1BA 3H1CA 3B02A 3EQLF 3CC4I 3ABLH 5D4SA 2JVGA 3RI4A 2Z9OA 2NS8A 5DUKA 5E1WA 4CZCA 2RNJA 1WH5A 4L18B 5L3EA 3KIOA 1ZN2A 1V55H 4I01A 2XF5A 1ZRCA 2M4KA 4EGYA 2JA5J 2HWVA 4G6TB 4XMYA 3GLXA 4ZH4F 3HHHA 2XAGA 3I3LA 3OYMA 3M8FA 4NUBA 3DKWA 4G7HF 4MEYF 5AONA 3RQIA 1G3TA 2ETHA 3ZQ7A 4U7DA 1FZPB 2WV1A 3HG9A 4BYYA 1JJ6C 4EJTA 5CVJA 4ENMA 4Y7NJ 2UWMA 3S3OA 2CWEA 3K2AA 4S05A 3BG9A 2HVQA 1IN8A 5F1RA 1WJAA 1WKMA 2CO5A 5EGOB 3ZQCA 2JT1A 2D2WA 1WJCA 4E7ZA 2HQRA 5DYMA 4ZZDA 1QVUA 1KQ9A 3IV5A 1ZH5A 4A3EJ 2DDAA 2LRDA 3WTYC 4KN4X 4FX0A 1OPCA 4KNYA 2GXAA 1B9MA 2Z2SB 2XRNA 3KP2A 3E7LA 1DPRA 4V19K 3W2WA 3S2HJ 1P7JA 2DTRA 3B73A 2AQFA 2YU9J 1EJ9A 1U5TA 3L2VA 4KUMA 5H2FC 4B47A 1LEAA 3IKVA 1JKQC 1RIOH 1WRJA 1EH6A 1JI8A 3F72A 2V9VA 4H0EA 3S1MJ 4LG0B 2F5FA 2BV6A 4YG2F 3U21A 1K4SA 3CJQB 1IDZA 2KDOA 2KQRA 1P4WA 3L2WA 2Q0OA 3S3MA 2DN0A 1W4MA 3CUQB 1HC8A 1FTTA 3KP7A 4EV0A 4ENNA 1IXCA 2H94A 1B4AA 3WE2A 1HSTA 5JVGF 4CO8A 1BI0A 1S29A 3D5LA 3H0DA 4KA4A 3I64A 1Y0NA 3OS1A 2DTZA 2HPMA 1S7EA 5TISC 5E3OA 2W82A 1VQ9I 3DFGA 3DWLE 1T38A 1R1VA 4UUSA 1SAUA 1WJDA 1UHWA 2QENA 5J8FA 3VSKA 1JHFA 5CKTA 1FMVA 4JOMA 2X9DA 5BOXA 5J4YA 2LOOA 3DU5A 1I6XA 1UCRA 2MA3A 1TNSA 4HEA2 1MJBA 2HGCA 3MZHA 2KLOA 4RB2C 3GTGJ 2GXBA 3CJNA 2Y31A 2BHZA 1YG2A 4LOCA 5KK1A 2Y9YA 2FBIA 2STTA 5LLQA 3LFUA 1HQCA 4XONA 5DD4A 1O7FA 2A5YB 1X1DA 2YSRA 1U5TC 3H35A 1XGOA 3PUFA 3Q3SA 2EH3A 2A61A 4NB5A 3HOVJ 2LD5A 5A2QK 2ZFUA 1MMNA 2V6EA 3QYEA 4IQ4A 2UZKA 3E5QA 3K70C 1QVTA 1REPC 2OV7A 4L9TA 5GAHJ 5GTIC 5C44J 1FJLA 4N4NB 2RKHA 4M9ZA 4PSXA 4MO7A 2OBPA 1VI0A 5M3FJ 2BW3B 3TP0A 2FJ1A 2GA2A 4RMNA 1WQ2A 3AFHA 4RAGA 2RQQA 3GWZA 5TRDA 1IXRC 1MNDA 1KA8A 1V54H 2H6CA 4C30A 3RKXA 1Z91A 4A3DJ 1J5YA 5KAIC 4ANJA 3DLLF 3KCCA 4M3GA 4AU7A 3PFIA 4FTHA 3MCZA 2DFEA 3TEDA 3IRQA 1VTNC 4XKVA 3JRFA 3GXOA 2DAOA 1MBFA 5M5WJ 5H6RA 1X58A 2F4MB 2QKLB 3SDGA 2KZGA 3BY6A 4E7IA 4NBQA 3IHUA 5FLXK 2IS2A 2L9SA 5FD6A 4KIBA 5E3NA 1IN7A 1XTAA 4IKFA 3DCFA 4OIOF 2DA2A 2H1LA 3V7CA 1W36D 2VODA 4B3AA 1LUJB 3IH3A 4I02A 5EEAA 3FBIB 2OU2A 2P6TA 3T0YA 1IXSB 1YX5A 4AVPA 5ILUA 1P4AA 2TRTA 4A0XA 2A68F 2EIJH 3QPSA 2DYRH 3TW6A 4BS9A 3QU6A 1MNEA 3RDIA 2DI3A 5CLSA 1GV2A 1BI1A 1MBEA 2VPRA 3IWZA 2IRFG 1VQ6I 3GO5A 4XQFA 5C4XJ 3P9IA 1IN6A 4KFCA 4PZJA 1YJNI 5FROA 4LG3A 3ZQIA 3VODA 1UFMA 2VOPA 3LA7A 5CVRA 1G3YA 1QZEA 3OSGA 2JA8J 1O3RA 2QCOA 3HKZN 2P5KA 2CW8A 4AWXB 1SD7A 2HOSA 2M3AA 2V9PA 5EDNA 4A3FJ 2X4HA 1Z6TA 3EDPA 1S8NA 2WAQN 2FUG2 1LB2A 3G1OA 2DOFA 2WB1A 2R7ZJ 1ETWA 4OIPF 3SZPA 2DJIA 4C2TA 1FMWA 2W48A 3JREA 2WC2A 1K83J 3HTUA 1ETQA 4XK4A 2XSJC 1G4DA 3JW4A 2A05A 3QYFA 1ZGAA 4N4OB 1GDTA 4BGDA 4UUTA 3SXYA 3CDIA 2ZJRF 4LD5A 4BE0A 1AOYA 1D0ZA 3VPRA 3NARA 2OPTA 5J3LA 2P7CB 5JVTA 2FMLA 2DXIA 4YIFA 3H92A 4XICA 3EETA 1KU7A 2IPQX 4ITVA 1PVEA 5B3SH 3I4MJ 1P4XA 1YRNB 2XGDA 1XX5A 2FXAA 1BOAA 1FOKA 1AKHB 4FQGA 2QSFX 4BQNA 1T39A 1JUMA 1S5LC 1HXDA 4BNCA 4XBFA 2A5WA 1SVMA 4FE4A 2NOJB 3D1NI 2QSHX 4ENJA 2L9NA 2X6YA 3TOAA 3PO2J 3PJRA 4OU0A 1OYYA 2JJ7A 1NK3P 2JRMA 3FK6A 2KRHA 4D1QA 3R4KA 1XSDA 2CQ7A 2AXTC 3ML6A 3HZJA 1R7JA 3PL8A 4HG2A 1RRJA 3CMAI 3SJMA 4R79A 1Z3XA 2GA1A 2E71A 2M7BA 1QRYA 3EPZA 3FMRA 4G7OF 2ZNZA 1LDDA 2Y0MA 1QA6A 2OF7A 2QQBA 2HKXA 3SEQA 5GPCA 2DJNA 1Z77A 2VKHA 3QWLA 4QIWN 2EFNA 1K6OA 4JP0A 1X1CA 4RBOA 4J01A 4AIDA 1J9IA 2W85A 3WGGA 3MZ8A 5E3LA 2JPBA 4WXDA 2VBZA 1A6IA 5L3FA 2VJIA 3N97A 1IN5A 4CICA 1JTYA 4P1WA 2J5PA 1T95A 4ZYAA 5B5EC 3ZQFA 3S17J 2LBFB 1D0YA 3DPLC 4RAFA 2KIFA 1LVKA 1ZGJA 2O3FA 4EM0B 3BZ6A 3DXJF 5LBQA 3O3KA 5GAGJ 2O9LA 2BHYA 1V5FA 4B4CA 1OCPA 4D7NA 4BKXA 2DMTA 4BEHA 2FMYA 2M2EA 2O8XA 2IS6A 3TO6A 1U8BA 1SVOA 1IGNA 1K78B 4EJWA 2NVUB 2DT5A 2LKXA 4M3FA 3HRTA 4U87A 3G2BA 3JCUC 1ETVA 3WG7H 4D7MA 1AWCA 3BZCA 1GVDA 3HOZJ 1QPMA 4OWRB 4X6AJ 4LB6B 1JGSA 1P92A 1EKEA 2VBWA 4Y4RA 4HNUA 2PEXA 3LA3A 5J1YA 3CCVI 3ASOH 1OISA 2COBA 2CUJA 1D5VA 4CDGA 2E35A 3I59B 4AIHA 3EYIA 1MDMB 3VFZA 5FKNA 3KYCB 1UHMA 2X51A 2IGNA 4AYBA 2P4WA 2R93J 5IP7J 2JQ7A 2EJRA 1Z7LA 3KP6A 3CLOA 3HRSA 1ZGWA 1U6GA 2IXSA 2MD0A 3EYYA 2FBKA 3J81Z 2LDUA 2G0EA 5E8GA 1S3JA 3QU3A 1BN5A 2VUMJ 2KIQA 3BTJA 2E1MB 4DNCA 2VXZA 5CYVA 1MGTA 4LJZF 3RPQA 2FOKA 1B72A 3VYUB 1K79A 4IHSA 5F6FA 5HLIA 4OINF 4M9SA 2AXLA 4A12A 1XMXA 3K10A 2CQKA 3BJOA 4DIQA 4A3BJ 2EIKH 3IH4A 3OY9A 3PFYA 2GOXB 4Y13A 1YO5C 1HW5A 2Q2EA 3E6CC 4A3LJ 2VJJA 3J80K 4EM2A 1O3SA 1J59A 2MGQA 2CS3A 1ZG3A 3CJTB 3WTVC 2W24A 3FXUA 2VPLA 2MLKA 2TDXA 1LQ1A 2HOEA 1T2KA 3E3VA 3EUAA 4RB0A 3ZMZA 3ZR8X 2VI6A 2HOTA 2R92J 5EG0B 2VQGA 3LSKA 3TQNA 4XLNF 4NC6A 1R9TJ 2DPUA 1WVRA 3O6BB 2MC4A 4CXFA 3BG6A 2BZTA 2OTLI 4FCYA 3I55I 4UB6C 3PUBA 3S15J 1X2NA 1XS9A 2KFDA 2Y48A 3ZQLA 4XLCA 4UHTA 1R00A 3WTTC 1TWHJ 1F5TA 2KZVA 4ASNA 2KIMA 3CMMA 5M3MJ 2NVQJ 3OS0A 1MJAA 1VFCA 2FU4A 1YOVB 4IRGA 1BI2A 3D0SA 1X1AA 1XMKA 2O6GE 1XCVA 3F23A 1J75A 4HF1A 1QNTA 1U0JA 1FY7A 1K6YA 3BR1A 4O3MA 3E6MA 2YUSA 2Q1ZB 3TMOA 3J7AO 3OIPA 3AAFA 2HDWA 4G7ZF 5F0CA 1D0XA 3HC7A 1PJRA 3KP4A 2PLYA 3UR3C 2CQQA 1N25A 1Z21A 4BXUA 2DA4A 4XLEA 2P0WA 2IA2A 5EYRA 3GMEA 2MD5A 3RPUA 3WHBA 5EF6A 1VQLI 2X6WA 3FBNB 3CO7C 4Z6YA 2Z3YA 3HSRA 2HVSA 5J1RA 2D5VA 1PYVA 3H0GJ 3KP5A 2GXGA 3REOA 1Y1WJ 1JKOC 2EA4A 5BQTA 3M1EA 3G3ZA 4KYWA 3VOEA 3KPHA 4MIMA 1VQNI 3OYFA 2DK5A 2ACJA 3QQAA 3S93A 2L01A 4ZJZA 1IF1A 2I5UA 3Q9VA 3CDHA 3Q0VA 3DKYA 4C9YA 2R4GA 2HR3A 2F5EA 3DEEA 3MWMA 2V1UA 2M7AA 3F8FA 1RKTA 4CCOA 3OOPA 2DMUA 1RC9A 2RDPA 3DPUA 5LGTA 1R6RA 3FMQA 2ZJQF 1T98A 2ZKZA 5FRNA 1YS7A 3ONQA 1BIAA 2VQCA 1U9NA 5LRSA 2D1HA 3HUGA 1HF0A 2QM3A 5J6XA 3RZDJ 2DLLA 3OYLA 2HYFA 3C7JA 4LLGF 1N77A 4BHBA 5J47A 2OZ6A 4D0PA 1GHCA 4ZTJA 1ZQ3P 2KJBA 5D4RA 3BR5A 1IRXA 2L5QA 1W1WE 3P9CA 3K4MA 3HSEA 4L9JA 2EB7A 2CFOA 2K40A 1N75A 1NTCA 4XKWA 3OL4A 1ZKGA 5KHDA 2PJRA 4U88A 2F4OB 2KMUA 1I5ZA 1O4XA 2CH0A 5F1JA 4MTDA 1BR1A 5F0HA 3QP6A 4A5NA 1FC3A 1WFXA 1IO2A 4JX4A 4C3HJ 1IC8A 1ZLKA 3Q9SA 1FSEA 2ELJA 3HGYA 2CUEA 3SZGA 2P5VA 3I5UA 2PI0A 3FXLA 2BY3A 2MYSA 1R1UA 4GYGA 3K4BA 1KYZA 4CHUA 3LA2A 2IGMA 1JKPC 3C1DA 3P5JA 1U78A 2LREA 2VXDA 5FKMA 1IDYA 1FBUA 2CQXA 2DA7A 2EINH 1SAXA 3R0JA 2P5LC 1NK2P 2DQRA 2LTPA 1HDDC 4IHVA 3CP2A 1Y6IA 1H89C 2M30A 4XNFA 2PJPA 5J40A 2BY1A 2Z33A 4IZZA 4UB8C 2QVOA 3R60A 5K7HA 2XKOA 2MBFA 4QSHA 5F0FA 1BJAA 2MH9A 1I50J 4RAYA 4ZDPA 4ESFA 1V5GA 2PMZA 1A6QA 2YX4A 1FOWA 5DS9A 2D45A 2PFBA 2HDCA 3QODA 5IP6A 3JTGA 2BY0A 1PUFB 1TW3A 2ZJ2A 5DTDA 2VT2A 1OKRA 3OWTA 2L7KA 5HDGA 4DOZA 1O3TA 2L7ZA 3V8JA 1RNLA 3WTZA 5K5OA 1T6SA 2H8WA 3WTXC 3QYBA 4EVIA 4ZTFA 3DQVC 3GYHX 2XAJA 4BJ5C 1EV7A 3JRCA 2KRFA 1TTYA 5JI6A 4M72A 4P9FA 2Z5UA 1KGSA 2EZHA 2W57A 2M8GX 5FKLA 5FLXZ 3FK7A 3BZKA 1ODDA 1V4RA 4P9UA 3CZ6A 3MKYB 4C3JJ 5K5QA 1C0WA 4PJ0C 2R7RA 2GIVA 2XV4S 1JTXA 2K9LA 2BXZA 2HQNA 4PFPA 4OOIA 5IY5H 3S2DJ 3A0HC 2ESHA 1SVLA 3DTIA 2EPFA 3FXMA 4PFOA 1GV5A 5GADJ 3JRBA 1GUUA 1DP7P 3A1YA 5ILSA 3GX4X 2K9QA 1G6NA 5B1BH 2VL8A 2QBYA 2LY1A 3ZMSA 1R71A 1QGPA 3LSIA 5FO5A 2XIGA 3RKYA 3RZOJ 3BTCA 3VWBA 1FWZA 4H4KC 4DW6A 3A01A 4MGRA 1LEBA 3WTSC 3M7GA 1VQ4I 4HX8A 1RR7A 4ZYDA 1E0EA 1W5SA 3WGIA 4UUVA 4JQFA 1FP2A 3T1BA 1B59A 2EWNA 4XLHA 4YELA 1G3SA 2K3PA 3WHCA 4BACA 3AL0B 5LGUA 1TQMA 3I71A 5JHUA 2WV0A 4XLPF 3KEYA 3R0AA 3LSPA 2NNNA 4AIKA 2A07F 3HOUJ 1A35A 1FIPA 2ZCWA 4Z2YA 5EEGA 2QYOA 2JTVA 3QP5A 5BS6A 1IV6A 5CJ9A 2CG4A 3F0CA 1YITI 4U0YA 2A3SA 1AU7A 3OYAA 1ZG1A 3S1RJ 4N0BA 4Y3OA 2VASA 1YI2I 3Q0WA 5HLTA 1A36A 2WAEA 3JR9A 1LDJA 2ZXWH 2XB5A 2ZMEC 3E6BA 5DCMA 3Q0UA 4A93J 1H9GA 1T0FC 2IGOA 3DF8A 4NQWA 4BBSJ 1S72I 1GXQA 4Q4ZF 2Y9ZA 5F64A 4A69C 2EV5A 4R8HA 3S1NJ 2GM4A 4LLLA 4DQ2A 3FKIJ 3GVAA 2GIZA 4HQMA 5H6QA 1S9HA 3K4NA 4IEJA 4B3XA 2XPUA 1Z6RA 3LSMA 4IOAF 2LY2A 3CMYA 2R5ZB 1JKRC 2PMUA 4HQEA 1N78A 2LY9A 1MBKA 1BR2A 1TQPA 4Y33A 3G6EI 1SFOJ 4E70A 2JMWA 2DFFA 1D3YA 3S16J 3JRHA 2RN7A 2L4AA 3HOTA 2PG4A 1APLC 4BDZA 5E18F 4F92B 3TDZC 2CV0A 4QTRA 2VN2A 1HSJA 2BYVE 2EFQA 1RUNA 1W5CC 1YW8A 2CQNA 4A3JJ 2ZSHB 5ICFA 1IN4A 2ZXHA 4BH9A 3GCMA 1BC8C 4HNTA 2N8GA 3GTKJ 2VT3A 3M4OJ 3DBHB 1X3WB 1S7AA 1DU6A 2ELHA 3F8CA 4EJOA 2CFXA 4IQJA 1DGWY 3A02A 4B1RA 1XGNA 3GEZA 3FDYA 2K3FA 1ZR4A 4YEJA 2XSDC 4FX4A 1V3FA 3HGGA 2ZBKA 2M5WA 2UXXA 4N9IA 2I10A 2P6SA 2R3SA 4V2FA 3LSTA 4ZDLA 3X2QH 4MQ9F 4YIRX 1H0MA 1BM9A 1CF7A 2G9WA 1O57A 3GBGA 4RM3A 4OIRF 3ZOBA 2HOAA 2YU3A 1R4NB 5C3EJ 2R7OA 3KZZA 1JHHA 2FBHA 2E5NA 5TJJA 2FEZA 1F36A 1UAAA 1TWGJ 5K1YA 3VYRB 2VIXA 5L3BA 1TWFJ 2X1CA 2FQ3A 2LC2A 3E1SA 1K61A 5GPAA 4UVBA 3K70D 1JUPA 2FE3A 1DPUA 1D8KA 3RYPA 3U2RA 1IG7A 2DA1A 3I58A 3GZ5A 5E3MA 2E2JJ 3KEOA 1P2FA 1HKTA 3LOCA 1HDPA 2L0KA 1X19A 1YX3A 2L7FP 4G12A 4X0GA 5EGOA 3OMYA 5M5XJ 2HXIA 4AC0A 4KDPA 2DT7B 4HOBA 4B44A 3KETA 4BXXJ 5LHHA 2JK3A 1X3UA 2HKOA 4JX6A 1YS6A 2UUZA 1QZYA 4L0YB 4MFDA 3H3VK 3F21A 3P9KA 1J09A 5EZGA 1BJZA 3GTMJ 4PGHA 3FF5A 2VC1A 1BA5A 4UNOA 3UKGA 4RGSA 3K7AJ 5HNHA 1VQPI 1H9TA 1ZLJA 3WGHA 1IRGA 2DA6A 3DKXA 2LF7A 2MW8A 3SFIA 3J80Z 3E0JB 2DBBA 2BOLA 3TP3A 1QHHD 4LG0A 1FIAA 1Z1DA 5FD5A 5GP9A 1QZZA 1M1EB 2XAQA 2C6YA 2CUZA 2VB6A 1W0UA 1D1CA 4HW0A 2HZDA 3HOYJ 4A3CJ 2LG4A 3OIQA 4DZJA 3PNVA 1K4TA 3CUQA 4G9YA 2HXOA 3M07A 5HS9A 1WI9A 5GTHC 5K5RA 2OCCH 5D5VB 4S04A 3GF2A 2F5DA 2KP6A 1IRZA 2WADA 3ABMH 2X6XA 3DPTA 2XKPA 4CSWA 3H36A 4C3IJ 1Y8RB 3PM1A 4I7HA 2VE9A 5IOZA 4XOPA 1X2MA 4A6EA 1O3QA 2O5RA 2NOGA 3F22A 2QGUA 3G71I 1MMAA 4BDYA 1WJEA 2MC3A 3CCEI 3NWSA 3CUOA 2VLAA 3ZXSA 5LEKA 3V7SA 3GW2A 5FKKA 3B6CA 4RGUA 5LHIA 3OS2A 4XKCA 3NAUA 3HPHA 3D5RC 1OYIA 4U0VA 5DCFA 1IJWC 1EH8A 5E1ZB 3C2HA 1MNMC 4DYQA 1I6HJ 2V1XA 3FMSA 2CYYA 1YHQI 2Y0SA 3JRAA 3LSGA 1KQ0A 3K9TA 4LGWA 4QWQA 1G3WA 5DUIA 2YPRA 2K9MA 4HDUA 1IRFA 1LDKB 2QLZA 5CPRB 1TQIA 1A04A 3M3YJ 3GTQJ 2GOMA 2IP2A 1JGGA 2M87A 5IYDJ 4ZZLA 2DMQA 3M1CA 1ZK8A 3AL0C 4OMZA 5D5WB 2XC7A 1RESA 3BG5A 4XKBA 1B8IB 2XGCA 2BW3A 1OR7C 4IPAA 3H3ZA 1XSXA 2WB1N 4RLFA 1XSVA 4MTEA 2L3DA 3LSJA 3N4MA 2I8DA 2DPDA 2JSCA 4CGZA 4RS8A 4UXNA 2ECCA 4AVZA 3CUQC 2RAEA 3OR2C 2XASA 3FXOA 3HYIA 2LKPA 1AHDP 3K4KA 4D5FA 1A5JA 1IZ1A 3PQJA 4MFEA 6PAXA 1U8RA 2DMPA 3M8JA 3A0BC 2IS4A 3ZCOA 1WZ2A 4HDVA 2JA7J 2R0QC 1TP4A 3FHZA 4WXCA 5K7FA 4BU2A 3CJRB 3V4GA 1Y8QB 4XIDA 3W6VA 3Q5FA 4BAYA 1U9OA 3E97A 2VKDA 3C3WA 2K02A 3PIOF 5HS8A 3IAS2 2E2IJ 4I0BA 4EGZA 9ANTA 1LE8B 3PQKA 3EUHA 4Q47A 3TDUC 2DW4A 1LJ9A 1JUSA 4E7JA 2M34A 1T56A 4KJZA 2HTSA 4KIFA 1ETOA 2A69F 4M3DA 4J19A 4CCNA 5KNLA 1Z67A 5HLHA 1QO0D 3R6SA 4GO1A 3VB2A 3WTUC 2XPVA 1ZR2A 1LFPA 2DYSH 2IEKA 4PJLA 2HYJA 2GZWA 4L5IA 3L1PA 2GAUA 3BG7A 1ETXA 1XDUA 2JVHA 3ZMVA 4RLQA 2WWYA 2MFZA 5FFXA 4E7SA 3CCQI 2DMNA 2CGPA 2PJRB 4XRSA 1W0TA 4S0HB 4IF4A 1ZAOA 4IRHA 2K27A 3KLOA 2ELKA 2G7UA 2MG4A 2CW7A 4BUPA 1YW9A 3I4PA 2B9SA 1ZG5A 1HA8A 5ED4A 1JT6A 2EZIA 4HBLA 4MQVA 5FLMJ 3IKTA 3COAC 4LFUA 4BJTA 2XB0X 1LNWA 4IXAA 4I0AA 4XSZF 1I1SA 4L5EA 4YIIA 4KN7X 4WK8F 3VSLA 4CCLA 4GYIA 2OD5A 3CF5F 2LNBA 2ZFWA 3WODF 3IL2A 1DU0A 1LVAA 1Z0XA 3MKWB 4KMFA 1YRNA 3AG4H 1AKHA 1B1BA 1V5EA 2V26A 4CH7A 2L7MP 3LSRA 3OL3A 3EUHC 2JUCA 1FYMA 2R5YB 3HXLA 4CYCB 1FBQA 1Y56A 1WCMJ 3BP8A 3PNYA 4CCKA 1USTA 1TZLA 2E2HJ 4K2EA 4MEXF 1FX7A 3B6AA 2OZUA 4CZZA 2XAFA 4JK1X 4A3GJ 2PMHA 1RETA 2BE5F 4AYBN 5BPDA 4QLCU 2JA2A 2CJJA 2IA0A 2QKMB 2KT0A 1R36A 2CMPA 5LRRA 1RI7A 2LH9A 2X1EA 4II2A 2EQRA 1OCCH 3L2UA 4XRMA 4D9JA 3JRDA 3K2ZA 4QPOA 3CCJI 1BC7C 2FNAA 3BWGA 4MNUA 3HEFA 3LNQA 1B9NA 3SFZA 1ITYA 1SD6A 2NNYA 1HOMA 1B6AA 3FISA 4DYCA 3C2GA 1GXPA 3HDDA 1IAWA 3HIFA 4JX5A 4PJJA 2YX7A 1DUXC 1W7PA 1VQ7I 3GLLA 2EFOA 4A3KJ 1KU9A 1WSUA 3WU2C 5HOOA 1F1ZA 5KAFC 3WTWC 4ZDOA 4XRFA 5D8LB 2BEOA 4PDKA 3A4CA 3NQOA 1K7AA 2L9RA 4ESBA 4P55A 3P7NA 4NC7A 4RGXA 1QPIA 3DU6A 1NG7A 4IVNA 2E5ZA 1ORKA 3FX3A 1NH3A 3G1MA 5D6EA 1SD4A 4NHJA 1I1GA 2LYCA 3OYEA 2M45A 5IT3A 1K78A 5D8KB 1GLNA 3H9QA 3BG3A 3CF2A 3TKYA 2HEOA 5E20A 1U5TB 4YFNF 2IT0A 4QPQA 1FPQA 5LD2C 2CW0F 2UXNA 3I53A 3OV8A 1OLTA 4FASD 1AA7A 2KKOA 1YW7A 1R58A 2HU9A 4A2UA 4HNVA 3BOQA 2CSOA 2IJLA 1LFUP 5DM6F 4PK4A 4I99C 4E7KA 3I59A 2WA0A 1MDMA 2R7UA 4FHTA 3RTRA 3WG9A 3RJPA 3DP7A 2H09A 3FXKA 4RM2A 2L4MA 4AM3A 3I9V2 1MBGA 1UJ8A 1YLFA 1YJ9I 4CYDA 4LK0F 3K0LA 2RVCA 2MSYA 3ULQB 1WGXA 2F6CA 3LWFA 3MMYB 2X0LA 3WE3A 4BBRJ 4ETSA 3T5XA 1JT0A 3TGNA 3FM3A 3OOUA 4BQAA 3SQNA 4HLXA 4C2UA 3K1PA 4UUSB 3PSIA 2EA2A 5LGNA 4IO9F 3J7YJ 2KIUA 4BQQA 3FXQA 1KZHA 3HOSA 4EATA 2JZYA 1YQAA 2BVMA 4II3A 4BL0B 5J4VA 3AG2H 4FETA 4EQQA 1TNTA 3A03A 5C4JJ 1U2WA 3WU0A 5B66C 4E7LA 1MJ9A 4BE1A 4V2GA 3MFKA 3ZQQA 2CV2A 2EV6A 1BR4A 3ZMDA 2XAUA 4KMUX 4AIJA 3ZQGA 4EJUA 1OCZH 3ABKH 3J7ZI 1A31A 3GTPJ 3AKZA 4HA8A 1NG6A 3H5RA 1T08B 1I27A 3OYJA 2XRLA 1TT5B 2OJED 2KPMA 2LSOA 3MD2A 4RA2A 2DO7A 3CLQA 2HDDA 2UV1A 1HLVA 3F6VA 4IJAA 5EG0A 2EFPA 2V79A 1Y1VJ 1ZARA 4U7BA 1OYWA 3E5XA 4BY1J 3OR1C 1RPWA 1R22A 3SYTA 1XD7A 4LK1F 2HQAA 3LAPA 2ID3A 2F48A 4G6QA 1WI3A 3RPUD 1VQ8I 1RUOA 3DBLB 3GFLA 3PO3J 1UG0A 1SFEA 5E79C 4Y17A 4M6YA 3LQQA 1IUYA 3HPGA 2VQLA 2W84A 3L2RA 4M71A 2FA5A 2Z1DA 3W2AA 2X85A 2NVXJ 2E1MC 4HSTA 5EJCA 3S32A 2LR8A 3CCYA 2NVYJ 3ZMTA 4L5JA 1HKQA 2A6HF 4YRVA 3CP8A 4ENKA 4OMYA 3JTHA 2ZMEA 5F04A 3W3CA 1T0FA 2EILH 1CF7B 4KIGA 4HYEA 1LFBA 4X1EA 2FRHA 3CTAA 1JE8A 2B63J 3E6DA 4LMYA 5TGTA 4XLAA 2RV8A 4CCJA 1WJFA 1YFHA 1U3EM 3KE2A 1XGMA 3KFWX 1OMIA 4KT5C 4HRIA 3HOWJ 2LMDA 5B1AH 3OYIA 1L0OC 2Y30A 2CV1A 4WF2A 3LAJA 2R7DA 3VEPA 3RSNA 3H5AA 4E7HA 2DK8A 1F9NA 1FOYA 1R5GA 1HKSA 1WHUA 3GFIA 1SFUA 5J8CA 2RREA 2QEXI 2OQRA 2V1NA 4LIUA 1KONA 4UV8A 2YR2A 2IBDA 4N9HA 2BGCA 2XUBA 1ACIA 2JA6J 5FB2A 2V9KA 4HX4A 1EF4A 3ZN0A 2IGKA 1UZCA 4A0ZA 2ICWG 1JJ8C 2COMA 3NEUA 2KL4A 4YFKF 3AG1H 3CCRI 3QOPA 3ZGKA 1LKXA 1FSHA 4G94A 3IP4B 2P8TA 3QOEA 2DOEA 2HVRA 3ERED 2F5CA 1KQ8A 3IWFA 1X3ZB 3ISPA 3BDDA 2PMZN 1HBXG 3GZNB 5EZHA 3G1LA 5HODA 3HOXJ 3BT9A 2H8RA 4F3QA 4EM1A 3QRFF 2E7XA 2HZTA 2BBYA 3D5SC 1O7LA 4M3EA 3FKJA 5CQEA 1BBYA 2R7FA 2L02A 3BLYA 1MMDA 2VKVA 5HNFA 3RKQA 4HV6A 1ON2A 1J2XA 5ERIA 2KJCA 3F9KA 5CVUA 1HW1A 2FD5A 3RCOA 5IYCJ 2NS7A 4PJNA 4B43A 2JRTA 2HFHA 5IOYA 3A2KA 4KITB 1FP1D 4NC8A 1MBJA 3FIWA 3NRVA 2VJ5A 3BJ6A 2P81A 2GWRA 1S6LA 2K4JA 3ROUA 3CQZJ 2XAHA 3MEXA 5E8IA 2STWA 3KLNA 4FT8A 4A3IJ 1X1BA 3ECHA 1Y0UA 3BQZA 3GTJJ 4HSRA 2HI3A 3BTLA 5CVVA 1ETYA 3FXRA 3CCSI 2MLGA 4XN3A 2WTEA 2W7NA 1DDNA 3GFMA 3JSOA 2L54A 4EJVA 2LF8A 3R61A 3HKZA 4UY8I 1Z3YA 4ZYEA 4HF2A 5IT9K 1FEXA 3DEWA 1W36C 2IAIA 1MKMA 2O7OA 2WAQA 2ZO4A 2ISYA 3CMEI 1FNNA 5F08A 4B8XA 2AS5F 2GQQA 5DDGA 2A6TA 3ZPLA 3I56I 1XMAA 1ZRFA 2VE8A 4WX9A 1PUFA 1HCRA 4OAZA 5DD8A 3OYKA 1TLHB 3W6KB 2E1NA 5IYBJ 4DJAA 3OSFA 3H3UA 2DFIA 4BEHB 3HSFA 4EMSA 3VYSB 1F4KA 2KRCA 1D5YA 1PUEE 2EK5A 4Y52J 1YIOA 1ZYRF 5AIPA 3KX2A 4UV9A 5DV5A 4DGWB 2NVTJ 3BQYA 1R4MB 3ERMA 3G4SI 1WH7A 5FLVA 2OAZA 4I98B 4I76A 2ISZA 3CC7I 4L9NA 1DQUA 3KYDB 1ZTRA 1D1AA 2EFWA 3C18A 2JUGA 4BXFA 1JXSA 1GVJA 2OCEA 2FQ4A 1TWAJ 3HL2A 1Z05A 2QQAA 4J00A 2QQ8A 3O8HA 2KISA 4F93B 2G7HA 2NAZA 3BCBA 3HM5A 4O6JA 5DM7F 2R7SA 1T33A 1J7KA 1FT9A 2FNPA 3KZYA 5CQGA 3ZN1A 4HX7A 3JSPA 3OYDA 1YE9A 2QA4I 1FOXA 1BIBA 4I09A 5D5XB 5CVIA 3JRGA 2RGVA 1RR8C 1BOBA 4W97A 4IHWA 2XPWA 5FJ8J 2E1CA 3ESWB 1BW6A 3EUKL 1E2XA 1L3LA 3DBRB 1B72B 5D6FA 2ME6A 2J5OA 3L2CA 2XF6A 1ONVA 3DV8A 4XL9A 4FISA 3DLAA 4L9VA 2K85A 2W00A 2Q2EB 1OR7A 3PNTA 2GBYA 2F5VA 2VKEA 3H9JA 5BMZA 1R49A 5E1XA 5KCMA 4DZPA 2M1BA 3MVPA 2LFBA 3H9GA 3BR2A 1MD0A 1UELB 2V6CA 3CESA 1IV8A 4LIVA 4MLOA 3L7WA 5HLGA 3FM5A 4PSWA 5JFRA 3G73A 4RGRA 2PBIA 3BPXA 2ZB9A 1PP8F 1ZRDA 2RQPA 1MSEC 2VBYA 2H27A 5HDKA 1SMTA 1KYWA 1E3HA 2NS0A 1RZ4A 1VZ0A 1SD5A 5E17F 2QUFA 4YFXF 2LP0A 2QZ8A 2DFHA 4HV5A 3K1MA 1OQYA 2EV0A 3FZVA 3ASNH 4ZYGA 3ABTA 2O0YA 2PQ8A 3GUDA 2R5ZA 1KU3A 1G59A 2F2EA 5JLXA 4RAZA 4A5MA 1XC5A 3BR6A 2CUFA 3S3NA 4O5VA 2Z99A 3CCMI 2QWWA 2Z16A 3TO7A 3VDXA 4IHYA 3C2BA 1GT0C 4D5CA 1XGSA 1YTYA 1SEUA 1USSA 5HVQC 3TOBA 3IH2A 3JAMZ 2DT6A 4BE2A 2IS1A 3BC8A 4BQOA 1UMQA 2FF4A 1OFCX 2K4BA 2VC0A 3CC2I 3ZRGA 4M9XA 1EH7A 1P7IA 4XRSG 3S14J 5BNGA 5K7ZA 1H8AC 3MN2A 5IPAA 2Y2ZA 1FYKA 4P96A 1W7PB 3KZIC 5EEHA 5JLWA 2JN6A 1P6RA 3V42A 2L9VA 2VQHA 4ABZA 3DTKA 2V1DA 2DU9A 4PJMA 1Z7UA 2EIMH 2WAFA 5JHFA 4LB5A 1R5HA 2VONA 2AHQA 2O8KA 3U1DA 3LL7A 1E17A 3PSFA 3VYTB 2NYXA 5ICCA 3BTIA 3CCLI 1POGA 2WY8Q 1XB4A 1ZHFA 2HTJA 2BY2A 4EEFG 2K5CA 2M0CA 4IHXA 4JYKA 1FLIA 2K9SA 2W4SA 2V7FA 4B09A 4RB1A 4BHPA 2MH2A 5LEJA 1J0RA 1D8JA 3KP3A 5KVRA 2WBMA 4GRIA 3ZMUA 3SHFA 2P7VB 4WWCA 2ECBA 4M3BA 3U9GA 5L3GA 3OYHA 1SFXA 3HUGB 3SDBA 3RQ4A 3HB9A 3L00A 1LPQA
chains in the Genus database with same CATH topology
1FBSA 3ABUA 4GCVA 4HF0A 1FYLA 4ZYHA 3MZYA 3RKWA 4BHCA 3L9FA 3BROA 3TO9A 4TV7A 3ELKA 3BPVA 4A0YA 3E5UA 1XCBA 4M73A 1YYVA 5HS7A 3HHGA 3W6JB 2IA1A 4Q48A 3RIRA 4JBAA 3RYRA 5ILVA 2W25A 5HDNA 4A6DA 4ESJA 3F8BA 5L3CA 4U0WA 1IW7F 1W5TA 1ZREA 5FFZA 2XGXA 2QQ9A 2HYGD 3DEUA 1XDSA 4IHTA 2RC4A 4M74A 4GGGA 3ZP5A 3K69A 1SMYF 2JPCA 3M8EA 1ULYA 2VOOA 1ON1A 4HZFA 2OQGA 1XN7A 3F3XA 3MQ0A 2Q8KA 4G6DA 4G8XA 3JAMK 3FWEA 2K86A 3GZ6A 3GFJA 4R1HA 1TBXA 2PN6A 3MAJA 2ZMEB 2VBXA 3K1NA 3HRMA 2Y75A 1S7OA 4UVAA 3SZTA 1CGPA 3I54A 2QBYB 3F8MA 1MZBA 2B0LA 2IW5A 3IC7A 5AIQA 4RB3C 3HTSB 5L3DA 3ECOA 3L09A 2ADUA 3V7RA 2ESNA 3O2PE 3LFKA 3BJAA 2ZXJA 2E7WA 4KICA 3QAHA 5ICGA 2FSWA 3T8RA 4PCQA 4GXOA 1Q1HA 2NRAC 4WCGA 4P5OA 1QBJA 5H20A 4WXHA 2A6EF 3CO6C 4UVCA 1NHAA 2ZNYA 2O03A 2HS5A 1STZA 2XVCA 2O61A 1UB9A 5DCMB 4HLYA 3J81K 2H6BA 5ICEA 1KU2A 1PDNC 4I2OA 2IVMA 2DQLA 1QQIA 5BPIA 3F8NA 2D1VA 3I0TA 2M8EA 3M9AA 3WU1B 2XROA 3T8TA 3V8KA 4IRIA 5D5UB 1PP7U 3F6OA 3V8LA 5JR3A 3LQRA 4Y15A 1HW2A 3S2WA 4XSXF 1R23A 1TW2A 5IT9Z 5LHGA 2K7LA 1Z9CA 1R1TA 5A2QZ 4LLNA 1BI3A 2XHKA 4L0ZB 2OA4A 4OIQF 3QPTA 1WWXA 1W7PD 4Q5SF 4AD9A 3HRUA 3IRRA 4M6XA 4ON0A 4F7ZA 4PGGA 5FGMA 3QPHA 4MHGA 3KEQA 4HAMA 5DEQA 3B02A 3EQLF 5D4SA 3RI4A 2Z9OA 5DUKA 5E1WA 2RNJA 4L18B 5L3EA 1ZN2A 4I01A 1ZRCA 4EGYA 2HWVA 3GLXA 4ZH4F 3HHHA 2XAGA 3M8FA 3DKWA 4G7HF 4MEYF 5AONA 3ZQ7A 1G3TA 2ETHA 4U7DA 1FZPB 4BYYA 4EJTA 5CVJA 4ENMA 2UWMA 2CWEA 4S05A 1IN8A 5F1RA 1WKMA 2CO5A 2JT1A 2D2WA 2HQRA 5DYMA 4ZZDA 1KQ9A 1ZH5A 3WTYC 4KN4X 4FX0A 1OPCA 4KNYA 1B9MA 2XRNA 3KP2A 1DPRA 2DTRA 3B73A 1U5TA 4KUMA 1LEAA 3IKVA 1RIOH 1WRJA 1EH6A 3F72A 2V9VA 4H0EA 4LG0B 2F5FA 2BV6A 4YG2F 1P4WA 2Q0OA 1W4MA 3CUQB 3KP7A 4EV0A 4ENNA 1IXCA 2H94A 1B4AA 3WE2A 1HSTA 4CO8A 1BI0A 1S29A 3D5LA 4KA4A 3I64A 3DFGA 1T38A 1R1VA 1UHWA 2QENA 5J8FA 1JHFA 5BOXA 1I6XA 1UCRA 1TNSA 2MA3A 3MZHA 1MJBA 2HGCA 4RB2C 2GXBA 3CJNA 1YG2A 5KK1A 2FBIA 2STTA 5LLQA 1HQCA 5DD4A 1O7FA 2A5YB 2YSRA 1U5TC 1XGOA 2A61A 4NB5A 5A2QK 2UZKA 3E5QA 1REPC 4L9TA 2RKHA 4M9ZA 2OBPA 2GA2A 1WQ2A 5TRDA 3GWZA 1IXRC 2H6CA 1KA8A 3RKXA 1Z91A 1J5YA 3KCCA 3PFIA 3MCZA 3IRQA 1VTNC 3GXOA 2DAOA 5H6RA 3BY6A 3IHUA 5FLXK 5FD6A 4KIBA 1IN7A 4OIOF 3V7CA 2VODA 4I02A 2OU2A 2P6TA 3T0YA 1IXSB 4AVPA 5ILUA 1P4AA 4A0XA 2A68F 3QU6A 3RDIA 2DI3A 5CLSA 1BI1A 3IWZA 2IRFG 3GO5A 3P9IA 1IN6A 4KFCA 4PZJA 2VOPA 3VODA 1UFMA 3LA7A 5CVRA 1G3YA 1O3RA 2P5KA 4AWXB 1SD7A 2X4HA 1Z6TA 3EDPA 1S8NA 1LB2A 4OIPF 3SZPA 2WC2A 3HTUA 1G4DA 3JW4A 1ZGAA 3SXYA 1AOYA 4LD5A 2P7CB 5JVTA 2FMLA 4YIFA 3H92A 1KU7A 3EETA 2IPQX 1P4XA 2FXAA 1BOAA 1FOKA 1T39A 1HXDA 4BNCA 4XBFA 4ENJA 3TOAA 4OU0A 1OYYA 1XSDA 3R4KA 3ML6A 1R7JA 4R79A 2GA1A 3FMRA 4G7OF 2ZNZA 1LDDA 2Y0MA 2QQBA 2HKXA 2EFNA 1K6OA 1J9IA 2W85A 3WGGA 2JPBA 4WXDA 2VBZA 5L3FA 3N97A 1IN5A 4CICA 2J5PA 3DPLC 2KIFA 1ZGJA 2O3FA 4EM0B 3BZ6A 3DXJF 5LBQA 3O3KA 2FMYA 2O8XA 3TO6A 1K78B 4EJWA 2DT5A 3HRTA 1AWCA 1QPMA 4LB6B 1JGSA 1P92A 2VBWA 2PEXA 3LA3A 1D5VA 4CDGA 3I59B 4AIHA 3EYIA 1MDMB 3VFZA 1UHMA 2P4WA 2EJRA 3KP6A 3CLOA 3HRSA 1U6GA 3EYYA 2FBKA 3J81Z 2LDUA 5E8GA 1S3JA 3QU3A 1BN5A 4DNCA 2VXZA 5CYVA 1MGTA 4LJZF 3RPQA 2FOKA 1K79A 4IHSA 5F6FA 5HLIA 4OINF 4M9SA 2AXLA 4A12A 2CQKA 3BJOA 4Y13A 1YO5C 1HW5A 2Q2EA 3E6CC 3J80K 1J59A 4EM2A 1O3SA 1ZG3A 3WTVC 2W24A 3FXUA 2MLKA 2TDXA 1LQ1A 2HOEA 1T2KA 3E3VA 3ZMZA 4RB0A 3TQNA 4XLNF 2DPUA 3O6BB 4CXFA 2Y48A 4UHTA 1R00A 3WTTC 1F5TA 4ASNA 2KIMA 1MJAA 2FU4A 4IRGA 1BI2A 3D0SA 1XMKA 2O6GE 1XCVA 3F23A 1J75A 4HF1A 1QNTA 1FY7A 4O3MA 3E6MA 3J7AO 3AAFA 4G7ZF 3KP4A 2PLYA 4BXUA 2IA2A 2MD5A 3RPUA 3CO7C 2Z3YA 3HSRA 3REOA 3KP5A 2GXGA 2EA4A 5BQTA 3M1EA 3G3ZA 4KYWA 3VOEA 2ACJA 2DK5A 2L01A 1IF1A 3Q9VA 3CDHA 2HR3A 2F5EA 3MWMA 2V1UA 3F8FA 3OOPA 2RDPA 5LGTA 3FMQA 1T98A 2ZKZA 1YS7A 1BIAA 5LRSA 2D1HA 3HUGA 2QM3A 5J6XA 2DLLA 2HYFA 3C7JA 4LLGF 4BHBA 2OZ6A 4D0PA 1GHCA 2KJBA 5D4RA 3P9CA 3HSEA 4L9JA 2EB7A 4U88A 1I5ZA 4MTDA 3QP6A 4A5NA 1FC3A 1ZLKA 3Q9SA 1FSEA 2P5VA 3I5UA 2PI0A 1R1UA 4GYGA 1KYZA 4CHUA 3LA2A 3C1DA 1U78A 1FBUA 1SAXA 3R0JA 2P5LC 2DQRA 2M30A 2PJPA 2Z33A 2QVOA 3R60A 2XKOA 2MBFA 1BJAA 2MH9A 4RAYA 4ESFA 2YX4A 2D45A 2PFBA 2HDCA 3JTGA 1TW3A 2ZJ2A 2VT2A 1OKRA 5HDGA 1O3TA 3V8JA 1RNLA 3WTZA 5K5OA 1T6SA 3WTXC 4EVIA 3DQVC 3GYHX 2XAJA 1EV7A 2KRFA 1TTYA 5JI6A 4M72A 4P9FA 2Z5UA 1KGSA 2W57A 5FLXZ 1ODDA 1V4RA 4P9UA 5K5QA 1C0WA 2GIVA 2XV4S 2HQNA 4OOIA 2ESHA 1DP7P 5ILSA 3GX4X 1G6NA 2QBYA 3ZMSA 1QGPA 5FO5A 2XIGA 3RKYA 1FWZA 4MGRA 1LEBA 3WTSC 3M7GA 4HX8A 4ZYDA 1W5SA 3WGIA 4UUVA 4JQFA 1FP2A 3T1BA 1B59A 2EWNA 1G3SA 5LGUA 1TQMA 3I71A 5JHUA 2WV0A 4XLPF 3R0AA 2NNNA 4AIKA 2A07F 2ZCWA 4Z2YA 5EEGA 2QYOA 2JTVA 3QP5A 5BS6A 5CJ9A 2CG4A 4U0YA 2A3SA 1ZG1A 4N0BA 1LDJA 3E6BA 5DCMA 1H9GA 3DF8A 4NQWA 1GXQA 4Q4ZF 5F64A 2EV5A 4R8HA 4LLLA 4DQ2A 4HQMA 3GVAA 5H6QA 1Z6RA 2PMUA 4HQEA 1TQPA 4E70A 1D3YA 2RN7A 2L4AA 3HOTA 2PG4A 5E18F 3TDZC 2VN2A 1HSJA 2BYVE 2EFQA 1RUNA 1YW8A 5ICFA 1IN4A 4BH9A 1BC8C 2VT3A 1S7AA 2ELHA 3F8CA 4EJOA 2CFXA 1XGNA 3GEZA 4FX4A 1V3FA 2ZBKA 2M5WA 2UXXA 4N9IA 2P6SA 2R3SA 3LSTA 4MQ9F 1H0MA 1BM9A 1CF7A 2G9WA 1O57A 4OIRF 2YU3A 3KZZA 1JHHA 2FBHA 5TJJA 2FEZA 5K1YA 5L3BA 2FQ3A 4UVBA 2FE3A 1DPUA 1D8KA 3RYPA 3U2RA 3I58A 3GZ5A 3KEOA 1P2FA 1HKTA 4KDPA 4HOBA 3KETA 5LHHA 1X3UA 2HKOA 1YS6A 4L0YB 1QZYA 3F21A 3P9KA 4PGHA 3FF5A 2VC1A 4UNOA 4RGSA 1H9TA 1ZLJA 3WGHA 1IRGA 2LF7A 3J80Z 2DBBA 4LG0A 1Z1DA 5FD5A 1QZZA 2C6YA 2XAQA 4HW0A 3CUQA 4G9YA 5HS9A 1WI9A 5K5RA 5D5VB 4S04A 3GF2A 2F5DA 3DPTA 2XKPA 4I7HA 2VE9A 4A6EA 1O3QA 3F22A 2MC3A 3CUOA 5LEKA 3V7SA 3GW2A 4RGUA 5LHIA 1OYIA 4U0VA 5DCFA 1EH8A 5E1ZB 2V1XA 3FMSA 2CYYA 1KQ0A 3K9TA 4LGWA 4QWQA 1G3WA 5DUIA 2YPRA 4HDUA 1IRFA 1LDKB 2QLZA 1TQIA 1A04A 2IP2A 2M87A 4ZZLA 4OMZA 5D5WB 4IPAA 3H3ZA 1XSXA 2DPDA 4MTEA 1XSVA 2L3DA 3N4MA 2JSCA 4CGZA 4RS8A 4UXNA 3CUQC 2XASA 3HYIA 2LKPA 1IZ1A 3PQJA 6PAXA 1U8RA 4HDVA 3FHZA 4WXCA 3V4GA 3Q5FA 4BAYA 3E97A 3C3WA 2K02A 5HS8A 4I0BA 4EGZA 3PQKA 3EUHA 4Q47A 3TDUC 2DW4A 1LJ9A 2HTSA 4KIFA 2A69F 5HLHA 1QO0D 3R6SA 4GO1A 3VB2A 3WTUC 2GZWA 4L5IA 2GAUA 1XDUA 3ZMVA 2WWYA 5FFXA 2CGPA 4IF4A 1ZAOA 4IRHA 2K27A 3KLOA 2G7UA 1YW9A 3I4PA 1ZG5A 5ED4A 4HBLA 4MQVA 3IKTA 3COAC 4LFUA 1LNWA 4IXAA 4I0AA 4XSZF 1I1SA 4YIIA 4KN7X 4WK8F 4GYIA 2OD5A 2LNBA 2ZFWA 3WODF 3IL2A 1LVAA 4KMFA 1B1BA 1FYMA 1FBQA 3BP8A 1USTA 4K2EA 4MEXF 1FX7A 2OZUA 4CZZA 2XAFA 4JK1X 2PMHA 2BE5F 5BPDA 4QLCU 2IA0A 1R36A 5LRRA 1RI7A 3K2ZA 1BC7C 2FNAA 3BWGA 4MNUA 1B9NA 3SFZA 1SD6A 2NNYA 1B6AA 1GXPA 1IAWA 3HIFA 2YX7A 1DUXC 1W7PA 2EFOA 1KU9A 1WSUA 5HOOA 3WTWC 1F1ZA 4XRFA 5D8LB 2BEOA 4PDKA 1K7AA 3NQOA 4ESBA 4P55A 3P7NA 4RGXA 4IVNA 3FX3A 5D6EA 1SD4A 4NHJA 1I1GA 2M45A 5IT3A 1K78A 5D8KB 3TKYA 2HEOA 5E20A 1U5TB 4YFNF 2IT0A 1FPQA 2CW0F 2UXNA 3I53A 3OV8A 2KKOA 1YW7A 1R58A 4A2UA 3BOQA 2CSOA 2IJLA 3I59A 1MDMA 4FHTA 3RTRA 3WG9A 3RJPA 3DP7A 2H09A 2L4MA 1YLFA 4CYDA 4LK0F 3K0LA 2RVCA 3ULQB 3LWFA 2X0LA 3WE3A 4ETSA 3T5XA 3TGNA 3FM3A 4BQAA 3SQNA 4HLXA 3K1PA 2EA2A 5LGNA 2KIUA 3FXQA 3HOSA 2JZYA 1YQAA 4EQQA 1TNTA 1U2WA 3WU0A 1MJ9A 3MFKA 2EV6A 3ZMDA 4KMUX 4AIJA 4EJUA 4HA8A 1I27A 2LSOA 2DO7A 3F6VA 4IJAA 2EFPA 2V79A 1ZARA 4U7BA 1OYWA 3E5XA 1R22A 1XD7A 4LK1F 3LAPA 4G6QA 1RUOA 3GFLA 1SFEA 4Y17A 4M6YA 3LQQA 1IUYA 2W84A 4M71A 2FA5A 3ZMTA 4L5JA 1HKQA 2A6HF 4ENKA 4OMYA 3JTHA 2ZMEA 1T0FA 1CF7B 4KIGA 4HYEA 2FRHA 3CTAA 1JE8A 3E6DA 4LMYA 2RV8A 1YFHA 1U3EM 3KE2A 1XGMA 3KFWX 1OMIA 4KT5C 1L0OC 4WF2A 3LAJA 2R7DA 3VEPA 2DK8A 1F9NA 1R5GA 1HKSA 3GFIA 1SFUA 5J8CA 2OQRA 4UV8A 2YR2A 4N9HA 2BGCA 2XUBA 5FB2A 4HX4A 3ZN0A 4A0ZA 2COMA 3NEUA 4YFKF 3QOPA 1FSHA 4G94A 2P8TA 3ERED 2F5CA 1KQ8A 3IWFA 3ISPA 3BDDA 1HBXG 4EM1A 3QRFF 2E7XA 2HZTA 2BBYA 1O7LA 1BBYA 2R7FA 2L02A 4HV6A 1ON2A 1J2XA 5ERIA 2KJCA 5CVUA 1HW1A 2JRTA 2HFHA 1FP1D 3NRVA 3BJ6A 2GWRA 1S6LA 2K4JA 3ROUA 2XAHA 3MEXA 5E8IA 2STWA 3KLNA 4FT8A 3ECHA 1Y0UA 5CVVA 3FXRA 2MLGA 2WTEA 1DDNA 3GFMA 3JSOA 2L54A 4EJVA 2LF8A 3R61A 4HF2A 4ZYEA 5IT9K 1MKMA 2ZO4A 2ISYA 1FNNA 4B8XA 2AS5F 2GQQA 5DDGA 3ZPLA 1XMAA 1ZRFA 2VE8A 4WX9A 5DD8A 1TLHB 3W6KB 2E1NA 3H3UA 2DFIA 3HSFA 4EMSA 1F4KA 1PUEE 2EK5A 1YIOA 1ZYRF 5AIPA 5DV5A 4UV9A 2OAZA 4I98B 2ISZA 4L9NA 2EFWA 3C18A 1JXSA 1GVJA 1Z05A 2QQAA 2G7HA 2NAZA 4O6JA 1J7KA 1FT9A 2FNPA 3KZYA 3ZN1A 4HX7A 3JSPA 1BIBA 4I09A 5D5XB 5CVIA 2RGVA 2E1CA 1E2XA 1L3LA 5D6FA 2J5OA 3L2CA 1ONVA 3DV8A 4L9VA 1OR7A 5BMZA 5E1XA 2M1BA 1MD0A 2V6CA 5HLGA 3L7WA 3FM5A 5JFRA 3G73A 4RGRA 2PBIA 3BPXA 1PP8F 1ZRDA 2RQPA 2VBYA 2H27A 5HDKA 1SMTA 1KYWA 2NS0A 1RZ4A 1SD5A 5E17F 2QUFA 4YFXF 2QZ8A 4HV5A 3K1MA 2EV0A 3FZVA 4ZYGA 3ABTA 2O0YA 2PQ8A 3GUDA 1KU3A 2F2EA 4RAZA 4A5MA 4O5VA 2Z99A 2QWWA 3TO7A 1YTYA 1XGSA 1USSA 5HVQC 3TOBA 3JAMZ 2FF4A 2K4BA 2VC0A 4M9XA 1EH7A 1FYKA 4P96A 1W7PB 5EEHA 1P6RA 2V1DA 2DU9A 1Z7UA 4LB5A 2VONA 1R5HA 3U1DA 1E17A 2NYXA 5ICCA 1XB4A 1ZHFA 2HTJA 1FLIA 4B09A 4RB1A 4BHPA 2MH2A 5LEJA 1J0RA 1D8JA 3KP3A 5KVRA 3ZMUA 3SHFA 2P7VB 4WWCA 3U9GA 5L3GA 1SFXA 3L00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBS A;  3ABU A;  4GCV A;  4HF0 A;  1FYL A;  4ZYH A;  3MZY A;  3RKW A;  4BHC A;  3L9F A;  3BRO A;  3TO9 A;  4TV7 A;  3ELK A;  3BPV A;  4A0Y A;  3E5U A;  1XCB A;  4M73 A;  1YYV A;  5HS7 A;  3HHG A;  3W6J B;  2IA1 A;  4Q48 A;  3RIR A;  4JBA A;  3RYR A;  5ILV A;  2W25 A;  5HDN A;  4A6D A;  4ESJ A;  3F8B A;  5L3C A;  4U0W A;  1IW7 F;  1W5T A;  1ZRE A;  5FFZ A;  2XGX A;  2QQ9 A;  2HYG D;  3DEU A;  1XDS A;  4IHT A;  2RC4 A;  4M74 A;  4GGG A;  3ZP5 A;  3K69 A;  1SMY F;  2JPC A;  3M8E A;  1ULY A;  2VOO A;  1ON1 A;  4HZF A;  2OQG A;  1XN7 A;  3F3X A;  3MQ0 A;  2Q8K A;  4G6D A;  4G8X A;  3JAM K;  3FWE A;  2K86 A;  3GZ6 A;  3GFJ A;  4R1H A;  1TBX A;  2PN6 A;  3MAJ A;  2ZME B;  2VBX A;  3K1N A;  3HRM A;  2Y75 A;  1S7O A;  4UVA A;  3SZT A;  1CGP A;  3I54 A;  2QBY B;  3F8M A;  1MZB A;  2B0L A;  2IW5 A;  3IC7 A;  5AIQ A;  4RB3 C;  3HTS B;  5L3D A;  3ECO A;  3L09 A;  2ADU A;  3V7R A;  2ESN A;  3O2P E;  3LFK A;  3BJA A;  2ZXJ A;  2E7W A;  4KIC A;  3QAH A;  5ICG A;  2FSW A;  3T8R A;  4PCQ A;  4GXO A;  1Q1H A;  2NRA C;  4WCG A;  4P5O A;  1QBJ A;  5H20 A;  4WXH A;  2A6E F;  3CO6 C;  4UVC A;  1NHA A;  2ZNY A;  2O03 A;  2HS5 A;  1STZ A;  2XVC A;  2O61 A;  1UB9 A;  5DCM B;  4HLY A;  3J81 K;  2H6B A;  5ICE A;  1KU2 A;  1PDN C;  4I2O A;  2IVM A;  2DQL A;  1QQI A;  5BPI A;  3F8N A;  2D1V A;  3I0T A;  2M8E A;  3M9A A;  3WU1 B;  2XRO A;  3T8T A;  3V8K A;  4IRI A;  5D5U B;  1PP7 U;  3F6O A;  3V8L A;  5JR3 A;  3LQR A;  4Y15 A;  1HW2 A;  3S2W A;  4XSX F;  1R23 A;  1TW2 A;  5IT9 Z;  5LHG A;  2K7L A;  1Z9C A;  1R1T A;  5A2Q Z;  4LLN A;  1BI3 A;  2XHK A;  4L0Z B;  2OA4 A;  4OIQ F;  3QPT A;  1WWX A;  1W7P D;  4Q5S F;  4AD9 A;  3HRU A;  3IRR A;  4M6X A;  4ON0 A;  4F7Z A;  4PGG A;  5FGM A;  3QPH A;  4MHG A;  3KEQ A;  4HAM A;  5DEQ A;  3B02 A;  3EQL F;  5D4S A;  3RI4 A;  2Z9O A;  5DUK A;  5E1W A;  2RNJ A;  4L18 B;  5L3E A;  1ZN2 A;  4I01 A;  1ZRC A;  4EGY A;  2HWV A;  3GLX A;  4ZH4 F;  3HHH A;  2XAG A;  3M8F A;  3DKW A;  4G7H F;  4MEY F;  5AON A;  3ZQ7 A;  1G3T A;  2ETH A;  4U7D A;  1FZP B;  4BYY A;  4EJT A;  5CVJ A;  4ENM A;  2UWM A;  2CWE A;  4S05 A;  1IN8 A;  5F1R A;  1WKM A;  2CO5 A;  2JT1 A;  2D2W A;  2HQR A;  5DYM A;  4ZZD A;  1KQ9 A;  1ZH5 A;  3WTY C;  4KN4 X;  4FX0 A;  1OPC A;  4KNY A;  1B9M A;  2XRN A;  3KP2 A;  1DPR A;  2DTR A;  3B73 A;  1U5T A;  4KUM A;  1LEA A;  3IKV A;  1RIO H;  1WRJ A;  1EH6 A;  3F72 A;  2V9V A;  4H0E A;  4LG0 B;  2F5F A;  2BV6 A;  4YG2 F;  1P4W A;  2Q0O A;  1W4M A;  3CUQ B;  3KP7 A;  4EV0 A;  4ENN A;  1IXC A;  2H94 A;  1B4A A;  3WE2 A;  1HST A;  4CO8 A;  1BI0 A;  1S29 A;  3D5L A;  4KA4 A;  3I64 A;  3DFG A;  1T38 A;  1R1V A;  1UHW A;  2QEN A;  5J8F A;  1JHF A;  5BOX A;  1I6X A;  1UCR A;  1TNS A;  2MA3 A;  3MZH A;  1MJB A;  2HGC A;  4RB2 C;  2GXB A;  3CJN A;  1YG2 A;  5KK1 A;  2FBI A;  2STT A;  5LLQ A;  1HQC A;  5DD4 A;  1O7F A;  2A5Y B;  2YSR A;  1U5T C;  1XGO A;  2A61 A;  4NB5 A;  5A2Q K;  2UZK A;  3E5Q A;  1REP C;  4L9T A;  2RKH A;  4M9Z A;  2OBP A;  2GA2 A;  1WQ2 A;  5TRD A;  3GWZ A;  1IXR C;  2H6C A;  1KA8 A;  3RKX A;  1Z91 A;  1J5Y A;  3KCC A;  3PFI A;  3MCZ A;  3IRQ A;  1VTN C;  3GXO A;  2DAO A;  5H6R A;  3BY6 A;  3IHU A;  5FLX K;  5FD6 A;  4KIB A;  1IN7 A;  4OIO F;  3V7C A;  2VOD A;  4I02 A;  2OU2 A;  2P6T A;  3T0Y A;  1IXS B;  4AVP A;  5ILU A;  1P4A A;  4A0X A;  2A68 F;  3QU6 A;  3RDI A;  2DI3 A;  5CLS A;  1BI1 A;  3IWZ A;  2IRF G;  3GO5 A;  3P9I A;  1IN6 A;  4KFC A;  4PZJ A;  2VOP A;  3VOD A;  1UFM A;  3LA7 A;  5CVR A;  1G3Y A;  1O3R A;  2P5K A;  4AWX B;  1SD7 A;  2X4H A;  1Z6T A;  3EDP A;  1S8N A;  1LB2 A;  4OIP F;  3SZP A;  2WC2 A;  3HTU A;  1G4D A;  3JW4 A;  1ZGA A;  3SXY A;  1AOY A;  4LD5 A;  2P7C B;  5JVT A;  2FML A;  4YIF A;  3H92 A;  1KU7 A;  3EET A;  2IPQ X;  1P4X A;  2FXA A;  1BOA A;  1FOK A;  1T39 A;  1HXD A;  4BNC A;  4XBF A;  4ENJ A;  3TOA A;  4OU0 A;  1OYY A;  1XSD A;  3R4K A;  3ML6 A;  1R7J A;  4R79 A;  2GA1 A;  3FMR A;  4G7O F;  2ZNZ A;  1LDD A;  2Y0M A;  2QQB A;  2HKX A;  2EFN A;  1K6O A;  1J9I A;  2W85 A;  3WGG A;  2JPB A;  4WXD A;  2VBZ A;  5L3F A;  3N97 A;  1IN5 A;  4CIC A;  2J5P A;  3DPL C;  2KIF A;  1ZGJ A;  2O3F A;  4EM0 B;  3BZ6 A;  3DXJ F;  5LBQ A;  3O3K A;  2FMY A;  2O8X A;  3TO6 A;  1K78 B;  4EJW A;  2DT5 A;  3HRT A;  1AWC A;  1QPM A;  4LB6 B;  1JGS A;  1P92 A;  2VBW A;  2PEX A;  3LA3 A;  1D5V A;  4CDG A;  3I59 B;  4AIH A;  3EYI A;  1MDM B;  3VFZ A;  1UHM A;  2P4W A;  2EJR A;  3KP6 A;  3CLO A;  3HRS A;  1U6G A;  3EYY A;  2FBK A;  3J81 Z;  2LDU A;  5E8G A;  1S3J A;  3QU3 A;  1BN5 A;  4DNC A;  2VXZ A;  5CYV A;  1MGT A;  4LJZ F;  3RPQ A;  2FOK A;  1K79 A;  4IHS A;  5F6F A;  5HLI A;  4OIN F;  4M9S A;  2AXL A;  4A12 A;  2CQK A;  3BJO A;  4Y13 A;  1YO5 C;  1HW5 A;  2Q2E A;  3E6C C;  3J80 K;  1J59 A;  4EM2 A;  1O3S A;  1ZG3 A;  3WTV C;  2W24 A;  3FXU A;  2MLK A;  2TDX A;  1LQ1 A;  2HOE A;  1T2K A;  3E3V A;  3ZMZ A;  4RB0 A;  3TQN A;  4XLN F;  2DPU A;  3O6B B;  4CXF A;  2Y48 A;  4UHT A;  1R00 A;  3WTT C;  1F5T A;  4ASN A;  2KIM A;  1MJA A;  2FU4 A;  4IRG A;  1BI2 A;  3D0S A;  1XMK A;  2O6G E;  1XCV A;  3F23 A;  1J75 A;  4HF1 A;  1QNT A;  1FY7 A;  4O3M A;  3E6M A;  3J7A O;  3AAF A;  4G7Z F;  3KP4 A;  2PLY A;  4BXU A;  2IA2 A;  2MD5 A;  3RPU A;  3CO7 C;  2Z3Y A;  3HSR A;  3REO A;  3KP5 A;  2GXG A;  2EA4 A;  5BQT A;  3M1E A;  3G3Z A;  4KYW A;  3VOE A;  2ACJ A;  2DK5 A;  2L01 A;  1IF1 A;  3Q9V A;  3CDH A;  2HR3 A;  2F5E A;  3MWM A;  2V1U A;  3F8F A;  3OOP A;  2RDP A;  5LGT A;  3FMQ A;  1T98 A;  2ZKZ A;  1YS7 A;  1BIA A;  5LRS A;  2D1H A;  3HUG A;  2QM3 A;  5J6X A;  2DLL A;  2HYF A;  3C7J A;  4LLG F;  4BHB A;  2OZ6 A;  4D0P A;  1GHC A;  2KJB A;  5D4R A;  3P9C A;  3HSE A;  4L9J A;  2EB7 A;  4U88 A;  1I5Z A;  4MTD A;  3QP6 A;  4A5N A;  1FC3 A;  1ZLK A;  3Q9S A;  1FSE A;  2P5V A;  3I5U A;  2PI0 A;  1R1U A;  4GYG A;  1KYZ A;  4CHU A;  3LA2 A;  3C1D A;  1U78 A;  1FBU A;  1SAX A;  3R0J A;  2P5L C;  2DQR A;  2M30 A;  2PJP A;  2Z33 A;  2QVO A;  3R60 A;  2XKO A;  2MBF A;  1BJA A;  2MH9 A;  4RAY A;  4ESF A;  2YX4 A;  2D45 A;  2PFB A;  2HDC A;  3JTG A;  1TW3 A;  2ZJ2 A;  2VT2 A;  1OKR A;  5HDG A;  1O3T A;  3V8J A;  1RNL A;  3WTZ A;  5K5O A;  1T6S A;  3WTX C;  4EVI A;  3DQV C;  3GYH X;  2XAJ A;  1EV7 A;  2KRF A;  1TTY A;  5JI6 A;  4M72 A;  4P9F A;  2Z5U A;  1KGS A;  2W57 A;  5FLX Z;  1ODD A;  1V4R A;  4P9U A;  5K5Q A;  1C0W A;  2GIV A;  2XV4 S;  2HQN A;  4OOI A;  2ESH A;  1DP7 P;  5ILS A;  3GX4 X;  1G6N A;  2QBY A;  3ZMS A;  1QGP A;  5FO5 A;  2XIG A;  3RKY A;  1FWZ A;  4MGR A;  1LEB A;  3WTS C;  3M7G A;  4HX8 A;  4ZYD A;  1W5S A;  3WGI A;  4UUV A;  4JQF A;  1FP2 A;  3T1B A;  1B59 A;  2EWN A;  1G3S A;  5LGU A;  1TQM A;  3I71 A;  5JHU A;  2WV0 A;  4XLP F;  3R0A A;  2NNN A;  4AIK A;  2A07 F;  2ZCW A;  4Z2Y A;  5EEG A;  2QYO A;  2JTV A;  3QP5 A;  5BS6 A;  5CJ9 A;  2CG4 A;  4U0Y A;  2A3S A;  1ZG1 A;  4N0B A;  1LDJ A;  3E6B A;  5DCM A;  1H9G A;  3DF8 A;  4NQW A;  1GXQ A;  4Q4Z F;  5F64 A;  2EV5 A;  4R8H A;  4LLL A;  4DQ2 A;  4HQM A;  3GVA A;  5H6Q A;  1Z6R A;  2PMU A;  4HQE A;  1TQP A;  4E70 A;  1D3Y A;  2RN7 A;  2L4A A;  3HOT A;  2PG4 A;  5E18 F;  3TDZ C;  2VN2 A;  1HSJ A;  2BYV E;  2EFQ A;  1RUN A;  1YW8 A;  5ICF A;  1IN4 A;  4BH9 A;  1BC8 C;  2VT3 A;  1S7A A;  2ELH A;  3F8C A;  4EJO A;  2CFX A;  1XGN A;  3GEZ A;  4FX4 A;  1V3F A;  2ZBK A;  2M5W A;  2UXX A;  4N9I A;  2P6S A;  2R3S A;  3LST A;  4MQ9 F;  1H0M A;  1BM9 A;  1CF7 A;  2G9W A;  1O57 A;  4OIR F;  2YU3 A;  3KZZ A;  1JHH A;  2FBH A;  5TJJ A;  2FEZ A;  5K1Y A;  5L3B A;  2FQ3 A;  4UVB A;  2FE3 A;  1DPU A;  1D8K A;  3RYP A;  3U2R A;  3I58 A;  3GZ5 A;  3KEO A;  1P2F A;  1HKT A;  4KDP A;  4HOB A;  3KET A;  5LHH A;  1X3U A;  2HKO A;  1YS6 A;  4L0Y B;  1QZY A;  3F21 A;  3P9K A;  4PGH A;  3FF5 A;  2VC1 A;  4UNO A;  4RGS A;  1H9T A;  1ZLJ A;  3WGH A;  1IRG A;  2LF7 A;  3J80 Z;  2DBB A;  4LG0 A;  1Z1D A;  5FD5 A;  1QZZ A;  2C6Y A;  2XAQ A;  4HW0 A;  3CUQ A;  4G9Y A;  5HS9 A;  1WI9 A;  5K5R A;  5D5V B;  4S04 A;  3GF2 A;  2F5D A;  3DPT A;  2XKP A;  4I7H A;  2VE9 A;  4A6E A;  1O3Q A;  3F22 A;  2MC3 A;  3CUO A;  5LEK A;  3V7S A;  3GW2 A;  4RGU A;  5LHI A;  1OYI A;  4U0V A;  5DCF A;  1EH8 A;  5E1Z B;  2V1X A;  3FMS A;  2CYY A;  1KQ0 A;  3K9T A;  4LGW A;  4QWQ A;  1G3W A;  5DUI A;  2YPR A;  4HDU A;  1IRF A;  1LDK B;  2QLZ A;  1TQI A;  1A04 A;  2IP2 A;  2M87 A;  4ZZL A;  4OMZ A;  5D5W B;  4IPA A;  3H3Z A;  1XSX A;  2DPD A;  4MTE A;  1XSV A;  2L3D A;  3N4M A;  2JSC A;  4CGZ A;  4RS8 A;  4UXN A;  3CUQ C;  2XAS A;  3HYI A;  2LKP A;  1IZ1 A;  3PQJ A;  6PAX A;  1U8R A;  4HDV A;  3FHZ A;  4WXC A;  3V4G A;  3Q5F A;  4BAY A;  3E97 A;  3C3W A;  2K02 A;  5HS8 A;  4I0B A;  4EGZ A;  3PQK A;  3EUH A;  4Q47 A;  3TDU C;  2DW4 A;  1LJ9 A;  2HTS A;  4KIF A;  2A69 F;  5HLH A;  1QO0 D;  3R6S A;  4GO1 A;  3VB2 A;  3WTU C;  2GZW A;  4L5I A;  2GAU A;  1XDU A;  3ZMV A;  2WWY A;  5FFX A;  2CGP A;  4IF4 A;  1ZAO A;  4IRH A;  2K27 A;  3KLO A;  2G7U A;  1YW9 A;  3I4P A;  1ZG5 A;  5ED4 A;  4HBL A;  4MQV A;  3IKT A;  3COA C;  4LFU A;  1LNW A;  4IXA A;  4I0A A;  4XSZ F;  1I1S A;  4YII A;  4KN7 X;  4WK8 F;  4GYI A;  2OD5 A;  2LNB A;  2ZFW A;  3WOD F;  3IL2 A;  1LVA A;  4KMF A;  1B1B A;  1FYM A;  1FBQ A;  3BP8 A;  1UST A;  4K2E A;  4MEX F;  1FX7 A;  2OZU A;  4CZZ A;  2XAF A;  4JK1 X;  2PMH A;  2BE5 F;  5BPD A;  4QLC U;  2IA0 A;  1R36 A;  5LRR A;  1RI7 A;  3K2Z A;  1BC7 C;  2FNA A;  3BWG A;  4MNU A;  1B9N A;  3SFZ A;  1SD6 A;  2NNY A;  1B6A A;  1GXP A;  1IAW A;  3HIF A;  2YX7 A;  1DUX C;  1W7P A;  2EFO A;  1KU9 A;  1WSU A;  5HOO A;  3WTW C;  1F1Z A;  4XRF A;  5D8L B;  2BEO A;  4PDK A;  1K7A A;  3NQO A;  4ESB A;  4P55 A;  3P7N A;  4RGX A;  4IVN A;  3FX3 A;  5D6E A;  1SD4 A;  4NHJ A;  1I1G A;  2M45 A;  5IT3 A;  1K78 A;  5D8K B;  3TKY A;  2HEO A;  5E20 A;  1U5T B;  4YFN F;  2IT0 A;  1FPQ A;  2CW0 F;  2UXN A;  3I53 A;  3OV8 A;  2KKO A;  1YW7 A;  1R58 A;  4A2U A;  3BOQ A;  2CSO A;  2IJL A;  3I59 A;  1MDM A;  4FHT A;  3RTR A;  3WG9 A;  3RJP A;  3DP7 A;  2H09 A;  2L4M A;  1YLF A;  4CYD A;  4LK0 F;  3K0L A;  2RVC A;  3ULQ B;  3LWF A;  2X0L A;  3WE3 A;  4ETS A;  3T5X A;  3TGN A;  3FM3 A;  4BQA A;  3SQN A;  4HLX A;  3K1P A;  2EA2 A;  5LGN A;  2KIU A;  3FXQ A;  3HOS A;  2JZY A;  1YQA A;  4EQQ A;  1TNT A;  1U2W A;  3WU0 A;  1MJ9 A;  3MFK A;  2EV6 A;  3ZMD A;  4KMU X;  4AIJ A;  4EJU A;  4HA8 A;  1I27 A;  2LSO A;  2DO7 A;  3F6V A;  4IJA A;  2EFP A;  2V79 A;  1ZAR A;  4U7B A;  1OYW A;  3E5X A;  1R22 A;  1XD7 A;  4LK1 F;  3LAP A;  4G6Q A;  1RUO A;  3GFL A;  1SFE A;  4Y17 A;  4M6Y A;  3LQQ A;  1IUY A;  2W84 A;  4M71 A;  2FA5 A;  3ZMT A;  4L5J A;  1HKQ A;  2A6H F;  4ENK A;  4OMY A;  3JTH A;  2ZME A;  1T0F A;  1CF7 B;  4KIG A;  4HYE A;  2FRH A;  3CTA A;  1JE8 A;  3E6D A;  4LMY A;  2RV8 A;  1YFH A;  1U3E M;  3KE2 A;  1XGM A;  3KFW X;  1OMI A;  4KT5 C;  1L0O C;  4WF2 A;  3LAJ A;  2R7D A;  3VEP A;  2DK8 A;  1F9N A;  1R5G A;  1HKS A;  3GFI A;  1SFU A;  5J8C A;  2OQR A;  4UV8 A;  2YR2 A;  4N9H A;  2BGC A;  2XUB A;  5FB2 A;  4HX4 A;  3ZN0 A;  4A0Z A;  2COM A;  3NEU A;  4YFK F;  3QOP A;  1FSH A;  4G94 A;  2P8T A;  3ERE D;  2F5C A;  1KQ8 A;  3IWF A;  3ISP A;  3BDD A;  1HBX G;  4EM1 A;  3QRF F;  2E7X A;  2HZT A;  2BBY A;  1O7L A;  1BBY A;  2R7F A;  2L02 A;  4HV6 A;  1ON2 A;  1J2X A;  5ERI A;  2KJC A;  5CVU A;  1HW1 A;  2JRT A;  2HFH A;  1FP1 D;  3NRV A;  3BJ6 A;  2GWR A;  1S6L A;  2K4J A;  3ROU A;  2XAH A;  3MEX A;  5E8I A;  2STW A;  3KLN A;  4FT8 A;  3ECH A;  1Y0U A;  5CVV A;  3FXR A;  2MLG A;  2WTE A;  1DDN A;  3GFM A;  3JSO A;  2L54 A;  4EJV A;  2LF8 A;  3R61 A;  4HF2 A;  4ZYE A;  5IT9 K;  1MKM A;  2ZO4 A;  2ISY A;  1FNN A;  4B8X A;  2AS5 F;  2GQQ A;  5DDG A;  3ZPL A;  1XMA A;  1ZRF A;  2VE8 A;  4WX9 A;  5DD8 A;  1TLH B;  3W6K B;  2E1N A;  3H3U A;  2DFI A;  3HSF A;  4EMS A;  1F4K A;  1PUE E;  2EK5 A;  1YIO A;  1ZYR F;  5AIP A;  5DV5 A;  4UV9 A;  2OAZ A;  4I98 B;  2ISZ A;  4L9N A;  2EFW A;  3C18 A;  1JXS A;  1GVJ A;  1Z05 A;  2QQA A;  2G7H A;  2NAZ A;  4O6J A;  1J7K A;  1FT9 A;  2FNP A;  3KZY A;  3ZN1 A;  4HX7 A;  3JSP A;  1BIB A;  4I09 A;  5D5X B;  5CVI A;  2RGV A;  2E1C A;  1E2X A;  1L3L A;  5D6F A;  2J5O A;  3L2C A;  1ONV A;  3DV8 A;  4L9V A;  1OR7 A;  5BMZ A;  5E1X A;  2M1B A;  1MD0 A;  2V6C A;  5HLG A;  3L7W A;  3FM5 A;  5JFR A;  3G73 A;  4RGR A;  2PBI A;  3BPX A;  1PP8 F;  1ZRD A;  2RQP A;  2VBY A;  2H27 A;  5HDK A;  1SMT A;  1KYW A;  2NS0 A;  1RZ4 A;  1SD5 A;  5E17 F;  2QUF A;  4YFX F;  2QZ8 A;  4HV5 A;  3K1M A;  2EV0 A;  3FZV A;  4ZYG A;  3ABT A;  2O0Y A;  2PQ8 A;  3GUD A;  1KU3 A;  2F2E A;  4RAZ A;  4A5M A;  4O5V A;  2Z99 A;  2QWW A;  3TO7 A;  1YTY A;  1XGS A;  1USS A;  5HVQ C;  3TOB A;  3JAM Z;  2FF4 A;  2K4B A;  2VC0 A;  4M9X A;  1EH7 A;  1FYK A;  4P96 A;  1W7P B;  5EEH A;  1P6R A;  2V1D A;  2DU9 A;  1Z7U A;  4LB5 A;  2VON A;  1R5H A;  3U1D A;  1E17 A;  2NYX A;  5ICC A;  1XB4 A;  1ZHF A;  2HTJ A;  1FLI A;  4B09 A;  4RB1 A;  4BHP A;  2MH2 A;  5LEJ A;  1J0R A;  1D8J A;  3KP3 A;  5KVR A;  3ZMU A;  3SHF A;  2P7V B;  4WWC A;  3U9G A;  5L3G A;  1SFX A;  3L00 A; 
#chains in the Genus database with same CATH topology
 1FBS A;  3ABU A;  2R7V A;  4GCV A;  2L2O A;  4W1U A;  2DA3 A;  1X4P A;  5GAE J;  3BR0 A;  2E1O A;  3KYL A;  3L2Q A;  4HF0 A;  1FYL A;  4ZYH A;  3MZY A;  3RKW A;  2ME0 A;  4BHC A;  1H88 C;  2PX9 A;  4KIS A;  3L9F A;  3BRO A;  2DOD A;  1X1P A;  4A3M J;  3TO9 A;  1ENH A;  4TV7 A;  2R7T A;  2EZK A;  3ELK A;  4E6K G;  2Y0S N;  3BPV A;  4A0Y A;  1DGR M;  3E5U A;  2JSP A;  4CCM A;  2HPI A;  4DBQ A;  4GDF A;  1XCB A;  4M73 A;  3BR3 A;  1YYV A;  5HS7 A;  5J1U A;  4KT6 A;  4F52 A;  3K4C A;  4C2M J;  3HHG A;  5FRM A;  3W6J B;  2IA1 A;  4I6Z A;  1VQK I;  2YS9 A;  4Q48 A;  2M9H A;  3RIR A;  2E19 A;  2TCT A;  4JBA A;  1WJB A;  2WY7 Q;  1ETK A;  3RYR A;  1E3O C;  2GLO A;  1P9Q C;  3S8P A;  3FHN A;  5ILV A;  2W25 A;  2AQE A;  2OC6 A;  5HDN A;  1G8X A;  4A6D A;  4ESJ A;  3F8B A;  1R5I D;  5L3C A;  2XGE A;  2DCE A;  2OUM A;  4U0W A;  2H1K A;  3MKL A;  1IW7 F;  3TBI A;  1W5T A;  3TW7 A;  1MH4 A;  1ZRE A;  5FFZ A;  2Y69 H;  2XGX A;  4DYR A;  2CU7 A;  2QQ9 A;  2HYG D;  4NDL A;  3DEU A;  1XDS A;  4IHT A;  3OYC A;  3UNG C;  2R7X A;  1MW7 A;  3OYB A;  2RC4 A;  4M74 A;  3I4N J;  2X6O A;  4GGG A;  3ZP5 A;  1I3Q J;  1WPK A;  3IUO A;  3K69 A;  1UHS A;  3N05 A;  1SMY F;  2JPC A;  3K6G A;  1OCT C;  2E60 A;  1OCR H;  2RNG A;  3M8E A;  1ULY A;  4XLF A;  2VOO A;  1ON1 A;  1RKW A;  4HZF A;  1I3A A;  2LLK A;  2OQG A;  1XN7 A;  1BL0 A;  3F3X A;  3MQ0 A;  2Q8K A;  4G6D A;  2JWT A;  2OTJ I;  4G8X A;  3JAM K;  3FWE A;  2ZJP F;  1G2H A;  5M5Y J;  4LIT A;  1UG2 A;  2K86 A;  3GZ6 A;  2QSG X;  4E4H A;  3GFJ A;  4R1H A;  1TBX A;  2PN6 A;  2X1D A;  3FXJ A;  3MAJ A;  4NNJ A;  2ZME B;  4XOT A;  1MMS A;  2VBX A;  3K1N A;  3HRM A;  2BXY A;  4FE7 A;  3CD6 I;  2LBF A;  2Y75 A;  2QF7 A;  1S7O A;  2M4G A;  4UVA A;  1FTZ A;  3SZT A;  1YJW I;  1CGP A;  3O8G A;  1YIJ I;  1B8I A;  5LFA A;  3I54 A;  3LSH A;  2QBY B;  3F8M A;  3U1K A;  1MZB A;  2B0L A;  2IW5 A;  3IC7 A;  5AIQ A;  4RB3 C;  2X48 A;  3HTS B;  2CRG A;  5L3D A;  3MKZ A;  2LVS A;  5F27 A;  4F91 B;  2HQ5 A;  3ECO A;  3L09 A;  4OAY A;  4HPQ A;  3JRI A;  3A01 B;  3OYN A;  3W2V A;  2DOA A;  2ADU A;  2VJ4 A;  3V7R A;  1QHG A;  2ESN A;  1E3P A;  2ID6 A;  5FKO A;  2LK2 A;  4CA0 A;  3O2P E;  2V4J C;  3LFK A;  3OYG A;  2B7E A;  4XOR A;  2F4I A;  1ZEL A;  3BJA A;  3GTL J;  2ZXJ A;  1MBH A;  2E7W A;  2DDB A;  2EBI A;  4KIC A;  4PUS A;  1BW5 A;  3QAH A;  1Q1V A;  4ZC3 A;  5ICG A;  2KHM A;  3J7A Y;  2FX0 A;  2FSW A;  3ZQH A;  4CUG A;  1MSF C;  3T8R A;  4PCQ A;  2K9N A;  4GXO A;  2FOW A;  1Q1H A;  3CCU I;  2NRA C;  4WCG A;  4P5O A;  1QBJ A;  2XDV A;  1LE8 A;  1X4O A;  5H20 A;  3HBL A;  2NXN B;  4WXH A;  2A6E F;  3OIO A;  3CO6 C;  4UVC A;  1TT0 A;  1XG1 A;  2R7W A;  1NHA A;  2ZNY A;  4XN0 A;  2O03 A;  2HS5 A;  3LMM A;  4AUX A;  3K4J A;  1STZ A;  3QPL A;  1OJL A;  2XVC A;  2O61 A;  1IUF A;  1UB9 A;  5DCM B;  1Y39 A;  4HLY A;  2R7Q A;  2HNH A;  4NQW B;  3J81 K;  2H6B A;  5ICE A;  1KU2 A;  1PDN C;  2ZC2 A;  4I2O A;  2IVM A;  2DQL A;  1QQI A;  4DBR A;  3BCA A;  1F43 A;  5BPI A;  1I39 A;  3F8N A;  1MH3 A;  2D1V A;  4IX7 A;  1CQT A;  1MMG A;  3I0T A;  2M8E A;  3M9A A;  3WU1 B;  2XRO A;  3T8T A;  2AO9 A;  1SC7 A;  2ZXI A;  1VQO I;  1SAN A;  1SFK A;  3V8K A;  1OCO H;  4IRI A;  5D5U B;  2E36 A;  1PP7 U;  4IOC F;  2W1O A;  3DTE A;  3F6O A;  1XPX A;  3V8L A;  5JR3 A;  2DA5 A;  3LQR A;  3K4L A;  1QU3 A;  4Y15 A;  1TL8 A;  4RDU A;  3SEZ A;  1VQM I;  1HW2 A;  1WJ5 A;  3S2W A;  4XSX F;  1R23 A;  1TW2 A;  1DP3 A;  5IT9 Z;  5LHG A;  4XR6 A;  1VQ5 I;  1VND A;  1MIJ A;  2K7L A;  3H5N A;  1EA3 A;  4BY7 J;  3NWT A;  2E34 A;  3IAM 2;  4F55 A;  3PIP F;  3CDL A;  3TL4 X;  1Z9C A;  1R1T A;  4IL6 C;  3AG3 H;  2LKS A;  5A2Q Z;  2EZL A;  4LLN A;  1BI3 A;  4XM3 A;  2XHK A;  4L0Z B;  1TC3 C;  2OA4 A;  4OIQ F;  3QPT A;  1WWX A;  3GTO J;  1W7P D;  4Q5S F;  4AD9 A;  3HJE A;  4CYC A;  2R5Y A;  2XF7 A;  5IP9 J;  3HRU A;  3IRR A;  2BVL A;  1T8I A;  4M6X A;  4GFB A;  2MAB A;  4ON0 A;  2ZSI B;  4BJ6 C;  4F7Z A;  1TWC J;  2M0M A;  4M6V A;  3S1Q J;  2KDZ A;  4PGG A;  5FGM A;  1ERD A;  1VF9 A;  3QPH A;  4MHG A;  3KEQ A;  4HAM A;  5DEQ A;  4B48 A;  1D1B A;  3H1C A;  3B02 A;  3EQL F;  3CC4 I;  3ABL H;  5D4S A;  2JVG A;  3RI4 A;  2Z9O A;  2NS8 A;  5DUK A;  5E1W A;  4CZC A;  2RNJ A;  1WH5 A;  4L18 B;  5L3E A;  3KIO A;  1ZN2 A;  1V55 H;  4I01 A;  2XF5 A;  1ZRC A;  2M4K A;  4EGY A;  2JA5 J;  2HWV A;  4G6T B;  4XMY A;  3GLX A;  4ZH4 F;  3HHH A;  2XAG A;  3I3L A;  3OYM A;  3M8F A;  4NUB A;  3DKW A;  4G7H F;  4MEY F;  5AON A;  3RQI A;  1G3T A;  2ETH A;  3ZQ7 A;  4U7D A;  1FZP B;  2WV1 A;  3HG9 A;  4BYY A;  1JJ6 C;  4EJT A;  5CVJ A;  4ENM A;  4Y7N J;  2UWM A;  3S3O A;  2CWE A;  3K2A A;  4S05 A;  3BG9 A;  2HVQ A;  1IN8 A;  5F1R A;  1WJA A;  1WKM A;  2CO5 A;  5EGO B;  3ZQC A;  2JT1 A;  2D2W A;  1WJC A;  4E7Z A;  2HQR A;  5DYM A;  4ZZD A;  1QVU A;  1KQ9 A;  3IV5 A;  1ZH5 A;  4A3E J;  2DDA A;  2LRD A;  3WTY C;  4KN4 X;  4FX0 A;  1OPC A;  4KNY A;  2GXA A;  1B9M A;  2Z2S B;  2XRN A;  3KP2 A;  3E7L A;  1DPR A;  4V19 K;  3W2W A;  3S2H J;  1P7J A;  2DTR A;  3B73 A;  2AQF A;  2YU9 J;  1EJ9 A;  1U5T A;  3L2V A;  4KUM A;  5H2F C;  4B47 A;  1LEA A;  3IKV A;  1JKQ C;  1RIO H;  1WRJ A;  1EH6 A;  1JI8 A;  3F72 A;  2V9V A;  4H0E A;  3S1M J;  4LG0 B;  2F5F A;  2BV6 A;  4YG2 F;  3U21 A;  1K4S A;  3CJQ B;  1IDZ A;  2KDO A;  2KQR A;  1P4W A;  3L2W A;  2Q0O A;  3S3M A;  2DN0 A;  1W4M A;  3CUQ B;  1HC8 A;  1FTT A;  3KP7 A;  4EV0 A;  4ENN A;  1IXC A;  2H94 A;  1B4A A;  3WE2 A;  1HST A;  5JVG F;  4CO8 A;  1BI0 A;  1S29 A;  3D5L A;  3H0D A;  4KA4 A;  3I64 A;  1Y0N A;  3OS1 A;  2DTZ A;  2HPM A;  1S7E A;  5TIS C;  5E3O A;  2W82 A;  1VQ9 I;  3DFG A;  3DWL E;  1T38 A;  1R1V A;  4UUS A;  1SAU A;  1WJD A;  1UHW A;  2QEN A;  5J8F A;  3VSK A;  1JHF A;  5CKT A;  1FMV A;  4JOM A;  2X9D A;  5BOX A;  5J4Y A;  2LOO A;  3DU5 A;  1I6X A;  1UCR A;  2MA3 A;  1TNS A;  4HEA 2;  1MJB A;  2HGC A;  3MZH A;  2KLO A;  4RB2 C;  3GTG J;  2GXB A;  3CJN A;  2Y31 A;  2BHZ A;  1YG2 A;  4LOC A;  5KK1 A;  2Y9Y A;  2FBI A;  2STT A;  5LLQ A;  3LFU A;  1HQC A;  4XON A;  5DD4 A;  1O7F A;  2A5Y B;  1X1D A;  2YSR A;  1U5T C;  3H35 A;  1XGO A;  3PUF A;  3Q3S A;  2EH3 A;  2A61 A;  4NB5 A;  3HOV J;  2LD5 A;  5A2Q K;  2ZFU A;  1MMN A;  2V6E A;  3QYE A;  4IQ4 A;  2UZK A;  3E5Q A;  3K70 C;  1QVT A;  1REP C;  2OV7 A;  4L9T A;  5GAH J;  5GTI C;  5C44 J;  1FJL A;  4N4N B;  2RKH A;  4M9Z A;  4PSX A;  4MO7 A;  2OBP A;  1VI0 A;  5M3F J;  2BW3 B;  3TP0 A;  2FJ1 A;  2GA2 A;  4RMN A;  1WQ2 A;  3AFH A;  4RAG A;  2RQQ A;  3GWZ A;  5TRD A;  1IXR C;  1MND A;  1KA8 A;  1V54 H;  2H6C A;  4C30 A;  3RKX A;  1Z91 A;  4A3D J;  1J5Y A;  5KAI C;  4ANJ A;  3DLL F;  3KCC A;  4M3G A;  4AU7 A;  3PFI A;  4FTH A;  3MCZ A;  2DFE A;  3TED A;  3IRQ A;  1VTN C;  4XKV A;  3JRF A;  3GXO A;  2DAO A;  1MBF A;  5M5W J;  5H6R A;  1X58 A;  2F4M B;  2QKL B;  3SDG A;  2KZG A;  3BY6 A;  4E7I A;  4NBQ A;  3IHU A;  5FLX K;  2IS2 A;  2L9S A;  5FD6 A;  4KIB A;  5E3N A;  1IN7 A;  1XTA A;  4IKF A;  3DCF A;  4OIO F;  2DA2 A;  2H1L A;  3V7C A;  1W36 D;  2VOD A;  4B3A A;  1LUJ B;  3IH3 A;  4I02 A;  5EEA A;  3FBI B;  2OU2 A;  2P6T A;  3T0Y A;  1IXS B;  1YX5 A;  4AVP A;  5ILU A;  1P4A A;  2TRT A;  4A0X A;  2A68 F;  2EIJ H;  3QPS A;  2DYR H;  3TW6 A;  4BS9 A;  3QU6 A;  1MNE A;  3RDI A;  2DI3 A;  5CLS A;  1GV2 A;  1BI1 A;  1MBE A;  2VPR A;  3IWZ A;  2IRF G;  1VQ6 I;  3GO5 A;  4XQF A;  5C4X J;  3P9I A;  1IN6 A;  4KFC A;  4PZJ A;  1YJN I;  5FRO A;  4LG3 A;  3ZQI A;  3VOD A;  1UFM A;  2VOP A;  3LA7 A;  5CVR A;  1G3Y A;  1QZE A;  3OSG A;  2JA8 J;  1O3R A;  2QCO A;  3HKZ N;  2P5K A;  2CW8 A;  4AWX B;  1SD7 A;  2HOS A;  2M3A A;  2V9P A;  5EDN A;  4A3F J;  2X4H A;  1Z6T A;  3EDP A;  1S8N A;  2WAQ N;  2FUG 2;  1LB2 A;  3G1O A;  2DOF A;  2WB1 A;  2R7Z J;  1ETW A;  4OIP F;  3SZP A;  2DJI A;  4C2T A;  1FMW A;  2W48 A;  3JRE A;  2WC2 A;  1K83 J;  3HTU A;  1ETQ A;  4XK4 A;  2XSJ C;  1G4D A;  3JW4 A;  2A05 A;  3QYF A;  1ZGA A;  4N4O B;  1GDT A;  4BGD A;  4UUT A;  3SXY A;  3CDI A;  2ZJR F;  4LD5 A;  4BE0 A;  1AOY A;  1D0Z A;  3VPR A;  3NAR A;  2OPT A;  5J3L A;  2P7C B;  5JVT A;  2FML A;  2DXI A;  4YIF A;  3H92 A;  4XIC A;  3EET A;  1KU7 A;  2IPQ X;  4ITV A;  1PVE A;  5B3S H;  3I4M J;  1P4X A;  1YRN B;  2XGD A;  1XX5 A;  2FXA A;  1BOA A;  1FOK A;  1AKH B;  4FQG A;  2QSF X;  4BQN A;  1T39 A;  1JUM A;  1S5L C;  1HXD A;  4BNC A;  4XBF A;  2A5W A;  1SVM A;  4FE4 A;  2NOJ B;  3D1N I;  2QSH X;  4ENJ A;  2L9N A;  2X6Y A;  3TOA A;  3PO2 J;  3PJR A;  4OU0 A;  1OYY A;  2JJ7 A;  1NK3 P;  2JRM A;  3FK6 A;  2KRH A;  4D1Q A;  3R4K A;  1XSD A;  2CQ7 A;  2AXT C;  3ML6 A;  3HZJ A;  1R7J A;  3PL8 A;  4HG2 A;  1RRJ A;  3CMA I;  3SJM A;  4R79 A;  1Z3X A;  2GA1 A;  2E71 A;  2M7B A;  1QRY A;  3EPZ A;  3FMR A;  4G7O F;  2ZNZ A;  1LDD A;  2Y0M A;  1QA6 A;  2OF7 A;  2QQB A;  2HKX A;  3SEQ A;  5GPC A;  2DJN A;  1Z77 A;  2VKH A;  3QWL A;  4QIW N;  2EFN A;  1K6O A;  4JP0 A;  1X1C A;  4RBO A;  4J01 A;  4AID A;  1J9I A;  2W85 A;  3WGG A;  3MZ8 A;  5E3L A;  2JPB A;  4WXD A;  2VBZ A;  1A6I A;  5L3F A;  2VJI A;  3N97 A;  1IN5 A;  4CIC A;  1JTY A;  4P1W A;  2J5P A;  1T95 A;  4ZYA A;  5B5E C;  3ZQF A;  3S17 J;  2LBF B;  1D0Y A;  3DPL C;  4RAF A;  2KIF A;  1LVK A;  1ZGJ A;  2O3F A;  4EM0 B;  3BZ6 A;  3DXJ F;  5LBQ A;  3O3K A;  5GAG J;  2O9L A;  2BHY A;  1V5F A;  4B4C A;  1OCP A;  4D7N A;  4BKX A;  2DMT A;  4BEH A;  2FMY A;  2M2E A;  2O8X A;  2IS6 A;  3TO6 A;  1U8B A;  1SVO A;  1IGN A;  1K78 B;  4EJW A;  2NVU B;  2DT5 A;  2LKX A;  4M3F A;  3HRT A;  4U87 A;  3G2B A;  3JCU C;  1ETV A;  3WG7 H;  4D7M A;  1AWC A;  3BZC A;  1GVD A;  3HOZ J;  1QPM A;  4OWR B;  4X6A J;  4LB6 B;  1JGS A;  1P92 A;  1EKE A;  2VBW A;  4Y4R A;  4HNU A;  2PEX A;  3LA3 A;  5J1Y A;  3CCV I;  3ASO H;  1OIS A;  2COB A;  2CUJ A;  1D5V A;  4CDG A;  2E35 A;  3I59 B;  4AIH A;  3EYI A;  1MDM B;  3VFZ A;  5FKN A;  3KYC B;  1UHM A;  2X51 A;  2IGN A;  4AYB A;  2P4W A;  2R93 J;  5IP7 J;  2JQ7 A;  2EJR A;  1Z7L A;  3KP6 A;  3CLO A;  3HRS A;  1ZGW A;  1U6G A;  2IXS A;  2MD0 A;  3EYY A;  2FBK A;  3J81 Z;  2LDU A;  2G0E A;  5E8G A;  1S3J A;  3QU3 A;  1BN5 A;  2VUM J;  2KIQ A;  3BTJ A;  2E1M B;  4DNC A;  2VXZ A;  5CYV A;  1MGT A;  4LJZ F;  3RPQ A;  2FOK A;  1B72 A;  3VYU B;  1K79 A;  4IHS A;  5F6F A;  5HLI A;  4OIN F;  4M9S A;  2AXL A;  4A12 A;  1XMX A;  3K10 A;  2CQK A;  3BJO A;  4DIQ A;  4A3B J;  2EIK H;  3IH4 A;  3OY9 A;  3PFY A;  2GOX B;  4Y13 A;  1YO5 C;  1HW5 A;  2Q2E A;  3E6C C;  4A3L J;  2VJJ A;  3J80 K;  4EM2 A;  1O3S A;  1J59 A;  2MGQ A;  2CS3 A;  1ZG3 A;  3CJT B;  3WTV C;  2W24 A;  3FXU A;  2VPL A;  2MLK A;  2TDX A;  1LQ1 A;  2HOE A;  1T2K A;  3E3V A;  3EUA A;  4RB0 A;  3ZMZ A;  3ZR8 X;  2VI6 A;  2HOT A;  2R92 J;  5EG0 B;  2VQG A;  3LSK A;  3TQN A;  4XLN F;  4NC6 A;  1R9T J;  2DPU A;  1WVR A;  3O6B B;  2MC4 A;  4CXF A;  3BG6 A;  2BZT A;  2OTL I;  4FCY A;  3I55 I;  4UB6 C;  3PUB A;  3S15 J;  1X2N A;  1XS9 A;  2KFD A;  2Y48 A;  3ZQL A;  4XLC A;  4UHT A;  1R00 A;  3WTT C;  1TWH J;  1F5T A;  2KZV A;  4ASN A;  2KIM A;  3CMM A;  5M3M J;  2NVQ J;  3OS0 A;  1MJA A;  1VFC A;  2FU4 A;  1YOV B;  4IRG A;  1BI2 A;  3D0S A;  1X1A A;  1XMK A;  2O6G E;  1XCV A;  3F23 A;  1J75 A;  4HF1 A;  1QNT A;  1U0J A;  1FY7 A;  1K6Y A;  3BR1 A;  4O3M A;  3E6M A;  2YUS A;  2Q1Z B;  3TMO A;  3J7A O;  3OIP A;  3AAF A;  2HDW A;  4G7Z F;  5F0C A;  1D0X A;  3HC7 A;  1PJR A;  3KP4 A;  2PLY A;  3UR3 C;  2CQQ A;  1N25 A;  1Z21 A;  4BXU A;  2DA4 A;  4XLE A;  2P0W A;  2IA2 A;  5EYR A;  3GME A;  2MD5 A;  3RPU A;  3WHB A;  5EF6 A;  1VQL I;  2X6W A;  3FBN B;  3CO7 C;  4Z6Y A;  2Z3Y A;  3HSR A;  2HVS A;  5J1R A;  2D5V A;  1PYV A;  3H0G J;  3KP5 A;  2GXG A;  3REO A;  1Y1W J;  1JKO C;  2EA4 A;  5BQT A;  3M1E A;  3G3Z A;  4KYW A;  3VOE A;  3KPH A;  4MIM A;  1VQN I;  3OYF A;  2DK5 A;  2ACJ A;  3QQA A;  3S93 A;  2L01 A;  4ZJZ A;  1IF1 A;  2I5U A;  3Q9V A;  3CDH A;  3Q0V A;  3DKY A;  4C9Y A;  2R4G A;  2HR3 A;  2F5E A;  3DEE A;  3MWM A;  2V1U A;  2M7A A;  3F8F A;  1RKT A;  4CCO A;  3OOP A;  2DMU A;  1RC9 A;  2RDP A;  3DPU A;  5LGT A;  1R6R A;  3FMQ A;  2ZJQ F;  1T98 A;  2ZKZ A;  5FRN A;  1YS7 A;  3ONQ A;  1BIA A;  2VQC A;  1U9N A;  5LRS A;  2D1H A;  3HUG A;  1HF0 A;  2QM3 A;  5J6X A;  3RZD J;  2DLL A;  3OYL A;  2HYF A;  3C7J A;  4LLG F;  1N77 A;  4BHB A;  5J47 A;  2OZ6 A;  4D0P A;  1GHC A;  4ZTJ A;  1ZQ3 P;  2KJB A;  5D4R A;  3BR5 A;  1IRX A;  2L5Q A;  1W1W E;  3P9C A;  3K4M A;  3HSE A;  4L9J A;  2EB7 A;  2CFO A;  2K40 A;  1N75 A;  1NTC A;  4XKW A;  3OL4 A;  1ZKG A;  5KHD A;  2PJR A;  4U88 A;  2F4O B;  2KMU A;  1I5Z A;  1O4X A;  2CH0 A;  5F1J A;  4MTD A;  1BR1 A;  5F0H A;  3QP6 A;  4A5N A;  1FC3 A;  1WFX A;  1IO2 A;  4JX4 A;  4C3H J;  1IC8 A;  1ZLK A;  3Q9S A;  1FSE A;  2ELJ A;  3HGY A;  2CUE A;  3SZG A;  2P5V A;  3I5U A;  2PI0 A;  3FXL A;  2BY3 A;  2MYS A;  1R1U A;  4GYG A;  3K4B A;  1KYZ A;  4CHU A;  3LA2 A;  2IGM A;  1JKP C;  3C1D A;  3P5J A;  1U78 A;  2LRE A;  2VXD A;  5FKM A;  1IDY A;  1FBU A;  2CQX A;  2DA7 A;  2EIN H;  1SAX A;  3R0J A;  2P5L C;  1NK2 P;  2DQR A;  2LTP A;  1HDD C;  4IHV A;  3CP2 A;  1Y6I A;  1H89 C;  2M30 A;  4XNF A;  2PJP A;  5J40 A;  2BY1 A;  2Z33 A;  4IZZ A;  4UB8 C;  2QVO A;  3R60 A;  5K7H A;  2XKO A;  2MBF A;  4QSH A;  5F0F A;  1BJA A;  2MH9 A;  1I50 J;  4RAY A;  4ZDP A;  4ESF A;  1V5G A;  2PMZ A;  1A6Q A;  2YX4 A;  1FOW A;  5DS9 A;  2D45 A;  2PFB A;  2HDC A;  3QOD A;  5IP6 A;  3JTG A;  2BY0 A;  1PUF B;  1TW3 A;  2ZJ2 A;  5DTD A;  2VT2 A;  1OKR A;  3OWT A;  2L7K A;  5HDG A;  4DOZ A;  1O3T A;  2L7Z A;  3V8J A;  1RNL A;  3WTZ A;  5K5O A;  1T6S A;  2H8W A;  3WTX C;  3QYB A;  4EVI A;  4ZTF A;  3DQV C;  3GYH X;  2XAJ A;  4BJ5 C;  1EV7 A;  3JRC A;  2KRF A;  1TTY A;  5JI6 A;  4M72 A;  4P9F A;  2Z5U A;  1KGS A;  2EZH A;  2W57 A;  2M8G X;  5FKL A;  5FLX Z;  3FK7 A;  3BZK A;  1ODD A;  1V4R A;  4P9U A;  3CZ6 A;  3MKY B;  4C3J J;  5K5Q A;  1C0W A;  4PJ0 C;  2R7R A;  2GIV A;  2XV4 S;  1JTX A;  2K9L A;  2BXZ A;  2HQN A;  4PFP A;  4OOI A;  5IY5 H;  3S2D J;  3A0H C;  2ESH A;  1SVL A;  3DTI A;  2EPF A;  3FXM A;  4PFO A;  1GV5 A;  5GAD J;  3JRB A;  1GUU A;  1DP7 P;  3A1Y A;  5ILS A;  3GX4 X;  2K9Q A;  1G6N A;  5B1B H;  2VL8 A;  2QBY A;  2LY1 A;  3ZMS A;  1R71 A;  1QGP A;  3LSI A;  5FO5 A;  2XIG A;  3RKY A;  3RZO J;  3BTC A;  3VWB A;  1FWZ A;  4H4K C;  4DW6 A;  3A01 A;  4MGR A;  1LEB A;  3WTS C;  3M7G A;  1VQ4 I;  4HX8 A;  1RR7 A;  4ZYD A;  1E0E A;  1W5S A;  3WGI A;  4UUV A;  4JQF A;  1FP2 A;  3T1B A;  1B59 A;  2EWN A;  4XLH A;  4YEL A;  1G3S A;  2K3P A;  3WHC A;  4BAC A;  3AL0 B;  5LGU A;  1TQM A;  3I71 A;  5JHU A;  2WV0 A;  4XLP F;  3KEY A;  3R0A A;  3LSP A;  2NNN A;  4AIK A;  2A07 F;  3HOU J;  1A35 A;  1FIP A;  2ZCW A;  4Z2Y A;  5EEG A;  2QYO A;  2JTV A;  3QP5 A;  5BS6 A;  1IV6 A;  5CJ9 A;  2CG4 A;  3F0C A;  1YIT I;  4U0Y A;  2A3S A;  1AU7 A;  3OYA A;  1ZG1 A;  3S1R J;  4N0B A;  4Y3O A;  2VAS A;  1YI2 I;  3Q0W A;  5HLT A;  1A36 A;  2WAE A;  3JR9 A;  1LDJ A;  2ZXW H;  2XB5 A;  2ZME C;  3E6B A;  5DCM A;  3Q0U A;  4A93 J;  1H9G A;  1T0F C;  2IGO A;  3DF8 A;  4NQW A;  4BBS J;  1S72 I;  1GXQ A;  4Q4Z F;  2Y9Z A;  5F64 A;  4A69 C;  2EV5 A;  4R8H A;  3S1N J;  2GM4 A;  4LLL A;  4DQ2 A;  3FKI J;  3GVA A;  2GIZ A;  4HQM A;  5H6Q A;  1S9H A;  3K4N A;  4IEJ A;  4B3X A;  2XPU A;  1Z6R A;  3LSM A;  4IOA F;  2LY2 A;  3CMY A;  2R5Z B;  1JKR C;  2PMU A;  4HQE A;  1N78 A;  2LY9 A;  1MBK A;  1BR2 A;  1TQP A;  4Y33 A;  3G6E I;  1SFO J;  4E70 A;  2JMW A;  2DFF A;  1D3Y A;  3S16 J;  3JRH A;  2RN7 A;  2L4A A;  3HOT A;  2PG4 A;  1APL C;  4BDZ A;  5E18 F;  4F92 B;  3TDZ C;  2CV0 A;  4QTR A;  2VN2 A;  1HSJ A;  2BYV E;  2EFQ A;  1RUN A;  1W5C C;  1YW8 A;  2CQN A;  4A3J J;  2ZSH B;  5ICF A;  1IN4 A;  2ZXH A;  4BH9 A;  3GCM A;  1BC8 C;  4HNT A;  2N8G A;  3GTK J;  2VT3 A;  3M4O J;  3DBH B;  1X3W B;  1S7A A;  1DU6 A;  2ELH A;  3F8C A;  4EJO A;  2CFX A;  4IQJ A;  1DGW Y;  3A02 A;  4B1R A;  1XGN A;  3GEZ A;  3FDY A;  2K3F A;  1ZR4 A;  4YEJ A;  2XSD C;  4FX4 A;  1V3F A;  3HGG A;  2ZBK A;  2M5W A;  2UXX A;  4N9I A;  2I10 A;  2P6S A;  2R3S A;  4V2F A;  3LST A;  4ZDL A;  3X2Q H;  4MQ9 F;  4YIR X;  1H0M A;  1BM9 A;  1CF7 A;  2G9W A;  1O57 A;  3GBG A;  4RM3 A;  4OIR F;  3ZOB A;  2HOA A;  2YU3 A;  1R4N B;  5C3E J;  2R7O A;  3KZZ A;  1JHH A;  2FBH A;  2E5N A;  5TJJ A;  2FEZ A;  1F36 A;  1UAA A;  1TWG J;  5K1Y A;  3VYR B;  2VIX A;  5L3B A;  1TWF J;  2X1C A;  2FQ3 A;  2LC2 A;  3E1S A;  1K61 A;  5GPA A;  4UVB A;  3K70 D;  1JUP A;  2FE3 A;  1DPU A;  1D8K A;  3RYP A;  3U2R A;  1IG7 A;  2DA1 A;  3I58 A;  3GZ5 A;  5E3M A;  2E2J J;  3KEO A;  1P2F A;  1HKT A;  3LOC A;  1HDP A;  2L0K A;  1X19 A;  1YX3 A;  2L7F P;  4G12 A;  4X0G A;  5EGO A;  3OMY A;  5M5X J;  2HXI A;  4AC0 A;  4KDP A;  2DT7 B;  4HOB A;  4B44 A;  3KET A;  4BXX J;  5LHH A;  2JK3 A;  1X3U A;  2HKO A;  4JX6 A;  1YS6 A;  2UUZ A;  1QZY A;  4L0Y B;  4MFD A;  3H3V K;  3F21 A;  3P9K A;  1J09 A;  5EZG A;  1BJZ A;  3GTM J;  4PGH A;  3FF5 A;  2VC1 A;  1BA5 A;  4UNO A;  3UKG A;  4RGS A;  3K7A J;  5HNH A;  1VQP I;  1H9T A;  1ZLJ A;  3WGH A;  1IRG A;  2DA6 A;  3DKX A;  2LF7 A;  2MW8 A;  3SFI A;  3J80 Z;  3E0J B;  2DBB A;  2BOL A;  3TP3 A;  1QHH D;  4LG0 A;  1FIA A;  1Z1D A;  5FD5 A;  5GP9 A;  1QZZ A;  1M1E B;  2XAQ A;  2C6Y A;  2CUZ A;  2VB6 A;  1W0U A;  1D1C A;  4HW0 A;  2HZD A;  3HOY J;  4A3C J;  2LG4 A;  3OIQ A;  4DZJ A;  3PNV A;  1K4T A;  3CUQ A;  4G9Y A;  2HXO A;  3M07 A;  5HS9 A;  1WI9 A;  5GTH C;  5K5R A;  2OCC H;  5D5V B;  4S04 A;  3GF2 A;  2F5D A;  2KP6 A;  1IRZ A;  2WAD A;  3ABM H;  2X6X A;  3DPT A;  2XKP A;  4CSW A;  3H36 A;  4C3I J;  1Y8R B;  3PM1 A;  4I7H A;  2VE9 A;  5IOZ A;  4XOP A;  1X2M A;  4A6E A;  1O3Q A;  2O5R A;  2NOG A;  3F22 A;  2QGU A;  3G71 I;  1MMA A;  4BDY A;  1WJE A;  2MC3 A;  3CCE I;  3NWS A;  3CUO A;  2VLA A;  3ZXS A;  5LEK A;  3V7S A;  3GW2 A;  5FKK A;  3B6C A;  4RGU A;  5LHI A;  3OS2 A;  4XKC A;  3NAU A;  3HPH A;  3D5R C;  1OYI A;  4U0V A;  5DCF A;  1IJW C;  1EH8 A;  5E1Z B;  3C2H A;  1MNM C;  4DYQ A;  1I6H J;  2V1X A;  3FMS A;  2CYY A;  1YHQ I;  2Y0S A;  3JRA A;  3LSG A;  1KQ0 A;  3K9T A;  4LGW A;  4QWQ A;  1G3W A;  5DUI A;  2YPR A;  2K9M A;  4HDU A;  1IRF A;  1LDK B;  2QLZ A;  5CPR B;  1TQI A;  1A04 A;  3M3Y J;  3GTQ J;  2GOM A;  2IP2 A;  1JGG A;  2M87 A;  5IYD J;  4ZZL A;  2DMQ A;  3M1C A;  1ZK8 A;  3AL0 C;  4OMZ A;  5D5W B;  2XC7 A;  1RES A;  3BG5 A;  4XKB A;  1B8I B;  2XGC A;  2BW3 A;  1OR7 C;  4IPA A;  3H3Z A;  1XSX A;  2WB1 N;  4RLF A;  1XSV A;  4MTE A;  2L3D A;  3LSJ A;  3N4M A;  2I8D A;  2DPD A;  2JSC A;  4CGZ A;  4RS8 A;  4UXN A;  2ECC A;  4AVZ A;  3CUQ C;  2RAE A;  3OR2 C;  2XAS A;  3FXO A;  3HYI A;  2LKP A;  1AHD P;  3K4K A;  4D5F A;  1A5J A;  1IZ1 A;  3PQJ A;  4MFE A;  6PAX A;  1U8R A;  2DMP A;  3M8J A;  3A0B C;  2IS4 A;  3ZCO A;  1WZ2 A;  4HDV A;  2JA7 J;  2R0Q C;  1TP4 A;  3FHZ A;  4WXC A;  5K7F A;  4BU2 A;  3CJR B;  3V4G A;  1Y8Q B;  4XID A;  3W6V A;  3Q5F A;  4BAY A;  1U9O A;  3E97 A;  2VKD A;  3C3W A;  2K02 A;  3PIO F;  5HS8 A;  3IAS 2;  2E2I J;  4I0B A;  4EGZ A;  9ANT A;  1LE8 B;  3PQK A;  3EUH A;  4Q47 A;  3TDU C;  2DW4 A;  1LJ9 A;  1JUS A;  4E7J A;  2M34 A;  1T56 A;  4KJZ A;  2HTS A;  4KIF A;  1ETO A;  2A69 F;  4M3D A;  4J19 A;  4CCN A;  5KNL A;  1Z67 A;  5HLH A;  1QO0 D;  3R6S A;  4GO1 A;  3VB2 A;  3WTU C;  2XPV A;  1ZR2 A;  1LFP A;  2DYS H;  2IEK A;  4PJL A;  2HYJ A;  2GZW A;  4L5I A;  3L1P A;  2GAU A;  3BG7 A;  1ETX A;  1XDU A;  2JVH A;  3ZMV A;  4RLQ A;  2WWY A;  2MFZ A;  5FFX A;  4E7S A;  3CCQ I;  2DMN A;  2CGP A;  2PJR B;  4XRS A;  1W0T A;  4S0H B;  4IF4 A;  1ZAO A;  4IRH A;  2K27 A;  3KLO A;  2ELK A;  2G7U A;  2MG4 A;  2CW7 A;  4BUP A;  1YW9 A;  3I4P A;  2B9S A;  1ZG5 A;  1HA8 A;  5ED4 A;  1JT6 A;  2EZI A;  4HBL A;  4MQV A;  5FLM J;  3IKT A;  3COA C;  4LFU A;  4BJT A;  2XB0 X;  1LNW A;  4IXA A;  4I0A A;  4XSZ F;  1I1S A;  4L5E A;  4YII A;  4KN7 X;  4WK8 F;  3VSL A;  4CCL A;  4GYI A;  2OD5 A;  3CF5 F;  2LNB A;  2ZFW A;  3WOD F;  3IL2 A;  1DU0 A;  1LVA A;  1Z0X A;  3MKW B;  4KMF A;  1YRN A;  3AG4 H;  1AKH A;  1B1B A;  1V5E A;  2V26 A;  4CH7 A;  2L7M P;  3LSR A;  3OL3 A;  3EUH C;  2JUC A;  1FYM A;  2R5Y B;  3HXL A;  4CYC B;  1FBQ A;  1Y56 A;  1WCM J;  3BP8 A;  3PNY A;  4CCK A;  1UST A;  1TZL A;  2E2H J;  4K2E A;  4MEX F;  1FX7 A;  3B6A A;  2OZU A;  4CZZ A;  2XAF A;  4JK1 X;  4A3G J;  2PMH A;  1RET A;  2BE5 F;  4AYB N;  5BPD A;  4QLC U;  2JA2 A;  2CJJ A;  2IA0 A;  2QKM B;  2KT0 A;  1R36 A;  2CMP A;  5LRR A;  1RI7 A;  2LH9 A;  2X1E A;  4II2 A;  2EQR A;  1OCC H;  3L2U A;  4XRM A;  4D9J A;  3JRD A;  3K2Z A;  4QPO A;  3CCJ I;  1BC7 C;  2FNA A;  3BWG A;  4MNU A;  3HEF A;  3LNQ A;  1B9N A;  3SFZ A;  1ITY A;  1SD6 A;  2NNY A;  1HOM A;  1B6A A;  3FIS A;  4DYC A;  3C2G A;  1GXP A;  3HDD A;  1IAW A;  3HIF A;  4JX5 A;  4PJJ A;  2YX7 A;  1DUX C;  1W7P A;  1VQ7 I;  3GLL A;  2EFO A;  4A3K J;  1KU9 A;  1WSU A;  3WU2 C;  5HOO A;  1F1Z A;  5KAF C;  3WTW C;  4ZDO A;  4XRF A;  5D8L B;  2BEO A;  4PDK A;  3A4C A;  3NQO A;  1K7A A;  2L9R A;  4ESB A;  4P55 A;  3P7N A;  4NC7 A;  4RGX A;  1QPI A;  3DU6 A;  1NG7 A;  4IVN A;  2E5Z A;  1ORK A;  3FX3 A;  1NH3 A;  3G1M A;  5D6E A;  1SD4 A;  4NHJ A;  1I1G A;  2LYC A;  3OYE A;  2M45 A;  5IT3 A;  1K78 A;  5D8K B;  1GLN A;  3H9Q A;  3BG3 A;  3CF2 A;  3TKY A;  2HEO A;  5E20 A;  1U5T B;  4YFN F;  2IT0 A;  4QPQ A;  1FPQ A;  5LD2 C;  2CW0 F;  2UXN A;  3I53 A;  3OV8 A;  1OLT A;  4FAS D;  1AA7 A;  2KKO A;  1YW7 A;  1R58 A;  2HU9 A;  4A2U A;  4HNV A;  3BOQ A;  2CSO A;  2IJL A;  1LFU P;  5DM6 F;  4PK4 A;  4I99 C;  4E7K A;  3I59 A;  2WA0 A;  1MDM A;  2R7U A;  4FHT A;  3RTR A;  3WG9 A;  3RJP A;  3DP7 A;  2H09 A;  3FXK A;  4RM2 A;  2L4M A;  4AM3 A;  3I9V 2;  1MBG A;  1UJ8 A;  1YLF A;  1YJ9 I;  4CYD A;  4LK0 F;  3K0L A;  2RVC A;  2MSY A;  3ULQ B;  1WGX A;  2F6C A;  3LWF A;  3MMY B;  2X0L A;  3WE3 A;  4BBR J;  4ETS A;  3T5X A;  1JT0 A;  3TGN A;  3FM3 A;  3OOU A;  4BQA A;  3SQN A;  4HLX A;  4C2U A;  3K1P A;  4UUS B;  3PSI A;  2EA2 A;  5LGN A;  4IO9 F;  3J7Y J;  2KIU A;  4BQQ A;  3FXQ A;  1KZH A;  3HOS A;  4EAT A;  2JZY A;  1YQA A;  2BVM A;  4II3 A;  4BL0 B;  5J4V A;  3AG2 H;  4FET A;  4EQQ A;  1TNT A;  3A03 A;  5C4J J;  1U2W A;  3WU0 A;  5B66 C;  4E7L A;  1MJ9 A;  4BE1 A;  4V2G A;  3MFK A;  3ZQQ A;  2CV2 A;  2EV6 A;  1BR4 A;  3ZMD A;  2XAU A;  4KMU X;  4AIJ A;  3ZQG A;  4EJU A;  1OCZ H;  3ABK H;  3J7Z I;  1A31 A;  3GTP J;  3AKZ A;  4HA8 A;  1NG6 A;  3H5R A;  1T08 B;  1I27 A;  3OYJ A;  2XRL A;  1TT5 B;  2OJE D;  2KPM A;  2LSO A;  3MD2 A;  4RA2 A;  2DO7 A;  3CLQ A;  2HDD A;  2UV1 A;  1HLV A;  3F6V A;  4IJA A;  5EG0 A;  2EFP A;  2V79 A;  1Y1V J;  1ZAR A;  4U7B A;  1OYW A;  3E5X A;  4BY1 J;  3OR1 C;  1RPW A;  1R22 A;  3SYT A;  1XD7 A;  4LK1 F;  2HQA A;  3LAP A;  2ID3 A;  2F48 A;  4G6Q A;  1WI3 A;  3RPU D;  1VQ8 I;  1RUO A;  3DBL B;  3GFL A;  3PO3 J;  1UG0 A;  1SFE A;  5E79 C;  4Y17 A;  4M6Y A;  3LQQ A;  1IUY A;  3HPG A;  2VQL A;  2W84 A;  3L2R A;  4M71 A;  2FA5 A;  2Z1D A;  3W2A A;  2X85 A;  2NVX J;  2E1M C;  4HST A;  5EJC A;  3S32 A;  2LR8 A;  3CCY A;  2NVY J;  3ZMT A;  4L5J A;  1HKQ A;  2A6H F;  4YRV A;  3CP8 A;  4ENK A;  4OMY A;  3JTH A;  2ZME A;  5F04 A;  3W3C A;  1T0F A;  2EIL H;  1CF7 B;  4KIG A;  4HYE A;  1LFB A;  4X1E A;  2FRH A;  3CTA A;  1JE8 A;  2B63 J;  3E6D A;  4LMY A;  5TGT A;  4XLA A;  2RV8 A;  4CCJ A;  1WJF A;  1YFH A;  1U3E M;  3KE2 A;  1XGM A;  3KFW X;  1OMI A;  4KT5 C;  4HRI A;  3HOW J;  2LMD A;  5B1A H;  3OYI A;  1L0O C;  2Y30 A;  2CV1 A;  4WF2 A;  3LAJ A;  2R7D A;  3VEP A;  3RSN A;  3H5A A;  4E7H A;  2DK8 A;  1F9N A;  1FOY A;  1R5G A;  1HKS A;  1WHU A;  3GFI A;  1SFU A;  5J8C A;  2RRE A;  2QEX I;  2OQR A;  2V1N A;  4LIU A;  1KON A;  4UV8 A;  2YR2 A;  2IBD A;  4N9H A;  2BGC A;  2XUB A;  1ACI A;  2JA6 J;  5FB2 A;  2V9K A;  4HX4 A;  1EF4 A;  3ZN0 A;  2IGK A;  1UZC A;  4A0Z A;  2ICW G;  1JJ8 C;  2COM A;  3NEU A;  2KL4 A;  4YFK F;  3AG1 H;  3CCR I;  3QOP A;  3ZGK A;  1LKX A;  1FSH A;  4G94 A;  3IP4 B;  2P8T A;  3QOE A;  2DOE A;  2HVR A;  3ERE D;  2F5C A;  1KQ8 A;  3IWF A;  1X3Z B;  3ISP A;  3BDD A;  2PMZ N;  1HBX G;  3GZN B;  5EZH A;  3G1L A;  5HOD A;  3HOX J;  3BT9 A;  2H8R A;  4F3Q A;  4EM1 A;  3QRF F;  2E7X A;  2HZT A;  2BBY A;  3D5S C;  1O7L A;  4M3E A;  3FKJ A;  5CQE A;  1BBY A;  2R7F A;  2L02 A;  3BLY A;  1MMD A;  2VKV A;  5HNF A;  3RKQ A;  4HV6 A;  1ON2 A;  1J2X A;  5ERI A;  2KJC A;  3F9K A;  5CVU A;  1HW1 A;  2FD5 A;  3RCO A;  5IYC J;  2NS7 A;  4PJN A;  4B43 A;  2JRT A;  2HFH A;  5IOY A;  3A2K A;  4KIT B;  1FP1 D;  4NC8 A;  1MBJ A;  3FIW A;  3NRV A;  2VJ5 A;  3BJ6 A;  2P81 A;  2GWR A;  1S6L A;  2K4J A;  3ROU A;  3CQZ J;  2XAH A;  3MEX A;  5E8I A;  2STW A;  3KLN A;  4FT8 A;  4A3I J;  1X1B A;  3ECH A;  1Y0U A;  3BQZ A;  3GTJ J;  4HSR A;  2HI3 A;  3BTL A;  5CVV A;  1ETY A;  3FXR A;  3CCS I;  2MLG A;  4XN3 A;  2WTE A;  2W7N A;  1DDN A;  3GFM A;  3JSO A;  2L54 A;  4EJV A;  2LF8 A;  3R61 A;  3HKZ A;  4UY8 I;  1Z3Y A;  4ZYE A;  4HF2 A;  5IT9 K;  1FEX A;  3DEW A;  1W36 C;  2IAI A;  1MKM A;  2O7O A;  2WAQ A;  2ZO4 A;  2ISY A;  3CME I;  1FNN A;  5F08 A;  4B8X A;  2AS5 F;  2GQQ A;  5DDG A;  2A6T A;  3ZPL A;  3I56 I;  1XMA A;  1ZRF A;  2VE8 A;  4WX9 A;  1PUF A;  1HCR A;  4OAZ A;  5DD8 A;  3OYK A;  1TLH B;  3W6K B;  2E1N A;  5IYB J;  4DJA A;  3OSF A;  3H3U A;  2DFI A;  4BEH B;  3HSF A;  4EMS A;  3VYS B;  1F4K A;  2KRC A;  1D5Y A;  1PUE E;  2EK5 A;  4Y52 J;  1YIO A;  1ZYR F;  5AIP A;  3KX2 A;  4UV9 A;  5DV5 A;  4DGW B;  2NVT J;  3BQY A;  1R4M B;  3ERM A;  3G4S I;  1WH7 A;  5FLV A;  2OAZ A;  4I98 B;  4I76 A;  2ISZ A;  3CC7 I;  4L9N A;  1DQU A;  3KYD B;  1ZTR A;  1D1A A;  2EFW A;  3C18 A;  2JUG A;  4BXF A;  1JXS A;  1GVJ A;  2OCE A;  2FQ4 A;  1TWA J;  3HL2 A;  1Z05 A;  2QQA A;  4J00 A;  2QQ8 A;  3O8H A;  2KIS A;  4F93 B;  2G7H A;  2NAZ A;  3BCB A;  3HM5 A;  4O6J A;  5DM7 F;  2R7S A;  1T33 A;  1J7K A;  1FT9 A;  2FNP A;  3KZY A;  5CQG A;  3ZN1 A;  4HX7 A;  3JSP A;  3OYD A;  1YE9 A;  2QA4 I;  1FOX A;  1BIB A;  4I09 A;  5D5X B;  5CVI A;  3JRG A;  2RGV A;  1RR8 C;  1BOB A;  4W97 A;  4IHW A;  2XPW A;  5FJ8 J;  2E1C A;  3ESW B;  1BW6 A;  3EUK L;  1E2X A;  1L3L A;  3DBR B;  1B72 B;  5D6F A;  2ME6 A;  2J5O A;  3L2C A;  2XF6 A;  1ONV A;  3DV8 A;  4XL9 A;  4FIS A;  3DLA A;  4L9V A;  2K85 A;  2W00 A;  2Q2E B;  1OR7 A;  3PNT A;  2GBY A;  2F5V A;  2VKE A;  3H9J A;  5BMZ A;  1R49 A;  5E1X A;  5KCM A;  4DZP A;  2M1B A;  3MVP A;  2LFB A;  3H9G A;  3BR2 A;  1MD0 A;  1UEL B;  2V6C A;  3CES A;  1IV8 A;  4LIV A;  4MLO A;  3L7W A;  5HLG A;  3FM5 A;  4PSW A;  5JFR A;  3G73 A;  4RGR A;  2PBI A;  3BPX A;  2ZB9 A;  1PP8 F;  1ZRD A;  2RQP A;  1MSE C;  2VBY A;  2H27 A;  5HDK A;  1SMT A;  1KYW A;  1E3H A;  2NS0 A;  1RZ4 A;  1VZ0 A;  1SD5 A;  5E17 F;  2QUF A;  4YFX F;  2LP0 A;  2QZ8 A;  2DFH A;  4HV5 A;  3K1M A;  1OQY A;  2EV0 A;  3FZV A;  3ASN H;  4ZYG A;  3ABT A;  2O0Y A;  2PQ8 A;  3GUD A;  2R5Z A;  1KU3 A;  1G59 A;  2F2E A;  5JLX A;  4RAZ A;  4A5M A;  1XC5 A;  3BR6 A;  2CUF A;  3S3N A;  4O5V A;  2Z99 A;  3CCM I;  2QWW A;  2Z16 A;  3TO7 A;  3VDX A;  4IHY A;  3C2B A;  1GT0 C;  4D5C A;  1XGS A;  1YTY A;  1SEU A;  1USS A;  5HVQ C;  3TOB A;  3IH2 A;  3JAM Z;  2DT6 A;  4BE2 A;  2IS1 A;  3BC8 A;  4BQO A;  1UMQ A;  2FF4 A;  1OFC X;  2K4B A;  2VC0 A;  3CC2 I;  3ZRG A;  4M9X A;  1EH7 A;  1P7I A;  4XRS G;  3S14 J;  5BNG A;  5K7Z A;  1H8A C;  3MN2 A;  5IPA A;  2Y2Z A;  1FYK A;  4P96 A;  1W7P B;  3KZI C;  5EEH A;  5JLW A;  2JN6 A;  1P6R A;  3V42 A;  2L9V A;  2VQH A;  4ABZ A;  3DTK A;  2V1D A;  2DU9 A;  4PJM A;  1Z7U A;  2EIM H;  2WAF A;  5JHF A;  4LB5 A;  1R5H A;  2VON A;  2AHQ A;  2O8K A;  3U1D A;  3LL7 A;  1E17 A;  3PSF A;  3VYT B;  2NYX A;  5ICC A;  3BTI A;  3CCL I;  1POG A;  2WY8 Q;  1XB4 A;  1ZHF A;  2HTJ A;  2BY2 A;  4EEF G;  2K5C A;  2M0C A;  4IHX A;  4JYK A;  1FLI A;  2K9S A;  2W4S A;  2V7F A;  4B09 A;  4RB1 A;  4BHP A;  2MH2 A;  5LEJ A;  1J0R A;  1D8J A;  3KP3 A;  5KVR A;  2WBM A;  4GRI A;  3ZMU A;  3SHF A;  2P7V B;  4WWC A;  2ECB A;  4M3B A;  3U9G A;  5L3G A;  3OYH A;  1SFX A;  3HUG B;  3SDB A;  3RQ4 A;  3HB9 A;  3L00 A;  1LPQ A; 
#chains in the Genus database with same CATH homology
 1FBS A;  3ABU A;  4GCV A;  4HF0 A;  1FYL A;  4ZYH A;  3MZY A;  3RKW A;  4BHC A;  3L9F A;  3BRO A;  3TO9 A;  4TV7 A;  3ELK A;  3BPV A;  4A0Y A;  3E5U A;  1XCB A;  4M73 A;  1YYV A;  5HS7 A;  3HHG A;  3W6J B;  2IA1 A;  4Q48 A;  3RIR A;  4JBA A;  3RYR A;  5ILV A;  2W25 A;  5HDN A;  4A6D A;  4ESJ A;  3F8B A;  5L3C A;  4U0W A;  1IW7 F;  1W5T A;  1ZRE A;  5FFZ A;  2XGX A;  2QQ9 A;  2HYG D;  3DEU A;  1XDS A;  4IHT A;  2RC4 A;  4M74 A;  4GGG A;  3ZP5 A;  3K69 A;  1SMY F;  2JPC A;  3M8E A;  1ULY A;  2VOO A;  1ON1 A;  4HZF A;  2OQG A;  1XN7 A;  3F3X A;  3MQ0 A;  2Q8K A;  4G6D A;  4G8X A;  3JAM K;  3FWE A;  2K86 A;  3GZ6 A;  3GFJ A;  4R1H A;  1TBX A;  2PN6 A;  3MAJ A;  2ZME B;  2VBX A;  3K1N A;  3HRM A;  2Y75 A;  1S7O A;  4UVA A;  3SZT A;  1CGP A;  3I54 A;  2QBY B;  3F8M A;  1MZB A;  2B0L A;  2IW5 A;  3IC7 A;  5AIQ A;  4RB3 C;  3HTS B;  5L3D A;  3ECO A;  3L09 A;  2ADU A;  3V7R A;  2ESN A;  3O2P E;  3LFK A;  3BJA A;  2ZXJ A;  2E7W A;  4KIC A;  3QAH A;  5ICG A;  2FSW A;  3T8R A;  4PCQ A;  4GXO A;  1Q1H A;  2NRA C;  4WCG A;  4P5O A;  1QBJ A;  5H20 A;  4WXH A;  2A6E F;  3CO6 C;  4UVC A;  1NHA A;  2ZNY A;  2O03 A;  2HS5 A;  1STZ A;  2XVC A;  2O61 A;  1UB9 A;  5DCM B;  4HLY A;  3J81 K;  2H6B A;  5ICE A;  1KU2 A;  1PDN C;  4I2O A;  2IVM A;  2DQL A;  1QQI A;  5BPI A;  3F8N A;  2D1V A;  3I0T A;  2M8E A;  3M9A A;  3WU1 B;  2XRO A;  3T8T A;  3V8K A;  4IRI A;  5D5U B;  1PP7 U;  3F6O A;  3V8L A;  5JR3 A;  3LQR A;  4Y15 A;  1HW2 A;  3S2W A;  4XSX F;  1R23 A;  1TW2 A;  5IT9 Z;  5LHG A;  2K7L A;  1Z9C A;  1R1T A;  5A2Q Z;  4LLN A;  1BI3 A;  2XHK A;  4L0Z B;  2OA4 A;  4OIQ F;  3QPT A;  1WWX A;  1W7P D;  4Q5S F;  4AD9 A;  3HRU A;  3IRR A;  4M6X A;  4ON0 A;  4F7Z A;  4PGG A;  5FGM A;  3QPH A;  4MHG A;  3KEQ A;  4HAM A;  5DEQ A;  3B02 A;  3EQL F;  5D4S A;  3RI4 A;  2Z9O A;  5DUK A;  5E1W A;  2RNJ A;  4L18 B;  5L3E A;  1ZN2 A;  4I01 A;  1ZRC A;  4EGY A;  2HWV A;  3GLX A;  4ZH4 F;  3HHH A;  2XAG A;  3M8F A;  3DKW A;  4G7H F;  4MEY F;  5AON A;  3ZQ7 A;  1G3T A;  2ETH A;  4U7D A;  1FZP B;  4BYY A;  4EJT A;  5CVJ A;  4ENM A;  2UWM A;  2CWE A;  4S05 A;  1IN8 A;  5F1R A;  1WKM A;  2CO5 A;  2JT1 A;  2D2W A;  2HQR A;  5DYM A;  4ZZD A;  1KQ9 A;  1ZH5 A;  3WTY C;  4KN4 X;  4FX0 A;  1OPC A;  4KNY A;  1B9M A;  2XRN A;  3KP2 A;  1DPR A;  2DTR A;  3B73 A;  1U5T A;  4KUM A;  1LEA A;  3IKV A;  1RIO H;  1WRJ A;  1EH6 A;  3F72 A;  2V9V A;  4H0E A;  4LG0 B;  2F5F A;  2BV6 A;  4YG2 F;  1P4W A;  2Q0O A;  1W4M A;  3CUQ B;  3KP7 A;  4EV0 A;  4ENN A;  1IXC A;  2H94 A;  1B4A A;  3WE2 A;  1HST A;  4CO8 A;  1BI0 A;  1S29 A;  3D5L A;  4KA4 A;  3I64 A;  3DFG A;  1T38 A;  1R1V A;  1UHW A;  2QEN A;  5J8F A;  1JHF A;  5BOX A;  1I6X A;  1UCR A;  1TNS A;  2MA3 A;  3MZH A;  1MJB A;  2HGC A;  4RB2 C;  2GXB A;  3CJN A;  1YG2 A;  5KK1 A;  2FBI A;  2STT A;  5LLQ A;  1HQC A;  5DD4 A;  1O7F A;  2A5Y B;  2YSR A;  1U5T C;  1XGO A;  2A61 A;  4NB5 A;  5A2Q K;  2UZK A;  3E5Q A;  1REP C;  4L9T A;  2RKH A;  4M9Z A;  2OBP A;  2GA2 A;  1WQ2 A;  5TRD A;  3GWZ A;  1IXR C;  2H6C A;  1KA8 A;  3RKX A;  1Z91 A;  1J5Y A;  3KCC A;  3PFI A;  3MCZ A;  3IRQ A;  1VTN C;  3GXO A;  2DAO A;  5H6R A;  3BY6 A;  3IHU A;  5FLX K;  5FD6 A;  4KIB A;  1IN7 A;  4OIO F;  3V7C A;  2VOD A;  4I02 A;  2OU2 A;  2P6T A;  3T0Y A;  1IXS B;  4AVP A;  5ILU A;  1P4A A;  4A0X A;  2A68 F;  3QU6 A;  3RDI A;  2DI3 A;  5CLS A;  1BI1 A;  3IWZ A;  2IRF G;  3GO5 A;  3P9I A;  1IN6 A;  4KFC A;  4PZJ A;  2VOP A;  3VOD A;  1UFM A;  3LA7 A;  5CVR A;  1G3Y A;  1O3R A;  2P5K A;  4AWX B;  1SD7 A;  2X4H A;  1Z6T A;  3EDP A;  1S8N A;  1LB2 A;  4OIP F;  3SZP A;  2WC2 A;  3HTU A;  1G4D A;  3JW4 A;  1ZGA A;  3SXY A;  1AOY A;  4LD5 A;  2P7C B;  5JVT A;  2FML A;  4YIF A;  3H92 A;  1KU7 A;  3EET A;  2IPQ X;  1P4X A;  2FXA A;  1BOA A;  1FOK A;  1T39 A;  1HXD A;  4BNC A;  4XBF A;  4ENJ A;  3TOA A;  4OU0 A;  1OYY A;  1XSD A;  3R4K A;  3ML6 A;  1R7J A;  4R79 A;  2GA1 A;  3FMR A;  4G7O F;  2ZNZ A;  1LDD A;  2Y0M A;  2QQB A;  2HKX A;  2EFN A;  1K6O A;  1J9I A;  2W85 A;  3WGG A;  2JPB A;  4WXD A;  2VBZ A;  5L3F A;  3N97 A;  1IN5 A;  4CIC A;  2J5P A;  3DPL C;  2KIF A;  1ZGJ A;  2O3F A;  4EM0 B;  3BZ6 A;  3DXJ F;  5LBQ A;  3O3K A;  2FMY A;  2O8X A;  3TO6 A;  1K78 B;  4EJW A;  2DT5 A;  3HRT A;  1AWC A;  1QPM A;  4LB6 B;  1JGS A;  1P92 A;  2VBW A;  2PEX A;  3LA3 A;  1D5V A;  4CDG A;  3I59 B;  4AIH A;  3EYI A;  1MDM B;  3VFZ A;  1UHM A;  2P4W A;  2EJR A;  3KP6 A;  3CLO A;  3HRS A;  1U6G A;  3EYY A;  2FBK A;  3J81 Z;  2LDU A;  5E8G A;  1S3J A;  3QU3 A;  1BN5 A;  4DNC A;  2VXZ A;  5CYV A;  1MGT A;  4LJZ F;  3RPQ A;  2FOK A;  1K79 A;  4IHS A;  5F6F A;  5HLI A;  4OIN F;  4M9S A;  2AXL A;  4A12 A;  2CQK A;  3BJO A;  4Y13 A;  1YO5 C;  1HW5 A;  2Q2E A;  3E6C C;  3J80 K;  1J59 A;  4EM2 A;  1O3S A;  1ZG3 A;  3WTV C;  2W24 A;  3FXU A;  2MLK A;  2TDX A;  1LQ1 A;  2HOE A;  1T2K A;  3E3V A;  3ZMZ A;  4RB0 A;  3TQN A;  4XLN F;  2DPU A;  3O6B B;  4CXF A;  2Y48 A;  4UHT A;  1R00 A;  3WTT C;  1F5T A;  4ASN A;  2KIM A;  1MJA A;  2FU4 A;  4IRG A;  1BI2 A;  3D0S A;  1XMK A;  2O6G E;  1XCV A;  3F23 A;  1J75 A;  4HF1 A;  1QNT A;  1FY7 A;  4O3M A;  3E6M A;  3J7A O;  3AAF A;  4G7Z F;  3KP4 A;  2PLY A;  4BXU A;  2IA2 A;  2MD5 A;  3RPU A;  3CO7 C;  2Z3Y A;  3HSR A;  3REO A;  3KP5 A;  2GXG A;  2EA4 A;  5BQT A;  3M1E A;  3G3Z A;  4KYW A;  3VOE A;  2ACJ A;  2DK5 A;  2L01 A;  1IF1 A;  3Q9V A;  3CDH A;  2HR3 A;  2F5E A;  3MWM A;  2V1U A;  3F8F A;  3OOP A;  2RDP A;  5LGT A;  3FMQ A;  1T98 A;  2ZKZ A;  1YS7 A;  1BIA A;  5LRS A;  2D1H A;  3HUG A;  2QM3 A;  5J6X A;  2DLL A;  2HYF A;  3C7J A;  4LLG F;  4BHB A;  2OZ6 A;  4D0P A;  1GHC A;  2KJB A;  5D4R A;  3P9C A;  3HSE A;  4L9J A;  2EB7 A;  4U88 A;  1I5Z A;  4MTD A;  3QP6 A;  4A5N A;  1FC3 A;  1ZLK A;  3Q9S A;  1FSE A;  2P5V A;  3I5U A;  2PI0 A;  1R1U A;  4GYG A;  1KYZ A;  4CHU A;  3LA2 A;  3C1D A;  1U78 A;  1FBU A;  1SAX A;  3R0J A;  2P5L C;  2DQR A;  2M30 A;  2PJP A;  2Z33 A;  2QVO A;  3R60 A;  2XKO A;  2MBF A;  1BJA A;  2MH9 A;  4RAY A;  4ESF A;  2YX4 A;  2D45 A;  2PFB A;  2HDC A;  3JTG A;  1TW3 A;  2ZJ2 A;  2VT2 A;  1OKR A;  5HDG A;  1O3T A;  3V8J A;  1RNL A;  3WTZ A;  5K5O A;  1T6S A;  3WTX C;  4EVI A;  3DQV C;  3GYH X;  2XAJ A;  1EV7 A;  2KRF A;  1TTY A;  5JI6 A;  4M72 A;  4P9F A;  2Z5U A;  1KGS A;  2W57 A;  5FLX Z;  1ODD A;  1V4R A;  4P9U A;  5K5Q A;  1C0W A;  2GIV A;  2XV4 S;  2HQN A;  4OOI A;  2ESH A;  1DP7 P;  5ILS A;  3GX4 X;  1G6N A;  2QBY A;  3ZMS A;  1QGP A;  5FO5 A;  2XIG A;  3RKY A;  1FWZ A;  4MGR A;  1LEB A;  3WTS C;  3M7G A;  4HX8 A;  4ZYD A;  1W5S A;  3WGI A;  4UUV A;  4JQF A;  1FP2 A;  3T1B A;  1B59 A;  2EWN A;  1G3S A;  5LGU A;  1TQM A;  3I71 A;  5JHU A;  2WV0 A;  4XLP F;  3R0A A;  2NNN A;  4AIK A;  2A07 F;  2ZCW A;  4Z2Y A;  5EEG A;  2QYO A;  2JTV A;  3QP5 A;  5BS6 A;  5CJ9 A;  2CG4 A;  4U0Y A;  2A3S A;  1ZG1 A;  4N0B A;  1LDJ A;  3E6B A;  5DCM A;  1H9G A;  3DF8 A;  4NQW A;  1GXQ A;  4Q4Z F;  5F64 A;  2EV5 A;  4R8H A;  4LLL A;  4DQ2 A;  4HQM A;  3GVA A;  5H6Q A;  1Z6R A;  2PMU A;  4HQE A;  1TQP A;  4E70 A;  1D3Y A;  2RN7 A;  2L4A A;  3HOT A;  2PG4 A;  5E18 F;  3TDZ C;  2VN2 A;  1HSJ A;  2BYV E;  2EFQ A;  1RUN A;  1YW8 A;  5ICF A;  1IN4 A;  4BH9 A;  1BC8 C;  2VT3 A;  1S7A A;  2ELH A;  3F8C A;  4EJO A;  2CFX A;  1XGN A;  3GEZ A;  4FX4 A;  1V3F A;  2ZBK A;  2M5W A;  2UXX A;  4N9I A;  2P6S A;  2R3S A;  3LST A;  4MQ9 F;  1H0M A;  1BM9 A;  1CF7 A;  2G9W A;  1O57 A;  4OIR F;  2YU3 A;  3KZZ A;  1JHH A;  2FBH A;  5TJJ A;  2FEZ A;  5K1Y A;  5L3B A;  2FQ3 A;  4UVB A;  2FE3 A;  1DPU A;  1D8K A;  3RYP A;  3U2R A;  3I58 A;  3GZ5 A;  3KEO A;  1P2F A;  1HKT A;  4KDP A;  4HOB A;  3KET A;  5LHH A;  1X3U A;  2HKO A;  1YS6 A;  4L0Y B;  1QZY A;  3F21 A;  3P9K A;  4PGH A;  3FF5 A;  2VC1 A;  4UNO A;  4RGS A;  1H9T A;  1ZLJ A;  3WGH A;  1IRG A;  2LF7 A;  3J80 Z;  2DBB A;  4LG0 A;  1Z1D A;  5FD5 A;  1QZZ A;  2C6Y A;  2XAQ A;  4HW0 A;  3CUQ A;  4G9Y A;  5HS9 A;  1WI9 A;  5K5R A;  5D5V B;  4S04 A;  3GF2 A;  2F5D A;  3DPT A;  2XKP A;  4I7H A;  2VE9 A;  4A6E A;  1O3Q A;  3F22 A;  2MC3 A;  3CUO A;  5LEK A;  3V7S A;  3GW2 A;  4RGU A;  5LHI A;  1OYI A;  4U0V A;  5DCF A;  1EH8 A;  5E1Z B;  2V1X A;  3FMS A;  2CYY A;  1KQ0 A;  3K9T A;  4LGW A;  4QWQ A;  1G3W A;  5DUI A;  2YPR A;  4HDU A;  1IRF A;  1LDK B;  2QLZ A;  1TQI A;  1A04 A;  2IP2 A;  2M87 A;  4ZZL A;  4OMZ A;  5D5W B;  4IPA A;  3H3Z A;  1XSX A;  2DPD A;  4MTE A;  1XSV A;  2L3D A;  3N4M A;  2JSC A;  4CGZ A;  4RS8 A;  4UXN A;  3CUQ C;  2XAS A;  3HYI A;  2LKP A;  1IZ1 A;  3PQJ A;  6PAX A;  1U8R A;  4HDV A;  3FHZ A;  4WXC A;  3V4G A;  3Q5F A;  4BAY A;  3E97 A;  3C3W A;  2K02 A;  5HS8 A;  4I0B A;  4EGZ A;  3PQK A;  3EUH A;  4Q47 A;  3TDU C;  2DW4 A;  1LJ9 A;  2HTS A;  4KIF A;  2A69 F;  5HLH A;  1QO0 D;  3R6S A;  4GO1 A;  3VB2 A;  3WTU C;  2GZW A;  4L5I A;  2GAU A;  1XDU A;  3ZMV A;  2WWY A;  5FFX A;  2CGP A;  4IF4 A;  1ZAO A;  4IRH A;  2K27 A;  3KLO A;  2G7U A;  1YW9 A;  3I4P A;  1ZG5 A;  5ED4 A;  4HBL A;  4MQV A;  3IKT A;  3COA C;  4LFU A;  1LNW A;  4IXA A;  4I0A A;  4XSZ F;  1I1S A;  4YII A;  4KN7 X;  4WK8 F;  4GYI A;  2OD5 A;  2LNB A;  2ZFW A;  3WOD F;  3IL2 A;  1LVA A;  4KMF A;  1B1B A;  1FYM A;  1FBQ A;  3BP8 A;  1UST A;  4K2E A;  4MEX F;  1FX7 A;  2OZU A;  4CZZ A;  2XAF A;  4JK1 X;  2PMH A;  2BE5 F;  5BPD A;  4QLC U;  2IA0 A;  1R36 A;  5LRR A;  1RI7 A;  3K2Z A;  1BC7 C;  2FNA A;  3BWG A;  4MNU A;  1B9N A;  3SFZ A;  1SD6 A;  2NNY A;  1B6A A;  1GXP A;  1IAW A;  3HIF A;  2YX7 A;  1DUX C;  1W7P A;  2EFO A;  1KU9 A;  1WSU A;  5HOO A;  3WTW C;  1F1Z A;  4XRF A;  5D8L B;  2BEO A;  4PDK A;  1K7A A;  3NQO A;  4ESB A;  4P55 A;  3P7N A;  4RGX A;  4IVN A;  3FX3 A;  5D6E A;  1SD4 A;  4NHJ A;  1I1G A;  2M45 A;  5IT3 A;  1K78 A;  5D8K B;  3TKY A;  2HEO A;  5E20 A;  1U5T B;  4YFN F;  2IT0 A;  1FPQ A;  2CW0 F;  2UXN A;  3I53 A;  3OV8 A;  2KKO A;  1YW7 A;  1R58 A;  4A2U A;  3BOQ A;  2CSO A;  2IJL A;  3I59 A;  1MDM A;  4FHT A;  3RTR A;  3WG9 A;  3RJP A;  3DP7 A;  2H09 A;  2L4M A;  1YLF A;  4CYD A;  4LK0 F;  3K0L A;  2RVC A;  3ULQ B;  3LWF A;  2X0L A;  3WE3 A;  4ETS A;  3T5X A;  3TGN A;  3FM3 A;  4BQA A;  3SQN A;  4HLX A;  3K1P A;  2EA2 A;  5LGN A;  2KIU A;  3FXQ A;  3HOS A;  2JZY A;  1YQA A;  4EQQ A;  1TNT A;  1U2W A;  3WU0 A;  1MJ9 A;  3MFK A;  2EV6 A;  3ZMD A;  4KMU X;  4AIJ A;  4EJU A;  4HA8 A;  1I27 A;  2LSO A;  2DO7 A;  3F6V A;  4IJA A;  2EFP A;  2V79 A;  1ZAR A;  4U7B A;  1OYW A;  3E5X A;  1R22 A;  1XD7 A;  4LK1 F;  3LAP A;  4G6Q A;  1RUO A;  3GFL A;  1SFE A;  4Y17 A;  4M6Y A;  3LQQ A;  1IUY A;  2W84 A;  4M71 A;  2FA5 A;  3ZMT A;  4L5J A;  1HKQ A;  2A6H F;  4ENK A;  4OMY A;  3JTH A;  2ZME A;  1T0F A;  1CF7 B;  4KIG A;  4HYE A;  2FRH A;  3CTA A;  1JE8 A;  3E6D A;  4LMY A;  2RV8 A;  1YFH A;  1U3E M;  3KE2 A;  1XGM A;  3KFW X;  1OMI A;  4KT5 C;  1L0O C;  4WF2 A;  3LAJ A;  2R7D A;  3VEP A;  2DK8 A;  1F9N A;  1R5G A;  1HKS A;  3GFI A;  1SFU A;  5J8C A;  2OQR A;  4UV8 A;  2YR2 A;  4N9H A;  2BGC A;  2XUB A;  5FB2 A;  4HX4 A;  3ZN0 A;  4A0Z A;  2COM A;  3NEU A;  4YFK F;  3QOP A;  1FSH A;  4G94 A;  2P8T A;  3ERE D;  2F5C A;  1KQ8 A;  3IWF A;  3ISP A;  3BDD A;  1HBX G;  4EM1 A;  3QRF F;  2E7X A;  2HZT A;  2BBY A;  1O7L A;  1BBY A;  2R7F A;  2L02 A;  4HV6 A;  1ON2 A;  1J2X A;  5ERI A;  2KJC A;  5CVU A;  1HW1 A;  2JRT A;  2HFH A;  1FP1 D;  3NRV A;  3BJ6 A;  2GWR A;  1S6L A;  2K4J A;  3ROU A;  2XAH A;  3MEX A;  5E8I A;  2STW A;  3KLN A;  4FT8 A;  3ECH A;  1Y0U A;  5CVV A;  3FXR A;  2MLG A;  2WTE A;  1DDN A;  3GFM A;  3JSO A;  2L54 A;  4EJV A;  2LF8 A;  3R61 A;  4HF2 A;  4ZYE A;  5IT9 K;  1MKM A;  2ZO4 A;  2ISY A;  1FNN A;  4B8X A;  2AS5 F;  2GQQ A;  5DDG A;  3ZPL A;  1XMA A;  1ZRF A;  2VE8 A;  4WX9 A;  5DD8 A;  1TLH B;  3W6K B;  2E1N A;  3H3U A;  2DFI A;  3HSF A;  4EMS A;  1F4K A;  1PUE E;  2EK5 A;  1YIO A;  1ZYR F;  5AIP A;  5DV5 A;  4UV9 A;  2OAZ A;  4I98 B;  2ISZ A;  4L9N A;  2EFW A;  3C18 A;  1JXS A;  1GVJ A;  1Z05 A;  2QQA A;  2G7H A;  2NAZ A;  4O6J A;  1J7K A;  1FT9 A;  2FNP A;  3KZY A;  3ZN1 A;  4HX7 A;  3JSP A;  1BIB A;  4I09 A;  5D5X B;  5CVI A;  2RGV A;  2E1C A;  1E2X A;  1L3L A;  5D6F A;  2J5O A;  3L2C A;  1ONV A;  3DV8 A;  4L9V A;  1OR7 A;  5BMZ A;  5E1X A;  2M1B A;  1MD0 A;  2V6C A;  5HLG A;  3L7W A;  3FM5 A;  5JFR A;  3G73 A;  4RGR A;  2PBI A;  3BPX A;  1PP8 F;  1ZRD A;  2RQP A;  2VBY A;  2H27 A;  5HDK A;  1SMT A;  1KYW A;  2NS0 A;  1RZ4 A;  1SD5 A;  5E17 F;  2QUF A;  4YFX F;  2QZ8 A;  4HV5 A;  3K1M A;  2EV0 A;  3FZV A;  4ZYG A;  3ABT A;  2O0Y A;  2PQ8 A;  3GUD A;  1KU3 A;  2F2E A;  4RAZ A;  4A5M A;  4O5V A;  2Z99 A;  2QWW A;  3TO7 A;  1YTY A;  1XGS A;  1USS A;  5HVQ C;  3TOB A;  3JAM Z;  2FF4 A;  2K4B A;  2VC0 A;  4M9X A;  1EH7 A;  1FYK A;  4P96 A;  1W7P B;  5EEH A;  1P6R A;  2V1D A;  2DU9 A;  1Z7U A;  4LB5 A;  2VON A;  1R5H A;  3U1D A;  1E17 A;  2NYX A;  5ICC A;  1XB4 A;  1ZHF A;  2HTJ A;  1FLI A;  4B09 A;  4RB1 A;  4BHP A;  2MH2 A;  5LEJ A;  1J0R A;  1D8J A;  3KP3 A;  5KVR A;  3ZMU A;  3SHF A;  2P7V B;  4WWC A;  3U9G A;  5L3G A;  1SFX A;  3L00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...