2FXAA

Structure of the protease production regulatory protein hpr from bacillus subtilis.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
156
Chain Sequence
PPYDVKEALVFTQKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRTYVQLTEEGTEVFWSLLEEFDPTRNAVFKGSQPLYHLFGKFPEVAEMMCMIRHIYGDDFMEIFETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Protease Production Regulatory Protein hpr from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Protease production regulatory protein hpr
total genus 50
structure length 156
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fxaA00
2CGPA 2XASA 2M1BA 4LG0B 4HF0A 4JQFA 1F9NA 2VODA 3BP8A 1NHAA 3AAFA 3Q9VA 5HS9A 4OMZA 2EFQA 3ZP5A 3VODA 2EFNA 1S7OA 3RTRA 2GZWA 1P4AA 1O7FA 1KU2A 3FZVA 2XKOA 3EQLF 4ENJA 5E20A 2W25A 2L4AA 1S3JA 4EJVA 4MTDA 3ZMTA 2DFIA 2CG4A 1U8RA 3SXYA 1G3WA 4R79A 1Q1HA 2XROA 2IP2A 4N9HA 4CYDA 5CVUA 3HHGA 1SFXA 4CICA 1OKRA 1ZHFA 1U5TA 4Z2YA 2ISZA 3ZN1A 2P7CB 1W7PA 3FXQA 4IJAA 1XGOA 2Z99A 4GYGA 1DPUA 5CVRA 2A6HF 5A2QZ 2VXZA 1ZN2A 5DCFA 5L3CA 3P9IA 2HZTA 3GFLA 3I54A 4P9UA 1R7JA 2HGCA 1VTNC 3I58A 2VC0A 4EGZA 3KZYA 2P5LC 2F2EA 4KA4A 3MQ0A 3NEUA 3H3ZA 3GYHX 4G6DA 1HW5A 4P96A 2PI0A 2HTJA 2HWVA 3WTXC 4G7HF 3SZTA 1IN7A 5E1XA 3ELKA 4RGRA 3CO6C 3RKWA 1DP7P 5CYVA 3KP7A 4LGWA 1B1BA 3RJPA 2EV0A 4MGRA 2UZKA 4WCGA 1LNWA 1F1ZA 1J75A 3T8RA 4EQQA 3VB2A 1BI3A 3W6JB 1JXSA 4P55A 2FE3A 1A04A 2W84A 4IRHA 5KVRA 3DF8A 4IHSA 1TNTA 3SZPA 3J80Z 1I6XA 2ADUA 3K1PA 4O5VA 4BAYA 1D5VA 4BHBA 3IKVA 1YO5C 2VE8A 3S2WA 1K78A 2W85A 4WF2A 2QBYB 3DKWA 2JZYA 3DPTA 2OZUA 2LDUA 3IRRA 3LA7A 4P5OA 2PQ8A 4CZZA 3J81K 4LB5A 2B0LA 3WGHA 3QU3A 1HXDA 1P6RA 1XMAA 2F5CA 1P4WA 4EJOA 2JPCA 2ZNZA 2EFPA 5DUIA 4OINF 4EM1A 4Y17A 3R6SA 4OU0A 3WE2A 4I0AA 4ESFA 2OA4A 1W5SA 5D4SA 3DV8A 1G4DA 2OQRA 5BOXA 1XSVA 1EH8A 1SMTA 3F6VA 4R1HA 5D6EA 3ZMVA 5DD8A 2IRFG 1SD7A 1G6NA 3V8KA 4H0EA 1EV7A 1L0OC 1Z1DA 3G3ZA 5F64A 1BM9A 1MGTA 3ZQ7A 4BNCA 1YS6A 3I0TA 4BHCA 4F7ZA 2EA4A 3BWGA 1FZPB 3LWFA 2O03A 1W7PB 2OBPA 3C18A 3M9AA 1ZAOA 3ZMDA 2P4WA 5KK1A 4AD9A 3PQKA 2ZCWA 4OOIA 5LLQA 2XAJA 3ZN0A 5DUKA 3M8EA 1FOKA 1YTYA 4LLLA 2VE9A 3LAPA 1Z7UA 3SQNA 2A3SA 5FD5A 1IW7F 1GHCA 3R61A 1IRGA 2PMHA 1UCRA 1XGSA 5CJ9A 1RI7A 2BGCA 3V7SA 1D3YA 1ODDA 2H09A 2PG4A 1TQMA 1BIAA 1S7AA 2L54A 3REOA 5FLXZ 4M6YA 1MDMB 1GXQA 2FBKA 1TBXA 3P9CA 4EJWA 1YS7A 1F5TA 2XV4S 1QPMA 3G73A 4I98B 4I09A 1KU3A 2XKPA 2M87A 1T98A 2WWYA 2GIVA 1T2KA 1H0MA 4M74A 3GVAA 4EM0B 4ESBA 1WWXA 5DCMB 1T38A 3GZ5A 2DO7A 2UXXA 3DP7A 1USTA 3BPVA 4IPAA 4LB6B 2YSRA 4OMYA 1R00A 2MLGA 1U3EM 1K78B 1OR7A 3F8FA 5ICGA 4U0VA 2MA3A 2WTEA 1HSJA 2OU2A 1XN7A 3DFGA 1YW9A 2PEXA 1S8NA 2DI3A 1W5TA 2D1VA 3HSRA 3HRTA 4A12A 4PDKA 1ZARA 3M1EA 4U7DA 2DK8A 1ZG1A 3RPQA 3KETA 4BQAA 2QYOA 2V6CA 4HAMA 3CTAA 3V8LA 3IHUA 2VONA 3FHZA 2ZO4A 4HX8A 4A6EA 4UXNA 2DTRA 3B73A 1Z6TA 3GZ6A 4P9FA 1REPC 4HF1A 4OIPF 1YIOA 4I7HA 4XSXF 2F5DA 2O61A 2NS0A 3CUQC 2DQLA 3E5XA 4EGYA 3GFJA 1TW2A 3OV8A 3RI4A 2A5YB 2O3FA 5D5XB 3DEUA 4MTEA 2AXLA 4HX7A 1PUEE 4HDVA 4UVAA 5IT3A 5D5UB 2K02A 2ACJA 2XAHA 1ZH5A 2LF7A 5E8IA 4L0ZB 2O0YA 1B4AA 1O3QA 5LHHA 5CVVA 4AIKA 2QZ8A 2XRNA 4UHTA 3TOBA 5FB2A 4U0YA 3TOAA 2VC1A 2RVCA 4MEYF 5JR3A 4FHTA 2F5EA 3R60A 4Q5SF 3LAJA 1KYZA 3MEXA 1XB4A 5J8CA 4PGGA 4BYYA 5D4RA 1QZYA 3Q9SA 1JE8A 4HBLA 4N9IA 2XUBA 2OQGA 3KFWX 2CSOA 3JSOA 3M7GA 4KDPA 4NHJA 1Z9CA 1I5ZA 2XAGA 1HKQA 1LQ1A 4KIFA 2IPQX 1G3TA 4YIFA 2Z3YA 3N97A 2JT1A 3C1DA 1Z6RA 3WTYC 3ZMUA 5HLHA 1IXSB 1BI1A 3CUOA 1U2WA 2ELHA 1LJ9A 4G94A 1ZRDA 3O2PE 2K7LA 1KGSA 4KMFA 4A6DA 3JTGA 1ZRCA 1ZG3A 1T0FA 1P4XA 1FC3A 2FXAA 2ZXJA 3GUDA 5EEGA 2YPRA 1R1TA 1WSUA 5HS7A 1GVJA 4IF4A 4RB1A 3QPHA 5JVTA 4EV0A 3JW4A 2DQRA 1RIOH 4HF2A 3GX4X 4A5MA 4CO8A 1XD7A 3E6DA 4RB3C 2P7VB 1O57A 5ICFA 3SHFA 4S05A 1K79A 5E1WA 1I27A 2FNAA 1PP8F 1FP1D 1RUOA 1R22A 1BI2A 2GAUA 3KLNA 5FFZA 1GXPA 4U0WA 3IRQA 4DNCA 2A6EF 2MLKA 3TO7A 1FBUA 2Q8KA 4I01A 1Z91A 5JFRA 3WTSC 1OMIA 1KU9A 1U78A 4A0ZA 4L0YB 4GXOA 4EJTA 2PFBA 3EYIA 3FMQA 5IT9Z 1QO0D 5BPDA 2Z33A 5L3BA 3I53A 2HDCA 4ENNA 1JGSA 3ZPLA 1TQPA 3H92A 3FMRA 4RGXA 4IHTA 5LBQA 2STWA 3P7NA 1B9NA 2W24A 2O8XA 2F5FA 4EJUA 4HQMA 3ROUA 2M8EA 2C6YA 5AIPA 4KNYA 3TGNA 2J5OA 3DXJF 2RNJA 3GLXA 1MZBA 2HR3A 4A0YA 4KUMA 1B6AA 3CJNA 3E5QA 5L3FA 2PLYA 1KQ9A 3WTVC 2HYGD 3F72A 1WI9A 4B8XA 3E6CC 3HUGA 3QP6A 4HQEA 1KA8A 1DPRA 2M5WA 1J9IA 3IL2A 1BJAA 4CGZA 1H9GA 2HYFA 4WXCA 5DEQA 1H9TA 3PFIA 4Y13A 1EH6A 1LEAA 3FX3A 4AIJA 3QOPA 4WXDA 1TTYA 2LKPA 2V79A 2O6GE 3K1MA 1UB9A 2DW4A 1ZG5A 2YX4A 1IN4A 3WODF 5HDNA 1DUXC 2Z5UA 3I4PA 4YFKF 1YFHA 2RDPA 1LDDA 1V4RA 2EFWA 4HV6A 4JK1X 1LDKB 5LRSA 3GFIA 2PMUA 4CDGA 5JI6A 3TDUC 3KE2A 1XCBA 2YU3A 3L2CA 4S04A 4LK1F 5ED4A 4B09A 1BI0A 3WTTC 3U1DA 1U5TC 1UHMA 3WU0A 5ILVA 4KMUX 1I1SA 4ESJA 3L00A 2BYVE 3WG9A 4FT8A 2DPDA 3V4GA 4TV7A 5ERIA 2VBYA 3FXUA 4LFUA 4WK8F 3D5LA 4XRFA 2DK5A 1EH7A 1B59A 2QQ9A 4M9ZA 1IZ1A 3EETA 2ZBKA 5D8LB 1FX7A 1YYVA 2MC3A 2A61A 2JPBA 2CW0F 2HKXA 2K4BA 4UV9A 5E17F 2FQ3A 3FWEA 3ISPA 3V8JA 4RGSA 1QQIA 1ZLKA 4KN7X 4RAZA 2GXGA 4IVNA 4ZZLA 2E7XA 2FRHA 1HSTA 1BOAA 3FM3A 1FSHA 4LK0F 1UFMA 3KLOA 1XMKA 3TO6A 1E2XA 3PQJA 3T5XA 1HKSA 1XSXA 4E70A 5L3EA 1FYLA 1O3RA 3R0JA 2ESHA 4G7ZF 3WTUC 4GO1A 4RB0A 1FYMA 2ZMEA 2P6SA 2OAZA 1ZGJA 2P5VA 2RGVA 2FOKA 3T1BA 2L01A 2VOPA 2RQPA 5K5OA 4M9SA 4A2UA 4FX0A 2QVOA 4KYWA 1Y0UA 3KEOA 1QZZA 2W57A 2FMYA 2V1DA 2WV0A 1XGNA 2DAOA 4WX9A 4D0PA 3IWZA 4UUVA 1Z05A 4GGGA 1HW2A 1IN5A 4KICA 4MNUA 2ZKZA 1MKMA 2Y0MA 1BC8C 3BY6A 4FX4A 1QNTA 1KQ0A 4AVPA 1FLIA 5BS6A 3DQVC 3E6BA 5FLXK 5D6FA 1STZA 2YX7A 1BIBA 2D2WA 1AOYA 4HYEA 3CLOA 2P6TA 4RGUA 2HEOA 4KIBA 4IXAA 3WTZA 5FO5A 1YW7A 5CVJA 2BBYA 5K1YA 3MCZA 1HW1A 2M30A 1LDJA 1FPQA 2COMA 3LA3A 4CHUA 2FNPA 4L18B 4N0BA 1MJ9A 4M71A 2OZ6A 2IT0A 4BHPA 2EB7A 2FF4A 1OPCA 5LGTA 2IA0A 2KKOA 3HYIA 3F21A 2GQQA 4QWQA 2EK5A 2XAFA 3EDPA 4BXUA 2CYYA 6PAXA 4LG0A 1TQIA 2IA2A 2A07F 3VFZA 1OYWA 3B02A 2STTA 1K6OA 4XSZF 3WU1B 3F3XA 4U88A 2H27A 2HOEA 2IA1A 4IRIA 2D45A 1XCVA 4CXFA 4RAYA 1FYKA 3E6MA 3TO9A 5DYMA 4OIOF 3KP3A 2IJLA 3GO5A 4XBFA 1J0RA 2QQBA 3RIRA 4ZYHA 1J5YA 3WGIA 5FGMA 2VBWA 4ENMA 2XAQA 2TDXA 3LA2A 5J6XA 4WWCA 5CLSA 3KP4A 1FWZA 2PN6A 2QQAA 2H6CA 3BROA 4PCQA 5LGUA 3P9KA 4HLYA 3HOSA 1ON2A 2L4MA 5HOOA 1ULYA 2K27A 2GA2A 2X0LA 1FBSA 2BV6A 1ONVA 3F8CA 2FEZA 5D5VB 3BDDA 2ZJ2A 4NQWA 3U9GA 2VBXA 5H6QA 5BMZA 2V1XA 3KP5A 2P5KA 2KIFA 1HBXG 3I59B 4IRGA 1CGPA 1QBJA 2E7WA 3NQOA 4A0XA 5FFXA 4ON0A 3HSEA 4PGHA 1HQCA 5DDGA 3COAC 3V7CA 4M9XA 2GA1A 3MFKA 1SMYF 4O3MA 3GXOA 3F8MA 1YQAA 2FBHA 2G9WA 2UWMA 1BC7C 4L9JA 4EMSA 1DDNA 1J2XA 4NB5A 1UHWA 2Q2EA 1IXRC 2HQRA 1YW8A 5HS8A 3CDHA 2HQNA 3RKYA 2ZNYA 2DBBA 2BEOA 1K7AA 3FM5A 2V1UA 4R8HA 1S29A 3ML6A 1SFEA 1SD6A 3IC7A 1ZREA 3BJOA 3ZMSA 3GF2A 1PP7U 1QGPA 1O3SA 5BPIA 4L9NA 2QUFA 4L9VA 4DQ2A 4XLPF 4I0BA 2EV5A 3K2ZA 2KIMA 2Y48A 1U5TB 2FSWA 3E5UA 4ZYDA 2FA5A 1BN5A 1E17A 3HHHA 4K2EA 5ILUA 5E1ZB 2NRAC 3ECHA 1ZRFA 4OIQF 2G7HA 1O3TA 3K0LA 4Q47A 5H20A 2E1NA 1MJBA 4M72A 4KN4X 3BJAA 4GCVA 3TDZC 1WKMA 5L3GA 4Q4ZF 4LJZF 3VOEA 5LEJA 1ZYRF 2L02A 4EVIA 1XDSA 3RKXA 5HDKA 1D8JA 3KCCA 1TW3A 3JAMK 1G3SA 4M73A 1JHHA 4ZH4F 1J59A 2YR2A 2CQKA 5E18F 1HKTA 2X4HA 1U6GA 2KIUA 5LRRA 1RZ4A 2GWRA 1ON1A 1MD0A 3FMSA 2XHKA 1SD4A 2MD5A 1V3FA 3ECOA 5JHUA 3MWMA 3BPXA 4AIHA 1JHFA 1KYWA 2JRTA 3J81Z 2CFXA 1X3UA 2ZMEB 2Q0OA 1KQ8A 5DD4A 1IUYA 1RUNA 2AS5F 4ASNA 2RN7A 3I71A 1IN8A 3CUQB 2QWWA 1C0WA 2L3DA 2NNNA 3RYPA 2GXBA 4YG2F 3T8TA 3QAHA 3HRMA 3H3UA 4MHGA 2MH9A 4RB2C 2FU4A 5K5RA 3I59A 4L5JA 4L9TA 2KRFA 2H6BA 2IW5A 2VN2A 1R5GA 3TQNA 5F6FA 3JSPA 2R7DA 3F22A 5LEKA 3I5UA 1OYYA 3J7AO 5AIQA 1YLFA 3DPLC 4BH9A 4ENKA 3ERED 5HLIA 2P8TA 3BOQA 3EUHA 2EA2A 2KJBA 5DV5A 3N4MA 5D8KB 4UVCA 4PZJA 2XIGA 3SFZA 3FF5A 3GEZA 4Y15A 1SFUA 4YIIA 4MEXF 2FBIA 2VBZA 4HW0A 5EEHA 2LF8A 1R1VA 4HA8A 3KZZA 4HDUA 2VT3A 2QLZA 3MZHA 5ILSA 3O3KA 1FSEA 3GFMA 1B9MA 2VT2A 4G6QA 4I2OA 3TKYA 5LGNA 3F23A 4UV8A 3LSTA 3QP5A 3R4KA 3D0SA 4RS8A 5FD6A 2ESNA 2NYXA 4M6XA 1LB2A 3RDIA 2XVCA 2EWNA 2HTSA 1R23A 2HKOA 1P2FA 3KEQA 3BZ6A 1FP2A 3O6BB 2RC4A 3OOPA 4LD5A 2CWEA 1XDUA 2XGXA 1FY7A 1MDMA 2DLLA 3QU6A 1S6LA 3GW2A 4LLNA 5HLGA 3KP6A 1TLHB 3RYRA 2R7FA 2A69F 4U7BA 5ICEA 2ZFWA 2NAZA 4G9YA 3WGGA 2BE5F 3BJ6A 3V7RA 2QM3A 3F6OA 1AWCA 2FMLA 4ZZDA 2CO5A 1IAWA 4G7OF 1IRFA 3MAJA 1SD5A 5L3DA 2NNYA 4WXHA 2JTVA 2HFHA 2UXNA 1G3YA 3ULQB 3ABTA 1F4KA 3HRUA 2R3SA 1R36A 2RKHA 3K1NA 5BQTA 3KP2A 2PJPA 5AONA 1R1UA 5TJJA 1YG2A 4JBAA 3EYYA 4HZFA 4LLGF 2ISYA 4I02A 4ETSA 5IT9K 2IVMA 3HTSB 1P92A 1TNSA 3E97A 3ABUA 2J5PA 5HVQC 3CO7C 2LSOA 2Z9OA 2WC2A 2H94A 3LFKA 2V9VA 4OIRF 4YFXF 5DCMA 4Q48A 3WE3A 1I1GA 1PDNC 4HX4A 3F8NA 1IN6A 3R0AA 4UNOA 1ZLJA 2K4JA 4AWXB 1IF1A 3IKTA 3HOTA 1D8KA 1R5HA 2EJRA 2QENA 1SAXA 3JAMZ 1T39A 1W4MA 4EM2A 1KU7A 4KT5C 2LNBA 3M8FA 1FBQA 1OYIA 1CF7B 2DT5A 5F1RA 3L9FA 2MH2A 3LQRA 4ZYEA 2MBFA 1L3LA 5A2QK 3W6KB 2QBYA 4MQVA 1ZGAA 3MZYA 5CVIA 1R58A 3HSFA 3JTHA 3C7JA 5TRDA 2M45A 4ZYGA 4LMYA 2EV6A 4YFNF 3J80K 3U2RA 2DU9A 4MQ9F 3HTUA 1FNNA 4A5NA 1O7LA 2JSCA 3E3VA 4KFCA 4HLXA 2PBIA 3K69A 2K86A 3FXRA 2ETHA 3F8BA 1RNLA 4L5IA 2RV8A 5ICCA 5H6RA 1WQ2A 1LVAA 2G7UA 1T6SA 4HV5A 3NRVA 3Q5FA 3WTWC 3L7WA 5LHGA 1WRJA 4QLCU 1XGMA 3I64A 2EFOA 2Y75A 3VEPA 3IWFA 4KIGA 4UVBA 3QRFF 4G8XA 3T0YA 1W7PD 1FT9A 2D1HA 3CUQA 3K9TA 1BBYA 3HIFA 3ZMZA 3C3WA 2E1CA 5D5WB 3HRSA 4O6JA 2A68F 2HS5A 5LHIA 4HOBA 3GWZA 3LQQA 1XSDA 3RPUA 4XLNF 5HDGA 1IXCA 2KJCA 5J8FA 2VOOA 1J7KA 4GYIA 3L09A 1USSA 3QPTA 5E8GA 2DPUA 2OD5A 1CF7A 1LEBA 5K5QA 1MJAA
chains in the Genus database with same CATH superfamily
3W2AA 2CGPA 1KONA 2XASA 1OCTC 4AYBN 3BQZA 2B7EA 2M1BA 4DYCA 4LG0B 1XMXA 1QHGA 3CC7I 4HF0A 4JQFA 1F9NA 2VODA 3BP8A 3MN2A 4QIWN 4S0HB 1NHAA 2WBMA 3AAFA 3L2UA 2WY7Q 3Q9VA 5HS9A 4OMZA 4IL6C 2EFQA 3OR2C 3ZP5A 4HPQA 3RQ4A 3VODA 4BY1J 2EFNA 1X4OA 2GLOA 2JRMA 2NS8A 2O5RA 3ABLH 3OSFA 1S7OA 3RTRA 2GZWA 2NOJB 4IHXA 2LY1A 3O8HA 1P4AA 1O7FA 1KU2A 1T95A 3FZVA 2XKOA 5E3OA 1GV5A 3EQLF 1OCCH 3EUAA 4ENJA 5E20A 2X1DA 2W25A 2L4AA 3GTQJ 1S3JA 2L9NA 4EJVA 3HPGA 5H2FC 4MTDA 4J19A 1MMNA 1OISA 2PX9A 3CESA 3ZMTA 5IP6A 1ITYA 2DFIA 2E36A 2N8GA 2CG4A 3H9GA 1U8RA 1Z7LA 3SXYA 1IJWC 5TISC 1G3WA 4R79A 1Q1HA 2E34A 4JX6A 2XROA 2IP2A 3CF2A 4CUGA 1Y8QB 3Q3SA 4N9HA 4CYDA 3CDIA 5CVUA 3HHGA 1R4NB 1SFXA 4CICA 5CKTA 1OKRA 3VPRA 2TCTA 1ZHFA 1U5TA 4Z2YA 1M1EB 3LL7A 2ISZA 2ZFUA 2O9LA 4V2FA 1WJFA 3ZN1A 2P7CB 1W7PA 3LNQA 3CD6I 3UKGA 3FXQA 2DFFA 2H1LA 4IJAA 1IRXA 2JJ7A 3JR9A 2HOTA 2A05A 2MABA 1XGOA 4EEFG 2QSHX 4LIUA 3J7ZI 3M07A 2Z99A 2CJJA 2DDAA 3LSMA 4GYGA 1QA6A 4B4CA 1W1WE 4CA0A 1DPUA 3PNTA 1T8IA 2X1CA 2MGQA 5CVRA 5C4JJ 2LVSA 2A6HF 5A2QZ 1A31A 2VXZA 1ZN2A 2W00A 5DCFA 3K4NA 5L3CA 4HG2A 1U9OA 3P9IA 1TWGJ 2HZTA 4BEHA 1VQ4I 3GFLA 3I54A 4P9UA 1R7JA 2GM4A 2XPVA 5C44J 2HGCA 1VTNC 3I58A 1AHDP 2VC0A 2DMQA 4DW6A 4EGZA 2NOGA 2OTJI 2KZGA 1I6HJ 3AKZA 4XLAA 4BE2A 1ZELA 2PMZN 3KZYA 2P5LC 2F2EA 2HOAA 4KA4A 3TL4X 3MQ0A 3NEUA 3H3ZA 3OYIA 4ZTJA 3GYHX 1X1CA 4G6DA 1HW5A 3OYBA 2B9SA 2QGUA 4JP0A 4P96A 2PI0A 2HTJA 2HWVA 3IH4A 3WTXC 4G7HF 4IHYA 3A0BC 3SZTA 1IN7A 2AQFA 3K4KA 5E1XA 1ENHA 3ELKA 4RGRA 4B47A 5IP9J 2R7RA 3AL0C 3CO6C 3CCRI 2DJIA 3RKWA 1DP7P 2RREA 5CYVA 1ZGWA 3OWTA 1LE8B 1YRNB 3ZQGA 1VF9A 3KP7A 4LGWA 2BY3A 1EF4A 1B1BA 5GAEJ 3RJPA 4ZDPA 3OL3A 4E7SA 3FBIB 5B3SH 1VQMI 4HNVA 2EV0A 4ZTFA 3K2AA 4B3XA 4RAFA 4MGRA 2UZKA 4WCGA 2B63J 1LNWA 3MKZA 3DLAA 1F1ZA 2JQ7A 3CC4I 1S9HA 5M3MJ 2KMUA 1J75A 1PYVA 4GRIA 1QRYA 3BCAA 3T8RA 4EQQA 3VB2A 5IYBJ 2XSDC 3H9JA 1BI3A 3W6JB 1JXSA 2K3FA 4I99C 5B1AH 5DM6F 4P55A 1JGGA 4OWRB 4GFBA 3OY9A 2XPWA 3I3LA 3FBNB 3ASOH 3K4CA 2FE3A 1A04A 2W84A 2AQEA 2KIQA 4IRHA 5KVRA 3DF8A 4IHSA 1TNTA 1VQ9I 3SFIA 3SZPA 3W2VA 3J80Z 1I6XA 1QVTA 2R5ZA 2ADUA 3K1PA 4O5VA 4BAYA 3G4SI 1FOWA 2IGNA 3PFYA 4BHBA 1D5VA 3IKVA 1T0FC 1YO5C 2ZJRF 2VE8A 3S2WA 3K4JA 1PJRA 1K78A 1QPIA 4RMNA 2W85A 3RZDJ 3HOVJ 4WF2A 2ZJPF 4C3JJ 4C30A 1YI2I 3DKWA 2QBYB 3JRBA 2JZYA 3DPTA 2OZUA 1FOYA 2LDUA 3IRRA 3LA7A 4P5OA 2BY0A 2PQ8A 4PJNA 2DA1A 4CZZA 3J81K 4LB5A 3I9V2 2B0LA 4PSXA 3VYTB 4II2A 3WGHA 4A3DJ 4MIMA 2Y2ZA 3QU3A 1HXDA 3S1NJ 1P6RA 1TP4A 1XMAA 2F5CA 1P4WA 5KAFC 4EJOA 3SJMA 4HSTA 1AU7A 2JPCA 2ZNZA 4IOAF 2K9LA 3AG2H 2OTLI 2WAQN 2EFPA 2L7ZA 5DUIA 4BUPA 3Q0VA 4OINF 4EM1A 2X6OA 4I76A 4Y17A 3R6SA 3WG7H 4J00A 5EGOB 1JJ8C 1V54H 5IOZA 1GV2A 2AO9A 2HZDA 4OU0A 3AFHA 3WE2A 4E7KA 2EILH 4I0AA 4ESFA 2OA4A 1W5SA 5D4SA 3DV8A 3WHCA 5KNLA 2VJJA 1JTXA 1G4DA 2OQRA 5BOXA 2M2EA 1TT5B 3LOCA 1XSVA 3I55I 2TRTA 1EH8A 1SMTA 2LK2A 3F6VA 1W5CC 4R1HA 5D6EA 1Z77A 2X48A 1WGXA 2YUSA 3ZMVA 5DD8A 2EZKA 5IOYA 2IRFG 1SD7A 1WJEA 4D5CA 1G6NA 2JUCA 3V8KA 3LSJA 4H0EA 2ID3A 1EV7A 1L0OC 1Z1DA 1XS9A 2BY2A 1RESA 3G3ZA 5F64A 1BM9A 1MGTA 2ZXWH 1GT0C 2LREA 4HSRA 4BXFA 3ZQ7A 4BNCA 3G6EI 1YS6A 3I0TA 4LITA 4IKFA 4BHCA 5IYCJ 2V1NA 4F7ZA 2CV1A 2EA4A 4II3A 3BWGA 3JRIA 2KT0A 1FZPB 3LWFA 2O03A 1W7PB 1OLTA 2OBPA 5EZHA 3C18A 3M9AA 1ZAOA 1K83J 3CCLI 3BT9A 2NVUB 1AKHA 3VWBA 3TP3A 1SAUA 2EIMH 3K10A 3ZMDA 1D0YA 2DMPA 2P4WA 1PUFB 4NNJA 5KK1A 4AD9A 1RETA 2M9HA 4FE4A 3A1YA 3PQKA 2ZCWA 4OOIA 4A3EJ 3GLLA 2DOAA 1X58A 5LLQA 3QOEA 2DXIA 3KYDB 2XAJA 3ZN0A 5DUKA 2WAEA 3M8EA 3H35A 1FOKA 2XGDA 1YTYA 4LLLA 2VE9A 3LAPA 1Z7UA 4C2TA 3SQNA 4CCLA 2DYSH 2DA6A 3NWSA 2A3SA 3DU5A 3HKZN 3GMEA 2DT7B 2LC2A 1MMGA 5FROA 5FD5A 1IW7F 4BQNA 3S1QJ 1GHCA 2IGMA 2VUMJ 3R61A 1IRGA 4DYRA 4XQFA 2PMHA 1UCRA 1XGSA 2HPMA 5DM7F 5CJ9A 1RI7A 2BGCA 1K4TA 2VXDA 3V7SA 1D3YA 1ODDA 2H09A 1BOBA 1FTZA 4NC7A 5J1RA 2PG4A 1ETYA 1TQMA 2P0WA 4NC6A 1BIAA 3HKZA 1S7AA 2L54A 3REOA 5IPAA 1S7EA 3D1NI 5HODA 1POGA 4HRIA 1LE8A 1YRNA 5FLXZ 3EPZA 2HVSA 4M6YA 1MDMB 1GXQA 2FBKA 1TBXA 3P9CA 4EJWA 5M5WJ 3OS0A 1YS7A 1F5TA 2NVYJ 2XGCA 2R93J 2XV4S 1QPMA 3UNGC 2COBA 4I98B 3G73A 4I09A 1KU3A 2M0MA 3GTGJ 1MBJA 2XKPA 2M87A 1T98A 4D9JA 2WWYA 2HI3A 3RCOA 3CCYA 4L5EA 3S2DJ 2GIVA 2ME0A 1T2KA 1H0MA 4M74A 1TZLA 4AIDA 5JLXA 3GVAA 4EM0B 4ESBA 1QZEA 1K4SA 1WWXA 4IO9F 5DCMB 2W82A 4NBQA 4F3QA 1T38A 1X2MA 3C2HA 3GZ5A 4QSHA 2DO7A 2V7FA 2UXXA 2E35A 3DP7A 4E6KG 1HDPA 2W48A 2CFOA 1USTA 3BPVA 2VJIA 2IGKA 3FXMA 2IXSA 3PJRA 5C3EJ 4IPAA 4LB6B 2YSRA 4BKXA 4F55A 1R00A 4OMYA 2MLGA 1U3EM 3GTMJ 1K78B 1OR7A 2CS3A 3F8FA 5ICGA 1HLVA 2VASA 2DYRH 4U0VA 1SVOA 4KITB 2MA3A 4PUSA 2WTEA 1HSJA 2OU2A 1UZCA 1WFXA 1ETVA 1XN7A 1JKQC 3K70C 3DFGA 1IG7A 1YW9A 2PEXA 2DA2A 1S8NA 1R4MB 4CCMA 1Y1WJ 2DI3A 1VQLI 1W5TA 2ID6A 3A02A 4B44A 2D1VA 1IUFA 4F92B 1DP3A 3HSRA 1EA3A 2H8WA 2AXTC 5K7ZA 3HRTA 4A12A 2LD5A 2L0KA 4PDKA 1W36D 1ZARA 4H4KC 3M1EA 4M3FA 4U7DA 2Z1DA 2DK8A 5FLVA 3CCJI 1ZG1A 3RPQA 3KETA 1P9QC 4BQAA 2VKDA 2QYOA 5FLMJ 1V5FA 2EIKH 5CPRB 1FMVA 2V6CA 4HAMA 1H88C 3IAS2 3CTAA 1Y0NA 3V8LA 3F0CA 3IHUA 2VONA 3FHZA 3W3CA 1GLNA 1B72B 2I5UA 2ZO4A 5IYDJ 4HX8A 4DBQA 4A6EA 4PJMA 2GBYA 2F4IA 1N25A 4D7NA 4BBSJ 2VJ4A 4UXNA 5CQEA 2OCCH 2DTRA 3B73A 1U9NA 1Z6TA 3GZ6A 3QYEA 3ZGKA 1U0JA 4P9FA 1REPC 4HF1A 1WHUA 3H3VK 4OIPF 1YIOA 4I7HA 4BXXJ 4XSXF 3BTLA 4EATA 1HC8A 2F5DA 4Y3OA 2O61A 3ZCOA 1YOVB 2NS0A 4RM3A 3CUQC 3OL4A 2OF7A 2DQLA 2FOWA 3E5XA 3ZQQA 3G2BA 4EGYA 2JA5J 2KRHA 3GFJA 1TW2A 3OV8A 3RI4A 2A5YB 2O3FA 4DJAA 5D5XB 3DEUA 4ZDLA 3FKIJ 4MTEA 2AXLA 4BBRJ 3OYAA 4HX7A 4XLFA 4BQQA 1PUEE 4HDVA 4UVAA 2R7TA 2XC7A 2X1EA 5IT3A 3PL8A 5D5UB 2K02A 2F6CA 2ACJA 2XAHA 1ZH5A 2LF7A 5E8IA 3JRGA 4L0ZB 2HVQA 2KDZA 4HNTA 3JRFA 3G71I 1FOXA 1B8IA 2OJED 2O0YA 4NUBA 5FKNA 1B4AA 1O3QA 5LHHA 5CVVA 4AIKA 4QPQA 1VQPI 1MBEA 1WI3A 2QZ8A 2XRNA 4UHTA 3TOBA 5FB2A 4U0YA 3TOAA 2VC1A 2HU9A 2RVCA 1Y6IA 3H36A 4MEYF 5JR3A 4FHTA 2F5EA 3R60A 4Q5SF 5GADJ 3LAJA 1KYZA 3MEXA 1XB4A 4D1QA 5J8CA 1WJAA 4PGGA 4BYYA 1P7JA 1PVEA 2E5NA 5D4RA 5FKMA 1B72A 2DMTA 1T56A 3HOWJ 2DTZA 2FQ4A 1D0XA 1QZYA 3Q9SA 2RQQA 3IH2A 1IV8A 1JE8A 4HBLA 1MIJA 4N9IA 4A3GJ 2XUBA 2E5ZA 3SEQA 3BQYA 5JVGF 2OQGA 4GDFA 3KFWX 2XF5A 2L9VA 2CSOA 1X3ZB 3M7GA 3JSOA 4KDPA 2HDWA 4NHJA 1Z9CA 4F52A 1I5ZA 2XAGA 1HKQA 1LQ1A 4IQ4A 4KIFA 2X9DA 5J40A 2IPQX 1G3TA 4YIFA 2EQRA 2Z3YA 4A3CJ 4XICA 1JKOC 3N97A 3FXOA 3LSRA 2LKXA 4XLHA 2JT1A 1GVDA 3OSGA 2XB5A 3C1DA 2FD5A 3VDXA 2WADA 1I39A 1Z6RA 5GTIC 3WTYC 3ZMUA 3K4MA 2CQQA 1IXSB 2HXOA 5HLHA 1BI1A 2JA2A 3CUOA 3E1SA 1U2WA 2ELHA 1W36C 3Q0WA 3KX2A 3HG9A 5E3MA 3DLLF 1LJ9A 4G94A 1YHQI 1ZRDA 3O2PE 2K7LA 1WH5A 2DCEA 2MFZA 2MC4A 5KHDA 1KGSA 1EKEA 2LMDA 3BR2A 3CP2A 4A6DA 4KMFA 3JTGA 2DMNA 1ZRCA 1ZG3A 1T0FA 1P4XA 2KL4A 1FC3A 2RAEA 3DBRB 2FXAA 2ZXJA 3OYHA 4B43A 1RR7A 3GUDA 2R7UA 1X1BA 2E1OA 3K70D 4XN0A 5EEGA 2YPRA 3ZQHA 2DT6A 2CQXA 2QKLB 3M8JA 1R1TA 1WVRA 3IH3A 1D1CA 3BLYA 1WSUA 2HNHA 2XSJC 5HS7A 3OYGA 4XIDA 1ETWA 2DJNA 3J7YJ 1GVJA 4IF4A 1MBGA 4RB1A 1TWAJ 2VKVA 3QPHA 4M3GA 5JVTA 2K9SA 1BW5A 4EV0A 3BCBA 3JW4A 3HEFA 3RKQA 2KZVA 2NVTJ 2DQRA 3CZ6A 1RIOH 4OAYA 3TMOA 4DIQA 1Z67A 3K7AJ 4HF2A 5EYRA 3BZKA 1JUMA 2X6YA 1VQOI 1ZQ3P 3GX4X 1VZ0A 4A5MA 4CO8A 4KT6A 4CSWA 1XD7A 3ABKH 3E6DA 2EZHA 3O8GA 4RB3C 2P7VB 1O57A 1YE9A 3QPSA 5ICFA 3SHFA 4CZCA 2EIJH 4S05A 1K79A 5E1WA 1VQNI 2LFBA 1I27A 2FNAA 4DBRA 1PP8F 1FP1D 1RUOA 5LFAA 1R22A 4MLOA 1BI2A 4BJ6C 5M5YJ 2GAUA 3KLNA 4UY8I 5FFZA 3GCMA 3AG4H 4BJTA 2DDBA 2JA8J 1GXPA 4U0WA 1ZTRA 4XL9A 4YEJA 4XM3A 5F0CA 3IRQA 3LSKA 4W97A 1BR1A 2Z2SB 3PM1A 1R49A 1WZ2A 4DNCA 2A6EF 2MLKA 3ASNH 1FBUA 4NQWB 2Q8KA 4I01A 3TO7A 1Z91A 5JFRA 3WTSC 1OMIA 5GAGJ 2VJ5A 3A4CA 1KU9A 3ZR8X 1U78A 4A0ZA 2R7WA 4L0YB 4GXOA 1X1DA 4EJTA 4A93J 1IDYA 2PFBA 4XNFA 3EYIA 3FMQA 1BR4A 1NG6A 1X19A 3HL2A 4MFEA 5IT9Z 2CUEA 2JVHA 1QO0D 5BPDA 2Z33A 5L3BA 4FTHA 3I53A 2LY9A 2HDCA 4C3IJ 3HZJA 4ENNA 1JGSA 1SVLA 4C3HJ 3ZPLA 1TQPA 3H92A 3FMRA 4RGXA 4IHTA 4E7ZA 5LBQA 2STWA 3P7NA 1WJBA 1B9NA 1ORKA 2QQ8A 2W24A 1SC7A 2O8XA 1I3QJ 1X3WB 2F5FA 4EJUA 4HQMA 2Y69H 4MFDA 3ROUA 2M8EA 2C6YA 5AIPA 4KNYA 4E7LA 3TGNA 2J5OA 1V5GA 3DXJF 2RNJA 3GLXA 2HPIA 1MZBA 2HR3A 4XKCA 3SDBA 4A0YA 4AUXA 3CMEI 4KUMA 1B6AA 2L9RA 4YRVA 3LSGA 2X6WA 3JREA 3CJNA 1EJ9A 3E5QA 5L3FA 2PLYA 1B8IB 1KQ9A 1JKPC 3WTVC 2L7MP 2DA5A 2HYGD 3F72A 1WI9A 3RPUD 4B8XA 2K9MA 3E6CC 2X85A 3CCQI 3HUGA 3DKXA 3QP6A 2LBFA 3RZOJ 2R5YB 4HQEA 1KA8A 1DPRA 4PJJA 2R4GA 2M5WA 2CQ7A 2CV0A 2F48A 2VPLA 1J9IA 4BDYA 3IL2A 2DMUA 1BJAA 2DOFA 4CGZA 1TWHJ 1UG2A 3F9KA 1H9GA 2HYFA 4WXCA 5DEQA 1NK3P 4RDUA 2PJRA 3TP0A 3HDDA 2K9NA 3S1MJ 3H1CA 1H9TA 3PFIA 3VYUB 4XORA 4X6AJ 1N77A 4Y13A 3N05A 1EH6A 1LEAA 2ELJA 5KAIC 3FX3A 4XONA 4D5FA 4AIJA 3ABMH 3QOPA 4WXDA 5EJCA 5E3LA 2KFDA 1TWCJ 2KRCA 1HOMA 1TTYA 1JUPA 2LKPA 2V79A 2PMZA 2O6GE 4ZDOA 4XK4A 3K1MA 1OQYA 1UB9A 2DW4A 3A0HC 5HNHA 1ZG5A 3K4BA 2YX4A 3V42A 1IN4A 3WODF 5HDNA 1DUXC 2Z5UA 5EG0B 3Q0UA 2IBDA 2CW7A 3I4PA 1T33A 2Y0SA 4YFKF 1YFHA 2RDPA 2M7AA 3BG9A 2LG4A 1OCZH 1OR7C 1LDDA 1FEXA 1V4RA 2CMPA 4HV6A 2EFWA 2HDDA 1ETQA 5C4XJ 3IAM2 4JK1X 2R5ZB 1LDKB 5LRSA 3GFIA 1OJLA 2PMUA 2MYSA 4CDGA 2ZXIA 1YJNI 5JI6A 3CLQA 3HOYJ 3TDUC 3KE2A 3PNYA 1XCBA 2YU3A 1V5EA 3L2CA 1GUUA 1MMAA 3QYFA 4S04A 4LK1F 2Y0SN 5ED4A 4B09A 1BI0A 3WTTC 4Y7NJ 3K4LA 3U1DA 1U5TC 3CCMI 2UUZA 1UHMA 3WU0A 5GP9A 5ILVA 2D5VA 4KMUX 3S8PA 3OIPA 1I1SA 5IP7J 2VI6A 4ESJA 3L00A 1DQUA 3M4OJ 2JWTA 4AM3A 2BYVE 3WG9A 4FT8A 2DPDA 3RSNA 4PFPA 3V4GA 5F1JA 1PUFA 4JOMA 4TV7A 2IAIA 5ERIA 5FKOA 1MSEC 2VBYA 1AKHB 3FXUA 4LFUA 4XMYA 4WK8F 2DFEA 1K61A 3D5LA 4XRFA 4B1RA 2DK5A 2EZIA 1EH7A 4U87A 3OYCA 3OYEA 1B59A 2QQ9A 1APLC 4M9ZA 2CV2A 2XDVA 4A69C 1XX5A 1XPXA 3HM5A 1IZ1A 1FTTA 3EETA 2ZBKA 5D8LB 1FX7A 3MMYB 3ZQCA 1YYVA 4IX7A 3MVPA 2MC3A 3LFUA 2A61A 3ZQIA 2JPBA 2XPUA 5DTDA 2CW0F 2HKXA 2K4BA 2HOSA 1YJ9I 1LFPA 4B48A 4UV9A 5E17F 2XRLA 2FQ3A 3FWEA 2DA4A 2OPTA 2ZJQF 2LY2A 1SANA 3ISPA 3IV5A 2LYCA 3QWLA 1A36A 3V8JA 4RGSA 1QQIA 2EH3A 4XKBA 1ZLKA 4KN7X 4RAZA 4XRSG 3S16J 2BOLA 2BHYA 1OFCX 2M34A 2GXGA 3A01B 4IVNA 2L5QA 4ZZLA 2JA7J 3FIWA 2E7XA 3NWTA 2FRHA 5IY5H 1HSTA 1Y8RB 1BOAA 4C9YA 3FM3A 1FSHA 4LK0F 1CQTA 1UFMA 2BVLA 3KLOA 1XMKA 2RNGA 3TO6A 1E2XA 4V19K 3PQJA 3T5XA 2G0EA 3A2KA 3ZOBA 1HKSA 1XSXA 1IRZA 2CU7A 4E70A 5L3EA 1FYLA 1O3RA 3R0JA 4QTRA 2ESHA 4G7ZF 4ZJZA 3WTUC 4GO1A 1HCRA 1IO2A 4RB0A 3KZIC 3OYLA 1E0EA 5JLWA 1FYMA 2ZMEA 2P6SA 2OAZA 3MKWB 1ZGJA 2P5VA 2RGVA 5FRMA 2FOKA 4BACA 3T1BA 2L7FP 2E1MB 2VQGA 1ETXA 2L01A 3FKJA 2VOPA 2RQPA 2I10A 5K5OA 4M9SA 4A2UA 4FX0A 2QVOA 3S32A 4KYWA 1A6IA 1Y0UA 3KEOA 1QZZA 2W57A 5HNFA 2FMYA 2V1DA 2WV0A 1NG7A 2JA6J 1XGNA 2DAOA 4WX9A 3FHNA 5EZGA 4D0PA 3IWZA 3FXLA 4XR6A 4UUVA 1Z05A 4GGGA 1HW2A 1IN5A 3OS1A 1RKWA 4KICA 1D0ZA 4MNUA 2ZKZA 2BY1A 2CQNA 1MKMA 2VL8A 2Y0MA 2HQ5A 1BC8C 3BY6A 2R92J 3VSLA 3FDYA 4FX4A 1QNTA 1QHHD 2L2OA 1KQ0A 3G1MA 4A3LJ 3SYTA 3GTKJ 2XB0X 4A3MJ 4AVPA 1FLIA 4XOTA 1G8XA 5BS6A 1FJLA 2CUJA 3DQVC 3E6BA 2ME6A 5FLXK 3PUFA 5D6FA 1STZA 2YX7A 4ABZA 1BIBA 2D2WA 5M3FJ 3H5NA 1NK2P 4IHWA 1AOYA 1XTAA 4HYEA 2BHZA 3PSFA 2M4KA 3CLOA 2P6TA 4RGUA 1LVKA 4KIBA 5F0FA 4IXAA 2HEOA 2HQAA 3HJEA 3WTZA 4C2MJ 1UMQA 5FO5A 1YW7A 5CVJA 2CH0A 2X51A 3VYSB 1WH7A 3ZRGA 3L1PA 2BBYA 3HGYA 2LOOA 2ZXHA 5K1YA 1G2HA 3MCZA 1HW1A 2M30A 1LDJA 1FPQA 2COMA 3LA3A 3AG1H 3DKYA 2E2JJ 4CHUA 3HOUJ 2FNPA 3KIOA 4AC0A 4L18B 3FK7A 3DWLE 2GOXB 4N0BA 1MJ9A 1I50J 4M71A 1ZK8A 3DEEA 2WB1N 2OZ6A 2IT0A 4BHPA 2EB7A 2FF4A 1OPCA 1JUSA 3I56I 4CH7A 1LFBA 1HDDC 5LGTA 1R71A 3GTLJ 4FE7A 2IA0A 2KKOA 3HYIA 4XKWA 3B6AA 3F21A 4MO7A 5GAHJ 1WPKA 1WJ5A 2GQQA 4QWQA 2EK5A 2XAFA 3EDPA 4RAGA 2CYYA 4BXUA 6PAXA 4LG0A 3CCVI 1TQIA 2IA2A 2O7OA 2A07F 3VFZA 1OYWA 2Q1ZB 2FJ1A 3S2HJ 2KLOA 2WB1A 3B02A 3DBHB 2AHQA 1SFOJ 4PK4A 2LP0A 2STTA 1K6OA 2ICWG 4XSZF 3WU1B 3F3XA 3MZ8A 1A5JA 4U88A 1G59A 2H27A 2HOEA 2IA1A 4BEHB 4IRIA 3HOZJ 2D45A 3PO3J 3ZQFA 1XCVA 2GXAA 4J01A 4CXFA 1ZKGA 1F36A 4RAYA 1MH3A 2Q2EB 1FYKA 2IS2A 3E6MA 5B1BH 2L9SA 2LBFB 3TO9A 3S3OA 5DYMA 1QU3A 2JK3A 4OIOF 3CDLA 1R6RA 3TBIA 3KP3A 2IJLA 3GO5A 4XBFA 1J0RA 2QQBA 3RIRA 2LLKA 4ZYHA 1J5YA 1JKRC 1Z3YA 3WGIA 2ZSHB 1MMSA 5FGMA 2VBWA 4ENMA 2XAQA 2DN0A 2TDXA 3AG3H 3S14J 3LA2A 2OUMA 1TWFJ 5J6XA 2LRDA 3NAUA 4WWCA 3HXLA 5CLSA 3PIOF 3KP4A 1FWZA 2PN6A 2QQAA 3CMYA 3W2WA 4F91B 3J7AY 2H6CA 3BROA 4PCQA 4E7HA 5LGUA 3P9KA 2Y9YA 3WU2C 4HLYA 3EUHC 1X2NA 1ON2A 3HOSA 2L4MA 3G1LA 5HOOA 1ULYA 2K27A 2ZC2A 2GA2A 2X0LA 1FBSA 2BV6A 2LR8A 4BU2A 2M4GA 4M3DA 2O8KA 1ONVA 3F8CA 2L7KA 5E79C 4I6ZA 2FEZA 5D5VB 1MNMC 2E19A 3KEYA 4ITVA 3BDDA 3PUBA 2ZJ2A 2F5VA 4NQWA 3U9GA 2VBXA 5H6QA 5BMZA 2V1XA 3KP5A 2P5KA 2DFHA 2R0QC 2KIFA 1HBXG 3I59B 4IRGA 2ECBA 1CGPA 1QBJA 1UG0A 2M8GX 3SZGA 2E7WA 3NQOA 3WHBA 3C2GA 4A0XA 3BR6A 5FFXA 1ZR4A 4ON0A 3HSEA 2BVMA 1HQCA 4PGHA 1TL8A 1XC5A 1JJ6C 1HF0A 2F4OB 1JI8A 5DDGA 3COAC 3V7CA 1T08B 3OOUA 4M9XA 2GA1A 2OCEA 3MFKA 5K7HA 2QA4I 3PSIA 5BNGA 2DA3A 1SMYF 1SFKA 4O3MA 3GXOA 1MBKA 3LSIA 3F8MA 2KQRA 3BTJA 1YQAA 1VQ5I 2FBHA 2G9WA 2PJRB 1D1BA 4BDZA 1X1AA 1XG1A 5F0HA 2UWMA 1BC7C 4L9JA 4EMSA 2Z16A 1DDNA 1J2XA 4NB5A 1UHWA 2Q2EA 2MG4A 1IXRC 2HQRA 3BC8A 3OYJA 1BR2A 1YW8A 5HS8A 3CDHA 2HQNA 3RKYA 3OS2A 2ZNYA 3VSKA 2ECCA 3MKLA 3GTJJ 1ETOA 2DBBA 2BEOA 2WV1A 1K7AA 1Z0XA 3FM5A 2V1UA 3QYBA 4CCOA 4R8HA 1S29A 3ML6A 1IC8A 1SFEA 1SD6A 4DYQA 2R7ZJ 5E3NA 3HGGA 4G6TB 3IC7A 1ZREA 2GIZA 3BJOA 3ZMSA 3GF2A 1UJ8A 1PP7U 1NTCA 1QGPA 2KP6A 1O3SA 5BPIA 2BXYA 2CW8A 2IEKA 3K6GA 2QUFA 4KJZA 4L9NA 4L9VA 4DQ2A 2R7SA 4XLPF 4I0BA 2EV5A 3K2ZA 1V55H 2KIMA 2F4MB 2Y48A 1U5TB 2V6EA 2FSWA 3E5UA 4BGDA 2VPRA 4ZYDA 2FA5A 3DCFA 1BN5A 1E17A 5FKKA 3D5RC 3HHHA 4K2EA 5ILUA 5E1ZB 5J4YA 2NRAC 3CP8A 3ECHA 4XLEA 1ZRFA 4CCJA 3KYCB 4OIQF 5J1YA 2G7HA 1O3TA 1SVMA 3K0LA 4Q47A 5H20A 1MJBA 2E1NA 4M72A 2JUGA 4PJ0C 4KN4X 3UR3C 1NH3A 1VQKI 3PO2J 3BJAA 4GCVA 3TDZC 3E0JB 2QCOA 1WKMA 4A3IJ 1Y56A 3H9QA 2XAUA 1VFCA 5L3GA 4Q4ZF 1MMDA 2VIXA 4IZZA 1J09A 4IHVA 4LJZF 3VOEA 1VI0A 5LEJA 4ZYAA 3FXKA 2P81A 1ZYRF 2EINH 2L02A 4EVIA 1XDSA 5FRNA 1BJZA 3RKXA 5HDKA 3L2QA 3KCCA 1D8JA 5F27A 1TW3A 3DPUA 3JAMK 2YU9J 2BXZA 1DU6A 1G3SA 1N78A 4PFOA 4DZJA 4M73A 1IV6A 1JHHA 4XN3A 4ZH4F 3JRAA 3GZNB 2VB6A 4C2UA 2CUZA 1J59A 2YR2A 2CQKA 3BTCA 4KISA 3TW6A 5E18F 1HKTA 2X4HA 4UB8C 1U6GA 2KIUA 2JVGA 5LRRA 1RZ4A 5J1UA 2IS6A 2H8RA 2GWRA 9ANTA 2FX0A 1ON1A 3VYRB 1MD0A 1MNDA 3PIPF 3TEDA 4A3JJ 4W1UA 3CJRB 2WAQA 3S17J 3BR5A 1TT0A 3FMSA 2XHKA 1SD4A 2MD5A 1V3FA 2VKEA 3ECOA 4G12A 4ZC3A 3H0DA 2LTPA 4NC8A 5JHUA 3MWMA 3BPXA 4AIHA 2R7VA 2HYJA 1JHFA 1KYWA 2JRTA 1LPQA 3J81Z 2CFXA 1X3UA 2ZMEB 1JT0A 2A5WA 4XKVA 2Q0OA 4FQGA 1KQ8A 5DD4A 4N4NB 3JRHA 1I3AA 5GTHC 1IUYA 1RUNA 2AS5F 4ASNA 3G1OA 2RN7A 3B6CA 3I71A 1IN8A 3KYLA 2NS7A 3CUQB 2QWWA 5TGTA 1C0WA 1Q1VA 2L3DA 2NNNA 2LKSA 3RYPA 2GXBA 1ZR2A 1JT6A 4A3BJ 1YX3A 4YG2F 1MNEA 5F08A 3T8TA 1RKTA 3QAHA 2MSYA 2ZMEC 3BR0A 3OIOA 3DU6A 4NDLA 3HRMA 3A01A 4BJ5C 3H3UA 4CCKA 2QEXI 1OCPA 3LSHA 4MHGA 2R5YA 2MH9A 2E2HJ 2ZB9A 4RB2C 2FU4A 5K5RA 2VLAA 3I59A 1A6QA 4L5JA 5EDNA 4L9TA 3LMMA 1P7IA 2KRFA 2H6BA 2IW5A 3PNVA 2VN2A 1R5GA 3TQNA 5F6FA 3TW7A 2BW3A 3JSPA 2R7DA 3F22A 5LEKA 3P5JA 3I5UA 1OYYA 5B5EC 3I4MJ 4RA2A 3J7AO 5FKLA 5AIQA 1YLFA 3DPLC 4BH9A 4ENKA 3ERED 5HLIA 2P8TA 1KZHA 3BOQA 3EUHA 2EA2A 4PJLA 1BL0A 2KJBA 5DV5A 2W1OA 1H89C 3N4MA 1WJDA 5D8KB 4UVCA 4PZJA 2XIGA 3OYFA 3SFZA 3FF5A 3GEZA 2IS4A 4Y15A 1SFUA 2EBIA 4YIIA 4MEXF 1TC3C 2FBIA 2VBZA 4HW0A 4CCNA 4DOZA 4Z6YA 4CYCA 1N75A 5EEHA 2LF8A 1R1VA 4HA8A 3KZZA 1Y1VJ 3IUOA 4HDUA 2VT3A 2Y9ZA 2OC6A 4XOPA 3BG7A 3FXJA 2EPFA 2QLZA 3MZHA 5ILSA 3O3KA 1GDTA 1FSEA 2W7NA 1BA5A 2YS9A 3GFMA 1B9MA 3DBLB 2VT2A 5CQGA 2JMWA 4G6QA 4I2OA 3TKYA 5LGNA 3F23A 4UV8A 3LSTA 2LH9A 2XGEA 3QP5A 3R4KA 3D0SA 4RS8A 1OCRH 2ESNA 5FD6A 3HB9A 4IEJA 2IS1A 2NYXA 2KDOA 3S93A 4D7MA 1ERDA 3ZXSA 4M6XA 2QF7A 4FASD 5M5XJ 1DGRM 1WCMJ 3RDIA 1LB2A 3ERMA 2M7BA 2XVCA 1YITI 2EWNA 2HTSA 1R23A 4FISA 2HKOA 3GTPJ 4X1EA 1P2FA 3KEQA 1BW6A 4N4OB 3BZ6A 1RPWA 4BL0B 3M1CA 1FP2A 3O6BB 1R9TJ 5KCMA 3FK6A 2E60A 3BG3A 2RC4A 4JX5A 4UUSA 2VKHA 3DTEA 3IP4B 3OOPA 1RC9A 4LD5A 2CWEA 1XDUA 2XGXA 1W0UA 3KPHA 1FY7A 4M3EA 1MDMA 2BZTA 4XRSA 1FIAA 2DLLA 3QU6A 1S6LA 2GOMA 3MD2A 2V26A 3GW2A 1VQ7I 4LLNA 3HUGB 5HLGA 3KP6A 4UB6C 4RM2A 2K3PA 4E7JA 1TLHB 3RYRA 1UAAA 3X2QH 2R7FA 1RRJA 3HBLA 2R7XA 2A69F 3BG6A 3DTIA 3OYNA 3CC2I 5JHFA 4U7BA 2ELKA 5ICEA 1ETKA 2ZFWA 2XF7A 4B3AA 2NAZA 4BS9A 4X0GA 4G9YA 5J4VA 3WGGA 2BE5F 4E7IA 2K85A 3BJ6A 3V7RA 2QM3A 2DODA 3F6OA 2UV1A 4P1WA 2FMLA 1O4XA 1WJCA 1AWCA 4ZZDA 1FIPA 3CCUI 2CO5A 3QQAA 5EEAA 1IAWA 4G7OF 1IRFA 1E3PA 3MAJA 2NVXJ 1SD5A 5L3DA 2NNYA 4WXHA 2XF6A 2JTVA 2M3AA 4AU7A 4A3FJ 2HFHA 2UXNA 1G3YA 3ULQB 1SEUA 3CCSI 3ABTA 1F4KA 2E2IJ 2R7OA 3LSPA 3HRUA 2R3SA 1R36A 2RKHA 3K1NA 3S1RJ 3CMMA 5BQTA 1VNDA 2DOEA 3KP2A 4A3KJ 2PJPA 5AONA 3FISA 4BQOA 4FCYA 1R1UA 3RQIA 2V4JC 5TJJA 3MKYB 1YG2A 4Y4RA 4JBAA 3EYYA 4HZFA 2BW3B 4LLGF 2ISYA 1VQ8I 3U1KA 4I02A 2NXNB 4ETSA 5IT9K 3U21A 2IVMA 3HTSB 1P92A 1TNSA 2WY8Q 3M3YJ 5F04A 3E7LA 3E97A 3ABUA 2J5PA 5HVQC 1A35A 1LKXA 3CO7C 2LSOA 2Z9OA 2WC2A 3H5AA 2H94A 1Z3XA 3LFKA 2V9VA 2V9PA 4OIRF 4YFXF 5DCMA 4Q48A 3WE3A 4ANJA 5DS9A 1I1GA 1PDNC 4HX4A 3I4NJ 2IGOA 3F8NA 4BY7J 5EG0A 3ZQLA 1MBHA 1MW7A 1H8AC 2E71A 2K5CA 4LG3A 1IN6A 3R0AA 1ZLJA 4UNOA 2K4JA 2E1MC 4AWXB 3IKTA 1IF1A 4PSWA 3HOTA 4V2GA 1D8KA 3A03A 1R5HA 2EJRA 1MJAA 2QENA 3CJQB 3CCEI 4LOCA 3ESWB 1SAXA 2QKMB 1QVUA 3JAMZ 1T39A 5LD2C 3SDGA 3S3NA 1W4MA 1X1PA 1K6YA 4EM2A 1KU7A 4RBOA 4KT5C 2LNBA 4UUTA 2Y31A 3GBGA 3M8FA 1FBQA 4UUSB 1OYIA 1CF7B 3QODA 1F43A 2DT5A 5F1RA 3L9FA 3OIQA 2MH2A 4JX4A 2JN6A 3HC7A 3LQRA 1E3HA 4ZYEA 2MBFA 3OYMA 2EZLA 4XRMA 2JSPA 3JCUC 1YIJI 1VQ6I 1RR8C 1L3LA 5A2QK 1E3OC 3W6KB 4BE0A 3BR3A 5GPAA 2QBYA 1DGWY 1D5YA 4AYBA 4MQVA 4YIRX 2X6XA 1ZGAA 3MZYA 3BZCA 5CVIA 1AA7A 2CRGA 1R58A 3HSFA 2VQCA 3JTHA 3C7JA 2K9QA 5TRDA 5J47A 2M45A 4ZYGA 4LMYA 2M0CA 2EV6A 1ACIA 1Z21A 2OV7A 4YFNF 3J80K 3U2RA 1IGNA 1MBFA 2DU9A 4OAZA 1YX5A 4MQ9F 3HTUA 1UHSA 4M6VA 3DTKA 4CYCB 1FNNA 4A5NA 2A6TA 2NVQJ 2H1KA 1FMWA 1O7LA 2JSCA 3E3VA 1D1AA 2MD0A 2KISA 3CJTB 3OYKA 4HLXA 4KFCA 4DGWB 2R7QA 3QPLA 2VQHA 3SEZA 1W0TA 2PBIA 1S72I 1LFUP 3K69A 2K86A 4M3BA 3FXRA 2ETHA 3F8BA 1RNLA 3CF5F 4L5IA 5K7FA 3DEWA 3W6VA 2RV8A 5ICCA 5H6RA 2V9KA 2FUG2 2HXIA 1WQ2A 1LVAA 2WA0A 1HA8A 2G7UA 1YJWI 1T6SA 4HV5A 4LIVA 3NRVA 4Y52J 3Q5FA 3WTWC 4IOCF 2W4SA 3L2VA 5GPCA 3JRDA 3L7WA 4HNUA 3BTIA 5LHGA 1WRJA 4FETA 4YELA 4QLCU 3BR1A 3ONQA 3CQZJ 1XGMA 3OR1C 3I64A 4F93B 3C2BA 1U8BA 1JTYA 2EFOA 4DZPA 3S3MA 1OCOH 2Y75A 3VEPA 5B66C 3IWFA 1Y39A 4KIGA 2DA7A 4UVBA 5FJ8J 3QRFF 5EF6A 4G8XA 2Y30A 3T0YA 1IDZA 4IQJA 2QSFX 1W7PD 4JYKA 3CMAI 1FT9A 2D1HA 3CUQA 3K9TA 3OYDA 1MSFC 3AL0B 1BBYA 3HIFA 4RLFA 3ZMZA 5J3LA 1DU0A 4RLQA 4AVZA 3C3WA 2KPMA 3L2WA 2E1CA 2I8DA 3S15J 2VQLA 1X4PA 5D5WB 3HRSA 4O6JA 2A68F 3HPHA 2HS5A 5LHIA 2K40A 4HEA2 4HOBA 3GWZA 5EGOA 2QSGX 3LQQA 1XSDA 3RPUA 3JRCA 4XLNF 2WAFA 2MW8A 3H0GJ 3GTOJ 1MH4A 2KHMA 2ZSIB 5HDGA 5HLTA 1R5ID 1IXCA 2KJCA 5J8FA 4E4HA 2VOOA 1J7KA 4GYIA 3L09A 2HVRA 3BG5A 1USSA 3L2RA 3QPTA 3EUKL 5E8GA 4BE1A 3D5SC 2DPUA 3NARA 4Y33A 1S5LC 2OD5A 4QPOA 3H5RA 3OMYA 1CF7A 1LEBA 1UELB 2CUFA 4XLCA 5K5QA 1LUJB 3HOXJ
chains in the Genus database with same CATH topology
2CGPA 2XASA 2M1BA 4LG0B 4HF0A 4JQFA 1F9NA 2VODA 3BP8A 1NHAA 3AAFA 3Q9VA 5HS9A 4OMZA 2EFQA 3ZP5A 3VODA 2EFNA 1S7OA 3RTRA 2GZWA 1P4AA 1O7FA 1KU2A 3FZVA 2XKOA 3EQLF 4ENJA 5E20A 2W25A 2L4AA 1S3JA 4EJVA 4MTDA 3ZMTA 2DFIA 2CG4A 1U8RA 3SXYA 1G3WA 4R79A 1Q1HA 2XROA 2IP2A 4N9HA 4CYDA 5CVUA 3HHGA 1SFXA 4CICA 1OKRA 1ZHFA 1U5TA 4Z2YA 2ISZA 3ZN1A 2P7CB 1W7PA 3FXQA 4IJAA 1XGOA 2Z99A 4GYGA 1DPUA 5CVRA 2A6HF 5A2QZ 2VXZA 1ZN2A 5DCFA 5L3CA 3P9IA 2HZTA 3GFLA 3I54A 4P9UA 1R7JA 2HGCA 1VTNC 3I58A 2VC0A 4EGZA 3KZYA 2P5LC 2F2EA 4KA4A 3MQ0A 3NEUA 3H3ZA 3GYHX 4G6DA 1HW5A 4P96A 2PI0A 2HTJA 2HWVA 3WTXC 4G7HF 3SZTA 1IN7A 5E1XA 3ELKA 4RGRA 3CO6C 3RKWA 1DP7P 5CYVA 3KP7A 4LGWA 1B1BA 3RJPA 2EV0A 4MGRA 2UZKA 4WCGA 1LNWA 1F1ZA 1J75A 3T8RA 4EQQA 3VB2A 1BI3A 3W6JB 1JXSA 4P55A 2FE3A 1A04A 2W84A 4IRHA 5KVRA 3DF8A 4IHSA 1TNTA 3SZPA 3J80Z 1I6XA 2ADUA 3K1PA 4O5VA 4BAYA 1D5VA 4BHBA 3IKVA 1YO5C 2VE8A 3S2WA 1K78A 2W85A 4WF2A 2QBYB 3DKWA 2JZYA 3DPTA 2OZUA 2LDUA 3IRRA 3LA7A 4P5OA 2PQ8A 4CZZA 3J81K 4LB5A 2B0LA 3WGHA 3QU3A 1HXDA 1P6RA 1XMAA 2F5CA 1P4WA 4EJOA 2JPCA 2ZNZA 2EFPA 5DUIA 4OINF 4EM1A 4Y17A 3R6SA 4OU0A 3WE2A 4I0AA 4ESFA 2OA4A 1W5SA 5D4SA 3DV8A 1G4DA 2OQRA 5BOXA 1XSVA 1EH8A 1SMTA 3F6VA 4R1HA 5D6EA 3ZMVA 5DD8A 2IRFG 1SD7A 1G6NA 3V8KA 4H0EA 1EV7A 1L0OC 1Z1DA 3G3ZA 5F64A 1BM9A 1MGTA 3ZQ7A 4BNCA 1YS6A 3I0TA 4BHCA 4F7ZA 2EA4A 3BWGA 1FZPB 3LWFA 2O03A 1W7PB 2OBPA 3C18A 3M9AA 1ZAOA 3ZMDA 2P4WA 5KK1A 4AD9A 3PQKA 2ZCWA 4OOIA 5LLQA 2XAJA 3ZN0A 5DUKA 3M8EA 1FOKA 1YTYA 4LLLA 2VE9A 3LAPA 1Z7UA 3SQNA 2A3SA 5FD5A 1IW7F 1GHCA 3R61A 1IRGA 2PMHA 1UCRA 1XGSA 5CJ9A 1RI7A 2BGCA 3V7SA 1D3YA 1ODDA 2H09A 2PG4A 1TQMA 1BIAA 1S7AA 2L54A 3REOA 5FLXZ 4M6YA 1MDMB 1GXQA 2FBKA 1TBXA 3P9CA 4EJWA 1YS7A 1F5TA 2XV4S 1QPMA 3G73A 4I98B 4I09A 1KU3A 2XKPA 2M87A 1T98A 2WWYA 2GIVA 1T2KA 1H0MA 4M74A 3GVAA 4EM0B 4ESBA 1WWXA 5DCMB 1T38A 3GZ5A 2DO7A 2UXXA 3DP7A 1USTA 3BPVA 4IPAA 4LB6B 2YSRA 4OMYA 1R00A 2MLGA 1U3EM 1K78B 1OR7A 3F8FA 5ICGA 4U0VA 2MA3A 2WTEA 1HSJA 2OU2A 1XN7A 3DFGA 1YW9A 2PEXA 1S8NA 2DI3A 1W5TA 2D1VA 3HSRA 3HRTA 4A12A 4PDKA 1ZARA 3M1EA 4U7DA 2DK8A 1ZG1A 3RPQA 3KETA 4BQAA 2QYOA 2V6CA 4HAMA 3CTAA 3V8LA 3IHUA 2VONA 3FHZA 2ZO4A 4HX8A 4A6EA 4UXNA 2DTRA 3B73A 1Z6TA 3GZ6A 4P9FA 1REPC 4HF1A 4OIPF 1YIOA 4I7HA 4XSXF 2F5DA 2O61A 2NS0A 3CUQC 2DQLA 3E5XA 4EGYA 3GFJA 1TW2A 3OV8A 3RI4A 2A5YB 2O3FA 5D5XB 3DEUA 4MTEA 2AXLA 4HX7A 1PUEE 4HDVA 4UVAA 5IT3A 5D5UB 2K02A 2ACJA 2XAHA 1ZH5A 2LF7A 5E8IA 4L0ZB 2O0YA 1B4AA 1O3QA 5LHHA 5CVVA 4AIKA 2QZ8A 2XRNA 4UHTA 3TOBA 5FB2A 4U0YA 3TOAA 2VC1A 2RVCA 4MEYF 5JR3A 4FHTA 2F5EA 3R60A 4Q5SF 3LAJA 1KYZA 3MEXA 1XB4A 5J8CA 4PGGA 4BYYA 5D4RA 1QZYA 3Q9SA 1JE8A 4HBLA 4N9IA 2XUBA 2OQGA 3KFWX 2CSOA 3JSOA 3M7GA 4KDPA 4NHJA 1Z9CA 1I5ZA 2XAGA 1HKQA 1LQ1A 4KIFA 2IPQX 1G3TA 4YIFA 2Z3YA 3N97A 2JT1A 3C1DA 1Z6RA 3WTYC 3ZMUA 5HLHA 1IXSB 1BI1A 3CUOA 1U2WA 2ELHA 1LJ9A 4G94A 1ZRDA 3O2PE 2K7LA 1KGSA 4KMFA 4A6DA 3JTGA 1ZRCA 1ZG3A 1T0FA 1P4XA 1FC3A 2FXAA 2ZXJA 3GUDA 5EEGA 2YPRA 1R1TA 1WSUA 5HS7A 1GVJA 4IF4A 4RB1A 3QPHA 5JVTA 4EV0A 3JW4A 2DQRA 1RIOH 4HF2A 3GX4X 4A5MA 4CO8A 1XD7A 3E6DA 4RB3C 2P7VB 1O57A 5ICFA 3SHFA 4S05A 1K79A 5E1WA 1I27A 2FNAA 1PP8F 1FP1D 1RUOA 1R22A 1BI2A 2GAUA 3KLNA 5FFZA 1GXPA 4U0WA 3IRQA 4DNCA 2A6EF 2MLKA 3TO7A 1FBUA 2Q8KA 4I01A 1Z91A 5JFRA 3WTSC 1OMIA 1KU9A 1U78A 4A0ZA 4L0YB 4GXOA 4EJTA 2PFBA 3EYIA 3FMQA 5IT9Z 1QO0D 5BPDA 2Z33A 5L3BA 3I53A 2HDCA 4ENNA 1JGSA 3ZPLA 1TQPA 3H92A 3FMRA 4RGXA 4IHTA 5LBQA 2STWA 3P7NA 1B9NA 2W24A 2O8XA 2F5FA 4EJUA 4HQMA 3ROUA 2M8EA 2C6YA 5AIPA 4KNYA 3TGNA 2J5OA 3DXJF 2RNJA 3GLXA 1MZBA 2HR3A 4A0YA 4KUMA 1B6AA 3CJNA 3E5QA 5L3FA 2PLYA 1KQ9A 3WTVC 2HYGD 3F72A 1WI9A 4B8XA 3E6CC 3HUGA 3QP6A 4HQEA 1KA8A 1DPRA 2M5WA 1J9IA 3IL2A 1BJAA 4CGZA 1H9GA 2HYFA 4WXCA 5DEQA 1H9TA 3PFIA 4Y13A 1EH6A 1LEAA 3FX3A 4AIJA 3QOPA 4WXDA 1TTYA 2LKPA 2V79A 2O6GE 3K1MA 1UB9A 2DW4A 1ZG5A 2YX4A 1IN4A 3WODF 5HDNA 1DUXC 2Z5UA 3I4PA 4YFKF 1YFHA 2RDPA 1LDDA 1V4RA 2EFWA 4HV6A 4JK1X 1LDKB 5LRSA 3GFIA 2PMUA 4CDGA 5JI6A 3TDUC 3KE2A 1XCBA 2YU3A 3L2CA 4S04A 4LK1F 5ED4A 4B09A 1BI0A 3WTTC 3U1DA 1U5TC 1UHMA 3WU0A 5ILVA 4KMUX 1I1SA 4ESJA 3L00A 2BYVE 3WG9A 4FT8A 2DPDA 3V4GA 4TV7A 5ERIA 2VBYA 3FXUA 4LFUA 4WK8F 3D5LA 4XRFA 2DK5A 1EH7A 1B59A 2QQ9A 4M9ZA 1IZ1A 3EETA 2ZBKA 5D8LB 1FX7A 1YYVA 2MC3A 2A61A 2JPBA 2CW0F 2HKXA 2K4BA 4UV9A 5E17F 2FQ3A 3FWEA 3ISPA 3V8JA 4RGSA 1QQIA 1ZLKA 4KN7X 4RAZA 2GXGA 4IVNA 4ZZLA 2E7XA 2FRHA 1HSTA 1BOAA 3FM3A 1FSHA 4LK0F 1UFMA 3KLOA 1XMKA 3TO6A 1E2XA 3PQJA 3T5XA 1HKSA 1XSXA 4E70A 5L3EA 1FYLA 1O3RA 3R0JA 2ESHA 4G7ZF 3WTUC 4GO1A 4RB0A 1FYMA 2ZMEA 2P6SA 2OAZA 1ZGJA 2P5VA 2RGVA 2FOKA 3T1BA 2L01A 2VOPA 2RQPA 5K5OA 4M9SA 4A2UA 4FX0A 2QVOA 4KYWA 1Y0UA 3KEOA 1QZZA 2W57A 2FMYA 2V1DA 2WV0A 1XGNA 2DAOA 4WX9A 4D0PA 3IWZA 4UUVA 1Z05A 4GGGA 1HW2A 1IN5A 4KICA 4MNUA 2ZKZA 1MKMA 2Y0MA 1BC8C 3BY6A 4FX4A 1QNTA 1KQ0A 4AVPA 1FLIA 5BS6A 3DQVC 3E6BA 5FLXK 5D6FA 1STZA 2YX7A 1BIBA 2D2WA 1AOYA 4HYEA 3CLOA 2P6TA 4RGUA 2HEOA 4KIBA 4IXAA 3WTZA 5FO5A 1YW7A 5CVJA 2BBYA 5K1YA 3MCZA 1HW1A 2M30A 1LDJA 1FPQA 2COMA 3LA3A 4CHUA 2FNPA 4L18B 4N0BA 1MJ9A 4M71A 2OZ6A 2IT0A 4BHPA 2EB7A 2FF4A 1OPCA 5LGTA 2IA0A 2KKOA 3HYIA 3F21A 2GQQA 4QWQA 2EK5A 2XAFA 3EDPA 4BXUA 2CYYA 6PAXA 4LG0A 1TQIA 2IA2A 2A07F 3VFZA 1OYWA 3B02A 2STTA 1K6OA 4XSZF 3WU1B 3F3XA 4U88A 2H27A 2HOEA 2IA1A 4IRIA 2D45A 1XCVA 4CXFA 4RAYA 1FYKA 3E6MA 3TO9A 5DYMA 4OIOF 3KP3A 2IJLA 3GO5A 4XBFA 1J0RA 2QQBA 3RIRA 4ZYHA 1J5YA 3WGIA 5FGMA 2VBWA 4ENMA 2XAQA 2TDXA 3LA2A 5J6XA 4WWCA 5CLSA 3KP4A 1FWZA 2PN6A 2QQAA 2H6CA 3BROA 4PCQA 5LGUA 3P9KA 4HLYA 3HOSA 1ON2A 2L4MA 5HOOA 1ULYA 2K27A 2GA2A 2X0LA 1FBSA 2BV6A 1ONVA 3F8CA 2FEZA 5D5VB 3BDDA 2ZJ2A 4NQWA 3U9GA 2VBXA 5H6QA 5BMZA 2V1XA 3KP5A 2P5KA 2KIFA 1HBXG 3I59B 4IRGA 1CGPA 1QBJA 2E7WA 3NQOA 4A0XA 5FFXA 4ON0A 3HSEA 4PGHA 1HQCA 5DDGA 3COAC 3V7CA 4M9XA 2GA1A 3MFKA 1SMYF 4O3MA 3GXOA 3F8MA 1YQAA 2FBHA 2G9WA 2UWMA 1BC7C 4L9JA 4EMSA 1DDNA 1J2XA 4NB5A 1UHWA 2Q2EA 1IXRC 2HQRA 1YW8A 5HS8A 3CDHA 2HQNA 3RKYA 2ZNYA 2DBBA 2BEOA 1K7AA 3FM5A 2V1UA 4R8HA 1S29A 3ML6A 1SFEA 1SD6A 3IC7A 1ZREA 3BJOA 3ZMSA 3GF2A 1PP7U 1QGPA 1O3SA 5BPIA 4L9NA 2QUFA 4L9VA 4DQ2A 4XLPF 4I0BA 2EV5A 3K2ZA 2KIMA 2Y48A 1U5TB 2FSWA 3E5UA 4ZYDA 2FA5A 1BN5A 1E17A 3HHHA 4K2EA 5ILUA 5E1ZB 2NRAC 3ECHA 1ZRFA 4OIQF 2G7HA 1O3TA 3K0LA 4Q47A 5H20A 2E1NA 1MJBA 4M72A 4KN4X 3BJAA 4GCVA 3TDZC 1WKMA 5L3GA 4Q4ZF 4LJZF 3VOEA 5LEJA 1ZYRF 2L02A 4EVIA 1XDSA 3RKXA 5HDKA 1D8JA 3KCCA 1TW3A 3JAMK 1G3SA 4M73A 1JHHA 4ZH4F 1J59A 2YR2A 2CQKA 5E18F 1HKTA 2X4HA 1U6GA 2KIUA 5LRRA 1RZ4A 2GWRA 1ON1A 1MD0A 3FMSA 2XHKA 1SD4A 2MD5A 1V3FA 3ECOA 5JHUA 3MWMA 3BPXA 4AIHA 1JHFA 1KYWA 2JRTA 3J81Z 2CFXA 1X3UA 2ZMEB 2Q0OA 1KQ8A 5DD4A 1IUYA 1RUNA 2AS5F 4ASNA 2RN7A 3I71A 1IN8A 3CUQB 2QWWA 1C0WA 2L3DA 2NNNA 3RYPA 2GXBA 4YG2F 3T8TA 3QAHA 3HRMA 3H3UA 4MHGA 2MH9A 4RB2C 2FU4A 5K5RA 3I59A 4L5JA 4L9TA 2KRFA 2H6BA 2IW5A 2VN2A 1R5GA 3TQNA 5F6FA 3JSPA 2R7DA 3F22A 5LEKA 3I5UA 1OYYA 3J7AO 5AIQA 1YLFA 3DPLC 4BH9A 4ENKA 3ERED 5HLIA 2P8TA 3BOQA 3EUHA 2EA2A 2KJBA 5DV5A 3N4MA 5D8KB 4UVCA 4PZJA 2XIGA 3SFZA 3FF5A 3GEZA 4Y15A 1SFUA 4YIIA 4MEXF 2FBIA 2VBZA 4HW0A 5EEHA 2LF8A 1R1VA 4HA8A 3KZZA 4HDUA 2VT3A 2QLZA 3MZHA 5ILSA 3O3KA 1FSEA 3GFMA 1B9MA 2VT2A 4G6QA 4I2OA 3TKYA 5LGNA 3F23A 4UV8A 3LSTA 3QP5A 3R4KA 3D0SA 4RS8A 5FD6A 2ESNA 2NYXA 4M6XA 1LB2A 3RDIA 2XVCA 2EWNA 2HTSA 1R23A 2HKOA 1P2FA 3KEQA 3BZ6A 1FP2A 3O6BB 2RC4A 3OOPA 4LD5A 2CWEA 1XDUA 2XGXA 1FY7A 1MDMA 2DLLA 3QU6A 1S6LA 3GW2A 4LLNA 5HLGA 3KP6A 1TLHB 3RYRA 2R7FA 2A69F 4U7BA 5ICEA 2ZFWA 2NAZA 4G9YA 3WGGA 2BE5F 3BJ6A 3V7RA 2QM3A 3F6OA 1AWCA 2FMLA 4ZZDA 2CO5A 1IAWA 4G7OF 1IRFA 3MAJA 1SD5A 5L3DA 2NNYA 4WXHA 2JTVA 2HFHA 2UXNA 1G3YA 3ULQB 3ABTA 1F4KA 3HRUA 2R3SA 1R36A 2RKHA 3K1NA 5BQTA 3KP2A 2PJPA 5AONA 1R1UA 5TJJA 1YG2A 4JBAA 3EYYA 4HZFA 4LLGF 2ISYA 4I02A 4ETSA 5IT9K 2IVMA 3HTSB 1P92A 1TNSA 3E97A 3ABUA 2J5PA 5HVQC 3CO7C 2LSOA 2Z9OA 2WC2A 2H94A 3LFKA 2V9VA 4OIRF 4YFXF 5DCMA 4Q48A 3WE3A 1I1GA 1PDNC 4HX4A 3F8NA 1IN6A 3R0AA 4UNOA 1ZLJA 2K4JA 4AWXB 1IF1A 3IKTA 3HOTA 1D8KA 1R5HA 2EJRA 2QENA 1SAXA 3JAMZ 1T39A 1W4MA 4EM2A 1KU7A 4KT5C 2LNBA 3M8FA 1FBQA 1OYIA 1CF7B 2DT5A 5F1RA 3L9FA 2MH2A 3LQRA 4ZYEA 2MBFA 1L3LA 5A2QK 3W6KB 2QBYA 4MQVA 1ZGAA 3MZYA 5CVIA 1R58A 3HSFA 3JTHA 3C7JA 5TRDA 2M45A 4ZYGA 4LMYA 2EV6A 4YFNF 3J80K 3U2RA 2DU9A 4MQ9F 3HTUA 1FNNA 4A5NA 1O7LA 2JSCA 3E3VA 4KFCA 4HLXA 2PBIA 3K69A 2K86A 3FXRA 2ETHA 3F8BA 1RNLA 4L5IA 2RV8A 5ICCA 5H6RA 1WQ2A 1LVAA 2G7UA 1T6SA 4HV5A 3NRVA 3Q5FA 3WTWC 3L7WA 5LHGA 1WRJA 4QLCU 1XGMA 3I64A 2EFOA 2Y75A 3VEPA 3IWFA 4KIGA 4UVBA 3QRFF 4G8XA 3T0YA 1W7PD 1FT9A 2D1HA 3CUQA 3K9TA 1BBYA 3HIFA 3ZMZA 3C3WA 2E1CA 5D5WB 3HRSA 4O6JA 2A68F 2HS5A 5LHIA 4HOBA 3GWZA 3LQQA 1XSDA 3RPUA 4XLNF 5HDGA 1IXCA 2KJCA 5J8FA 2VOOA 1J7KA 4GYIA 3L09A 1USSA 3QPTA 5E8GA 2DPUA 2OD5A 1CF7A 1LEBA 5K5QA 1MJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CGP A;  2XAS A;  2M1B A;  4LG0 B;  4HF0 A;  4JQF A;  1F9N A;  2VOD A;  3BP8 A;  1NHA A;  3AAF A;  3Q9V A;  5HS9 A;  4OMZ A;  2EFQ A;  3ZP5 A;  3VOD A;  2EFN A;  1S7O A;  3RTR A;  2GZW A;  1P4A A;  1O7F A;  1KU2 A;  3FZV A;  2XKO A;  3EQL F;  4ENJ A;  5E20 A;  2W25 A;  2L4A A;  1S3J A;  4EJV A;  4MTD A;  3ZMT A;  2DFI A;  2CG4 A;  1U8R A;  3SXY A;  1G3W A;  4R79 A;  1Q1H A;  2XRO A;  2IP2 A;  4N9H A;  4CYD A;  5CVU A;  3HHG A;  1SFX A;  4CIC A;  1OKR A;  1ZHF A;  1U5T A;  4Z2Y A;  2ISZ A;  3ZN1 A;  2P7C B;  1W7P A;  3FXQ A;  4IJA A;  1XGO A;  2Z99 A;  4GYG A;  1DPU A;  5CVR A;  2A6H F;  5A2Q Z;  2VXZ A;  1ZN2 A;  5DCF A;  5L3C A;  3P9I A;  2HZT A;  3GFL A;  3I54 A;  4P9U A;  1R7J A;  2HGC A;  1VTN C;  3I58 A;  2VC0 A;  4EGZ A;  3KZY A;  2P5L C;  2F2E A;  4KA4 A;  3MQ0 A;  3NEU A;  3H3Z A;  3GYH X;  4G6D A;  1HW5 A;  4P96 A;  2PI0 A;  2HTJ A;  2HWV A;  3WTX C;  4G7H F;  3SZT A;  1IN7 A;  5E1X A;  3ELK A;  4RGR A;  3CO6 C;  3RKW A;  1DP7 P;  5CYV A;  3KP7 A;  4LGW A;  1B1B A;  3RJP A;  2EV0 A;  4MGR A;  2UZK A;  4WCG A;  1LNW A;  1F1Z A;  1J75 A;  3T8R A;  4EQQ A;  3VB2 A;  1BI3 A;  3W6J B;  1JXS A;  4P55 A;  2FE3 A;  1A04 A;  2W84 A;  4IRH A;  5KVR A;  3DF8 A;  4IHS A;  1TNT A;  3SZP A;  3J80 Z;  1I6X A;  2ADU A;  3K1P A;  4O5V A;  4BAY A;  1D5V A;  4BHB A;  3IKV A;  1YO5 C;  2VE8 A;  3S2W A;  1K78 A;  2W85 A;  4WF2 A;  2QBY B;  3DKW A;  2JZY A;  3DPT A;  2OZU A;  2LDU A;  3IRR A;  3LA7 A;  4P5O A;  2PQ8 A;  4CZZ A;  3J81 K;  4LB5 A;  2B0L A;  3WGH A;  3QU3 A;  1HXD A;  1P6R A;  1XMA A;  2F5C A;  1P4W A;  4EJO A;  2JPC A;  2ZNZ A;  2EFP A;  5DUI A;  4OIN F;  4EM1 A;  4Y17 A;  3R6S A;  4OU0 A;  3WE2 A;  4I0A A;  4ESF A;  2OA4 A;  1W5S A;  5D4S A;  3DV8 A;  1G4D A;  2OQR A;  5BOX A;  1XSV A;  1EH8 A;  1SMT A;  3F6V A;  4R1H A;  5D6E A;  3ZMV A;  5DD8 A;  2IRF G;  1SD7 A;  1G6N A;  3V8K A;  4H0E A;  1EV7 A;  1L0O C;  1Z1D A;  3G3Z A;  5F64 A;  1BM9 A;  1MGT A;  3ZQ7 A;  4BNC A;  1YS6 A;  3I0T A;  4BHC A;  4F7Z A;  2EA4 A;  3BWG A;  1FZP B;  3LWF A;  2O03 A;  1W7P B;  2OBP A;  3C18 A;  3M9A A;  1ZAO A;  3ZMD A;  2P4W A;  5KK1 A;  4AD9 A;  3PQK A;  2ZCW A;  4OOI A;  5LLQ A;  2XAJ A;  3ZN0 A;  5DUK A;  3M8E A;  1FOK A;  1YTY A;  4LLL A;  2VE9 A;  3LAP A;  1Z7U A;  3SQN A;  2A3S A;  5FD5 A;  1IW7 F;  1GHC A;  3R61 A;  1IRG A;  2PMH A;  1UCR A;  1XGS A;  5CJ9 A;  1RI7 A;  2BGC A;  3V7S A;  1D3Y A;  1ODD A;  2H09 A;  2PG4 A;  1TQM A;  1BIA A;  1S7A A;  2L54 A;  3REO A;  5FLX Z;  4M6Y A;  1MDM B;  1GXQ A;  2FBK A;  1TBX A;  3P9C A;  4EJW A;  1YS7 A;  1F5T A;  2XV4 S;  1QPM A;  3G73 A;  4I98 B;  4I09 A;  1KU3 A;  2XKP A;  2M87 A;  1T98 A;  2WWY A;  2GIV A;  1T2K A;  1H0M A;  4M74 A;  3GVA A;  4EM0 B;  4ESB A;  1WWX A;  5DCM B;  1T38 A;  3GZ5 A;  2DO7 A;  2UXX A;  3DP7 A;  1UST A;  3BPV A;  4IPA A;  4LB6 B;  2YSR A;  4OMY A;  1R00 A;  2MLG A;  1U3E M;  1K78 B;  1OR7 A;  3F8F A;  5ICG A;  4U0V A;  2MA3 A;  2WTE A;  1HSJ A;  2OU2 A;  1XN7 A;  3DFG A;  1YW9 A;  2PEX A;  1S8N A;  2DI3 A;  1W5T A;  2D1V A;  3HSR A;  3HRT A;  4A12 A;  4PDK A;  1ZAR A;  3M1E A;  4U7D A;  2DK8 A;  1ZG1 A;  3RPQ A;  3KET A;  4BQA A;  2QYO A;  2V6C A;  4HAM A;  3CTA A;  3V8L A;  3IHU A;  2VON A;  3FHZ A;  2ZO4 A;  4HX8 A;  4A6E A;  4UXN A;  2DTR A;  3B73 A;  1Z6T A;  3GZ6 A;  4P9F A;  1REP C;  4HF1 A;  4OIP F;  1YIO A;  4I7H A;  4XSX F;  2F5D A;  2O61 A;  2NS0 A;  3CUQ C;  2DQL A;  3E5X A;  4EGY A;  3GFJ A;  1TW2 A;  3OV8 A;  3RI4 A;  2A5Y B;  2O3F A;  5D5X B;  3DEU A;  4MTE A;  2AXL A;  4HX7 A;  1PUE E;  4HDV A;  4UVA A;  5IT3 A;  5D5U B;  2K02 A;  2ACJ A;  2XAH A;  1ZH5 A;  2LF7 A;  5E8I A;  4L0Z B;  2O0Y A;  1B4A A;  1O3Q A;  5LHH A;  5CVV A;  4AIK A;  2QZ8 A;  2XRN A;  4UHT A;  3TOB A;  5FB2 A;  4U0Y A;  3TOA A;  2VC1 A;  2RVC A;  4MEY F;  5JR3 A;  4FHT A;  2F5E A;  3R60 A;  4Q5S F;  3LAJ A;  1KYZ A;  3MEX A;  1XB4 A;  5J8C A;  4PGG A;  4BYY A;  5D4R A;  1QZY A;  3Q9S A;  1JE8 A;  4HBL A;  4N9I A;  2XUB A;  2OQG A;  3KFW X;  2CSO A;  3JSO A;  3M7G A;  4KDP A;  4NHJ A;  1Z9C A;  1I5Z A;  2XAG A;  1HKQ A;  1LQ1 A;  4KIF A;  2IPQ X;  1G3T A;  4YIF A;  2Z3Y A;  3N97 A;  2JT1 A;  3C1D A;  1Z6R A;  3WTY C;  3ZMU A;  5HLH A;  1IXS B;  1BI1 A;  3CUO A;  1U2W A;  2ELH A;  1LJ9 A;  4G94 A;  1ZRD A;  3O2P E;  2K7L A;  1KGS A;  4KMF A;  4A6D A;  3JTG A;  1ZRC A;  1ZG3 A;  1T0F A;  1P4X A;  1FC3 A;  2FXA A;  2ZXJ A;  3GUD A;  5EEG A;  2YPR A;  1R1T A;  1WSU A;  5HS7 A;  1GVJ A;  4IF4 A;  4RB1 A;  3QPH A;  5JVT A;  4EV0 A;  3JW4 A;  2DQR A;  1RIO H;  4HF2 A;  3GX4 X;  4A5M A;  4CO8 A;  1XD7 A;  3E6D A;  4RB3 C;  2P7V B;  1O57 A;  5ICF A;  3SHF A;  4S05 A;  1K79 A;  5E1W A;  1I27 A;  2FNA A;  1PP8 F;  1FP1 D;  1RUO A;  1R22 A;  1BI2 A;  2GAU A;  3KLN A;  5FFZ A;  1GXP A;  4U0W A;  3IRQ A;  4DNC A;  2A6E F;  2MLK A;  3TO7 A;  1FBU A;  2Q8K A;  4I01 A;  1Z91 A;  5JFR A;  3WTS C;  1OMI A;  1KU9 A;  1U78 A;  4A0Z A;  4L0Y B;  4GXO A;  4EJT A;  2PFB A;  3EYI A;  3FMQ A;  5IT9 Z;  1QO0 D;  5BPD A;  2Z33 A;  5L3B A;  3I53 A;  2HDC A;  4ENN A;  1JGS A;  3ZPL A;  1TQP A;  3H92 A;  3FMR A;  4RGX A;  4IHT A;  5LBQ A;  2STW A;  3P7N A;  1B9N A;  2W24 A;  2O8X A;  2F5F A;  4EJU A;  4HQM A;  3ROU A;  2M8E A;  2C6Y A;  5AIP A;  4KNY A;  3TGN A;  2J5O A;  3DXJ F;  2RNJ A;  3GLX A;  1MZB A;  2HR3 A;  4A0Y A;  4KUM A;  1B6A A;  3CJN A;  3E5Q A;  5L3F A;  2PLY A;  1KQ9 A;  3WTV C;  2HYG D;  3F72 A;  1WI9 A;  4B8X A;  3E6C C;  3HUG A;  3QP6 A;  4HQE A;  1KA8 A;  1DPR A;  2M5W A;  1J9I A;  3IL2 A;  1BJA A;  4CGZ A;  1H9G A;  2HYF A;  4WXC A;  5DEQ A;  1H9T A;  3PFI A;  4Y13 A;  1EH6 A;  1LEA A;  3FX3 A;  4AIJ A;  3QOP A;  4WXD A;  1TTY A;  2LKP A;  2V79 A;  2O6G E;  3K1M A;  1UB9 A;  2DW4 A;  1ZG5 A;  2YX4 A;  1IN4 A;  3WOD F;  5HDN A;  1DUX C;  2Z5U A;  3I4P A;  4YFK F;  1YFH A;  2RDP A;  1LDD A;  1V4R A;  2EFW A;  4HV6 A;  4JK1 X;  1LDK B;  5LRS A;  3GFI A;  2PMU A;  4CDG A;  5JI6 A;  3TDU C;  3KE2 A;  1XCB A;  2YU3 A;  3L2C A;  4S04 A;  4LK1 F;  5ED4 A;  4B09 A;  1BI0 A;  3WTT C;  3U1D A;  1U5T C;  1UHM A;  3WU0 A;  5ILV A;  4KMU X;  1I1S A;  4ESJ A;  3L00 A;  2BYV E;  3WG9 A;  4FT8 A;  2DPD A;  3V4G A;  4TV7 A;  5ERI A;  2VBY A;  3FXU A;  4LFU A;  4WK8 F;  3D5L A;  4XRF A;  2DK5 A;  1EH7 A;  1B59 A;  2QQ9 A;  4M9Z A;  1IZ1 A;  3EET A;  2ZBK A;  5D8L B;  1FX7 A;  1YYV A;  2MC3 A;  2A61 A;  2JPB A;  2CW0 F;  2HKX A;  2K4B A;  4UV9 A;  5E17 F;  2FQ3 A;  3FWE A;  3ISP A;  3V8J A;  4RGS A;  1QQI A;  1ZLK A;  4KN7 X;  4RAZ A;  2GXG A;  4IVN A;  4ZZL A;  2E7X A;  2FRH A;  1HST A;  1BOA A;  3FM3 A;  1FSH A;  4LK0 F;  1UFM A;  3KLO A;  1XMK A;  3TO6 A;  1E2X A;  3PQJ A;  3T5X A;  1HKS A;  1XSX A;  4E70 A;  5L3E A;  1FYL A;  1O3R A;  3R0J A;  2ESH A;  4G7Z F;  3WTU C;  4GO1 A;  4RB0 A;  1FYM A;  2ZME A;  2P6S A;  2OAZ A;  1ZGJ A;  2P5V A;  2RGV A;  2FOK A;  3T1B A;  2L01 A;  2VOP A;  2RQP A;  5K5O A;  4M9S A;  4A2U A;  4FX0 A;  2QVO A;  4KYW A;  1Y0U A;  3KEO A;  1QZZ A;  2W57 A;  2FMY A;  2V1D A;  2WV0 A;  1XGN A;  2DAO A;  4WX9 A;  4D0P A;  3IWZ A;  4UUV A;  1Z05 A;  4GGG A;  1HW2 A;  1IN5 A;  4KIC A;  4MNU A;  2ZKZ A;  1MKM A;  2Y0M A;  1BC8 C;  3BY6 A;  4FX4 A;  1QNT A;  1KQ0 A;  4AVP A;  1FLI A;  5BS6 A;  3DQV C;  3E6B A;  5FLX K;  5D6F A;  1STZ A;  2YX7 A;  1BIB A;  2D2W A;  1AOY A;  4HYE A;  3CLO A;  2P6T A;  4RGU A;  2HEO A;  4KIB A;  4IXA A;  3WTZ A;  5FO5 A;  1YW7 A;  5CVJ A;  2BBY A;  5K1Y A;  3MCZ A;  1HW1 A;  2M30 A;  1LDJ A;  1FPQ A;  2COM A;  3LA3 A;  4CHU A;  2FNP A;  4L18 B;  4N0B A;  1MJ9 A;  4M71 A;  2OZ6 A;  2IT0 A;  4BHP A;  2EB7 A;  2FF4 A;  1OPC A;  5LGT A;  2IA0 A;  2KKO A;  3HYI A;  3F21 A;  2GQQ A;  4QWQ A;  2EK5 A;  2XAF A;  3EDP A;  4BXU A;  2CYY A;  6PAX A;  4LG0 A;  1TQI A;  2IA2 A;  2A07 F;  3VFZ A;  1OYW A;  3B02 A;  2STT A;  1K6O A;  4XSZ F;  3WU1 B;  3F3X A;  4U88 A;  2H27 A;  2HOE A;  2IA1 A;  4IRI A;  2D45 A;  1XCV A;  4CXF A;  4RAY A;  1FYK A;  3E6M A;  3TO9 A;  5DYM A;  4OIO F;  3KP3 A;  2IJL A;  3GO5 A;  4XBF A;  1J0R A;  2QQB A;  3RIR A;  4ZYH A;  1J5Y A;  3WGI A;  5FGM A;  2VBW A;  4ENM A;  2XAQ A;  2TDX A;  3LA2 A;  5J6X A;  4WWC A;  5CLS A;  3KP4 A;  1FWZ A;  2PN6 A;  2QQA A;  2H6C A;  3BRO A;  4PCQ A;  5LGU A;  3P9K A;  4HLY A;  3HOS A;  1ON2 A;  2L4M A;  5HOO A;  1ULY A;  2K27 A;  2GA2 A;  2X0L A;  1FBS A;  2BV6 A;  1ONV A;  3F8C A;  2FEZ A;  5D5V B;  3BDD A;  2ZJ2 A;  4NQW A;  3U9G A;  2VBX A;  5H6Q A;  5BMZ A;  2V1X A;  3KP5 A;  2P5K A;  2KIF A;  1HBX G;  3I59 B;  4IRG A;  1CGP A;  1QBJ A;  2E7W A;  3NQO A;  4A0X A;  5FFX A;  4ON0 A;  3HSE A;  4PGH A;  1HQC A;  5DDG A;  3COA C;  3V7C A;  4M9X A;  2GA1 A;  3MFK A;  1SMY F;  4O3M A;  3GXO A;  3F8M A;  1YQA A;  2FBH A;  2G9W A;  2UWM A;  1BC7 C;  4L9J A;  4EMS A;  1DDN A;  1J2X A;  4NB5 A;  1UHW A;  2Q2E A;  1IXR C;  2HQR A;  1YW8 A;  5HS8 A;  3CDH A;  2HQN A;  3RKY A;  2ZNY A;  2DBB A;  2BEO A;  1K7A A;  3FM5 A;  2V1U A;  4R8H A;  1S29 A;  3ML6 A;  1SFE A;  1SD6 A;  3IC7 A;  1ZRE A;  3BJO A;  3ZMS A;  3GF2 A;  1PP7 U;  1QGP A;  1O3S A;  5BPI A;  4L9N A;  2QUF A;  4L9V A;  4DQ2 A;  4XLP F;  4I0B A;  2EV5 A;  3K2Z A;  2KIM A;  2Y48 A;  1U5T B;  2FSW A;  3E5U A;  4ZYD A;  2FA5 A;  1BN5 A;  1E17 A;  3HHH A;  4K2E A;  5ILU A;  5E1Z B;  2NRA C;  3ECH A;  1ZRF A;  4OIQ F;  2G7H A;  1O3T A;  3K0L A;  4Q47 A;  5H20 A;  2E1N A;  1MJB A;  4M72 A;  4KN4 X;  3BJA A;  4GCV A;  3TDZ C;  1WKM A;  5L3G A;  4Q4Z F;  4LJZ F;  3VOE A;  5LEJ A;  1ZYR F;  2L02 A;  4EVI A;  1XDS A;  3RKX A;  5HDK A;  1D8J A;  3KCC A;  1TW3 A;  3JAM K;  1G3S A;  4M73 A;  1JHH A;  4ZH4 F;  1J59 A;  2YR2 A;  2CQK A;  5E18 F;  1HKT A;  2X4H A;  1U6G A;  2KIU A;  5LRR A;  1RZ4 A;  2GWR A;  1ON1 A;  1MD0 A;  3FMS A;  2XHK A;  1SD4 A;  2MD5 A;  1V3F A;  3ECO A;  5JHU A;  3MWM A;  3BPX A;  4AIH A;  1JHF A;  1KYW A;  2JRT A;  3J81 Z;  2CFX A;  1X3U A;  2ZME B;  2Q0O A;  1KQ8 A;  5DD4 A;  1IUY A;  1RUN A;  2AS5 F;  4ASN A;  2RN7 A;  3I71 A;  1IN8 A;  3CUQ B;  2QWW A;  1C0W A;  2L3D A;  2NNN A;  3RYP A;  2GXB A;  4YG2 F;  3T8T A;  3QAH A;  3HRM A;  3H3U A;  4MHG A;  2MH9 A;  4RB2 C;  2FU4 A;  5K5R A;  3I59 A;  4L5J A;  4L9T A;  2KRF A;  2H6B A;  2IW5 A;  2VN2 A;  1R5G A;  3TQN A;  5F6F A;  3JSP A;  2R7D A;  3F22 A;  5LEK A;  3I5U A;  1OYY A;  3J7A O;  5AIQ A;  1YLF A;  3DPL C;  4BH9 A;  4ENK A;  3ERE D;  5HLI A;  2P8T A;  3BOQ A;  3EUH A;  2EA2 A;  2KJB A;  5DV5 A;  3N4M A;  5D8K B;  4UVC A;  4PZJ A;  2XIG A;  3SFZ A;  3FF5 A;  3GEZ A;  4Y15 A;  1SFU A;  4YII A;  4MEX F;  2FBI A;  2VBZ A;  4HW0 A;  5EEH A;  2LF8 A;  1R1V A;  4HA8 A;  3KZZ A;  4HDU A;  2VT3 A;  2QLZ A;  3MZH A;  5ILS A;  3O3K A;  1FSE A;  3GFM A;  1B9M A;  2VT2 A;  4G6Q A;  4I2O A;  3TKY A;  5LGN A;  3F23 A;  4UV8 A;  3LST A;  3QP5 A;  3R4K A;  3D0S A;  4RS8 A;  5FD6 A;  2ESN A;  2NYX A;  4M6X A;  1LB2 A;  3RDI A;  2XVC A;  2EWN A;  2HTS A;  1R23 A;  2HKO A;  1P2F A;  3KEQ A;  3BZ6 A;  1FP2 A;  3O6B B;  2RC4 A;  3OOP A;  4LD5 A;  2CWE A;  1XDU A;  2XGX A;  1FY7 A;  1MDM A;  2DLL A;  3QU6 A;  1S6L A;  3GW2 A;  4LLN A;  5HLG A;  3KP6 A;  1TLH B;  3RYR A;  2R7F A;  2A69 F;  4U7B A;  5ICE A;  2ZFW A;  2NAZ A;  4G9Y A;  3WGG A;  2BE5 F;  3BJ6 A;  3V7R A;  2QM3 A;  3F6O A;  1AWC A;  2FML A;  4ZZD A;  2CO5 A;  1IAW A;  4G7O F;  1IRF A;  3MAJ A;  1SD5 A;  5L3D A;  2NNY A;  4WXH A;  2JTV A;  2HFH A;  2UXN A;  1G3Y A;  3ULQ B;  3ABT A;  1F4K A;  3HRU A;  2R3S A;  1R36 A;  2RKH A;  3K1N A;  5BQT A;  3KP2 A;  2PJP A;  5AON A;  1R1U A;  5TJJ A;  1YG2 A;  4JBA A;  3EYY A;  4HZF A;  4LLG F;  2ISY A;  4I02 A;  4ETS A;  5IT9 K;  2IVM A;  3HTS B;  1P92 A;  1TNS A;  3E97 A;  3ABU A;  2J5P A;  5HVQ C;  3CO7 C;  2LSO A;  2Z9O A;  2WC2 A;  2H94 A;  3LFK A;  2V9V A;  4OIR F;  4YFX F;  5DCM A;  4Q48 A;  3WE3 A;  1I1G A;  1PDN C;  4HX4 A;  3F8N A;  1IN6 A;  3R0A A;  4UNO A;  1ZLJ A;  2K4J A;  4AWX B;  1IF1 A;  3IKT A;  3HOT A;  1D8K A;  1R5H A;  2EJR A;  2QEN A;  1SAX A;  3JAM Z;  1T39 A;  1W4M A;  4EM2 A;  1KU7 A;  4KT5 C;  2LNB A;  3M8F A;  1FBQ A;  1OYI A;  1CF7 B;  2DT5 A;  5F1R A;  3L9F A;  2MH2 A;  3LQR A;  4ZYE A;  2MBF A;  1L3L A;  5A2Q K;  3W6K B;  2QBY A;  4MQV A;  1ZGA A;  3MZY A;  5CVI A;  1R58 A;  3HSF A;  3JTH A;  3C7J A;  5TRD A;  2M45 A;  4ZYG A;  4LMY A;  2EV6 A;  4YFN F;  3J80 K;  3U2R A;  2DU9 A;  4MQ9 F;  3HTU A;  1FNN A;  4A5N A;  1O7L A;  2JSC A;  3E3V A;  4KFC A;  4HLX A;  2PBI A;  3K69 A;  2K86 A;  3FXR A;  2ETH A;  3F8B A;  1RNL A;  4L5I A;  2RV8 A;  5ICC A;  5H6R A;  1WQ2 A;  1LVA A;  2G7U A;  1T6S A;  4HV5 A;  3NRV A;  3Q5F A;  3WTW C;  3L7W A;  5LHG A;  1WRJ A;  4QLC U;  1XGM A;  3I64 A;  2EFO A;  2Y75 A;  3VEP A;  3IWF A;  4KIG A;  4UVB A;  3QRF F;  4G8X A;  3T0Y A;  1W7P D;  1FT9 A;  2D1H A;  3CUQ A;  3K9T A;  1BBY A;  3HIF A;  3ZMZ A;  3C3W A;  2E1C A;  5D5W B;  3HRS A;  4O6J A;  2A68 F;  2HS5 A;  5LHI A;  4HOB A;  3GWZ A;  3LQQ A;  1XSD A;  3RPU A;  4XLN F;  5HDG A;  1IXC A;  2KJC A;  5J8F A;  2VOO A;  1J7K A;  4GYI A;  3L09 A;  1USS A;  3QPT A;  5E8G A;  2DPU A;  2OD5 A;  1CF7 A;  1LEB A;  5K5Q A;  1MJA A; 
#chains in the Genus database with same CATH topology
 3W2A A;  2CGP A;  1KON A;  2XAS A;  1OCT C;  4AYB N;  3BQZ A;  2B7E A;  2M1B A;  4DYC A;  4LG0 B;  1XMX A;  1QHG A;  3CC7 I;  4HF0 A;  4JQF A;  1F9N A;  2VOD A;  3BP8 A;  3MN2 A;  4QIW N;  4S0H B;  1NHA A;  2WBM A;  3AAF A;  3L2U A;  2WY7 Q;  3Q9V A;  5HS9 A;  4OMZ A;  4IL6 C;  2EFQ A;  3OR2 C;  3ZP5 A;  4HPQ A;  3RQ4 A;  3VOD A;  4BY1 J;  2EFN A;  1X4O A;  2GLO A;  2JRM A;  2NS8 A;  2O5R A;  3ABL H;  3OSF A;  1S7O A;  3RTR A;  2GZW A;  2NOJ B;  4IHX A;  2LY1 A;  3O8H A;  1P4A A;  1O7F A;  1KU2 A;  1T95 A;  3FZV A;  2XKO A;  5E3O A;  1GV5 A;  3EQL F;  1OCC H;  3EUA A;  4ENJ A;  5E20 A;  2X1D A;  2W25 A;  2L4A A;  3GTQ J;  1S3J A;  2L9N A;  4EJV A;  3HPG A;  5H2F C;  4MTD A;  4J19 A;  1MMN A;  1OIS A;  2PX9 A;  3CES A;  3ZMT A;  5IP6 A;  1ITY A;  2DFI A;  2E36 A;  2N8G A;  2CG4 A;  3H9G A;  1U8R A;  1Z7L A;  3SXY A;  1IJW C;  5TIS C;  1G3W A;  4R79 A;  1Q1H A;  2E34 A;  4JX6 A;  2XRO A;  2IP2 A;  3CF2 A;  4CUG A;  1Y8Q B;  3Q3S A;  4N9H A;  4CYD A;  3CDI A;  5CVU A;  3HHG A;  1R4N B;  1SFX A;  4CIC A;  5CKT A;  1OKR A;  3VPR A;  2TCT A;  1ZHF A;  1U5T A;  4Z2Y A;  1M1E B;  3LL7 A;  2ISZ A;  2ZFU A;  2O9L A;  4V2F A;  1WJF A;  3ZN1 A;  2P7C B;  1W7P A;  3LNQ A;  3CD6 I;  3UKG A;  3FXQ A;  2DFF A;  2H1L A;  4IJA A;  1IRX A;  2JJ7 A;  3JR9 A;  2HOT A;  2A05 A;  2MAB A;  1XGO A;  4EEF G;  2QSH X;  4LIU A;  3J7Z I;  3M07 A;  2Z99 A;  2CJJ A;  2DDA A;  3LSM A;  4GYG A;  1QA6 A;  4B4C A;  1W1W E;  4CA0 A;  1DPU A;  3PNT A;  1T8I A;  2X1C A;  2MGQ A;  5CVR A;  5C4J J;  2LVS A;  2A6H F;  5A2Q Z;  1A31 A;  2VXZ A;  1ZN2 A;  2W00 A;  5DCF A;  3K4N A;  5L3C A;  4HG2 A;  1U9O A;  3P9I A;  1TWG J;  2HZT A;  4BEH A;  1VQ4 I;  3GFL A;  3I54 A;  4P9U A;  1R7J A;  2GM4 A;  2XPV A;  5C44 J;  2HGC A;  1VTN C;  3I58 A;  1AHD P;  2VC0 A;  2DMQ A;  4DW6 A;  4EGZ A;  2NOG A;  2OTJ I;  2KZG A;  1I6H J;  3AKZ A;  4XLA A;  4BE2 A;  1ZEL A;  2PMZ N;  3KZY A;  2P5L C;  2F2E A;  2HOA A;  4KA4 A;  3TL4 X;  3MQ0 A;  3NEU A;  3H3Z A;  3OYI A;  4ZTJ A;  3GYH X;  1X1C A;  4G6D A;  1HW5 A;  3OYB A;  2B9S A;  2QGU A;  4JP0 A;  4P96 A;  2PI0 A;  2HTJ A;  2HWV A;  3IH4 A;  3WTX C;  4G7H F;  4IHY A;  3A0B C;  3SZT A;  1IN7 A;  2AQF A;  3K4K A;  5E1X A;  1ENH A;  3ELK A;  4RGR A;  4B47 A;  5IP9 J;  2R7R A;  3AL0 C;  3CO6 C;  3CCR I;  2DJI A;  3RKW A;  1DP7 P;  2RRE A;  5CYV A;  1ZGW A;  3OWT A;  1LE8 B;  1YRN B;  3ZQG A;  1VF9 A;  3KP7 A;  4LGW A;  2BY3 A;  1EF4 A;  1B1B A;  5GAE J;  3RJP A;  4ZDP A;  3OL3 A;  4E7S A;  3FBI B;  5B3S H;  1VQM I;  4HNV A;  2EV0 A;  4ZTF A;  3K2A A;  4B3X A;  4RAF A;  4MGR A;  2UZK A;  4WCG A;  2B63 J;  1LNW A;  3MKZ A;  3DLA A;  1F1Z A;  2JQ7 A;  3CC4 I;  1S9H A;  5M3M J;  2KMU A;  1J75 A;  1PYV A;  4GRI A;  1QRY A;  3BCA A;  3T8R A;  4EQQ A;  3VB2 A;  5IYB J;  2XSD C;  3H9J A;  1BI3 A;  3W6J B;  1JXS A;  2K3F A;  4I99 C;  5B1A H;  5DM6 F;  4P55 A;  1JGG A;  4OWR B;  4GFB A;  3OY9 A;  2XPW A;  3I3L A;  3FBN B;  3ASO H;  3K4C A;  2FE3 A;  1A04 A;  2W84 A;  2AQE A;  2KIQ A;  4IRH A;  5KVR A;  3DF8 A;  4IHS A;  1TNT A;  1VQ9 I;  3SFI A;  3SZP A;  3W2V A;  3J80 Z;  1I6X A;  1QVT A;  2R5Z A;  2ADU A;  3K1P A;  4O5V A;  4BAY A;  3G4S I;  1FOW A;  2IGN A;  3PFY A;  4BHB A;  1D5V A;  3IKV A;  1T0F C;  1YO5 C;  2ZJR F;  2VE8 A;  3S2W A;  3K4J A;  1PJR A;  1K78 A;  1QPI A;  4RMN A;  2W85 A;  3RZD J;  3HOV J;  4WF2 A;  2ZJP F;  4C3J J;  4C30 A;  1YI2 I;  3DKW A;  2QBY B;  3JRB A;  2JZY A;  3DPT A;  2OZU A;  1FOY A;  2LDU A;  3IRR A;  3LA7 A;  4P5O A;  2BY0 A;  2PQ8 A;  4PJN A;  2DA1 A;  4CZZ A;  3J81 K;  4LB5 A;  3I9V 2;  2B0L A;  4PSX A;  3VYT B;  4II2 A;  3WGH A;  4A3D J;  4MIM A;  2Y2Z A;  3QU3 A;  1HXD A;  3S1N J;  1P6R A;  1TP4 A;  1XMA A;  2F5C A;  1P4W A;  5KAF C;  4EJO A;  3SJM A;  4HST A;  1AU7 A;  2JPC A;  2ZNZ A;  4IOA F;  2K9L A;  3AG2 H;  2OTL I;  2WAQ N;  2EFP A;  2L7Z A;  5DUI A;  4BUP A;  3Q0V A;  4OIN F;  4EM1 A;  2X6O A;  4I76 A;  4Y17 A;  3R6S A;  3WG7 H;  4J00 A;  5EGO B;  1JJ8 C;  1V54 H;  5IOZ A;  1GV2 A;  2AO9 A;  2HZD A;  4OU0 A;  3AFH A;  3WE2 A;  4E7K A;  2EIL H;  4I0A A;  4ESF A;  2OA4 A;  1W5S A;  5D4S A;  3DV8 A;  3WHC A;  5KNL A;  2VJJ A;  1JTX A;  1G4D A;  2OQR A;  5BOX A;  2M2E A;  1TT5 B;  3LOC A;  1XSV A;  3I55 I;  2TRT A;  1EH8 A;  1SMT A;  2LK2 A;  3F6V A;  1W5C C;  4R1H A;  5D6E A;  1Z77 A;  2X48 A;  1WGX A;  2YUS A;  3ZMV A;  5DD8 A;  2EZK A;  5IOY A;  2IRF G;  1SD7 A;  1WJE A;  4D5C A;  1G6N A;  2JUC A;  3V8K A;  3LSJ A;  4H0E A;  2ID3 A;  1EV7 A;  1L0O C;  1Z1D A;  1XS9 A;  2BY2 A;  1RES A;  3G3Z A;  5F64 A;  1BM9 A;  1MGT A;  2ZXW H;  1GT0 C;  2LRE A;  4HSR A;  4BXF A;  3ZQ7 A;  4BNC A;  3G6E I;  1YS6 A;  3I0T A;  4LIT A;  4IKF A;  4BHC A;  5IYC J;  2V1N A;  4F7Z A;  2CV1 A;  2EA4 A;  4II3 A;  3BWG A;  3JRI A;  2KT0 A;  1FZP B;  3LWF A;  2O03 A;  1W7P B;  1OLT A;  2OBP A;  5EZH A;  3C18 A;  3M9A A;  1ZAO A;  1K83 J;  3CCL I;  3BT9 A;  2NVU B;  1AKH A;  3VWB A;  3TP3 A;  1SAU A;  2EIM H;  3K10 A;  3ZMD A;  1D0Y A;  2DMP A;  2P4W A;  1PUF B;  4NNJ A;  5KK1 A;  4AD9 A;  1RET A;  2M9H A;  4FE4 A;  3A1Y A;  3PQK A;  2ZCW A;  4OOI A;  4A3E J;  3GLL A;  2DOA A;  1X58 A;  5LLQ A;  3QOE A;  2DXI A;  3KYD B;  2XAJ A;  3ZN0 A;  5DUK A;  2WAE A;  3M8E A;  3H35 A;  1FOK A;  2XGD A;  1YTY A;  4LLL A;  2VE9 A;  3LAP A;  1Z7U A;  4C2T A;  3SQN A;  4CCL A;  2DYS H;  2DA6 A;  3NWS A;  2A3S A;  3DU5 A;  3HKZ N;  3GME A;  2DT7 B;  2LC2 A;  1MMG A;  5FRO A;  5FD5 A;  1IW7 F;  4BQN A;  3S1Q J;  1GHC A;  2IGM A;  2VUM J;  3R61 A;  1IRG A;  4DYR A;  4XQF A;  2PMH A;  1UCR A;  1XGS A;  2HPM A;  5DM7 F;  5CJ9 A;  1RI7 A;  2BGC A;  1K4T A;  2VXD A;  3V7S A;  1D3Y A;  1ODD A;  2H09 A;  1BOB A;  1FTZ A;  4NC7 A;  5J1R A;  2PG4 A;  1ETY A;  1TQM A;  2P0W A;  4NC6 A;  1BIA A;  3HKZ A;  1S7A A;  2L54 A;  3REO A;  5IPA A;  1S7E A;  3D1N I;  5HOD A;  1POG A;  4HRI A;  1LE8 A;  1YRN A;  5FLX Z;  3EPZ A;  2HVS A;  4M6Y A;  1MDM B;  1GXQ A;  2FBK A;  1TBX A;  3P9C A;  4EJW A;  5M5W J;  3OS0 A;  1YS7 A;  1F5T A;  2NVY J;  2XGC A;  2R93 J;  2XV4 S;  1QPM A;  3UNG C;  2COB A;  4I98 B;  3G73 A;  4I09 A;  1KU3 A;  2M0M A;  3GTG J;  1MBJ A;  2XKP A;  2M87 A;  1T98 A;  4D9J A;  2WWY A;  2HI3 A;  3RCO A;  3CCY A;  4L5E A;  3S2D J;  2GIV A;  2ME0 A;  1T2K A;  1H0M A;  4M74 A;  1TZL A;  4AID A;  5JLX A;  3GVA A;  4EM0 B;  4ESB A;  1QZE A;  1K4S A;  1WWX A;  4IO9 F;  5DCM B;  2W82 A;  4NBQ A;  4F3Q A;  1T38 A;  1X2M A;  3C2H A;  3GZ5 A;  4QSH A;  2DO7 A;  2V7F A;  2UXX A;  2E35 A;  3DP7 A;  4E6K G;  1HDP A;  2W48 A;  2CFO A;  1UST A;  3BPV A;  2VJI A;  2IGK A;  3FXM A;  2IXS A;  3PJR A;  5C3E J;  4IPA A;  4LB6 B;  2YSR A;  4BKX A;  4F55 A;  1R00 A;  4OMY A;  2MLG A;  1U3E M;  3GTM J;  1K78 B;  1OR7 A;  2CS3 A;  3F8F A;  5ICG A;  1HLV A;  2VAS A;  2DYR H;  4U0V A;  1SVO A;  4KIT B;  2MA3 A;  4PUS A;  2WTE A;  1HSJ A;  2OU2 A;  1UZC A;  1WFX A;  1ETV A;  1XN7 A;  1JKQ C;  3K70 C;  3DFG A;  1IG7 A;  1YW9 A;  2PEX A;  2DA2 A;  1S8N A;  1R4M B;  4CCM A;  1Y1W J;  2DI3 A;  1VQL I;  1W5T A;  2ID6 A;  3A02 A;  4B44 A;  2D1V A;  1IUF A;  4F92 B;  1DP3 A;  3HSR A;  1EA3 A;  2H8W A;  2AXT C;  5K7Z A;  3HRT A;  4A12 A;  2LD5 A;  2L0K A;  4PDK A;  1W36 D;  1ZAR A;  4H4K C;  3M1E A;  4M3F A;  4U7D A;  2Z1D A;  2DK8 A;  5FLV A;  3CCJ I;  1ZG1 A;  3RPQ A;  3KET A;  1P9Q C;  4BQA A;  2VKD A;  2QYO A;  5FLM J;  1V5F A;  2EIK H;  5CPR B;  1FMV A;  2V6C A;  4HAM A;  1H88 C;  3IAS 2;  3CTA A;  1Y0N A;  3V8L A;  3F0C A;  3IHU A;  2VON A;  3FHZ A;  3W3C A;  1GLN A;  1B72 B;  2I5U A;  2ZO4 A;  5IYD J;  4HX8 A;  4DBQ A;  4A6E A;  4PJM A;  2GBY A;  2F4I A;  1N25 A;  4D7N A;  4BBS J;  2VJ4 A;  4UXN A;  5CQE A;  2OCC H;  2DTR A;  3B73 A;  1U9N A;  1Z6T A;  3GZ6 A;  3QYE A;  3ZGK A;  1U0J A;  4P9F A;  1REP C;  4HF1 A;  1WHU A;  3H3V K;  4OIP F;  1YIO A;  4I7H A;  4BXX J;  4XSX F;  3BTL A;  4EAT A;  1HC8 A;  2F5D A;  4Y3O A;  2O61 A;  3ZCO A;  1YOV B;  2NS0 A;  4RM3 A;  3CUQ C;  3OL4 A;  2OF7 A;  2DQL A;  2FOW A;  3E5X A;  3ZQQ A;  3G2B A;  4EGY A;  2JA5 J;  2KRH A;  3GFJ A;  1TW2 A;  3OV8 A;  3RI4 A;  2A5Y B;  2O3F A;  4DJA A;  5D5X B;  3DEU A;  4ZDL A;  3FKI J;  4MTE A;  2AXL A;  4BBR J;  3OYA A;  4HX7 A;  4XLF A;  4BQQ A;  1PUE E;  4HDV A;  4UVA A;  2R7T A;  2XC7 A;  2X1E A;  5IT3 A;  3PL8 A;  5D5U B;  2K02 A;  2F6C A;  2ACJ A;  2XAH A;  1ZH5 A;  2LF7 A;  5E8I A;  3JRG A;  4L0Z B;  2HVQ A;  2KDZ A;  4HNT A;  3JRF A;  3G71 I;  1FOX A;  1B8I A;  2OJE D;  2O0Y A;  4NUB A;  5FKN A;  1B4A A;  1O3Q A;  5LHH A;  5CVV A;  4AIK A;  4QPQ A;  1VQP I;  1MBE A;  1WI3 A;  2QZ8 A;  2XRN A;  4UHT A;  3TOB A;  5FB2 A;  4U0Y A;  3TOA A;  2VC1 A;  2HU9 A;  2RVC A;  1Y6I A;  3H36 A;  4MEY F;  5JR3 A;  4FHT A;  2F5E A;  3R60 A;  4Q5S F;  5GAD J;  3LAJ A;  1KYZ A;  3MEX A;  1XB4 A;  4D1Q A;  5J8C A;  1WJA A;  4PGG A;  4BYY A;  1P7J A;  1PVE A;  2E5N A;  5D4R A;  5FKM A;  1B72 A;  2DMT A;  1T56 A;  3HOW J;  2DTZ A;  2FQ4 A;  1D0X A;  1QZY A;  3Q9S A;  2RQQ A;  3IH2 A;  1IV8 A;  1JE8 A;  4HBL A;  1MIJ A;  4N9I A;  4A3G J;  2XUB A;  2E5Z A;  3SEQ A;  3BQY A;  5JVG F;  2OQG A;  4GDF A;  3KFW X;  2XF5 A;  2L9V A;  2CSO A;  1X3Z B;  3M7G A;  3JSO A;  4KDP A;  2HDW A;  4NHJ A;  1Z9C A;  4F52 A;  1I5Z A;  2XAG A;  1HKQ A;  1LQ1 A;  4IQ4 A;  4KIF A;  2X9D A;  5J40 A;  2IPQ X;  1G3T A;  4YIF A;  2EQR A;  2Z3Y A;  4A3C J;  4XIC A;  1JKO C;  3N97 A;  3FXO A;  3LSR A;  2LKX A;  4XLH A;  2JT1 A;  1GVD A;  3OSG A;  2XB5 A;  3C1D A;  2FD5 A;  3VDX A;  2WAD A;  1I39 A;  1Z6R A;  5GTI C;  3WTY C;  3ZMU A;  3K4M A;  2CQQ A;  1IXS B;  2HXO A;  5HLH A;  1BI1 A;  2JA2 A;  3CUO A;  3E1S A;  1U2W A;  2ELH A;  1W36 C;  3Q0W A;  3KX2 A;  3HG9 A;  5E3M A;  3DLL F;  1LJ9 A;  4G94 A;  1YHQ I;  1ZRD A;  3O2P E;  2K7L A;  1WH5 A;  2DCE A;  2MFZ A;  2MC4 A;  5KHD A;  1KGS A;  1EKE A;  2LMD A;  3BR2 A;  3CP2 A;  4A6D A;  4KMF A;  3JTG A;  2DMN A;  1ZRC A;  1ZG3 A;  1T0F A;  1P4X A;  2KL4 A;  1FC3 A;  2RAE A;  3DBR B;  2FXA A;  2ZXJ A;  3OYH A;  4B43 A;  1RR7 A;  3GUD A;  2R7U A;  1X1B A;  2E1O A;  3K70 D;  4XN0 A;  5EEG A;  2YPR A;  3ZQH A;  2DT6 A;  2CQX A;  2QKL B;  3M8J A;  1R1T A;  1WVR A;  3IH3 A;  1D1C A;  3BLY A;  1WSU A;  2HNH A;  2XSJ C;  5HS7 A;  3OYG A;  4XID A;  1ETW A;  2DJN A;  3J7Y J;  1GVJ A;  4IF4 A;  1MBG A;  4RB1 A;  1TWA J;  2VKV A;  3QPH A;  4M3G A;  5JVT A;  2K9S A;  1BW5 A;  4EV0 A;  3BCB A;  3JW4 A;  3HEF A;  3RKQ A;  2KZV A;  2NVT J;  2DQR A;  3CZ6 A;  1RIO H;  4OAY A;  3TMO A;  4DIQ A;  1Z67 A;  3K7A J;  4HF2 A;  5EYR A;  3BZK A;  1JUM A;  2X6Y A;  1VQO I;  1ZQ3 P;  3GX4 X;  1VZ0 A;  4A5M A;  4CO8 A;  4KT6 A;  4CSW A;  1XD7 A;  3ABK H;  3E6D A;  2EZH A;  3O8G A;  4RB3 C;  2P7V B;  1O57 A;  1YE9 A;  3QPS A;  5ICF A;  3SHF A;  4CZC A;  2EIJ H;  4S05 A;  1K79 A;  5E1W A;  1VQN I;  2LFB A;  1I27 A;  2FNA A;  4DBR A;  1PP8 F;  1FP1 D;  1RUO A;  5LFA A;  1R22 A;  4MLO A;  1BI2 A;  4BJ6 C;  5M5Y J;  2GAU A;  3KLN A;  4UY8 I;  5FFZ A;  3GCM A;  3AG4 H;  4BJT A;  2DDB A;  2JA8 J;  1GXP A;  4U0W A;  1ZTR A;  4XL9 A;  4YEJ A;  4XM3 A;  5F0C A;  3IRQ A;  3LSK A;  4W97 A;  1BR1 A;  2Z2S B;  3PM1 A;  1R49 A;  1WZ2 A;  4DNC A;  2A6E F;  2MLK A;  3ASN H;  1FBU A;  4NQW B;  2Q8K A;  4I01 A;  3TO7 A;  1Z91 A;  5JFR A;  3WTS C;  1OMI A;  5GAG J;  2VJ5 A;  3A4C A;  1KU9 A;  3ZR8 X;  1U78 A;  4A0Z A;  2R7W A;  4L0Y B;  4GXO A;  1X1D A;  4EJT A;  4A93 J;  1IDY A;  2PFB A;  4XNF A;  3EYI A;  3FMQ A;  1BR4 A;  1NG6 A;  1X19 A;  3HL2 A;  4MFE A;  5IT9 Z;  2CUE A;  2JVH A;  1QO0 D;  5BPD A;  2Z33 A;  5L3B A;  4FTH A;  3I53 A;  2LY9 A;  2HDC A;  4C3I J;  3HZJ A;  4ENN A;  1JGS A;  1SVL A;  4C3H J;  3ZPL A;  1TQP A;  3H92 A;  3FMR A;  4RGX A;  4IHT A;  4E7Z A;  5LBQ A;  2STW A;  3P7N A;  1WJB A;  1B9N A;  1ORK A;  2QQ8 A;  2W24 A;  1SC7 A;  2O8X A;  1I3Q J;  1X3W B;  2F5F A;  4EJU A;  4HQM A;  2Y69 H;  4MFD A;  3ROU A;  2M8E A;  2C6Y A;  5AIP A;  4KNY A;  4E7L A;  3TGN A;  2J5O A;  1V5G A;  3DXJ F;  2RNJ A;  3GLX A;  2HPI A;  1MZB A;  2HR3 A;  4XKC A;  3SDB A;  4A0Y A;  4AUX A;  3CME I;  4KUM A;  1B6A A;  2L9R A;  4YRV A;  3LSG A;  2X6W A;  3JRE A;  3CJN A;  1EJ9 A;  3E5Q A;  5L3F A;  2PLY A;  1B8I B;  1KQ9 A;  1JKP C;  3WTV C;  2L7M P;  2DA5 A;  2HYG D;  3F72 A;  1WI9 A;  3RPU D;  4B8X A;  2K9M A;  3E6C C;  2X85 A;  3CCQ I;  3HUG A;  3DKX A;  3QP6 A;  2LBF A;  3RZO J;  2R5Y B;  4HQE A;  1KA8 A;  1DPR A;  4PJJ A;  2R4G A;  2M5W A;  2CQ7 A;  2CV0 A;  2F48 A;  2VPL A;  1J9I A;  4BDY A;  3IL2 A;  2DMU A;  1BJA A;  2DOF A;  4CGZ A;  1TWH J;  1UG2 A;  3F9K A;  1H9G A;  2HYF A;  4WXC A;  5DEQ A;  1NK3 P;  4RDU A;  2PJR A;  3TP0 A;  3HDD A;  2K9N A;  3S1M J;  3H1C A;  1H9T A;  3PFI A;  3VYU B;  4XOR A;  4X6A J;  1N77 A;  4Y13 A;  3N05 A;  1EH6 A;  1LEA A;  2ELJ A;  5KAI C;  3FX3 A;  4XON A;  4D5F A;  4AIJ A;  3ABM H;  3QOP A;  4WXD A;  5EJC A;  5E3L A;  2KFD A;  1TWC J;  2KRC A;  1HOM A;  1TTY A;  1JUP A;  2LKP A;  2V79 A;  2PMZ A;  2O6G E;  4ZDO A;  4XK4 A;  3K1M A;  1OQY A;  1UB9 A;  2DW4 A;  3A0H C;  5HNH A;  1ZG5 A;  3K4B A;  2YX4 A;  3V42 A;  1IN4 A;  3WOD F;  5HDN A;  1DUX C;  2Z5U A;  5EG0 B;  3Q0U A;  2IBD A;  2CW7 A;  3I4P A;  1T33 A;  2Y0S A;  4YFK F;  1YFH A;  2RDP A;  2M7A A;  3BG9 A;  2LG4 A;  1OCZ H;  1OR7 C;  1LDD A;  1FEX A;  1V4R A;  2CMP A;  4HV6 A;  2EFW A;  2HDD A;  1ETQ A;  5C4X J;  3IAM 2;  4JK1 X;  2R5Z B;  1LDK B;  5LRS A;  3GFI A;  1OJL A;  2PMU A;  2MYS A;  4CDG A;  2ZXI A;  1YJN I;  5JI6 A;  3CLQ A;  3HOY J;  3TDU C;  3KE2 A;  3PNY A;  1XCB A;  2YU3 A;  1V5E A;  3L2C A;  1GUU A;  1MMA A;  3QYF A;  4S04 A;  4LK1 F;  2Y0S N;  5ED4 A;  4B09 A;  1BI0 A;  3WTT C;  4Y7N J;  3K4L A;  3U1D A;  1U5T C;  3CCM I;  2UUZ A;  1UHM A;  3WU0 A;  5GP9 A;  5ILV A;  2D5V A;  4KMU X;  3S8P A;  3OIP A;  1I1S A;  5IP7 J;  2VI6 A;  4ESJ A;  3L00 A;  1DQU A;  3M4O J;  2JWT A;  4AM3 A;  2BYV E;  3WG9 A;  4FT8 A;  2DPD A;  3RSN A;  4PFP A;  3V4G A;  5F1J A;  1PUF A;  4JOM A;  4TV7 A;  2IAI A;  5ERI A;  5FKO A;  1MSE C;  2VBY A;  1AKH B;  3FXU A;  4LFU A;  4XMY A;  4WK8 F;  2DFE A;  1K61 A;  3D5L A;  4XRF A;  4B1R A;  2DK5 A;  2EZI A;  1EH7 A;  4U87 A;  3OYC A;  3OYE A;  1B59 A;  2QQ9 A;  1APL C;  4M9Z A;  2CV2 A;  2XDV A;  4A69 C;  1XX5 A;  1XPX A;  3HM5 A;  1IZ1 A;  1FTT A;  3EET A;  2ZBK A;  5D8L B;  1FX7 A;  3MMY B;  3ZQC A;  1YYV A;  4IX7 A;  3MVP A;  2MC3 A;  3LFU A;  2A61 A;  3ZQI A;  2JPB A;  2XPU A;  5DTD A;  2CW0 F;  2HKX A;  2K4B A;  2HOS A;  1YJ9 I;  1LFP A;  4B48 A;  4UV9 A;  5E17 F;  2XRL A;  2FQ3 A;  3FWE A;  2DA4 A;  2OPT A;  2ZJQ F;  2LY2 A;  1SAN A;  3ISP A;  3IV5 A;  2LYC A;  3QWL A;  1A36 A;  3V8J A;  4RGS A;  1QQI A;  2EH3 A;  4XKB A;  1ZLK A;  4KN7 X;  4RAZ A;  4XRS G;  3S16 J;  2BOL A;  2BHY A;  1OFC X;  2M34 A;  2GXG A;  3A01 B;  4IVN A;  2L5Q A;  4ZZL A;  2JA7 J;  3FIW A;  2E7X A;  3NWT A;  2FRH A;  5IY5 H;  1HST A;  1Y8R B;  1BOA A;  4C9Y A;  3FM3 A;  1FSH A;  4LK0 F;  1CQT A;  1UFM A;  2BVL A;  3KLO A;  1XMK A;  2RNG A;  3TO6 A;  1E2X A;  4V19 K;  3PQJ A;  3T5X A;  2G0E A;  3A2K A;  3ZOB A;  1HKS A;  1XSX A;  1IRZ A;  2CU7 A;  4E70 A;  5L3E A;  1FYL A;  1O3R A;  3R0J A;  4QTR A;  2ESH A;  4G7Z F;  4ZJZ A;  3WTU C;  4GO1 A;  1HCR A;  1IO2 A;  4RB0 A;  3KZI C;  3OYL A;  1E0E A;  5JLW A;  1FYM A;  2ZME A;  2P6S A;  2OAZ A;  3MKW B;  1ZGJ A;  2P5V A;  2RGV A;  5FRM A;  2FOK A;  4BAC A;  3T1B A;  2L7F P;  2E1M B;  2VQG A;  1ETX A;  2L01 A;  3FKJ A;  2VOP A;  2RQP A;  2I10 A;  5K5O A;  4M9S A;  4A2U A;  4FX0 A;  2QVO A;  3S32 A;  4KYW A;  1A6I A;  1Y0U A;  3KEO A;  1QZZ A;  2W57 A;  5HNF A;  2FMY A;  2V1D A;  2WV0 A;  1NG7 A;  2JA6 J;  1XGN A;  2DAO A;  4WX9 A;  3FHN A;  5EZG A;  4D0P A;  3IWZ A;  3FXL A;  4XR6 A;  4UUV A;  1Z05 A;  4GGG A;  1HW2 A;  1IN5 A;  3OS1 A;  1RKW A;  4KIC A;  1D0Z A;  4MNU A;  2ZKZ A;  2BY1 A;  2CQN A;  1MKM A;  2VL8 A;  2Y0M A;  2HQ5 A;  1BC8 C;  3BY6 A;  2R92 J;  3VSL A;  3FDY A;  4FX4 A;  1QNT A;  1QHH D;  2L2O A;  1KQ0 A;  3G1M A;  4A3L J;  3SYT A;  3GTK J;  2XB0 X;  4A3M J;  4AVP A;  1FLI A;  4XOT A;  1G8X A;  5BS6 A;  1FJL A;  2CUJ A;  3DQV C;  3E6B A;  2ME6 A;  5FLX K;  3PUF A;  5D6F A;  1STZ A;  2YX7 A;  4ABZ A;  1BIB A;  2D2W A;  5M3F J;  3H5N A;  1NK2 P;  4IHW A;  1AOY A;  1XTA A;  4HYE A;  2BHZ A;  3PSF A;  2M4K A;  3CLO A;  2P6T A;  4RGU A;  1LVK A;  4KIB A;  5F0F A;  4IXA A;  2HEO A;  2HQA A;  3HJE A;  3WTZ A;  4C2M J;  1UMQ A;  5FO5 A;  1YW7 A;  5CVJ A;  2CH0 A;  2X51 A;  3VYS B;  1WH7 A;  3ZRG A;  3L1P A;  2BBY A;  3HGY A;  2LOO A;  2ZXH A;  5K1Y A;  1G2H A;  3MCZ A;  1HW1 A;  2M30 A;  1LDJ A;  1FPQ A;  2COM A;  3LA3 A;  3AG1 H;  3DKY A;  2E2J J;  4CHU A;  3HOU J;  2FNP A;  3KIO A;  4AC0 A;  4L18 B;  3FK7 A;  3DWL E;  2GOX B;  4N0B A;  1MJ9 A;  1I50 J;  4M71 A;  1ZK8 A;  3DEE A;  2WB1 N;  2OZ6 A;  2IT0 A;  4BHP A;  2EB7 A;  2FF4 A;  1OPC A;  1JUS A;  3I56 I;  4CH7 A;  1LFB A;  1HDD C;  5LGT A;  1R71 A;  3GTL J;  4FE7 A;  2IA0 A;  2KKO A;  3HYI A;  4XKW A;  3B6A A;  3F21 A;  4MO7 A;  5GAH J;  1WPK A;  1WJ5 A;  2GQQ A;  4QWQ A;  2EK5 A;  2XAF A;  3EDP A;  4RAG A;  2CYY A;  4BXU A;  6PAX A;  4LG0 A;  3CCV I;  1TQI A;  2IA2 A;  2O7O A;  2A07 F;  3VFZ A;  1OYW A;  2Q1Z B;  2FJ1 A;  3S2H J;  2KLO A;  2WB1 A;  3B02 A;  3DBH B;  2AHQ A;  1SFO J;  4PK4 A;  2LP0 A;  2STT A;  1K6O A;  2ICW G;  4XSZ F;  3WU1 B;  3F3X A;  3MZ8 A;  1A5J A;  4U88 A;  1G59 A;  2H27 A;  2HOE A;  2IA1 A;  4BEH B;  4IRI A;  3HOZ J;  2D45 A;  3PO3 J;  3ZQF A;  1XCV A;  2GXA A;  4J01 A;  4CXF A;  1ZKG A;  1F36 A;  4RAY A;  1MH3 A;  2Q2E B;  1FYK A;  2IS2 A;  3E6M A;  5B1B H;  2L9S A;  2LBF B;  3TO9 A;  3S3O A;  5DYM A;  1QU3 A;  2JK3 A;  4OIO F;  3CDL A;  1R6R A;  3TBI A;  3KP3 A;  2IJL A;  3GO5 A;  4XBF A;  1J0R A;  2QQB A;  3RIR A;  2LLK A;  4ZYH A;  1J5Y A;  1JKR C;  1Z3Y A;  3WGI A;  2ZSH B;  1MMS A;  5FGM A;  2VBW A;  4ENM A;  2XAQ A;  2DN0 A;  2TDX A;  3AG3 H;  3S14 J;  3LA2 A;  2OUM A;  1TWF J;  5J6X A;  2LRD A;  3NAU A;  4WWC A;  3HXL A;  5CLS A;  3PIO F;  3KP4 A;  1FWZ A;  2PN6 A;  2QQA A;  3CMY A;  3W2W A;  4F91 B;  3J7A Y;  2H6C A;  3BRO A;  4PCQ A;  4E7H A;  5LGU A;  3P9K A;  2Y9Y A;  3WU2 C;  4HLY A;  3EUH C;  1X2N A;  1ON2 A;  3HOS A;  2L4M A;  3G1L A;  5HOO A;  1ULY A;  2K27 A;  2ZC2 A;  2GA2 A;  2X0L A;  1FBS A;  2BV6 A;  2LR8 A;  4BU2 A;  2M4G A;  4M3D A;  2O8K A;  1ONV A;  3F8C A;  2L7K A;  5E79 C;  4I6Z A;  2FEZ A;  5D5V B;  1MNM C;  2E19 A;  3KEY A;  4ITV A;  3BDD A;  3PUB A;  2ZJ2 A;  2F5V A;  4NQW A;  3U9G A;  2VBX A;  5H6Q A;  5BMZ A;  2V1X A;  3KP5 A;  2P5K A;  2DFH A;  2R0Q C;  2KIF A;  1HBX G;  3I59 B;  4IRG A;  2ECB A;  1CGP A;  1QBJ A;  1UG0 A;  2M8G X;  3SZG A;  2E7W A;  3NQO A;  3WHB A;  3C2G A;  4A0X A;  3BR6 A;  5FFX A;  1ZR4 A;  4ON0 A;  3HSE A;  2BVM A;  1HQC A;  4PGH A;  1TL8 A;  1XC5 A;  1JJ6 C;  1HF0 A;  2F4O B;  1JI8 A;  5DDG A;  3COA C;  3V7C A;  1T08 B;  3OOU A;  4M9X A;  2GA1 A;  2OCE A;  3MFK A;  5K7H A;  2QA4 I;  3PSI A;  5BNG A;  2DA3 A;  1SMY F;  1SFK A;  4O3M A;  3GXO A;  1MBK A;  3LSI A;  3F8M A;  2KQR A;  3BTJ A;  1YQA A;  1VQ5 I;  2FBH A;  2G9W A;  2PJR B;  1D1B A;  4BDZ A;  1X1A A;  1XG1 A;  5F0H A;  2UWM A;  1BC7 C;  4L9J A;  4EMS A;  2Z16 A;  1DDN A;  1J2X A;  4NB5 A;  1UHW A;  2Q2E A;  2MG4 A;  1IXR C;  2HQR A;  3BC8 A;  3OYJ A;  1BR2 A;  1YW8 A;  5HS8 A;  3CDH A;  2HQN A;  3RKY A;  3OS2 A;  2ZNY A;  3VSK A;  2ECC A;  3MKL A;  3GTJ J;  1ETO A;  2DBB A;  2BEO A;  2WV1 A;  1K7A A;  1Z0X A;  3FM5 A;  2V1U A;  3QYB A;  4CCO A;  4R8H A;  1S29 A;  3ML6 A;  1IC8 A;  1SFE A;  1SD6 A;  4DYQ A;  2R7Z J;  5E3N A;  3HGG A;  4G6T B;  3IC7 A;  1ZRE A;  2GIZ A;  3BJO A;  3ZMS A;  3GF2 A;  1UJ8 A;  1PP7 U;  1NTC A;  1QGP A;  2KP6 A;  1O3S A;  5BPI A;  2BXY A;  2CW8 A;  2IEK A;  3K6G A;  2QUF A;  4KJZ A;  4L9N A;  4L9V A;  4DQ2 A;  2R7S A;  4XLP F;  4I0B A;  2EV5 A;  3K2Z A;  1V55 H;  2KIM A;  2F4M B;  2Y48 A;  1U5T B;  2V6E A;  2FSW A;  3E5U A;  4BGD A;  2VPR A;  4ZYD A;  2FA5 A;  3DCF A;  1BN5 A;  1E17 A;  5FKK A;  3D5R C;  3HHH A;  4K2E A;  5ILU A;  5E1Z B;  5J4Y A;  2NRA C;  3CP8 A;  3ECH A;  4XLE A;  1ZRF A;  4CCJ A;  3KYC B;  4OIQ F;  5J1Y A;  2G7H A;  1O3T A;  1SVM A;  3K0L A;  4Q47 A;  5H20 A;  1MJB A;  2E1N A;  4M72 A;  2JUG A;  4PJ0 C;  4KN4 X;  3UR3 C;  1NH3 A;  1VQK I;  3PO2 J;  3BJA A;  4GCV A;  3TDZ C;  3E0J B;  2QCO A;  1WKM A;  4A3I J;  1Y56 A;  3H9Q A;  2XAU A;  1VFC A;  5L3G A;  4Q4Z F;  1MMD A;  2VIX A;  4IZZ A;  1J09 A;  4IHV A;  4LJZ F;  3VOE A;  1VI0 A;  5LEJ A;  4ZYA A;  3FXK A;  2P81 A;  1ZYR F;  2EIN H;  2L02 A;  4EVI A;  1XDS A;  5FRN A;  1BJZ A;  3RKX A;  5HDK A;  3L2Q A;  3KCC A;  1D8J A;  5F27 A;  1TW3 A;  3DPU A;  3JAM K;  2YU9 J;  2BXZ A;  1DU6 A;  1G3S A;  1N78 A;  4PFO A;  4DZJ A;  4M73 A;  1IV6 A;  1JHH A;  4XN3 A;  4ZH4 F;  3JRA A;  3GZN B;  2VB6 A;  4C2U A;  2CUZ A;  1J59 A;  2YR2 A;  2CQK A;  3BTC A;  4KIS A;  3TW6 A;  5E18 F;  1HKT A;  2X4H A;  4UB8 C;  1U6G A;  2KIU A;  2JVG A;  5LRR A;  1RZ4 A;  5J1U A;  2IS6 A;  2H8R A;  2GWR A;  9ANT A;  2FX0 A;  1ON1 A;  3VYR B;  1MD0 A;  1MND A;  3PIP F;  3TED A;  4A3J J;  4W1U A;  3CJR B;  2WAQ A;  3S17 J;  3BR5 A;  1TT0 A;  3FMS A;  2XHK A;  1SD4 A;  2MD5 A;  1V3F A;  2VKE A;  3ECO A;  4G12 A;  4ZC3 A;  3H0D A;  2LTP A;  4NC8 A;  5JHU A;  3MWM A;  3BPX A;  4AIH A;  2R7V A;  2HYJ A;  1JHF A;  1KYW A;  2JRT A;  1LPQ A;  3J81 Z;  2CFX A;  1X3U A;  2ZME B;  1JT0 A;  2A5W A;  4XKV A;  2Q0O A;  4FQG A;  1KQ8 A;  5DD4 A;  4N4N B;  3JRH A;  1I3A A;  5GTH C;  1IUY A;  1RUN A;  2AS5 F;  4ASN A;  3G1O A;  2RN7 A;  3B6C A;  3I71 A;  1IN8 A;  3KYL A;  2NS7 A;  3CUQ B;  2QWW A;  5TGT A;  1C0W A;  1Q1V A;  2L3D A;  2NNN A;  2LKS A;  3RYP A;  2GXB A;  1ZR2 A;  1JT6 A;  4A3B J;  1YX3 A;  4YG2 F;  1MNE A;  5F08 A;  3T8T A;  1RKT A;  3QAH A;  2MSY A;  2ZME C;  3BR0 A;  3OIO A;  3DU6 A;  4NDL A;  3HRM A;  3A01 A;  4BJ5 C;  3H3U A;  4CCK A;  2QEX I;  1OCP A;  3LSH A;  4MHG A;  2R5Y A;  2MH9 A;  2E2H J;  2ZB9 A;  4RB2 C;  2FU4 A;  5K5R A;  2VLA A;  3I59 A;  1A6Q A;  4L5J A;  5EDN A;  4L9T A;  3LMM A;  1P7I A;  2KRF A;  2H6B A;  2IW5 A;  3PNV A;  2VN2 A;  1R5G A;  3TQN A;  5F6F A;  3TW7 A;  2BW3 A;  3JSP A;  2R7D A;  3F22 A;  5LEK A;  3P5J A;  3I5U A;  1OYY A;  5B5E C;  3I4M J;  4RA2 A;  3J7A O;  5FKL A;  5AIQ A;  1YLF A;  3DPL C;  4BH9 A;  4ENK A;  3ERE D;  5HLI A;  2P8T A;  1KZH A;  3BOQ A;  3EUH A;  2EA2 A;  4PJL A;  1BL0 A;  2KJB A;  5DV5 A;  2W1O A;  1H89 C;  3N4M A;  1WJD A;  5D8K B;  4UVC A;  4PZJ A;  2XIG A;  3OYF A;  3SFZ A;  3FF5 A;  3GEZ A;  2IS4 A;  4Y15 A;  1SFU A;  2EBI A;  4YII A;  4MEX F;  1TC3 C;  2FBI A;  2VBZ A;  4HW0 A;  4CCN A;  4DOZ A;  4Z6Y A;  4CYC A;  1N75 A;  5EEH A;  2LF8 A;  1R1V A;  4HA8 A;  3KZZ A;  1Y1V J;  3IUO A;  4HDU A;  2VT3 A;  2Y9Z A;  2OC6 A;  4XOP A;  3BG7 A;  3FXJ A;  2EPF A;  2QLZ A;  3MZH A;  5ILS A;  3O3K A;  1GDT A;  1FSE A;  2W7N A;  1BA5 A;  2YS9 A;  3GFM A;  1B9M A;  3DBL B;  2VT2 A;  5CQG A;  2JMW A;  4G6Q A;  4I2O A;  3TKY A;  5LGN A;  3F23 A;  4UV8 A;  3LST A;  2LH9 A;  2XGE A;  3QP5 A;  3R4K A;  3D0S A;  4RS8 A;  1OCR H;  2ESN A;  5FD6 A;  3HB9 A;  4IEJ A;  2IS1 A;  2NYX A;  2KDO A;  3S93 A;  4D7M A;  1ERD A;  3ZXS A;  4M6X A;  2QF7 A;  4FAS D;  5M5X J;  1DGR M;  1WCM J;  3RDI A;  1LB2 A;  3ERM A;  2M7B A;  2XVC A;  1YIT I;  2EWN A;  2HTS A;  1R23 A;  4FIS A;  2HKO A;  3GTP J;  4X1E A;  1P2F A;  3KEQ A;  1BW6 A;  4N4O B;  3BZ6 A;  1RPW A;  4BL0 B;  3M1C A;  1FP2 A;  3O6B B;  1R9T J;  5KCM A;  3FK6 A;  2E60 A;  3BG3 A;  2RC4 A;  4JX5 A;  4UUS A;  2VKH A;  3DTE A;  3IP4 B;  3OOP A;  1RC9 A;  4LD5 A;  2CWE A;  1XDU A;  2XGX A;  1W0U A;  3KPH A;  1FY7 A;  4M3E A;  1MDM A;  2BZT A;  4XRS A;  1FIA A;  2DLL A;  3QU6 A;  1S6L A;  2GOM A;  3MD2 A;  2V26 A;  3GW2 A;  1VQ7 I;  4LLN A;  3HUG B;  5HLG A;  3KP6 A;  4UB6 C;  4RM2 A;  2K3P A;  4E7J A;  1TLH B;  3RYR A;  1UAA A;  3X2Q H;  2R7F A;  1RRJ A;  3HBL A;  2R7X A;  2A69 F;  3BG6 A;  3DTI A;  3OYN A;  3CC2 I;  5JHF A;  4U7B A;  2ELK A;  5ICE A;  1ETK A;  2ZFW A;  2XF7 A;  4B3A A;  2NAZ A;  4BS9 A;  4X0G A;  4G9Y A;  5J4V A;  3WGG A;  2BE5 F;  4E7I A;  2K85 A;  3BJ6 A;  3V7R A;  2QM3 A;  2DOD A;  3F6O A;  2UV1 A;  4P1W A;  2FML A;  1O4X A;  1WJC A;  1AWC A;  4ZZD A;  1FIP A;  3CCU I;  2CO5 A;  3QQA A;  5EEA A;  1IAW A;  4G7O F;  1IRF A;  1E3P A;  3MAJ A;  2NVX J;  1SD5 A;  5L3D A;  2NNY A;  4WXH A;  2XF6 A;  2JTV A;  2M3A A;  4AU7 A;  4A3F J;  2HFH A;  2UXN A;  1G3Y A;  3ULQ B;  1SEU A;  3CCS I;  3ABT A;  1F4K A;  2E2I J;  2R7O A;  3LSP A;  3HRU A;  2R3S A;  1R36 A;  2RKH A;  3K1N A;  3S1R J;  3CMM A;  5BQT A;  1VND A;  2DOE A;  3KP2 A;  4A3K J;  2PJP A;  5AON A;  3FIS A;  4BQO A;  4FCY A;  1R1U A;  3RQI A;  2V4J C;  5TJJ A;  3MKY B;  1YG2 A;  4Y4R A;  4JBA A;  3EYY A;  4HZF A;  2BW3 B;  4LLG F;  2ISY A;  1VQ8 I;  3U1K A;  4I02 A;  2NXN B;  4ETS A;  5IT9 K;  3U21 A;  2IVM A;  3HTS B;  1P92 A;  1TNS A;  2WY8 Q;  3M3Y J;  5F04 A;  3E7L A;  3E97 A;  3ABU A;  2J5P A;  5HVQ C;  1A35 A;  1LKX A;  3CO7 C;  2LSO A;  2Z9O A;  2WC2 A;  3H5A A;  2H94 A;  1Z3X A;  3LFK A;  2V9V A;  2V9P A;  4OIR F;  4YFX F;  5DCM A;  4Q48 A;  3WE3 A;  4ANJ A;  5DS9 A;  1I1G A;  1PDN C;  4HX4 A;  3I4N J;  2IGO A;  3F8N A;  4BY7 J;  5EG0 A;  3ZQL A;  1MBH A;  1MW7 A;  1H8A C;  2E71 A;  2K5C A;  4LG3 A;  1IN6 A;  3R0A A;  1ZLJ A;  4UNO A;  2K4J A;  2E1M C;  4AWX B;  3IKT A;  1IF1 A;  4PSW A;  3HOT A;  4V2G A;  1D8K A;  3A03 A;  1R5H A;  2EJR A;  1MJA A;  2QEN A;  3CJQ B;  3CCE I;  4LOC A;  3ESW B;  1SAX A;  2QKM B;  1QVU A;  3JAM Z;  1T39 A;  5LD2 C;  3SDG A;  3S3N A;  1W4M A;  1X1P A;  1K6Y A;  4EM2 A;  1KU7 A;  4RBO A;  4KT5 C;  2LNB A;  4UUT A;  2Y31 A;  3GBG A;  3M8F A;  1FBQ A;  4UUS B;  1OYI A;  1CF7 B;  3QOD A;  1F43 A;  2DT5 A;  5F1R A;  3L9F A;  3OIQ A;  2MH2 A;  4JX4 A;  2JN6 A;  3HC7 A;  3LQR A;  1E3H A;  4ZYE A;  2MBF A;  3OYM A;  2EZL A;  4XRM A;  2JSP A;  3JCU C;  1YIJ I;  1VQ6 I;  1RR8 C;  1L3L A;  5A2Q K;  1E3O C;  3W6K B;  4BE0 A;  3BR3 A;  5GPA A;  2QBY A;  1DGW Y;  1D5Y A;  4AYB A;  4MQV A;  4YIR X;  2X6X A;  1ZGA A;  3MZY A;  3BZC A;  5CVI A;  1AA7 A;  2CRG A;  1R58 A;  3HSF A;  2VQC A;  3JTH A;  3C7J A;  2K9Q A;  5TRD A;  5J47 A;  2M45 A;  4ZYG A;  4LMY A;  2M0C A;  2EV6 A;  1ACI A;  1Z21 A;  2OV7 A;  4YFN F;  3J80 K;  3U2R A;  1IGN A;  1MBF A;  2DU9 A;  4OAZ A;  1YX5 A;  4MQ9 F;  3HTU A;  1UHS A;  4M6V A;  3DTK A;  4CYC B;  1FNN A;  4A5N A;  2A6T A;  2NVQ J;  2H1K A;  1FMW A;  1O7L A;  2JSC A;  3E3V A;  1D1A A;  2MD0 A;  2KIS A;  3CJT B;  3OYK A;  4HLX A;  4KFC A;  4DGW B;  2R7Q A;  3QPL A;  2VQH A;  3SEZ A;  1W0T A;  2PBI A;  1S72 I;  1LFU P;  3K69 A;  2K86 A;  4M3B A;  3FXR A;  2ETH A;  3F8B A;  1RNL A;  3CF5 F;  4L5I A;  5K7F A;  3DEW A;  3W6V A;  2RV8 A;  5ICC A;  5H6R A;  2V9K A;  2FUG 2;  2HXI A;  1WQ2 A;  1LVA A;  2WA0 A;  1HA8 A;  2G7U A;  1YJW I;  1T6S A;  4HV5 A;  4LIV A;  3NRV A;  4Y52 J;  3Q5F A;  3WTW C;  4IOC F;  2W4S A;  3L2V A;  5GPC A;  3JRD A;  3L7W A;  4HNU A;  3BTI A;  5LHG A;  1WRJ A;  4FET A;  4YEL A;  4QLC U;  3BR1 A;  3ONQ A;  3CQZ J;  1XGM A;  3OR1 C;  3I64 A;  4F93 B;  3C2B A;  1U8B A;  1JTY A;  2EFO A;  4DZP A;  3S3M A;  1OCO H;  2Y75 A;  3VEP A;  5B66 C;  3IWF A;  1Y39 A;  4KIG A;  2DA7 A;  4UVB A;  5FJ8 J;  3QRF F;  5EF6 A;  4G8X A;  2Y30 A;  3T0Y A;  1IDZ A;  4IQJ A;  2QSF X;  1W7P D;  4JYK A;  3CMA I;  1FT9 A;  2D1H A;  3CUQ A;  3K9T A;  3OYD A;  1MSF C;  3AL0 B;  1BBY A;  3HIF A;  4RLF A;  3ZMZ A;  5J3L A;  1DU0 A;  4RLQ A;  4AVZ A;  3C3W A;  2KPM A;  3L2W A;  2E1C A;  2I8D A;  3S15 J;  2VQL A;  1X4P A;  5D5W B;  3HRS A;  4O6J A;  2A68 F;  3HPH A;  2HS5 A;  5LHI A;  2K40 A;  4HEA 2;  4HOB A;  3GWZ A;  5EGO A;  2QSG X;  3LQQ A;  1XSD A;  3RPU A;  3JRC A;  4XLN F;  2WAF A;  2MW8 A;  3H0G J;  3GTO J;  1MH4 A;  2KHM A;  2ZSI B;  5HDG A;  5HLT A;  1R5I D;  1IXC A;  2KJC A;  5J8F A;  4E4H A;  2VOO A;  1J7K A;  4GYI A;  3L09 A;  2HVR A;  3BG5 A;  1USS A;  3L2R A;  3QPT A;  3EUK L;  5E8G A;  4BE1 A;  3D5S C;  2DPU A;  3NAR A;  4Y33 A;  1S5L C;  2OD5 A;  4QPO A;  3H5R A;  3OMY A;  1CF7 A;  1LEB A;  1UEL B;  2CUF A;  4XLC A;  5K5Q A;  1LUJ B;  3HOX J; 
#chains in the Genus database with same CATH homology
 2CGP A;  2XAS A;  2M1B A;  4LG0 B;  4HF0 A;  4JQF A;  1F9N A;  2VOD A;  3BP8 A;  1NHA A;  3AAF A;  3Q9V A;  5HS9 A;  4OMZ A;  2EFQ A;  3ZP5 A;  3VOD A;  2EFN A;  1S7O A;  3RTR A;  2GZW A;  1P4A A;  1O7F A;  1KU2 A;  3FZV A;  2XKO A;  3EQL F;  4ENJ A;  5E20 A;  2W25 A;  2L4A A;  1S3J A;  4EJV A;  4MTD A;  3ZMT A;  2DFI A;  2CG4 A;  1U8R A;  3SXY A;  1G3W A;  4R79 A;  1Q1H A;  2XRO A;  2IP2 A;  4N9H A;  4CYD A;  5CVU A;  3HHG A;  1SFX A;  4CIC A;  1OKR A;  1ZHF A;  1U5T A;  4Z2Y A;  2ISZ A;  3ZN1 A;  2P7C B;  1W7P A;  3FXQ A;  4IJA A;  1XGO A;  2Z99 A;  4GYG A;  1DPU A;  5CVR A;  2A6H F;  5A2Q Z;  2VXZ A;  1ZN2 A;  5DCF A;  5L3C A;  3P9I A;  2HZT A;  3GFL A;  3I54 A;  4P9U A;  1R7J A;  2HGC A;  1VTN C;  3I58 A;  2VC0 A;  4EGZ A;  3KZY A;  2P5L C;  2F2E A;  4KA4 A;  3MQ0 A;  3NEU A;  3H3Z A;  3GYH X;  4G6D A;  1HW5 A;  4P96 A;  2PI0 A;  2HTJ A;  2HWV A;  3WTX C;  4G7H F;  3SZT A;  1IN7 A;  5E1X A;  3ELK A;  4RGR A;  3CO6 C;  3RKW A;  1DP7 P;  5CYV A;  3KP7 A;  4LGW A;  1B1B A;  3RJP A;  2EV0 A;  4MGR A;  2UZK A;  4WCG A;  1LNW A;  1F1Z A;  1J75 A;  3T8R A;  4EQQ A;  3VB2 A;  1BI3 A;  3W6J B;  1JXS A;  4P55 A;  2FE3 A;  1A04 A;  2W84 A;  4IRH A;  5KVR A;  3DF8 A;  4IHS A;  1TNT A;  3SZP A;  3J80 Z;  1I6X A;  2ADU A;  3K1P A;  4O5V A;  4BAY A;  1D5V A;  4BHB A;  3IKV A;  1YO5 C;  2VE8 A;  3S2W A;  1K78 A;  2W85 A;  4WF2 A;  2QBY B;  3DKW A;  2JZY A;  3DPT A;  2OZU A;  2LDU A;  3IRR A;  3LA7 A;  4P5O A;  2PQ8 A;  4CZZ A;  3J81 K;  4LB5 A;  2B0L A;  3WGH A;  3QU3 A;  1HXD A;  1P6R A;  1XMA A;  2F5C A;  1P4W A;  4EJO A;  2JPC A;  2ZNZ A;  2EFP A;  5DUI A;  4OIN F;  4EM1 A;  4Y17 A;  3R6S A;  4OU0 A;  3WE2 A;  4I0A A;  4ESF A;  2OA4 A;  1W5S A;  5D4S A;  3DV8 A;  1G4D A;  2OQR A;  5BOX A;  1XSV A;  1EH8 A;  1SMT A;  3F6V A;  4R1H A;  5D6E A;  3ZMV A;  5DD8 A;  2IRF G;  1SD7 A;  1G6N A;  3V8K A;  4H0E A;  1EV7 A;  1L0O C;  1Z1D A;  3G3Z A;  5F64 A;  1BM9 A;  1MGT A;  3ZQ7 A;  4BNC A;  1YS6 A;  3I0T A;  4BHC A;  4F7Z A;  2EA4 A;  3BWG A;  1FZP B;  3LWF A;  2O03 A;  1W7P B;  2OBP A;  3C18 A;  3M9A A;  1ZAO A;  3ZMD A;  2P4W A;  5KK1 A;  4AD9 A;  3PQK A;  2ZCW A;  4OOI A;  5LLQ A;  2XAJ A;  3ZN0 A;  5DUK A;  3M8E A;  1FOK A;  1YTY A;  4LLL A;  2VE9 A;  3LAP A;  1Z7U A;  3SQN A;  2A3S A;  5FD5 A;  1IW7 F;  1GHC A;  3R61 A;  1IRG A;  2PMH A;  1UCR A;  1XGS A;  5CJ9 A;  1RI7 A;  2BGC A;  3V7S A;  1D3Y A;  1ODD A;  2H09 A;  2PG4 A;  1TQM A;  1BIA A;  1S7A A;  2L54 A;  3REO A;  5FLX Z;  4M6Y A;  1MDM B;  1GXQ A;  2FBK A;  1TBX A;  3P9C A;  4EJW A;  1YS7 A;  1F5T A;  2XV4 S;  1QPM A;  3G73 A;  4I98 B;  4I09 A;  1KU3 A;  2XKP A;  2M87 A;  1T98 A;  2WWY A;  2GIV A;  1T2K A;  1H0M A;  4M74 A;  3GVA A;  4EM0 B;  4ESB A;  1WWX A;  5DCM B;  1T38 A;  3GZ5 A;  2DO7 A;  2UXX A;  3DP7 A;  1UST A;  3BPV A;  4IPA A;  4LB6 B;  2YSR A;  4OMY A;  1R00 A;  2MLG A;  1U3E M;  1K78 B;  1OR7 A;  3F8F A;  5ICG A;  4U0V A;  2MA3 A;  2WTE A;  1HSJ A;  2OU2 A;  1XN7 A;  3DFG A;  1YW9 A;  2PEX A;  1S8N A;  2DI3 A;  1W5T A;  2D1V A;  3HSR A;  3HRT A;  4A12 A;  4PDK A;  1ZAR A;  3M1E A;  4U7D A;  2DK8 A;  1ZG1 A;  3RPQ A;  3KET A;  4BQA A;  2QYO A;  2V6C A;  4HAM A;  3CTA A;  3V8L A;  3IHU A;  2VON A;  3FHZ A;  2ZO4 A;  4HX8 A;  4A6E A;  4UXN A;  2DTR A;  3B73 A;  1Z6T A;  3GZ6 A;  4P9F A;  1REP C;  4HF1 A;  4OIP F;  1YIO A;  4I7H A;  4XSX F;  2F5D A;  2O61 A;  2NS0 A;  3CUQ C;  2DQL A;  3E5X A;  4EGY A;  3GFJ A;  1TW2 A;  3OV8 A;  3RI4 A;  2A5Y B;  2O3F A;  5D5X B;  3DEU A;  4MTE A;  2AXL A;  4HX7 A;  1PUE E;  4HDV A;  4UVA A;  5IT3 A;  5D5U B;  2K02 A;  2ACJ A;  2XAH A;  1ZH5 A;  2LF7 A;  5E8I A;  4L0Z B;  2O0Y A;  1B4A A;  1O3Q A;  5LHH A;  5CVV A;  4AIK A;  2QZ8 A;  2XRN A;  4UHT A;  3TOB A;  5FB2 A;  4U0Y A;  3TOA A;  2VC1 A;  2RVC A;  4MEY F;  5JR3 A;  4FHT A;  2F5E A;  3R60 A;  4Q5S F;  3LAJ A;  1KYZ A;  3MEX A;  1XB4 A;  5J8C A;  4PGG A;  4BYY A;  5D4R A;  1QZY A;  3Q9S A;  1JE8 A;  4HBL A;  4N9I A;  2XUB A;  2OQG A;  3KFW X;  2CSO A;  3JSO A;  3M7G A;  4KDP A;  4NHJ A;  1Z9C A;  1I5Z A;  2XAG A;  1HKQ A;  1LQ1 A;  4KIF A;  2IPQ X;  1G3T A;  4YIF A;  2Z3Y A;  3N97 A;  2JT1 A;  3C1D A;  1Z6R A;  3WTY C;  3ZMU A;  5HLH A;  1IXS B;  1BI1 A;  3CUO A;  1U2W A;  2ELH A;  1LJ9 A;  4G94 A;  1ZRD A;  3O2P E;  2K7L A;  1KGS A;  4KMF A;  4A6D A;  3JTG A;  1ZRC A;  1ZG3 A;  1T0F A;  1P4X A;  1FC3 A;  2FXA A;  2ZXJ A;  3GUD A;  5EEG A;  2YPR A;  1R1T A;  1WSU A;  5HS7 A;  1GVJ A;  4IF4 A;  4RB1 A;  3QPH A;  5JVT A;  4EV0 A;  3JW4 A;  2DQR A;  1RIO H;  4HF2 A;  3GX4 X;  4A5M A;  4CO8 A;  1XD7 A;  3E6D A;  4RB3 C;  2P7V B;  1O57 A;  5ICF A;  3SHF A;  4S05 A;  1K79 A;  5E1W A;  1I27 A;  2FNA A;  1PP8 F;  1FP1 D;  1RUO A;  1R22 A;  1BI2 A;  2GAU A;  3KLN A;  5FFZ A;  1GXP A;  4U0W A;  3IRQ A;  4DNC A;  2A6E F;  2MLK A;  3TO7 A;  1FBU A;  2Q8K A;  4I01 A;  1Z91 A;  5JFR A;  3WTS C;  1OMI A;  1KU9 A;  1U78 A;  4A0Z A;  4L0Y B;  4GXO A;  4EJT A;  2PFB A;  3EYI A;  3FMQ A;  5IT9 Z;  1QO0 D;  5BPD A;  2Z33 A;  5L3B A;  3I53 A;  2HDC A;  4ENN A;  1JGS A;  3ZPL A;  1TQP A;  3H92 A;  3FMR A;  4RGX A;  4IHT A;  5LBQ A;  2STW A;  3P7N A;  1B9N A;  2W24 A;  2O8X A;  2F5F A;  4EJU A;  4HQM A;  3ROU A;  2M8E A;  2C6Y A;  5AIP A;  4KNY A;  3TGN A;  2J5O A;  3DXJ F;  2RNJ A;  3GLX A;  1MZB A;  2HR3 A;  4A0Y A;  4KUM A;  1B6A A;  3CJN A;  3E5Q A;  5L3F A;  2PLY A;  1KQ9 A;  3WTV C;  2HYG D;  3F72 A;  1WI9 A;  4B8X A;  3E6C C;  3HUG A;  3QP6 A;  4HQE A;  1KA8 A;  1DPR A;  2M5W A;  1J9I A;  3IL2 A;  1BJA A;  4CGZ A;  1H9G A;  2HYF A;  4WXC A;  5DEQ A;  1H9T A;  3PFI A;  4Y13 A;  1EH6 A;  1LEA A;  3FX3 A;  4AIJ A;  3QOP A;  4WXD A;  1TTY A;  2LKP A;  2V79 A;  2O6G E;  3K1M A;  1UB9 A;  2DW4 A;  1ZG5 A;  2YX4 A;  1IN4 A;  3WOD F;  5HDN A;  1DUX C;  2Z5U A;  3I4P A;  4YFK F;  1YFH A;  2RDP A;  1LDD A;  1V4R A;  2EFW A;  4HV6 A;  4JK1 X;  1LDK B;  5LRS A;  3GFI A;  2PMU A;  4CDG A;  5JI6 A;  3TDU C;  3KE2 A;  1XCB A;  2YU3 A;  3L2C A;  4S04 A;  4LK1 F;  5ED4 A;  4B09 A;  1BI0 A;  3WTT C;  3U1D A;  1U5T C;  1UHM A;  3WU0 A;  5ILV A;  4KMU X;  1I1S A;  4ESJ A;  3L00 A;  2BYV E;  3WG9 A;  4FT8 A;  2DPD A;  3V4G A;  4TV7 A;  5ERI A;  2VBY A;  3FXU A;  4LFU A;  4WK8 F;  3D5L A;  4XRF A;  2DK5 A;  1EH7 A;  1B59 A;  2QQ9 A;  4M9Z A;  1IZ1 A;  3EET A;  2ZBK A;  5D8L B;  1FX7 A;  1YYV A;  2MC3 A;  2A61 A;  2JPB A;  2CW0 F;  2HKX A;  2K4B A;  4UV9 A;  5E17 F;  2FQ3 A;  3FWE A;  3ISP A;  3V8J A;  4RGS A;  1QQI A;  1ZLK A;  4KN7 X;  4RAZ A;  2GXG A;  4IVN A;  4ZZL A;  2E7X A;  2FRH A;  1HST A;  1BOA A;  3FM3 A;  1FSH A;  4LK0 F;  1UFM A;  3KLO A;  1XMK A;  3TO6 A;  1E2X A;  3PQJ A;  3T5X A;  1HKS A;  1XSX A;  4E70 A;  5L3E A;  1FYL A;  1O3R A;  3R0J A;  2ESH A;  4G7Z F;  3WTU C;  4GO1 A;  4RB0 A;  1FYM A;  2ZME A;  2P6S A;  2OAZ A;  1ZGJ A;  2P5V A;  2RGV A;  2FOK A;  3T1B A;  2L01 A;  2VOP A;  2RQP A;  5K5O A;  4M9S A;  4A2U A;  4FX0 A;  2QVO A;  4KYW A;  1Y0U A;  3KEO A;  1QZZ A;  2W57 A;  2FMY A;  2V1D A;  2WV0 A;  1XGN A;  2DAO A;  4WX9 A;  4D0P A;  3IWZ A;  4UUV A;  1Z05 A;  4GGG A;  1HW2 A;  1IN5 A;  4KIC A;  4MNU A;  2ZKZ A;  1MKM A;  2Y0M A;  1BC8 C;  3BY6 A;  4FX4 A;  1QNT A;  1KQ0 A;  4AVP A;  1FLI A;  5BS6 A;  3DQV C;  3E6B A;  5FLX K;  5D6F A;  1STZ A;  2YX7 A;  1BIB A;  2D2W A;  1AOY A;  4HYE A;  3CLO A;  2P6T A;  4RGU A;  2HEO A;  4KIB A;  4IXA A;  3WTZ A;  5FO5 A;  1YW7 A;  5CVJ A;  2BBY A;  5K1Y A;  3MCZ A;  1HW1 A;  2M30 A;  1LDJ A;  1FPQ A;  2COM A;  3LA3 A;  4CHU A;  2FNP A;  4L18 B;  4N0B A;  1MJ9 A;  4M71 A;  2OZ6 A;  2IT0 A;  4BHP A;  2EB7 A;  2FF4 A;  1OPC A;  5LGT A;  2IA0 A;  2KKO A;  3HYI A;  3F21 A;  2GQQ A;  4QWQ A;  2EK5 A;  2XAF A;  3EDP A;  4BXU A;  2CYY A;  6PAX A;  4LG0 A;  1TQI A;  2IA2 A;  2A07 F;  3VFZ A;  1OYW A;  3B02 A;  2STT A;  1K6O A;  4XSZ F;  3WU1 B;  3F3X A;  4U88 A;  2H27 A;  2HOE A;  2IA1 A;  4IRI A;  2D45 A;  1XCV A;  4CXF A;  4RAY A;  1FYK A;  3E6M A;  3TO9 A;  5DYM A;  4OIO F;  3KP3 A;  2IJL A;  3GO5 A;  4XBF A;  1J0R A;  2QQB A;  3RIR A;  4ZYH A;  1J5Y A;  3WGI A;  5FGM A;  2VBW A;  4ENM A;  2XAQ A;  2TDX A;  3LA2 A;  5J6X A;  4WWC A;  5CLS A;  3KP4 A;  1FWZ A;  2PN6 A;  2QQA A;  2H6C A;  3BRO A;  4PCQ A;  5LGU A;  3P9K A;  4HLY A;  3HOS A;  1ON2 A;  2L4M A;  5HOO A;  1ULY A;  2K27 A;  2GA2 A;  2X0L A;  1FBS A;  2BV6 A;  1ONV A;  3F8C A;  2FEZ A;  5D5V B;  3BDD A;  2ZJ2 A;  4NQW A;  3U9G A;  2VBX A;  5H6Q A;  5BMZ A;  2V1X A;  3KP5 A;  2P5K A;  2KIF A;  1HBX G;  3I59 B;  4IRG A;  1CGP A;  1QBJ A;  2E7W A;  3NQO A;  4A0X A;  5FFX A;  4ON0 A;  3HSE A;  4PGH A;  1HQC A;  5DDG A;  3COA C;  3V7C A;  4M9X A;  2GA1 A;  3MFK A;  1SMY F;  4O3M A;  3GXO A;  3F8M A;  1YQA A;  2FBH A;  2G9W A;  2UWM A;  1BC7 C;  4L9J A;  4EMS A;  1DDN A;  1J2X A;  4NB5 A;  1UHW A;  2Q2E A;  1IXR C;  2HQR A;  1YW8 A;  5HS8 A;  3CDH A;  2HQN A;  3RKY A;  2ZNY A;  2DBB A;  2BEO A;  1K7A A;  3FM5 A;  2V1U A;  4R8H A;  1S29 A;  3ML6 A;  1SFE A;  1SD6 A;  3IC7 A;  1ZRE A;  3BJO A;  3ZMS A;  3GF2 A;  1PP7 U;  1QGP A;  1O3S A;  5BPI A;  4L9N A;  2QUF A;  4L9V A;  4DQ2 A;  4XLP F;  4I0B A;  2EV5 A;  3K2Z A;  2KIM A;  2Y48 A;  1U5T B;  2FSW A;  3E5U A;  4ZYD A;  2FA5 A;  1BN5 A;  1E17 A;  3HHH A;  4K2E A;  5ILU A;  5E1Z B;  2NRA C;  3ECH A;  1ZRF A;  4OIQ F;  2G7H A;  1O3T A;  3K0L A;  4Q47 A;  5H20 A;  2E1N A;  1MJB A;  4M72 A;  4KN4 X;  3BJA A;  4GCV A;  3TDZ C;  1WKM A;  5L3G A;  4Q4Z F;  4LJZ F;  3VOE A;  5LEJ A;  1ZYR F;  2L02 A;  4EVI A;  1XDS A;  3RKX A;  5HDK A;  1D8J A;  3KCC A;  1TW3 A;  3JAM K;  1G3S A;  4M73 A;  1JHH A;  4ZH4 F;  1J59 A;  2YR2 A;  2CQK A;  5E18 F;  1HKT A;  2X4H A;  1U6G A;  2KIU A;  5LRR A;  1RZ4 A;  2GWR A;  1ON1 A;  1MD0 A;  3FMS A;  2XHK A;  1SD4 A;  2MD5 A;  1V3F A;  3ECO A;  5JHU A;  3MWM A;  3BPX A;  4AIH A;  1JHF A;  1KYW A;  2JRT A;  3J81 Z;  2CFX A;  1X3U A;  2ZME B;  2Q0O A;  1KQ8 A;  5DD4 A;  1IUY A;  1RUN A;  2AS5 F;  4ASN A;  2RN7 A;  3I71 A;  1IN8 A;  3CUQ B;  2QWW A;  1C0W A;  2L3D A;  2NNN A;  3RYP A;  2GXB A;  4YG2 F;  3T8T A;  3QAH A;  3HRM A;  3H3U A;  4MHG A;  2MH9 A;  4RB2 C;  2FU4 A;  5K5R A;  3I59 A;  4L5J A;  4L9T A;  2KRF A;  2H6B A;  2IW5 A;  2VN2 A;  1R5G A;  3TQN A;  5F6F A;  3JSP A;  2R7D A;  3F22 A;  5LEK A;  3I5U A;  1OYY A;  3J7A O;  5AIQ A;  1YLF A;  3DPL C;  4BH9 A;  4ENK A;  3ERE D;  5HLI A;  2P8T A;  3BOQ A;  3EUH A;  2EA2 A;  2KJB A;  5DV5 A;  3N4M A;  5D8K B;  4UVC A;  4PZJ A;  2XIG A;  3SFZ A;  3FF5 A;  3GEZ A;  4Y15 A;  1SFU A;  4YII A;  4MEX F;  2FBI A;  2VBZ A;  4HW0 A;  5EEH A;  2LF8 A;  1R1V A;  4HA8 A;  3KZZ A;  4HDU A;  2VT3 A;  2QLZ A;  3MZH A;  5ILS A;  3O3K A;  1FSE A;  3GFM A;  1B9M A;  2VT2 A;  4G6Q A;  4I2O A;  3TKY A;  5LGN A;  3F23 A;  4UV8 A;  3LST A;  3QP5 A;  3R4K A;  3D0S A;  4RS8 A;  5FD6 A;  2ESN A;  2NYX A;  4M6X A;  1LB2 A;  3RDI A;  2XVC A;  2EWN A;  2HTS A;  1R23 A;  2HKO A;  1P2F A;  3KEQ A;  3BZ6 A;  1FP2 A;  3O6B B;  2RC4 A;  3OOP A;  4LD5 A;  2CWE A;  1XDU A;  2XGX A;  1FY7 A;  1MDM A;  2DLL A;  3QU6 A;  1S6L A;  3GW2 A;  4LLN A;  5HLG A;  3KP6 A;  1TLH B;  3RYR A;  2R7F A;  2A69 F;  4U7B A;  5ICE A;  2ZFW A;  2NAZ A;  4G9Y A;  3WGG A;  2BE5 F;  3BJ6 A;  3V7R A;  2QM3 A;  3F6O A;  1AWC A;  2FML A;  4ZZD A;  2CO5 A;  1IAW A;  4G7O F;  1IRF A;  3MAJ A;  1SD5 A;  5L3D A;  2NNY A;  4WXH A;  2JTV A;  2HFH A;  2UXN A;  1G3Y A;  3ULQ B;  3ABT A;  1F4K A;  3HRU A;  2R3S A;  1R36 A;  2RKH A;  3K1N A;  5BQT A;  3KP2 A;  2PJP A;  5AON A;  1R1U A;  5TJJ A;  1YG2 A;  4JBA A;  3EYY A;  4HZF A;  4LLG F;  2ISY A;  4I02 A;  4ETS A;  5IT9 K;  2IVM A;  3HTS B;  1P92 A;  1TNS A;  3E97 A;  3ABU A;  2J5P A;  5HVQ C;  3CO7 C;  2LSO A;  2Z9O A;  2WC2 A;  2H94 A;  3LFK A;  2V9V A;  4OIR F;  4YFX F;  5DCM A;  4Q48 A;  3WE3 A;  1I1G A;  1PDN C;  4HX4 A;  3F8N A;  1IN6 A;  3R0A A;  4UNO A;  1ZLJ A;  2K4J A;  4AWX B;  1IF1 A;  3IKT A;  3HOT A;  1D8K A;  1R5H A;  2EJR A;  2QEN A;  1SAX A;  3JAM Z;  1T39 A;  1W4M A;  4EM2 A;  1KU7 A;  4KT5 C;  2LNB A;  3M8F A;  1FBQ A;  1OYI A;  1CF7 B;  2DT5 A;  5F1R A;  3L9F A;  2MH2 A;  3LQR A;  4ZYE A;  2MBF A;  1L3L A;  5A2Q K;  3W6K B;  2QBY A;  4MQV A;  1ZGA A;  3MZY A;  5CVI A;  1R58 A;  3HSF A;  3JTH A;  3C7J A;  5TRD A;  2M45 A;  4ZYG A;  4LMY A;  2EV6 A;  4YFN F;  3J80 K;  3U2R A;  2DU9 A;  4MQ9 F;  3HTU A;  1FNN A;  4A5N A;  1O7L A;  2JSC A;  3E3V A;  4KFC A;  4HLX A;  2PBI A;  3K69 A;  2K86 A;  3FXR A;  2ETH A;  3F8B A;  1RNL A;  4L5I A;  2RV8 A;  5ICC A;  5H6R A;  1WQ2 A;  1LVA A;  2G7U A;  1T6S A;  4HV5 A;  3NRV A;  3Q5F A;  3WTW C;  3L7W A;  5LHG A;  1WRJ A;  4QLC U;  1XGM A;  3I64 A;  2EFO A;  2Y75 A;  3VEP A;  3IWF A;  4KIG A;  4UVB A;  3QRF F;  4G8X A;  3T0Y A;  1W7P D;  1FT9 A;  2D1H A;  3CUQ A;  3K9T A;  1BBY A;  3HIF A;  3ZMZ A;  3C3W A;  2E1C A;  5D5W B;  3HRS A;  4O6J A;  2A68 F;  2HS5 A;  5LHI A;  4HOB A;  3GWZ A;  3LQQ A;  1XSD A;  3RPU A;  4XLN F;  5HDG A;  1IXC A;  2KJC A;  5J8F A;  2VOO A;  1J7K A;  4GYI A;  3L09 A;  1USS A;  3QPT A;  5E8G A;  2DPU A;  2OD5 A;  1CF7 A;  1LEB A;  5K5Q A;  1MJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...