2FXAA

Structure of the protease production regulatory protein hpr from bacillus subtilis.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
156
Chain Sequence
PPYDVKEALVFTQKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRTYVQLTEEGTEVFWSLLEEFDPTRNAVFKGSQPLYHLFGKFPEVAEMMCMIRHIYGDDFMEIFETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease production regulatory protein hpr
publication title Structure of the Protease Production Regulatory Protein hpr from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 50
structure length 156
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2fxaA00
2BYVE 1RUNA 1QPMA 3HTUA 2VBWA 5E20A 1U3EM 3PFIA 5E1XA 5ERIA 5DYMA 2QUFA 4LB5A 2HR3A 2DQLA 1H9GA 1L0OC 4AIHA 3IRRA 3QU6A 3L00A 1HKSA 4IHSA 5LEKA 3MZHA 1XGMA 2PBIA 3V4GA 1W5TA 2HQNA 3T5XA 3DXJF 4HX4A 1USSA 3W6JB 5DD4A 2QBYB 1IW7F 4I98B 4GGGA 2FRHA 5KK1A 3GXOA 4Y17A 1S6LA 2FMLA 5FFXA 2UZKA 4A0YA 1U6GA 1HKQA 1TW3A 5E18F 4RGUA 1OKRA 2EFPA 5D5UB 2XROA 1S3JA 4N9HA 3FM5A 5HS9A 3BZ6A 1MKMA 2P7VB 5F1RA 1USTA 5K5QA 3BROA 3KEOA 2HOEA 5D5WB 2CO5A 1ZARA 5CJ9A 2KIFA 2P8TA 1FSEA 3TO9A 4OU0A 2MH2A 2CSOA 3LFKA 5CVJA 3SZTA 4MTEA 1FLIA 2G7HA 1BIAA 1HW2A 2VN2A 4HA8A 2ISYA 4KMFA 1UB9A 2DU9A 2DW4A 1XSXA 2XRNA 2HYFA 1ZG5A 4M74A 1B6AA 1JE8A 3ZPLA 3GWZA 1KA8A 1D3YA 2OZ6A 2RC4A 5DCMB 3GVAA 1R7JA 2NAZA 3HUGA 3C1DA 1OPCA 4RB0A 4LMYA 5IT3A 2PMUA 4U0VA 1P4WA 3ROUA 1YW9A 3MQ0A 3DPTA 4L9NA 3OOPA 4QLCU 3M8EA 5ICFA 4FHTA 5JHUA 1ZHFA 3F23A 1L3LA 3GFLA 2W24A 1SD4A 4Q4ZF 4HDVA 3CUQA 4ETSA 3FMRA 1P4AA 5DD8A 3J80Z 2NNNA 4HV6A 2F2EA 5L3GA 4RS8A 1YW8A 3C3WA 5FD5A 3WTVC 2ZMEB 5D5XB 1YQAA 3SHFA 1Z05A 4BYYA 4LLGF 2X0LA 3EUHA 1YS7A 3J7AO 3C7JA 4EJTA 2ZJ2A 1V3FA 5DEQA 3ZMDA 1GXPA 4XSZF 1REPC 4ASNA 3KP4A 1TLHB 1WQ2A 1RIOH 2NYXA 1B1BA 4Z2YA 4UHTA 1T39A 1S7AA 5D5VB 2L02A 2CFXA 4MGRA 4CDGA 1OR7A 4IJAA 4BQAA 4WK8F 1MDMB 2JT1A 2FNAA 2ZXJA 2WTEA 3IKTA 4ZZLA 3ML6A 1A04A 1P4XA 1LNWA 3CTAA 4EJWA 4KMUX 2V1UA 2DTRA 3QP6A 3ULQB 2A61A 4OMYA 3WGHA 1G3SA 5CVIA 4M9XA 1BM9A 1ZAOA 1IRGA 3LA3A 2BBYA 4E70A 4F7ZA 2GWRA 4YFKF 4KFCA 3K1PA 3F8BA 1SFXA 4LK0F 2RNJA 2M5WA 2A68F 1KU9A 3LQRA 1XD7A 5BPDA 2JZYA 2Y48A 4EM0B 5JFRA 5ICEA 4S04A 1Y0UA 2D45A 4I02A 1YYVA 4BHPA 1FBUA 2W84A 3HRUA 1TNTA 1RI7A 2ESHA 2K27A 3T1BA 1J9IA 2IRFG 4CYDA 3RPQA 1SFEA 3HRMA 1SAXA 3RI4A 2VT3A 5A2QZ 1ON1A 1LEAA 2RDPA 4HX8A 2FSWA 2MA3A 2CGPA 1FPQA 3H3ZA 2ZFWA 1J7KA 3V8LA 3RJPA 1H9TA 4ESFA 3DQVC 2W25A 3L2CA 1YFHA 3R6SA 5BPIA 1Z91A 2AXLA 1EH7A 3V7SA 5IT9Z 1W5SA 5EEGA 4IVNA 5CVRA 1STZA 4AWXB 2H94A 3KP7A 3GX4X 1IRFA 3KP5A 3Q9SA 2GA2A 1ZN2A 2WV0A 3IKVA 3ISPA 3MFKA 5CVVA 5DUKA 4HQEA 4CZZA 4HF2A 3FX3A 2A3SA 4PGGA 2XAFA 1R22A 1KYZA 3MWMA 5LRSA 3GO5A 3BWGA 4DNCA 3B02A 2K02A 2HKOA 2VONA 1OYYA 2RV8A 1YIOA 2OQGA 4L18B 4G7OF 2YX4A 3MCZA 2M30A 1YS6A 2DI3A 2D2WA 4HX7A 5ICGA 1Z6RA 2PN6A 1O3QA 2GZWA 2ACJA 4OINF 5BS6A 1UFMA 2CG4A 2EJRA 1YTYA 4Q47A 1Z7UA 1K78B 1ZRDA 1RZ4A 3ZN0A 2OBPA 1OMIA 4UVCA 1CF7B 2FOKA 3ZMTA 2O3FA 2F5EA 2O03A 4PZJA 1IN6A 2JRTA 1E2XA 5KVRA 4BAYA 3F21A 2GXBA 3LSTA 1G3WA 2WC2A 2R3SA 1TTYA 5DCFA 1O7FA 1KU7A 2GQQA 4G6DA 4S05A 1FYMA 4LB6B 4EM1A 4MQVA 1BC7C 2FF4A 3K9TA 2OU2A 3JSOA 5K1YA 3COAC 3WE2A 3Q5FA 4BNCA 3J80K 3FZVA 3GW2A 1IN5A 3R0JA 4PCQA 5DDGA 2NNYA 4HLYA 5FD6A 1P2FA 1EH8A 4U7BA 4N9IA 4OMZA 4R1HA 4L9JA 4RB1A 3TKYA 4AVPA 4O6JA 3F8MA 2R7FA 1FOKA 2VOOA 1O3RA 4KIGA 3REOA 1MJAA 2EWNA 3SFZA 2IJLA 5D6FA 4G8XA 4WCGA 1ZRFA 5DCMA 3O3KA 2F5FA 1FY7A 2FE3A 4HZFA 4WWCA 2FMYA 1KGSA 4IRIA 2OA4A 1QGPA 2OAZA 1LJ9A 1JXSA 1K79A 4CXFA 3RKWA 1R5GA 3BPXA 2A69F 2J5PA 2E1NA 3EETA 1S7OA 3ECOA 5CYVA 4I0BA 3KEQA 3WTSC 4OIQF 3KP3A 3TOBA 1QNTA 2H27A 1KQ0A 2YPRA 2MC3A 2G7UA 2O0YA 2O8XA 4XRFA 4UV8A 2ZMEA 3GZ5A 6PAXA 1SMYF 3K1NA 4ZYHA 2PJPA 3N97A 4M9ZA 2AS5F 2FU4A 4L5IA 4LLLA 1R23A 3RTRA 4OIOF 1TQPA 1KU3A 1BIBA 3WODF 1IN4A 5DV5A 2DQRA 3WTWC 2A6HF 1TW2A 4HAMA 1G3YA 1FBQA 1SMTA 4KIFA 3ZMUA 4UVBA 3M9AA 2PEXA 2E1CA 1IF1A 2LDUA 2RVCA 5A2QK 3I71A 1B9MA 2Q2EA 3E97A 4XLPF 3NRVA 1J0RA 2MBFA 1BBYA 5D8KB 2DBBA 2HFHA 3GFMA 3GF2A 1T6SA 3F72A 2DO7A 3I64A 5FLXK 3HOSA 1E17A 2B0LA 2CYYA 5IT9K 1AOYA 4LJZF 1FNNA 1R00A 3DPLC 2V1DA 3VEPA 1C0WA 4OOIA 4ENMA 1LDKB 3RIRA 4KICA 1ZG3A 2Q8KA 2FBHA 4I0AA 1MJ9A 2LF8A 4NQWA 2FA5A 1HQCA 1FZPB 3BJAA 3AAFA 1R1TA 3VFZA 1H0MA 1W7PB 2QENA 3MEXA 4JK1X 3ERED 3TQNA 2DK8A 5DUIA 4WXDA 4M71A 2H6CA 2M1BA 3U9GA 3JW4A 2RKHA 2E7WA 2G9WA 5L3DA 2HZTA 4UV9A 2VE9A 4A5NA 1LQ1A 2XIGA 1B4AA 5HLIA 4UXNA 1BI2A 2XAHA 3Q9VA 2C6YA 4BHBA 3L09A 4H0EA 1GVJA 5LGTA 3CUQC 1G3TA 1ZGAA 3E5XA 3QPHA 3FXUA 2A6EF 1QO0D 2BGCA 1IZ1A 3BOQA 1J2XA 5H20A 2RGVA 2MLGA 1ZLKA 5JI6A 3E3VA 4L9VA 1U78A 2IT0A 3WTZA 4ENJA 4UVAA 3SQNA 2K4JA 3L9FA 2M87A 1KQ8A 2PQ8A 2VBXA 2BEOA 1U5TA 4LGWA 1FSHA 2D1VA 1BC8C 2ELHA 1XGSA 1T98A 2P5KA 1ZYRF 2ZKZA 1B59A 4A0ZA 2IW5A 1XMKA 1FX7A 5AONA 3V7CA 1U5TC 2QQAA 3TGNA 1XCVA 5J8CA 4ZYDA 1R36A 2CWEA 3SXYA 1ZH5A 3WTTC 2PI0A 3TO7A 3JTGA 2FBIA 5HDNA 2Z3YA 2EV5A 3P9KA 5FGMA 4M6YA 2STWA 3F6OA 3M8FA 2HKXA 1BJAA 4M9SA 2RQPA 3HYIA 3HRTA 3K0LA 3H92A 5LHGA 1S8NA 4IRGA 1I1GA 2EFNA 2L4AA 3ZMVA 4WF2A 4L5JA 2J5OA 4DQ2A 2WWYA 1YO5C 1TQIA 2EFWA 4LK1F 5LHHA 2VC1A 2KKOA 4IXAA 4CO8A 2K86A 4U88A 2IA0A 5E8GA 3EYYA 4L0YB 4UUVA 4ZZDA 2IA1A 4YIIA 4ESJA 3LAJA 5L3EA 1T2KA 5E17F 3JAMK 2HTSA 1HKTA 4KUMA 1PP7U 1PUEE 3C18A 3V8JA 5FLXZ 2MD5A 4A6EA 3MAJA 2KJCA 1D8KA 2M45A 2FEZA 1P92A 3BJ6A 4ENNA 5ILSA 2PG4A 4KT5C 1IN7A 5AIPA 2ESNA 1KYWA 2A07F 3WGIA 3GFIA 1YW7A 1W4MA 5FO5A 2ZNZA 3GEZA 1IUYA 4N0BA 2FXAA 4FX0A 3WE3A 1XGNA 3D0SA 4ZH4F 5BMZA 1ZGJA 1G6NA 1FYLA 2XGXA 2O61A 1W7PD 1MD0A 3G73A 3TDUC 4P55A 4HLXA 5E1ZB 1FBSA 2K4BA 4LFUA 3QRFF 2O6GE 3IWZA 4WXCA 5HS8A 1HXDA 2Z33A 4IHTA 2ZO4A 1ON2A 4NB5A 1AWCA 3I0TA 3F8FA 5J8FA 5ICCA 4K2EA 4ENKA 2MH9A 2STTA 1MGTA 2QVOA 3CLOA 1T38A 4EJUA 2QYOA 1F9NA 2P4WA 5D4RA 1IN8A 1HBXG 2QBYA 2XUBA 4B09A 3RYRA 3I5UA 1BOAA 1TQMA 5LLQA 2QM3A 3HHHA 4U0YA 1Z6TA 3KE2A 2XKPA 3G3ZA 2IP2A 2F5DA 2Y75A 2W85A 4KN4X 3RKYA 3RPUA 4RGRA 5LEJA 1WSUA 3GUDA 1SFUA 3FF5A 3F3XA 1QQIA 2ZBKA 2UWMA 5HVQC 2ZNYA 4Y15A 3FXQA 1X3UA 5EEHA 4O5VA 1O3TA 2BE5F 3W6KB 5F6FA 3F8NA 3CO6C 1EV7A 1K6OA 2EFOA 3P9CA 3V8KA 4ON0A 3E5QA 1HW5A 1ZRCA 3WTUC 1LB2A 3E6DA 1MJBA 3LA7A 3CO7C 3ZMZA 3K2ZA 3BDDA 4IF4A 3VB2A 2RN7A 1ZLJA 3P7NA 4P9FA 3DF8A 3H3UA 3IL2A 4RGSA 4KNYA 4Q48A 3T8TA 2FQ3A 1I1SA 1ODDA 3CUOA 1RUOA 5FFZA 4KYWA 1DPRA 1KU2A 4G7HF 1VTNC 1XDUA 2LF7A 3I59B 4JQFA 4AD9A 1QZZA 1XSVA 5HOOA 2PFBA 3RDIA 4A6DA 3J81K 3FMSA 4A5MA 2XAQA 3JAMZ 3O6BB 2D1HA 3R0AA 3F8CA 4FT8A 3N4MA 5H6RA 5BQTA 1PDNC 1I27A 4LG0B 2GA1A 2L54A 2VBYA 2COMA 5ILVA 1FWZA 2HDCA 5D8LB 2JPBA 4FX4A 3BPVA 3HOTA 2Z5UA 1SD5A 1ONVA 4PDKA 1BI3A 1MDMA 2EA2A 4RB2C 1IXCA 2IA2A 2K7LA 1UHMA 3M7GA 4XLNF 2DPUA 4R79A 3T8RA 4P9UA 2OZUA 5HDKA 2EV6A 3KCCA 3M1EA 4BXUA 3EDPA 4YIFA 3VOEA 2HEOA 1XMAA 1WI9A 3WU1B 3ZP5A 5JR3A 4EGZA 2JPCA 1K7AA 1SD6A 1LDDA 1F5TA 3WG9A 2VC0A 1QBJA 3I4PA 1CGPA 2V1XA 3LQQA 5TJJA 4IRHA 3IRQA 3DFGA 1ZG1A 1FC3A 3I54A 1D8JA 5LBQA 1DDNA 3OV8A 1FT9A 1J5YA 3E5UA 2F5CA 1RNLA 4HW0A 3LA2A 2W57A 2V9VA 4EM2A 4HF1A 4RAZA 4RB3C 2LSOA 2P6TA 4GYIA 2X4HA 2VT2A 1KQ9A 2XVCA 5K5RA 4PGHA 1LDJA 3KP6A 2DPDA 4LLNA 4M6XA 4HOBA 3EQLF 3FWEA 2XAJA 4HV5A 1ZREA 5K5OA 1BN5A 2OQRA 2DK5A 2YU3A 1YG2A 2FBKA 4AIJA 3HIFA 3IWFA 3WTXC 3K69A 3B73A 2P7CB 1BI1A 2QLZA 2XHKA 4GO1A 2TDXA 2Z9OA 3QOPA 4MQ9F 1EH6A 3KP2A 4HF0A 4EJVA 4JBAA 4UNOA 3K1MA 4CICA 3TDZC 4D0PA 3KLNA 2EFQA 2XV4S 4WX9A 5D4SA 1O7LA 5H6QA 4XBFA 3ZMSA 1XDSA 2CW0F 5LRRA 2QZ8A 4G9YA 3R4KA 3CDHA 3HHGA 3FM3A 2QWWA 1Z9CA 3DEUA 4BHCA 3E6MA 2GXGA 5E1WA 4L0ZB 4P5OA 2QQBA 4KA4A 3KLOA 3PQKA 3L7WA 4BH9A 1T0FA 4HYEA 4P96A 2VXZA 2YR2A 1J75A 3IC7A 5HLHA 2NRAC 4EQQA 4YFNF 4EVIA 2L3DA 3DP7A 3TO6A 4MNUA 4NHJA 2XASA 4A0XA 3GYHX 1UCRA 2KIMA 1ULYA 3J81Z 1K78A 4GXOA 1CF7A 4EMSA 5L3BA 2YX7A 3NQOA 2FNPA 3O2PE 3RKXA 2UXNA 3RYPA 1V4RA 1I5ZA 1O57A 4OIPF 3I53A 2LNBA 3DV8A 5BOXA 2NS0A 4IPAA 1P6RA 3HRSA 3F6VA 4HDUA 4XSXF 2V6CA 2YSRA 1UHWA 1Z1DA 5HLGA 1MZBA 4Y13A 2UXXA 5D6EA 2R7DA 3U1DA 2ZCWA 1I6XA 4TV7A 1WKMA 3QU3A 2HS5A 2KJBA 2ADUA 4QWQA 1R1UA 4U7DA 2M8EA 3LAPA 4KIBA 4G7ZF 1XB4A 2IPQX 1JGSA 3IHUA 5CVUA 2VODA 1QZYA 1YLFA 1FYKA 3CUQB 2EK5A 3WU0A 3QP5A 2DAOA 1U2WA 1FP2A 3HSRA 2PLYA 2HYGD 4EGYA 1WRJA 3FXRA 3FMQA 1IAWA 5LGUA 3ECHA 1S29A 4KDPA 4EV0A 2H09A 1OYWA 3CJNA 4B8XA 5LHIA 1R5HA 2OD5A 1LEBA 3JSPA 2ISZA 2GIVA 1B9NA 3I59A 2JTVA 2HWVA 2DT5A 3D5LA 4OIRF 5E8IA 5HDGA 3R61A 3KZZA 4MEYF 3U2RA 1XGOA 1U5TB 2H6BA 4GYGA 2VBZA 2IVMA 3KZYA 1HSTA 1J59A 5L3CA 2Q0OA 4Q5SF 2HTJA 4RGXA 3VODA 2P5LC 3PQJA 4LG0A 3ZN1A 3BP8A 3P9IA 2BV6A 3I58A 2P5VA 1IXSB 1PP8F 2GAUA 4A2UA 3WGGA 4RAYA 4YG2F 1NHAA 3ABTA 2L01A 4YFXF 2DFIA 2DLLA 4A12A 1DPUA 4M73A 4L9TA 2QQ9A 1O3SA 3NEUA 5ED4A 1U8RA 3KFWX 5TRDA 5CLSA 4M72A 4HBLA 3LWFA 4G94A 4MEXF 3SZPA 3S2WA 2EV0A 1IXRC 3HSFA 3WTYC 4ZYGA 4LD5A 2VE8A 3E6BA 4MHGA 5J6XA 4R8HA 3R60A 3EYIA 2EA4A 2LKPA 1DUXC 4CHUA 4ESBA 2VOPA 3JTHA 4G6QA 5FB2A 1XCBA 3TOAA 4ZYEA 1HW1A 2KIUA 1JHFA 3HSEA 1TBXA 1SD7A 3MZYA 5F64A 2XKOA 1XSDA 1Q1HA 1R1VA 1R58A 1OYIA 3QPTA 5L3FA 4WXHA 2Y0MA 1F4KA 2EB7A 5HS7A 5LGNA 1W7PA 3ZQ7A 1D5VA 2PMHA 3ELKA 1F1ZA 2MLKA 2CQKA 1JHHA 2P6SA 4GCVA 4U0WA 5JVTA 1HSJA 4I7HA 4AIKA 1XN7A 4I09A 2V79A 4I2OA 3FHZA 4CGZA 3DKWA 3F22A 3E6CC 3BY6A 3BJOA 4MTDA 4HQMA 4O3MA 3V7RA 5ILUA 1BI0A 1GHCA 2E7XA 3KETA 3GFJA 4KN7X 3T0YA 1WWXA 1FP1D 3HTSB 1DP7P 1TNSA 2KRFA 5AIQA 1LVAA 2Z99A 3ABUA 2JSCA 2A5YB 1G4DA 2ETHA 4I01A 3QAHA 2HQRA 2L4MA 2HGCA 1GXQA 4EJOA 2XAGA 3GLXA 3GZ6A
chains in the Genus database with same CATH superfamily
2BYVE 1RUNA 2R7QA 3JR9A 3ZQFA 2ELKA 1QPMA 3HTUA 5FKLA 5M3MJ 1JKPC 2VBWA 5E20A 1JJ6C 1U3EM 3PFIA 4XORA 5E1XA 4PJ0C 5ERIA 1Z0XA 2NXNB 5DYMA 3GTKJ 1OQYA 1YE9A 3LSIA 3GTQJ 2QUFA 4LB5A 2VPRA 2HR3A 2DQLA 4KT6A 1H9GA 1UZCA 1L0OC 4AIHA 3IRRA 3QU6A 3L00A 1E3HA 1HKSA 4IHSA 4F93B 5LEKA 3MZHA 2IBDA 1LPQA 1XGMA 2PBIA 3V4GA 1W5TA 2L9SA 2JA7J 2IS1A 2HQNA 1IC8A 3T5XA 3DXJF 4HX4A 3OYJA 3K10A 4JX6A 3DBHB 1USSA 3W6JB 5DD4A 2QBYB 1IW7F 1ETOA 4I98B 2I8DA 3SDGA 3S2HJ 4GGGA 3LSRA 2FRHA 5KK1A 3CZ6A 2HOTA 3GXOA 4Y17A 1S6LA 2FMLA 5FFXA 3I55I 1TC3C 2UZKA 4A0YA 4A3KJ 1U6GA 1X1DA 2W00A 3QODA 2O8KA 2V6EA 5M5WJ 3A4CA 3FXMA 2O9LA 5K7ZA 1OCCH 1HKQA 1TW3A 3G1MA 3X2QH 5E18F 2M2EA 4RGUA 2QKMB 1OKRA 2EFPA 5D5UB 2XROA 1S3JA 5B1BH 4N9HA 3ZQIA 2XGEA 3FM5A 1X1CA 4OWRB 1OJLA 2W7NA 5HS9A 1WGXA 2KT0A 4BS9A 3BZ6A 4IZZA 1T95A 1MKMA 2CW7A 2P7VB 5F1RA 1USTA 5K5QA 2BW3B 3BROA 3KEOA 4BBRJ 2HOEA 5D5WB 1SC7A 2L0KA 2WA0A 4CCKA 4AIDA 2CO5A 1ZARA 5CJ9A 2KIFA 3G1LA 2P8TA 4C3HJ 3FK7A 1FSEA 3TO9A 4OU0A 2MH2A 2CSOA 3LFKA 1GLNA 5CVJA 1X58A 3SZTA 4FASD 4MTEA 2BY2A 3FKIJ 2HDWA 1FLIA 3CCVI 2G7HA 1BIAA 3VYTB 2VN2A 2MYSA 1HW2A 4KISA 4HA8A 2ISYA 2JN6A 4KMFA 3GTMJ 1UB9A 3A02A 2DU9A 2DW4A 1LE8A 2PJRA 1XSXA 3A0HC 2XRNA 2HYFA 1ZG5A 2VKEA 3DBLB 4M74A 2CUFA 3AL0B 1B6AA 2LC2A 1JE8A 2HYJA 3G2BA 3GWZA 3ZPLA 2ID6A 1KA8A 1D3YA 4Y4RA 3K4JA 4QSHA 2LBFA 2E36A 4XN3A 1X3ZB 2OZ6A 2RC4A 1O4XA 2HVSA 5DCMB 3H0DA 3GVAA 4E7HA 2NVQJ 2HXIA 1R7JA 1Y6IA 2VJIA 3CCMI 1K61A 1D1CA 3HM5A 2NAZA 2JA6J 3HUGA 2VJJA 3C1DA 3SEZA 2XB5A 4XLEA 1OPCA 5E3MA 4RB0A 5GAEJ 4LMYA 5IT3A 2PMUA 9ANTA 4U0VA 1P4WA 3ROUA 1YW9A 3MQ0A 3DPTA 2HDDA 4L9NA 3OOPA 4QLCU 1QU3A 3M8EA 5ICFA 3JRGA 4FHTA 1YITI 1UG0A 5JHUA 4RDUA 1ZHFA 4RLFA 4B44A 3F23A 1L3LA 1ZKGA 3GFLA 2W24A 4IL6C 1SD4A 3OIOA 4D1QA 1TL8A 4Q4ZF 3A01B 4HDVA 3CUQA 1Y0NA 4ETSA 1HDDC 2JQ7A 3FMRA 2Q1ZB 1P4AA 5CQGA 5DD8A 3ZCOA 4FQGA 1AU7A 3J80Z 2NNNA 4HV6A 2F2EA 5L3GA 4RS8A 1YW8A 3C3WA 5JVGF 3AFHA 4XRMA 5FD5A 3WTVC 2R7UA 2XB0X 1SANA 2ZMEB 5D5XB 1YQAA 2EILH 1POGA 3SHFA 1UJ8A 4PFOA 1Z05A 4BYYA 4LLGF 3JRIA 2X0LA 3EUHA 1YS7A 4BXFA 3J7AO 3C7JA 4EJTA 2ZJ2A 1V3FA 5DEQA 3ZMDA 1GXPA 4XSZF 1RKWA 2K5CA 1BR2A 3VDXA 1N77A 1REPC 4C2TA 4ASNA 1ITYA 4BBSJ 4BEHA 3KP4A 3PSIA 1V55H 1TLHB 1WQ2A 3GTJJ 4BL0B 1JI8A 1RIOH 2NYXA 1B1BA 2JRMA 4Z2YA 4UHTA 3CCSI 1T39A 4D7NA 1S7AA 5D5VB 1KZHA 2L02A 2CFXA 4MGRA 4CDGA 1OR7A 4IJAA 2XF7A 4B47A 4QIWN 3OYKA 3S3OA 3GLXA 4BQAA 4WK8F 2ZJRF 1MDMB 1Z67A 1DGRM 2JT1A 2FNAA 4W97A 4XKWA 2CV2A 2ZXJA 2WTEA 1W5CC 3IKTA 4ZZLA 1HCRA 3ML6A 1WHUA 1A04A 3KYCB 1P4XA 1LNWA 2LH9A 3CTAA 1TWGJ 3HPHA 4EJWA 4KMUX 2V1UA 2OTLI 1OFCX 2DTRA 3QP6A 1Z3XA 3ULQB 1XPXA 2IEKA 2A61A 4OMYA 3WGHA 1WVRA 2CU7A 3S15J 1G3SA 5CVIA 4M9XA 1BM9A 1ZAOA 1IRGA 3LA3A 3OL4A 4HNUA 2DDAA 1VQLI 1P7IA 3QQAA 2BBYA 2DA5A 1NH3A 4E70A 4F7ZA 2GWRA 4YFKF 4KFCA 1GV5A 2XPWA 4PJLA 4CA0A 3K1PA 3F8BA 1SFXA 2KHMA 2VXDA 4LK0F 2RNJA 2M5WA 3NARA 2A68F 1KU9A 1VFCA 3JRFA 2UV1A 1ZQ3P 5J4VA 3LQRA 1XD7A 3FXJA 5BPDA 3CP8A 5E3LA 2JZYA 2VJ4A 2Y48A 4EM0B 5JFRA 5ICEA 2ZB9A 3IUOA 2E2HJ 4UY8I 1DU6A 4ANJA 2DJIA 4M3DA 1JUPA 3G71I 2LFBA 2GOMA 1X19A 1E3OC 4BJ6C 4S04A 2HI3A 1Y0UA 2D45A 1VI0A 2F5VA 4I02A 4XRSG 5J47A 1YYVA 2EZIA 4BHPA 1FBUA 1VQKI 5HLTA 2W84A 3C2GA 4C2MJ 3HRUA 4F91B 1TNTA 2CH0A 1RI7A 3PNYA 3W2AA 3B6CA 2ESHA 4DJAA 2ZJPF 3OYEA 2CUJA 2K27A 5LD2C 2M4KA 3T1BA 1J9IA 5J3LA 3OS1A 2IRFG 5EZGA 4CYDA 2OF7A 3RPQA 2OC6A 3BZCA 3VYUB 1SFEA 3IAM2 2IS4A 5J1RA 3HRMA 1SAXA 2RAEA 3RI4A 2E5ZA 1KONA 2VT3A 5A2QZ 5CPRB 1ON1A 3TP0A 2AXTC 3MD2A 2IGOA 2WAQN 1LEAA 3RPUD 2RDPA 1G8XA 2FSWA 2MA3A 4HX8A 3M3YJ 2CGPA 2YU9J 1FPQA 3H3ZA 2ZFWA 1J7KA 3HG9A 3V8LA 2GIZA 3RJPA 2IAIA 4ESFA 3DQVC 1H9TA 2W25A 3K7AJ 3L2CA 3RZDJ 3S1NJ 1YFHA 4V19K 3R6SA 2EPFA 1I39A 1MMAA 5BPIA 1Z91A 4QPQA 2AXLA 2IGNA 1XS9A 1EH7A 3V7SA 2K9MA 2LMDA 2DFEA 5IT9Z 1W5SA 3ZQHA 4DYQA 5EEGA 3SZGA 3OS0A 1OCRH 3KX2A 4IVNA 3I3LA 5H2FC 4Y3OA 5CVRA 1STZA 3VPRA 2H94A 3KP7A 4AWXB 3GX4X 1IRFA 3KP5A 3Q9SA 2GA2A 2F4OB 1ZN2A 3BG6A 2WV0A 4BE0A 2VIXA 3IKVA 3ISPA 3MFKA 5CVVA 1VQ7I 5DUKA 4HQEA 2WADA 3GCMA 2XGDA 4CH7A 4CZZA 2QSFX 4HF2A 1FTTA 4D5FA 3FX3A 5E3OA 3C2BA 2A3SA 4PGGA 2XAFA 2X51A 1R22A 1WPKA 4FISA 1KYZA 5LFAA 3MWMA 5LRSA 3GO5A 4C2UA 3BWGA 2BXYA 4DNCA 3B02A 5C4XJ 2WV1A 2K02A 4DZJA 1Y8RB 4XLAA 2EIMH 5TGTA 4ZDPA 2HKOA 3HDDA 2VONA 3PSFA 1HC8A 1OYYA 2K40A 2LY9A 2RV8A 3TP3A 1YIOA 2OQGA 4XL9A 4L18B 4G7OF 2YX4A 3I56I 2QEXI 2V4JC 3MCZA 2M30A 1QHHD 4CCLA 1YS6A 3QYBA 2DI3A 2D2WA 4HX7A 1T33A 2W4SA 5ICGA 5GPAA 3FBIB 5EGOB 1Z6RA 1LVKA 3GLLA 1MMGA 4RA2A 2PN6A 3BCAA 4M6VA 2WBMA 1O3QA 1H89C 4NC7A 2F4MB 1E3PA 1FIAA 1U9NA 2GZWA 3UR3C 2DA4A 2X85A 5CQEA 4OINF 2ACJA 3JRAA 5BS6A 1UFMA 2CG4A 2EJRA 1HF0A 1YTYA 5IPAA 3KEYA 4Q47A 1Z7UA 3NWTA 1K78B 5EEAA 1ZRDA 1RZ4A 2ECCA 2V1NA 3ZN0A 1W36C 2OBPA 1IDYA 3CC7I 1TWFJ 1OMIA 2XF5A 1X4PA 4UVCA 4XICA 2FOKA 3ZMTA 1CF7B 2O3FA 2F5EA 1Y1WJ 1T08B 2O03A 2XAUA 2M3AA 4PZJA 1IN6A 1ETWA 2JRTA 5B5EC 1E2XA 4M3GA 5KVRA 4BAYA 3F21A 2GXBA 1FOXA 3LSTA 4RM2A 1ERDA 2JMWA 3IH4A 1G3WA 2WC2A 2R3SA 3FXKA 3ABMH 1TTYA 2HZDA 5DCFA 1O7FA 1KU7A 2WB1N 4XR6A 1EF4A 4ZDLA 2GQQA 3BC8A 4G6DA 4S05A 1FYMA 1T8IA 2D5VA 4LB6B 5GP9A 4EM1A 2EINH 4MQVA 1BC7C 3CF5F 2FF4A 1MH4A 3K9TA 1NG6A 2FX0A 3HKZN 1MBEA 2OU2A 2CRGA 3JSOA 5C44J 4JP0A 1X2MA 2H8WA 4IHYA 3A2KA 5K1YA 3COAC 3WE2A 3Q5FA 4BNCA 3PIOF 2O5RA 5IOYA 3J80K 4BJ5C 3FZVA 3GW2A 1IN5A 3R0JA 4PCQA 5DDGA 2CFOA 2NNYA 4HLYA 5FD6A 1P2FA 1EH8A 5M5YJ 1HA8A 4U7BA 4N9IA 4OMZA 4XRSA 4R1HA 1EA3A 3CQZJ 3CCJI 1VQMI 4L9JA 5JLWA 4RB1A 3TKYA 2E1MC 4AVPA 4O6JA 2OTJI 2V9KA 2CQQA 2R7OA 1GDTA 3F8MA 2H8RA 1A6QA 4MIMA 2QQ8A 5FKMA 2HXOA 2R7FA 1SFKA 3LSJA 2EZKA 2OCCH 1FOKA 2VOOA 1O3RA 4KIGA 4MFDA 3WG7H 3REOA 1MJAA 2EWNA 3SFZA 2IJLA 5D6FA 4G8XA 4WCGA 1ZRFA 4BGDA 3CJQB 3OMYA 3Q3SA 5DCMA 2ECBA 3O3KA 2F5FA 4RBOA 2K3PA 1FY7A 4OAZA 2MC4A 2BOLA 3HBLA 3OIQA 2FE3A 3CCYA 4HZFA 3WHBA 1ETKA 2FMYA 4WWCA 4B3AA 1OCPA 1KGSA 3JREA 1JKOC 4IRIA 2OA4A 3SJMA 2YS9A 1QGPA 2OAZA 5IOZA 4HNTA 1LJ9A 1JXSA 4D9JA 4CXFA 1K79A 2L9NA 3RKWA 1R5GA 5F08A 3BPXA 4IHXA 3ZOBA 2A69F 2J5PA 1IDZA 4XKCA 3BZKA 2E1NA 1FOYA 3K70C 3EETA 3A01A 1S7OA 4B4CA 3ECOA 5CYVA 4I0BA 2M9HA 5FKNA 3KEQA 3WTSC 1MMDA 4OIQF 3CESA 3KP3A 1YJ9I 3TOBA 4BACA 1QNTA 4B1RA 2H27A 1SVLA 4BDYA 1KQ0A 2YPRA 2MC3A 2G7UA 2O0YA 2O8XA 4XRFA 3EUAA 3LSMA 4UV8A 2ZMEA 2B63J 3GZ5A 3PNTA 6PAXA 1SMYF 3K1NA 2R4GA 4ZYHA 2PJPA 5F0FA 3N97A 1Y8QB 2F4IA 4M9ZA 2AS5F 2FU4A 4L5IA 2X1CA 2I10A 1GVDA 2LY1A 4LLLA 1R23A 3RTRA 4NNJA 2AQFA 4OIOF 1TQPA 1KU3A 1BIBA 1P9QC 3WODF 1IN4A 5DV5A 2X6WA 4E7KA 2DQRA 3WTWC 1FTZA 2A6HF 1TW2A 1QHGA 4HAMA 1N25A 1W0TA 3DKXA 3PL8A 1XG1A 1I3QJ 2M7AA 1G3YA 1FBQA 1S9HA 1SMTA 4KIFA 4XMYA 3ZMUA 4AU7A 4UVBA 2L7MP 1JGGA 3M9AA 3OSGA 3DWLE 2PEXA 2E1CA 4BDZA 1IF1A 2FOWA 2E19A 5JHFA 1FIPA 2KFDA 2LDUA 2RVCA 5A2QK 1V5GA 1B9MA 1UMQA 3I71A 2Q2EA 2Y0SN 3E97A 4XLPF 2KLOA 1TP4A 2FD5A 2XC7A 3NRVA 1J0RA 3ZQGA 2MBFA 3EUKL 1BBYA 5D8KB 2DBBA 1X1BA 2HFHA 5F27A 2GBYA 1WJDA 3GFMA 3GF2A 4BU2A 1T6SA 3F72A 4W1UA 3L2RA 1R49A 3S3NA 1QVUA 2DO7A 3JCUC 4C3IJ 2X9DA 3I64A 2LYCA 5FLXK 3HOSA 1E17A 2B0LA 3LSKA 2CYYA 5IT9K 1AOYA 2DFFA 3M4OJ 3VYRB 2UUZA 4LJZF 4RAGA 1FNNA 1R00A 2ELJA 2JUCA 2DMNA 5FLMJ 1FEXA 1VQ6I 1JUMA 1VQ8I 3DPLC 2V1DA 3VEPA 1PYVA 1C0WA 4OOIA 4ENMA 3S32A 4FETA 2Y69H 3M8JA 4FTHA 3PUFA 4M3EA 4ZDOA 1LDKB 2VQGA 3RIRA 4KICA 2JJ7A 4BY7J 1ZG3A 5EZHA 2Q8KA 3GBGA 2FBHA 2KMUA 1LFPA 2VL8A 4I0AA 1MJ9A 2LF8A 4NQWA 4XONA 4AYBA 2E1OA 4IX7A 2FA5A 1HQCA 3RQIA 1FZPB 3BJAA 3AAFA 1ETQA 2L7KA 2HPIA 2R0QC 1LKXA 1R1TA 3VFZA 1H0MA 3B6AA 1W7PB 2QENA 2VUMJ 3MEXA 4JK1X 3JRCA 3ERED 1RETA 1MIJA 2PX9A 3TQNA 2DK8A 5DUIA 2K9QA 4WXDA 4NC8A 3GMEA 4XM3A 4I99C 3NAUA 4ZC3A 5F04A 3H5RA 2Z1DA 2JUGA 4M71A 1ZR4A 1MH3A 1WFXA 4G6TB 1W1WE 1WJFA 1VQPI 3S93A 2HVRA 2H6CA 2M1BA 1ETVA 3U9GA 3JW4A 2RKHA 2E7WA 3LSHA 3DPUA 2G9WA 5L3DA 1MNMC 1ZGWA 5DM6F 3ABLH 1GT0C 2HZTA 4B3XA 3L2WA 4UV9A 2V26A 3GTOJ 2CQ7A 1YOVB 2BVLA 2VE9A 4A5NA 3RCOA 1DGWY 4M3FA 2Y31A 1LQ1A 2XIGA 1B4AA 3FK6A 5HLIA 3OS2A 2E2IJ 4UXNA 1BI2A 2G0EA 2XAHA 3OYIA 2DMUA 3Q9VA 4XNFA 1R4MB 3RQ4A 3J7AY 2C6YA 1FOWA 4BHBA 4C3JJ 3L09A 1YJWI 1Z3YA 4H0EA 1GVJA 4I6ZA 4MLOA 5LGTA 3CUQC 4ZJZA 3UKGA 1G3TA 1ZGAA 1EKEA 3E5XA 1BJZA 3LFUA 1ZELA 3QPHA 2VLAA 3FXUA 2R5ZB 3M07A 2A6EF 1QO0D 2BGCA 1IZ1A 1I50J 3QPSA 3BOQA 3BTJA 1J2XA 2CUZA 4IQ4A 5H20A 2RGVA 5EF6A 2MLGA 2DTZA 5JI6A 3CF2A 4CYCA 5KCMA 2KDZA 1ZLKA 3BQYA 3E3VA 4L9VA 1U78A 5K7HA 3MMYB 2IT0A 3WTZA 4ENJA 4UVAA 3SQNA 3KYLA 2X48A 1JUSA 2HU9A 3W2WA 2M8GX 2K4JA 3L9FA 2M87A 1KQ8A 2PQ8A 3EUHC 2VBXA 2P0WA 2EIJH 3DEEA 1BR4A 3TMOA 4LOCA 3TBIA 3ZGKA 2BEOA 1U5TA 3QYFA 4LGWA 1FSHA 2JA8J 2D1VA 1BC8C 5EG0A 1TZLA 2ELHA 4KJZA 1XGSA 1T98A 3O8HA 2P5KA 1ZYRF 3RSNA 1OR7C 1RR7A 2ZKZA 3VSLA 1HOMA 4V2FA 3OYHA 1B59A 4A0ZA 4ZTFA 1BL0A 2IW5A 5EGOA 1XMKA 1FX7A 4IOAF 3IP4B 5AONA 3BG9A 3V7CA 2DT6A 1U5TC 2QQAA 3TGNA 1XCVA 5J8CA 4PJNA 4ZYDA 2DA3A 3OYGA 1R36A 3AG3H 3QWLA 2CWEA 3SXYA 1ZH5A 3WTTC 2PI0A 2R5YA 1XX5A 2KIQA 2P81A 4LG3A 4G12A 3TO7A 3JTGA 2FBIA 5HDNA 2Z3YA 2EV5A 3OYBA 3P9KA 5FGMA 1WI3A 4M6YA 3DTEA 2STWA 3F6OA 3HEFA 4E6KG 1A31A 4DZPA 3M8FA 2WAQA 2ZJQF 2HKXA 3LSPA 1DU0A 1BJAA 4M9SA 2RQPA 4IEJA 3HYIA 3HRTA 3U21A 2CV0A 3K0LA 5E3NA 3H92A 3K6GA 5LHGA 1S8NA 4IRGA 1UELB 1SEUA 1I1GA 2EFNA 1VF9A 2L4AA 4E7LA 1ZTRA 2BHYA 1R9TJ 3C2HA 3ZMVA 1G2HA 4WF2A 4L5JA 1V5FA 2J5OA 1U9OA 3D5RC 4DQ2A 2WWYA 1YO5C 1TQIA 3H0GJ 2EFWA 2R7VA 4LK1F 2A6TA 2WY7Q 2NS8A 2LVSA 2EZLA 5LHHA 2VC1A 2KKOA 2PJRB 2K86A 4IXAA 4CO8A 2LG4A 4A3GJ 2COBA 4U88A 1LFUP 2IA0A 3A1YA 4FCYA 5E8GA 1YRNB 3EYYA 2X6OA 4L0YB 2LRDA 4DIQA 4UUVA 4ZZDA 2IA1A 1IUFA 1X1AA 3DU6A 1TT0A 3MKLA 4X1EA 4YIIA 5J4YA 1BR1A 4ESJA 5IYBJ 1ETYA 2M7BA 5L3EA 3LAJA 2QSHX 1T2KA 5E17F 3JAMK 1T56A 3BG3A 3I4NJ 2HTSA 1WJCA 3CMEI 1HKTA 3MVPA 4KUMA 3HUGB 3ZQQA 4BQNA 3PIPF 2EH3A 1PP7U 1PUEE 2TRTA 3HOVJ 3C18A 5DTDA 3V8JA 2Y2ZA 1MBJA 5FLXZ 2MD5A 4EEFG 4A6EA 3MAJA 1H8AC 2KJCA 3CCLI 5EYRA 4DYRA 1D8KA 2M45A 2FEZA 4I76A 4Y33A 1P92A 3BJ6A 4ENNA 1Y39A 5IP6A 3BR0A 5ILSA 4CZCA 1IO2A 4UUSA 2PG4A 3H35A 4A3DJ 2PMZA 1WZ2A 2ME6A 2KZGA 4KT5C 2CV1A 5FROA 1IN7A 1IV8A 1Z77A 5AIPA 2ESNA 1KYWA 2A07F 1NTCA 4PUSA 1WJBA 3WGIA 1D0YA 1LUJB 4EATA 3GFIA 2B7EA 1YW7A 1W4MA 3BR2A 5FO5A 2ZNZA 3GEZA 1WJAA 3OYFA 2L9RA 1IUYA 4N0BA 2DT7B 2FXAA 4FX0A 1Y1VJ 3WE3A 1XGNA 3D0SA 2LP0A 4ZH4F 3G6EI 5BMZA 1ZGJA 4S0HB 1G6NA 2DFHA 4MO7A 4A3LJ 1B72A 4AVZA 1FYLA 1PUFA 1MBFA 3QOEA 2XGXA 2O61A 1W7PD 2LKSA 3CDIA 1MD0A 3G73A 2WAEA 1BOBA 3H5AA 2KRCA 4BEHB 2RREA 1K6YA 3TDUC 2Y9ZA 4P55A 4HLXA 3PO3J 5E1ZB 1FBSA 2K4BA 4LFUA 3I9V2 4CCOA 4JOMA 3QRFF 2O6GE 3FISA 3IWZA 1ACIA 4WXCA 5HS8A 1HXDA 2L5QA 3K4BA 3W3CA 2Z33A 1HLVA 3MZ8A 2IGMA 4A3FJ 2ID3A 3K4MA 4IHTA 2L7ZA 2ZO4A 1ON2A 4NB5A 1VQOI 2XRLA 2XSJC 4CSWA 4F55A 1AWCA 3W6VA 2BY3A 3I0TA 5FRMA 4UB6C 3F8FA 5J8FA 1BW6A 2OUMA 4BJTA 5ICCA 4K2EA 2YUSA 4ENKA 1DP3A 4HEA2 5IYDJ 2MH9A 2F48A 1MGTA 2STTA 3OR2C 3HC7A 3EPZA 3FXLA 3UNGC 2QVOA 3CLOA 1MBHA 5C4JJ 1AHDP 1T38A 3CMMA 4EJUA 4GFBA 2TCTA 2K9SA 2QYOA 1F9NA 4A3EJ 1K4SA 2EIKH 2P4WA 5D4RA 1IN8A 1HBXG 2QBYA 2XUBA 4B09A 1OISA 2JVGA 3RYRA 3I5UA 3SEQA 4F92B 1BOAA 1TQMA 3E0JB 2DMQA 2V9PA 5LLQA 5IP9J 1GUUA 2QM3A 3HHHA 3KZIC 4U0YA 1Z6TA 1JT6A 3KE2A 2XKPA 3G3ZA 2IP2A 3M1CA 4XKVA 2F5DA 2NOJB 2Y75A 2W85A 3BR5A 4KN4X 3RKYA 4RGRA 3RPUA 5LEJA 3LSGA 1WSUA 3GUDA 2DMPA 1SFUA 3CJTB 3KYDB 2H1KA 3FF5A 3F3XA 2EQRA 4YEJA 2IS6A 1QQIA 2ZBKA 3AG2H 3L2VA 2UWMA 2HOAA 1YX5A 3VYSB 5HVQC 4U87A 4L5EA 2ZNYA 4Y15A 3FXQA 1ZK8A 1X3UA 5EEHA 4O5VA 3CC4I 5J1YA 1SVMA 2BW3A 2NS7A 1O3TA 2BE5F 4IO9F 1QVTA 3W6KB 2OPTA 1G59A 4ZYAA 3BR1A 5HNFA 4ABZA 1I6HJ 5F6FA 3F8NA 3CO6C 1EV7A 4RAFA 1K6OA 2EFOA 3P9CA 3V8KA 3KIOA 2KL4A 3OOUA 1X4OA 2N8GA 4ON0A 1IRXA 3CLQA 3OSFA 3H3VK 3E5QA 4AC0A 1HW5A 1TWAJ 2RQQA 2ZSHB 4N4NB 1ZRCA 3HOYJ 5FJ8J 2X6YA 3WTUC 3GZNB 1LB2A 3TW6A 1YHQI 1QA6A 3SFIA 2CS3A 1IGNA 3E6DA 1MJBA 3PFYA 2A05A 3LA7A 5J40A 4AUXA 3CO7C 3F0CA 2X1DA 2R7WA 2GOXB 3ZMZA 3OYCA 3K2ZA 3BDDA 3MN2A 4IF4A 3VB2A 4KITB 4X0GA 1UG2A 2RN7A 3HGYA 2HQ5A 3LNQA 3Q0VA 1ZLJA 3BQZA 2H1LA 2Y9YA 3BCBA 5DS9A 3P7NA 4P9FA 2DMTA 3DF8A 3H3UA 1D5YA 3AL0C 1QZEA 2XPUA 3IL2A 3JRDA 4HRIA 4RGSA 4KNYA 4Q48A 3T8TA 3LL7A 3CMAI 2FQ3A 3K4CA 1I1SA 1ODDA 2ZXIA 3CUOA 2LY2A 3BG7A 1RUOA 5FFZA 1XTAA 4KYWA 1DPRA 1VNDA 1KU2A 1XDUA 2LF7A 3I59B 4JQFA 4AD9A 3L2QA 4G7HF 3Q0WA 1VTNC 1QZZA 3A03A 1R71A 2LOOA 1K4TA 2OV7A 2L7FP 1XSVA 2AQEA 5EDNA 4JX5A 2R7SA 5HOOA 2PFBA 3RDIA 4A6DA 3J81K 3FMSA 4A5MA 2XAQA 4YIRX 3JAMZ 3O6BB 3MKYB 2CUEA 2D1HA 1MNEA 2FQ4A 1Q1VA 5GPCA 1S5LC 2EBIA 3R0AA 3F8CA 5KAIC 5F0CA 5KNLA 1R5ID 3DTKA 2F6CA 4FT8A 1CQTA 4PJJA 3N4MA 5H6RA 5BQTA 1PDNC 2MW8A 4DBQA 2R5ZA 1I27A 3J7YJ 4LG0B 3SYTA 2GA1A 2L54A 2VBYA 2COMA 4BQOA 5ILVA 4XN0A 1FWZA 3HOXJ 5D8LB 2HDCA 3AKZA 3WU2C 1NG7A 2JPBA 2ZMEC 4FX4A 2DODA 3BPVA 3G4SI 3HOTA 1NK3P 2Z5UA 1SD5A 1ONVA 4PDKA 1BI3A 1MDMA 2EA2A 4RB2C 1IXCA 2IA2A 2K7LA 3ZQCA 1UHMA 4RM3A 3M7GA 4XLNF 2DPUA 4R79A 3T8RA 2K3FA 4P9UA 2OZUA 5HDKA 2EV6A 1AKHB 2ZC2A 3KCCA 3M1EA 4BXUA 3EDPA 4XLFA 1V54H 4YIFA 3VOEA 2HEOA 2CQNA 1XMAA 1WI9A 4CCMA 3ESWB 5FRNA 2VPLA 4GRIA 3WU1B 3ZP5A 5JR3A 4EGZA 1U0JA 1X3WB 1XC5A 2JPCA 4FE7A 1SD6A 1LDDA 1K7AA 3WG9A 1F5TA 2VC0A 4XQFA 1QBJA 3I4PA 2DOAA 1CGPA 2MSYA 3GTLJ 2DN0A 4XLHA 2V1XA 5F1JA 1A36A 3LQQA 5TJJA 3WHCA 4IRHA 3RKQA 1Y56A 2OCEA 3IRQA 3DFGA 4ZTJA 1ZG1A 1VQ9I 1FC3A 4BY1J 2KPMA 3I54A 4N4OB 3PJRA 1D8JA 5LBQA 1DDNA 1JT0A 2KQRA 1F43A 2KISA 3OV8A 1FT9A 1SAUA 4Y52J 1J5YA 2E1MB 1F36A 2JSPA 3E5UA 3PO2J 2F5CA 1RNLA 4HW0A 3O8GA 1JJ8C 1Z7LA 3LA2A 2QF7A 2W57A 2V9VA 4EM2A 4HF1A 4RAZA 4RB3C 2LSOA 2JWTA 1MSEC 2P6TA 2ME0A 2NOGA 4GYIA 4HNVA 2X4HA 4CUGA 2VT2A 3FDYA 4PSWA 1KQ9A 2KDOA 2ICWG 2XVCA 5K5RA 4A3IJ 2M34A 4NUBA 1R4NB 4PGHA 4HPQA 1J09A 1LDJA 2VI6A 3KP6A 4RLQA 3ERMA 3MKZA 1U8BA 2NVYJ 2DPDA 4LLNA 2VQLA 1OCZH 4M6XA 1YRNA 4HOBA 3EQLF 4RMNA 2E5NA 3FWEA 3S1MJ 2M4GA 2XAJA 4HV5A 1ZREA 5K5OA 1P7JA 1BN5A 3CC2I 2OQRA 2DK5A 2YU3A 3S2DJ 1YG2A 4DBRA 1UHSA 2FBKA 4AIJA 2MG4A 3HIFA 3IWFA 3WTXC 3K69A 2BY0A 4E7SA 3B73A 2R7RA 2P7CB 1RKTA 1BI1A 2QLZA 2DDBA 5C3EJ 3S16J 1QPIA 3CJRB 2XHKA 1S7EA 3P5JA 1B8IB 2R7TA 4GO1A 2TDXA 2L9VA 2BXZA 2XF6A 2Z9OA 4A3CJ 3ZQLA 2DA7A 3QOPA 5EJCA 3VSKA 1XMXA 3OYDA 4MQ9F 1EH6A 3KP2A 4HF0A 2CJJA 4EJVA 5F0HA 1EJ9A 4DOZA 4JBAA 1TT5B 4UNOA 1NK2P 3K1MA 1MW7A 3HL2A 4JYKA 1N75A 3TDZC 4CICA 1RESA 5KAFC 4BE1A 4D0PA 3KLNA 2EFQA 2XV4S 3G1OA 4WX9A 5D4SA 4DYCA 1A35A 2E71A 1O7LA 5H6QA 4AYBN 2JA2A 4HG2A 4XBFA 3ZMSA 3D5SC 1WCMJ 3CP2A 1XDSA 2WAFA 2CW0F 3HOUJ 5LRRA 2QZ8A 1MMSA 4G9YA 3KPHA 3R4KA 3CDHA 1PJRA 4AM3A 3HHGA 2W1OA 3FM3A 1WJ5A 3JRBA 2QWWA 1Z9CA 3DEUA 4BHCA 1UAAA 2DA1A 2JA5J 3E6MA 2GXGA 2KZVA 5TISC 5E1WA 4L0ZB 2FUG2 4P5OA 2QQBA 1ETXA 4KA4A 1IV6A 3KLOA 4XK4A 3GTGJ 3BT9A 3PQKA 3L7WA 2MD0A 4BH9A 1T0FA 4HYEA 1TWCJ 4P96A 3MKWB 5B66C 3S8PA 2VXZA 2YR2A 5M3FJ 1Z21A 1J75A 1IRZA 3IC7A 1OLTA 3FXOA 5HLHA 2ZSIB 2NRAC 2QA4I 4EQQA 4YFNF 3D1NI 4EVIA 2L3DA 5HNHA 3BTCA 3DP7A 3W2VA 3TO6A 4HSTA 4MNUA 5JLXA 4II2A 2VKDA 4NHJA 2XASA 4A0XA 2E2JJ 5E79C 3GYHX 1T0FC 2GXAA 3CMYA 1VZ0A 2NVXJ 3DU5A 3HXLA 5IYCJ 1UCRA 1BA5A 3I4MJ 2IGKA 4BKXA 2KIMA 2Q2EB 4B48A 2WY8Q 3A0BC 1ULYA 1SFOJ 4IHVA 1BW5A 1AA7A 3J81Z 3ASNH 1K78A 2K9NA 4YRVA 1IG7A 4GXOA 2KRHA 5K7FA 4GDFA 3L1PA 3N05A 3FIWA 1CF7A 2DJNA 4EMSA 1W0UA 4XKBA 5L3BA 5FKKA 2YX7A 3NQOA 2FNPA 3O2PE 4J01A 3RKXA 3PM1A 2LREA 1S72I 4NC6A 3HJEA 2Z16A 2UXNA 3IV5A 3RYPA 4PK4A 4QPOA 1W36D 3K4LA 1V4RA 1I5ZA 1O57A 4OIPF 4A3BJ 5BNGA 3I53A 4CCJA 2LNBA 4C30A 2LLKA 4LIUA 5B3SH 3DV8A 5GTIC 1LE8B 2OJED 5BOXA 2LK2A 2NS0A 4IPAA 1MBKA 3FKJA 4NQWB 3U1KA 1P6RA 3HRSA 2E60A 3OR1C 3F6VA 4HDUA 3BR6A 4XSXF 4E4HA 2V6CA 3RZOJ 2YSRA 3DEWA 2I5UA 4ITVA 1UHWA 2LBFB 1Z1DA 5HLGA 1MZBA 4Y13A 1A5JA 1FMVA 4PSXA 3HZJA 2UXXA 1TWHJ 2QCOA 5D6EA 1I3AA 1X2NA 1RC9A 3DLLF 4BE2A 2R7DA 5FLVA 2DYSH 3U1DA 2DA6A 5B1AH 2ZCWA 1I6XA 1LFBA 2R92J 4A3JJ 2AO9A 4TV7A 1WKMA 3QU3A 2HS5A 2KJBA 2ADUA 2ZXHA 4QWQA 1ENHA 2GM4A 4H4KC 2CMPA 1R1UA 1QRYA 4U7DA 2M8EA 3HGGA 3LAPA 2LTPA 4KIBA 4G7ZF 3TEDA 5GAHJ 1A6IA 5KHDA 2VB6A 1XB4A 2IPQX 2IXSA 2ZFUA 1JGSA 3IHUA 3K4KA 5CVUA 2VODA 1QZYA 3H9GA 3S17J 5GADJ 3OL3A 1JTYA 3HOZJ 3CD6I 3BR3A 1YLFA 3QPLA 3AG1H 1FYKA 2W48A 3DKYA 3BG5A 3CUQB 2EK5A 3WU0A 1D1AA 3QP5A 4UUTA 2B9SA 2ZXWH 3VWBA 4DW6A 2DAOA 1YI2I 1U2WA 1FP2A 2Z2SB 3HSRA 4XIDA 1JKRC 4IKFA 3K4NA 2PLYA 2HYGD 1VQ5I 3L2UA 4EGYA 1WRJA 4LITA 4PFPA 1GV2A 3CCQI 3FXRA 3H36A 3ASOH 2HQAA 4P1WA 3FMQA 2XPVA 1IAWA 5LGUA 3ECHA 1S29A 1ORKA 4KDPA 4F3QA 4EV0A 2H09A 1OYWA 2VQCA 3PNVA 3OYNA 3CJNA 4B8XA 4J00A 2A5WA 1PVEA 5FKOA 5LHIA 1R5HA 2OD5A 1LEBA 3FHNA 3JSPA 1M1EB 2K9LA 2ISZA 2BZTA 4CYCB 2GIVA 2X1EA 3OY9A 1MMNA 1B9NA 3I59A 2JTVA 4A3MJ 2XGCA 2HWVA 2DT5A 3D5LA 4OIRF 4FE4A 5E8IA 4IOCF 5HDGA 2BHZA 2LR8A 3R61A 4DGWB 1E0EA 3KZZA 1VQ4I 4MEYF 3OYLA 3U2RA 4QTRA 2MABA 3K2AA 1XGOA 2WB1A 1U5TB 2DCEA 2H6BA 4MFEA 4GYGA 1MSFC 2EZHA 2VBZA 2IVMA 3KZYA 3SDBA 5EG0B 1HSTA 2XSDC 1J59A 5L3CA 3DTIA 2QSGX 2Q0OA 3K70D 3BTLA 2PMZN 2HVQA 2HOSA 4Q5SF 3IH2A 3HKZA 2HTJA 4RGXA 1RR8C 3DBRB 3VODA 1MNDA 2P5LC 3PQJA 4LG0A 3ZN1A 2K85A 4XOTA 4C9YA 3BP8A 3P9IA 2BV6A 3DLAA 3I58A 3S14J 1WH5A 4IHWA 2P5VA 1IXSB 3S1RJ 3CDLA 2R7ZJ 1PP8F 2DOEA 3OYMA 2GAUA 2M0MA 1RPWA 4A2UA 4LIVA 3V42A 3WGGA 2R5YB 4RAYA 4YG2F 2HPMA 2NVTJ 2BY1A 1NHAA 3ABTA 2L01A 3Q0UA 4YFXF 2DFIA 2QKLB 2DLLA 4A12A 1IJWC 2Y30A 5HODA 3CCRI 3AG4H 1D0ZA 2CQXA 1DPUA 3ONQA 4XOPA 1MBGA 4E7JA 4M73A 4L9TA 2HNHA 3HPGA 3GTPJ 2QQ9A 1O3SA 1DQUA 3NEUA 1AKHA 2DYRH 3H5NA 2GLOA 2VASA 5ED4A 1ZR2A 1U8RA 3KFWX 5TRDA 2RNGA 5CLSA 4M72A 3HB9A 4CCNA 4HBLA 3LWFA 2JVHA 4OAYA 4G94A 4MEXF 3H9JA 3SZPA 3J7ZI 2R93J 2QGUA 3S2WA 2EV0A 1R6RA 2W82A 3TL4X 4E7ZA 3OYAA 1K83J 4M3BA 1IXRC 2VQHA 2LD5A 3HSFA 4BQQA 3WTYC 4ZYGA 3HOWJ 3H9QA 2FJ1A 4LD5A 1D0XA 2VE8A 4D7MA 4II3A 2L2OA 3E6BA 4MHGA 4PJMA 1RRJA 5J6XA 1D1BA 4R8HA 2AHQA 3R60A 3EYIA 2EA4A 1N78A 2DXIA 3ZRGA 3BTIA 2LKPA 1DUXC 2O7OA 4CHUA 4ESBA 2VOPA 2M0CA 3JTHA 4XLCA 5GAGJ 4G6QA 5FB2A 3IH3A 1XCBA 3TOAA 2R7XA 4ZYEA 2LKXA 1HW1A 1FJLA 2KIUA 2MGQA 4UB8C 1JHFA 1X1PA 2E35A 2JK3A 3HSEA 1TBXA 4Y7NJ 1SD7A 3MZYA 5CKTA 3LOCA 5F64A 3JRHA 2XKOA 1H88C 3H1CA 1XSDA 1Q1HA 3S1QJ 2IS2A 2VKHA 1R1VA 3BLYA 3OWTA 5J1UA 4A69C 1R58A 1OYIA 2V7FA 3QPTA 3ABKH 4WXHA 5L3FA 2Y0MA 1F4KA 1APLC 3FBNB 2X6XA 2EB7A 4B43A 4IQJA 4X6AJ 5HS7A 1FMWA 5LGNA 1HDPA 1WJEA 4JX4A 1W7PA 3OIPA 5M5XJ 1SVOA 3ZQ7A 5DM7F 2PMHA 3ELKA 1D5VA 1F1ZA 2MLKA 4HSRA 4YELA 1JTXA 4A93J 2CQKA 4NDLA 4UUSB 4E7IA 1JHHA 3ZXSA 2P6SA 4GCVA 4U0WA 4D5CA 2XDVA 5JVTA 1OCTC 1HSJA 4I7HA 4AIKA 1XN7A 5GTHC 4BXXJ 4I09A 2V79A 3S3MA 4I2OA 3NWSA 3QYEA 3FHZA 2DA2A 3IAS2 4CGZA 3DKWA 3F22A 3E6CC 3BY6A 3BJOA 4MTDA 1VQNI 3ZR8X 1V5EA 4J19A 5IP7J 4HQMA 1YX3A 4O3MA 3V7RA 5ILUA 1OCOH 3F9KA 3E1SA 1BI0A 1GHCA 2E7XA 3E7LA 1YJNI 3KETA 3GFJA 4KN7X 3T0YA 1B8IA 4BUPA 3CCUI 1B72B 3PUBA 2MFZA 1WWXA 1FP1D 2NVUB 1PUFB 1DP7P 3HTSB 1TNSA 2KP6A 1JKQC 2KRFA 5AIQA 4F52A 5IY5H 1LVAA 3CCEI 2Z99A 2E34A 3LMMA 2VJ5A 3ABUA 2JSCA 2A5YB 1YIJI 1G4DA 2Y0SA 4NBQA 2ETHA 2BVMA 4Z6YA 4I01A 3QAHA 2HQRA 2L4MA 1WH7A 2HGCA 4V2GA 3TW7A 1GXQA 2CW8A 4EJOA 2VKVA 2XAGA 2DOFA 3DCFA 3GZ6A
chains in the Genus database with same CATH topology
2BYVE 1RUNA 1QPMA 3HTUA 2VBWA 5E20A 1U3EM 3PFIA 5E1XA 5ERIA 5DYMA 2QUFA 4LB5A 2HR3A 2DQLA 1H9GA 1L0OC 4AIHA 3IRRA 3QU6A 3L00A 1HKSA 4IHSA 5LEKA 3MZHA 1XGMA 2PBIA 3V4GA 1W5TA 2HQNA 3T5XA 3DXJF 4HX4A 1USSA 3W6JB 5DD4A 2QBYB 1IW7F 4I98B 4GGGA 2FRHA 5KK1A 3GXOA 4Y17A 1S6LA 2FMLA 5FFXA 2UZKA 4A0YA 1U6GA 1HKQA 1TW3A 5E18F 4RGUA 1OKRA 2EFPA 5D5UB 2XROA 1S3JA 4N9HA 3FM5A 5HS9A 3BZ6A 1MKMA 2P7VB 5F1RA 1USTA 5K5QA 3BROA 3KEOA 2HOEA 5D5WB 2CO5A 1ZARA 5CJ9A 2KIFA 2P8TA 1FSEA 3TO9A 4OU0A 2MH2A 2CSOA 3LFKA 5CVJA 3SZTA 4MTEA 1FLIA 2G7HA 1BIAA 1HW2A 2VN2A 4HA8A 2ISYA 4KMFA 1UB9A 2DU9A 2DW4A 1XSXA 2XRNA 2HYFA 1ZG5A 4M74A 1B6AA 1JE8A 3ZPLA 3GWZA 1KA8A 1D3YA 2OZ6A 2RC4A 5DCMB 3GVAA 1R7JA 2NAZA 3HUGA 3C1DA 1OPCA 4RB0A 4LMYA 5IT3A 2PMUA 4U0VA 1P4WA 3ROUA 1YW9A 3MQ0A 3DPTA 4L9NA 3OOPA 4QLCU 3M8EA 5ICFA 4FHTA 5JHUA 1ZHFA 3F23A 1L3LA 3GFLA 2W24A 1SD4A 4Q4ZF 4HDVA 3CUQA 4ETSA 3FMRA 1P4AA 5DD8A 3J80Z 2NNNA 4HV6A 2F2EA 5L3GA 4RS8A 1YW8A 3C3WA 5FD5A 3WTVC 2ZMEB 5D5XB 1YQAA 3SHFA 1Z05A 4BYYA 4LLGF 2X0LA 3EUHA 1YS7A 3J7AO 3C7JA 4EJTA 2ZJ2A 1V3FA 5DEQA 3ZMDA 1GXPA 4XSZF 1REPC 4ASNA 3KP4A 1TLHB 1WQ2A 1RIOH 2NYXA 1B1BA 4Z2YA 4UHTA 1T39A 1S7AA 5D5VB 2L02A 2CFXA 4MGRA 4CDGA 1OR7A 4IJAA 4BQAA 4WK8F 1MDMB 2JT1A 2FNAA 2ZXJA 2WTEA 3IKTA 4ZZLA 3ML6A 1A04A 1P4XA 1LNWA 3CTAA 4EJWA 4KMUX 2V1UA 2DTRA 3QP6A 3ULQB 2A61A 4OMYA 3WGHA 1G3SA 5CVIA 4M9XA 1BM9A 1ZAOA 1IRGA 3LA3A 2BBYA 4E70A 4F7ZA 2GWRA 4YFKF 4KFCA 3K1PA 3F8BA 1SFXA 4LK0F 2RNJA 2M5WA 2A68F 1KU9A 3LQRA 1XD7A 5BPDA 2JZYA 2Y48A 4EM0B 5JFRA 5ICEA 4S04A 1Y0UA 2D45A 4I02A 1YYVA 4BHPA 1FBUA 2W84A 3HRUA 1TNTA 1RI7A 2ESHA 2K27A 3T1BA 1J9IA 2IRFG 4CYDA 3RPQA 1SFEA 3HRMA 1SAXA 3RI4A 2VT3A 5A2QZ 1ON1A 1LEAA 2RDPA 4HX8A 2FSWA 2MA3A 2CGPA 1FPQA 3H3ZA 2ZFWA 1J7KA 3V8LA 3RJPA 1H9TA 4ESFA 3DQVC 2W25A 3L2CA 1YFHA 3R6SA 5BPIA 1Z91A 2AXLA 1EH7A 3V7SA 5IT9Z 1W5SA 5EEGA 4IVNA 5CVRA 1STZA 4AWXB 2H94A 3KP7A 3GX4X 1IRFA 3KP5A 3Q9SA 2GA2A 1ZN2A 2WV0A 3IKVA 3ISPA 3MFKA 5CVVA 5DUKA 4HQEA 4CZZA 4HF2A 3FX3A 2A3SA 4PGGA 2XAFA 1R22A 1KYZA 3MWMA 5LRSA 3GO5A 3BWGA 4DNCA 3B02A 2K02A 2HKOA 2VONA 1OYYA 2RV8A 1YIOA 2OQGA 4L18B 4G7OF 2YX4A 3MCZA 2M30A 1YS6A 2DI3A 2D2WA 4HX7A 5ICGA 1Z6RA 2PN6A 1O3QA 2GZWA 2ACJA 4OINF 5BS6A 1UFMA 2CG4A 2EJRA 1YTYA 4Q47A 1Z7UA 1K78B 1ZRDA 1RZ4A 3ZN0A 2OBPA 1OMIA 4UVCA 1CF7B 2FOKA 3ZMTA 2O3FA 2F5EA 2O03A 4PZJA 1IN6A 2JRTA 1E2XA 5KVRA 4BAYA 3F21A 2GXBA 3LSTA 1G3WA 2WC2A 2R3SA 1TTYA 5DCFA 1O7FA 1KU7A 2GQQA 4G6DA 4S05A 1FYMA 4LB6B 4EM1A 4MQVA 1BC7C 2FF4A 3K9TA 2OU2A 3JSOA 5K1YA 3COAC 3WE2A 3Q5FA 4BNCA 3J80K 3FZVA 3GW2A 1IN5A 3R0JA 4PCQA 5DDGA 2NNYA 4HLYA 5FD6A 1P2FA 1EH8A 4U7BA 4N9IA 4OMZA 4R1HA 4L9JA 4RB1A 3TKYA 4AVPA 4O6JA 3F8MA 2R7FA 1FOKA 2VOOA 1O3RA 4KIGA 3REOA 1MJAA 2EWNA 3SFZA 2IJLA 5D6FA 4G8XA 4WCGA 1ZRFA 5DCMA 3O3KA 2F5FA 1FY7A 2FE3A 4HZFA 4WWCA 2FMYA 1KGSA 4IRIA 2OA4A 1QGPA 2OAZA 1LJ9A 1JXSA 1K79A 4CXFA 3RKWA 1R5GA 3BPXA 2A69F 2J5PA 2E1NA 3EETA 1S7OA 3ECOA 5CYVA 4I0BA 3KEQA 3WTSC 4OIQF 3KP3A 3TOBA 1QNTA 2H27A 1KQ0A 2YPRA 2MC3A 2G7UA 2O0YA 2O8XA 4XRFA 4UV8A 2ZMEA 3GZ5A 6PAXA 1SMYF 3K1NA 4ZYHA 2PJPA 3N97A 4M9ZA 2AS5F 2FU4A 4L5IA 4LLLA 1R23A 3RTRA 4OIOF 1TQPA 1KU3A 1BIBA 3WODF 1IN4A 5DV5A 2DQRA 3WTWC 2A6HF 1TW2A 4HAMA 1G3YA 1FBQA 1SMTA 4KIFA 3ZMUA 4UVBA 3M9AA 2PEXA 2E1CA 1IF1A 2LDUA 2RVCA 5A2QK 3I71A 1B9MA 2Q2EA 3E97A 4XLPF 3NRVA 1J0RA 2MBFA 1BBYA 5D8KB 2DBBA 2HFHA 3GFMA 3GF2A 1T6SA 3F72A 2DO7A 3I64A 5FLXK 3HOSA 1E17A 2B0LA 2CYYA 5IT9K 1AOYA 4LJZF 1FNNA 1R00A 3DPLC 2V1DA 3VEPA 1C0WA 4OOIA 4ENMA 1LDKB 3RIRA 4KICA 1ZG3A 2Q8KA 2FBHA 4I0AA 1MJ9A 2LF8A 4NQWA 2FA5A 1HQCA 1FZPB 3BJAA 3AAFA 1R1TA 3VFZA 1H0MA 1W7PB 2QENA 3MEXA 4JK1X 3ERED 3TQNA 2DK8A 5DUIA 4WXDA 4M71A 2H6CA 2M1BA 3U9GA 3JW4A 2RKHA 2E7WA 2G9WA 5L3DA 2HZTA 4UV9A 2VE9A 4A5NA 1LQ1A 2XIGA 1B4AA 5HLIA 4UXNA 1BI2A 2XAHA 3Q9VA 2C6YA 4BHBA 3L09A 4H0EA 1GVJA 5LGTA 3CUQC 1G3TA 1ZGAA 3E5XA 3QPHA 3FXUA 2A6EF 1QO0D 2BGCA 1IZ1A 3BOQA 1J2XA 5H20A 2RGVA 2MLGA 1ZLKA 5JI6A 3E3VA 4L9VA 1U78A 2IT0A 3WTZA 4ENJA 4UVAA 3SQNA 2K4JA 3L9FA 2M87A 1KQ8A 2PQ8A 2VBXA 2BEOA 1U5TA 4LGWA 1FSHA 2D1VA 1BC8C 2ELHA 1XGSA 1T98A 2P5KA 1ZYRF 2ZKZA 1B59A 4A0ZA 2IW5A 1XMKA 1FX7A 5AONA 3V7CA 1U5TC 2QQAA 3TGNA 1XCVA 5J8CA 4ZYDA 1R36A 2CWEA 3SXYA 1ZH5A 3WTTC 2PI0A 3TO7A 3JTGA 2FBIA 5HDNA 2Z3YA 2EV5A 3P9KA 5FGMA 4M6YA 2STWA 3F6OA 3M8FA 2HKXA 1BJAA 4M9SA 2RQPA 3HYIA 3HRTA 3K0LA 3H92A 5LHGA 1S8NA 4IRGA 1I1GA 2EFNA 2L4AA 3ZMVA 4WF2A 4L5JA 2J5OA 4DQ2A 2WWYA 1YO5C 1TQIA 2EFWA 4LK1F 5LHHA 2VC1A 2KKOA 4IXAA 4CO8A 2K86A 4U88A 2IA0A 5E8GA 3EYYA 4L0YB 4UUVA 4ZZDA 2IA1A 4YIIA 4ESJA 3LAJA 5L3EA 1T2KA 5E17F 3JAMK 2HTSA 1HKTA 4KUMA 1PP7U 1PUEE 3C18A 3V8JA 5FLXZ 2MD5A 4A6EA 3MAJA 2KJCA 1D8KA 2M45A 2FEZA 1P92A 3BJ6A 4ENNA 5ILSA 2PG4A 4KT5C 1IN7A 5AIPA 2ESNA 1KYWA 2A07F 3WGIA 3GFIA 1YW7A 1W4MA 5FO5A 2ZNZA 3GEZA 1IUYA 4N0BA 2FXAA 4FX0A 3WE3A 1XGNA 3D0SA 4ZH4F 5BMZA 1ZGJA 1G6NA 1FYLA 2XGXA 2O61A 1W7PD 1MD0A 3G73A 3TDUC 4P55A 4HLXA 5E1ZB 1FBSA 2K4BA 4LFUA 3QRFF 2O6GE 3IWZA 4WXCA 5HS8A 1HXDA 2Z33A 4IHTA 2ZO4A 1ON2A 4NB5A 1AWCA 3I0TA 3F8FA 5J8FA 5ICCA 4K2EA 4ENKA 2MH9A 2STTA 1MGTA 2QVOA 3CLOA 1T38A 4EJUA 2QYOA 1F9NA 2P4WA 5D4RA 1IN8A 1HBXG 2QBYA 2XUBA 4B09A 3RYRA 3I5UA 1BOAA 1TQMA 5LLQA 2QM3A 3HHHA 4U0YA 1Z6TA 3KE2A 2XKPA 3G3ZA 2IP2A 2F5DA 2Y75A 2W85A 4KN4X 3RKYA 3RPUA 4RGRA 5LEJA 1WSUA 3GUDA 1SFUA 3FF5A 3F3XA 1QQIA 2ZBKA 2UWMA 5HVQC 2ZNYA 4Y15A 3FXQA 1X3UA 5EEHA 4O5VA 1O3TA 2BE5F 3W6KB 5F6FA 3F8NA 3CO6C 1EV7A 1K6OA 2EFOA 3P9CA 3V8KA 4ON0A 3E5QA 1HW5A 1ZRCA 3WTUC 1LB2A 3E6DA 1MJBA 3LA7A 3CO7C 3ZMZA 3K2ZA 3BDDA 4IF4A 3VB2A 2RN7A 1ZLJA 3P7NA 4P9FA 3DF8A 3H3UA 3IL2A 4RGSA 4KNYA 4Q48A 3T8TA 2FQ3A 1I1SA 1ODDA 3CUOA 1RUOA 5FFZA 4KYWA 1DPRA 1KU2A 4G7HF 1VTNC 1XDUA 2LF7A 3I59B 4JQFA 4AD9A 1QZZA 1XSVA 5HOOA 2PFBA 3RDIA 4A6DA 3J81K 3FMSA 4A5MA 2XAQA 3JAMZ 3O6BB 2D1HA 3R0AA 3F8CA 4FT8A 3N4MA 5H6RA 5BQTA 1PDNC 1I27A 4LG0B 2GA1A 2L54A 2VBYA 2COMA 5ILVA 1FWZA 2HDCA 5D8LB 2JPBA 4FX4A 3BPVA 3HOTA 2Z5UA 1SD5A 1ONVA 4PDKA 1BI3A 1MDMA 2EA2A 4RB2C 1IXCA 2IA2A 2K7LA 1UHMA 3M7GA 4XLNF 2DPUA 4R79A 3T8RA 4P9UA 2OZUA 5HDKA 2EV6A 3KCCA 3M1EA 4BXUA 3EDPA 4YIFA 3VOEA 2HEOA 1XMAA 1WI9A 3WU1B 3ZP5A 5JR3A 4EGZA 2JPCA 1K7AA 1SD6A 1LDDA 1F5TA 3WG9A 2VC0A 1QBJA 3I4PA 1CGPA 2V1XA 3LQQA 5TJJA 4IRHA 3IRQA 3DFGA 1ZG1A 1FC3A 3I54A 1D8JA 5LBQA 1DDNA 3OV8A 1FT9A 1J5YA 3E5UA 2F5CA 1RNLA 4HW0A 3LA2A 2W57A 2V9VA 4EM2A 4HF1A 4RAZA 4RB3C 2LSOA 2P6TA 4GYIA 2X4HA 2VT2A 1KQ9A 2XVCA 5K5RA 4PGHA 1LDJA 3KP6A 2DPDA 4LLNA 4M6XA 4HOBA 3EQLF 3FWEA 2XAJA 4HV5A 1ZREA 5K5OA 1BN5A 2OQRA 2DK5A 2YU3A 1YG2A 2FBKA 4AIJA 3HIFA 3IWFA 3WTXC 3K69A 3B73A 2P7CB 1BI1A 2QLZA 2XHKA 4GO1A 2TDXA 2Z9OA 3QOPA 4MQ9F 1EH6A 3KP2A 4HF0A 4EJVA 4JBAA 4UNOA 3K1MA 4CICA 3TDZC 4D0PA 3KLNA 2EFQA 2XV4S 4WX9A 5D4SA 1O7LA 5H6QA 4XBFA 3ZMSA 1XDSA 2CW0F 5LRRA 2QZ8A 4G9YA 3R4KA 3CDHA 3HHGA 3FM3A 2QWWA 1Z9CA 3DEUA 4BHCA 3E6MA 2GXGA 5E1WA 4L0ZB 4P5OA 2QQBA 4KA4A 3KLOA 3PQKA 3L7WA 4BH9A 1T0FA 4HYEA 4P96A 2VXZA 2YR2A 1J75A 3IC7A 5HLHA 2NRAC 4EQQA 4YFNF 4EVIA 2L3DA 3DP7A 3TO6A 4MNUA 4NHJA 2XASA 4A0XA 3GYHX 1UCRA 2KIMA 1ULYA 3J81Z 1K78A 4GXOA 1CF7A 4EMSA 5L3BA 2YX7A 3NQOA 2FNPA 3O2PE 3RKXA 2UXNA 3RYPA 1V4RA 1I5ZA 1O57A 4OIPF 3I53A 2LNBA 3DV8A 5BOXA 2NS0A 4IPAA 1P6RA 3HRSA 3F6VA 4HDUA 4XSXF 2V6CA 2YSRA 1UHWA 1Z1DA 5HLGA 1MZBA 4Y13A 2UXXA 5D6EA 2R7DA 3U1DA 2ZCWA 1I6XA 4TV7A 1WKMA 3QU3A 2HS5A 2KJBA 2ADUA 4QWQA 1R1UA 4U7DA 2M8EA 3LAPA 4KIBA 4G7ZF 1XB4A 2IPQX 1JGSA 3IHUA 5CVUA 2VODA 1QZYA 1YLFA 1FYKA 3CUQB 2EK5A 3WU0A 3QP5A 2DAOA 1U2WA 1FP2A 3HSRA 2PLYA 2HYGD 4EGYA 1WRJA 3FXRA 3FMQA 1IAWA 5LGUA 3ECHA 1S29A 4KDPA 4EV0A 2H09A 1OYWA 3CJNA 4B8XA 5LHIA 1R5HA 2OD5A 1LEBA 3JSPA 2ISZA 2GIVA 1B9NA 3I59A 2JTVA 2HWVA 2DT5A 3D5LA 4OIRF 5E8IA 5HDGA 3R61A 3KZZA 4MEYF 3U2RA 1XGOA 1U5TB 2H6BA 4GYGA 2VBZA 2IVMA 3KZYA 1HSTA 1J59A 5L3CA 2Q0OA 4Q5SF 2HTJA 4RGXA 3VODA 2P5LC 3PQJA 4LG0A 3ZN1A 3BP8A 3P9IA 2BV6A 3I58A 2P5VA 1IXSB 1PP8F 2GAUA 4A2UA 3WGGA 4RAYA 4YG2F 1NHAA 3ABTA 2L01A 4YFXF 2DFIA 2DLLA 4A12A 1DPUA 4M73A 4L9TA 2QQ9A 1O3SA 3NEUA 5ED4A 1U8RA 3KFWX 5TRDA 5CLSA 4M72A 4HBLA 3LWFA 4G94A 4MEXF 3SZPA 3S2WA 2EV0A 1IXRC 3HSFA 3WTYC 4ZYGA 4LD5A 2VE8A 3E6BA 4MHGA 5J6XA 4R8HA 3R60A 3EYIA 2EA4A 2LKPA 1DUXC 4CHUA 4ESBA 2VOPA 3JTHA 4G6QA 5FB2A 1XCBA 3TOAA 4ZYEA 1HW1A 2KIUA 1JHFA 3HSEA 1TBXA 1SD7A 3MZYA 5F64A 2XKOA 1XSDA 1Q1HA 1R1VA 1R58A 1OYIA 3QPTA 5L3FA 4WXHA 2Y0MA 1F4KA 2EB7A 5HS7A 5LGNA 1W7PA 3ZQ7A 1D5VA 2PMHA 3ELKA 1F1ZA 2MLKA 2CQKA 1JHHA 2P6SA 4GCVA 4U0WA 5JVTA 1HSJA 4I7HA 4AIKA 1XN7A 4I09A 2V79A 4I2OA 3FHZA 4CGZA 3DKWA 3F22A 3E6CC 3BY6A 3BJOA 4MTDA 4HQMA 4O3MA 3V7RA 5ILUA 1BI0A 1GHCA 2E7XA 3KETA 3GFJA 4KN7X 3T0YA 1WWXA 1FP1D 3HTSB 1DP7P 1TNSA 2KRFA 5AIQA 1LVAA 2Z99A 3ABUA 2JSCA 2A5YB 1G4DA 2ETHA 4I01A 3QAHA 2HQRA 2L4MA 2HGCA 1GXQA 4EJOA 2XAGA 3GLXA 3GZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYV E;  1RUN A;  1QPM A;  3HTU A;  2VBW A;  5E20 A;  1U3E M;  3PFI A;  5E1X A;  5ERI A;  5DYM A;  2QUF A;  4LB5 A;  2HR3 A;  2DQL A;  1H9G A;  1L0O C;  4AIH A;  3IRR A;  3QU6 A;  3L00 A;  1HKS A;  4IHS A;  5LEK A;  3MZH A;  1XGM A;  2PBI A;  3V4G A;  1W5T A;  2HQN A;  3T5X A;  3DXJ F;  4HX4 A;  1USS A;  3W6J B;  5DD4 A;  2QBY B;  1IW7 F;  4I98 B;  4GGG A;  2FRH A;  5KK1 A;  3GXO A;  4Y17 A;  1S6L A;  2FML A;  5FFX A;  2UZK A;  4A0Y A;  1U6G A;  1HKQ A;  1TW3 A;  5E18 F;  4RGU A;  1OKR A;  2EFP A;  5D5U B;  2XRO A;  1S3J A;  4N9H A;  3FM5 A;  5HS9 A;  3BZ6 A;  1MKM A;  2P7V B;  5F1R A;  1UST A;  5K5Q A;  3BRO A;  3KEO A;  2HOE A;  5D5W B;  2CO5 A;  1ZAR A;  5CJ9 A;  2KIF A;  2P8T A;  1FSE A;  3TO9 A;  4OU0 A;  2MH2 A;  2CSO A;  3LFK A;  5CVJ A;  3SZT A;  4MTE A;  1FLI A;  2G7H A;  1BIA A;  1HW2 A;  2VN2 A;  4HA8 A;  2ISY A;  4KMF A;  1UB9 A;  2DU9 A;  2DW4 A;  1XSX A;  2XRN A;  2HYF A;  1ZG5 A;  4M74 A;  1B6A A;  1JE8 A;  3ZPL A;  3GWZ A;  1KA8 A;  1D3Y A;  2OZ6 A;  2RC4 A;  5DCM B;  3GVA A;  1R7J A;  2NAZ A;  3HUG A;  3C1D A;  1OPC A;  4RB0 A;  4LMY A;  5IT3 A;  2PMU A;  4U0V A;  1P4W A;  3ROU A;  1YW9 A;  3MQ0 A;  3DPT A;  4L9N A;  3OOP A;  4QLC U;  3M8E A;  5ICF A;  4FHT A;  5JHU A;  1ZHF A;  3F23 A;  1L3L A;  3GFL A;  2W24 A;  1SD4 A;  4Q4Z F;  4HDV A;  3CUQ A;  4ETS A;  3FMR A;  1P4A A;  5DD8 A;  3J80 Z;  2NNN A;  4HV6 A;  2F2E A;  5L3G A;  4RS8 A;  1YW8 A;  3C3W A;  5FD5 A;  3WTV C;  2ZME B;  5D5X B;  1YQA A;  3SHF A;  1Z05 A;  4BYY A;  4LLG F;  2X0L A;  3EUH A;  1YS7 A;  3J7A O;  3C7J A;  4EJT A;  2ZJ2 A;  1V3F A;  5DEQ A;  3ZMD A;  1GXP A;  4XSZ F;  1REP C;  4ASN A;  3KP4 A;  1TLH B;  1WQ2 A;  1RIO H;  2NYX A;  1B1B A;  4Z2Y A;  4UHT A;  1T39 A;  1S7A A;  5D5V B;  2L02 A;  2CFX A;  4MGR A;  4CDG A;  1OR7 A;  4IJA A;  4BQA A;  4WK8 F;  1MDM B;  2JT1 A;  2FNA A;  2ZXJ A;  2WTE A;  3IKT A;  4ZZL A;  3ML6 A;  1A04 A;  1P4X A;  1LNW A;  3CTA A;  4EJW A;  4KMU X;  2V1U A;  2DTR A;  3QP6 A;  3ULQ B;  2A61 A;  4OMY A;  3WGH A;  1G3S A;  5CVI A;  4M9X A;  1BM9 A;  1ZAO A;  1IRG A;  3LA3 A;  2BBY A;  4E70 A;  4F7Z A;  2GWR A;  4YFK F;  4KFC A;  3K1P A;  3F8B A;  1SFX A;  4LK0 F;  2RNJ A;  2M5W A;  2A68 F;  1KU9 A;  3LQR A;  1XD7 A;  5BPD A;  2JZY A;  2Y48 A;  4EM0 B;  5JFR A;  5ICE A;  4S04 A;  1Y0U A;  2D45 A;  4I02 A;  1YYV A;  4BHP A;  1FBU A;  2W84 A;  3HRU A;  1TNT A;  1RI7 A;  2ESH A;  2K27 A;  3T1B A;  1J9I A;  2IRF G;  4CYD A;  3RPQ A;  1SFE A;  3HRM A;  1SAX A;  3RI4 A;  2VT3 A;  5A2Q Z;  1ON1 A;  1LEA A;  2RDP A;  4HX8 A;  2FSW A;  2MA3 A;  2CGP A;  1FPQ A;  3H3Z A;  2ZFW A;  1J7K A;  3V8L A;  3RJP A;  1H9T A;  4ESF A;  3DQV C;  2W25 A;  3L2C A;  1YFH A;  3R6S A;  5BPI A;  1Z91 A;  2AXL A;  1EH7 A;  3V7S A;  5IT9 Z;  1W5S A;  5EEG A;  4IVN A;  5CVR A;  1STZ A;  4AWX B;  2H94 A;  3KP7 A;  3GX4 X;  1IRF A;  3KP5 A;  3Q9S A;  2GA2 A;  1ZN2 A;  2WV0 A;  3IKV A;  3ISP A;  3MFK A;  5CVV A;  5DUK A;  4HQE A;  4CZZ A;  4HF2 A;  3FX3 A;  2A3S A;  4PGG A;  2XAF A;  1R22 A;  1KYZ A;  3MWM A;  5LRS A;  3GO5 A;  3BWG A;  4DNC A;  3B02 A;  2K02 A;  2HKO A;  2VON A;  1OYY A;  2RV8 A;  1YIO A;  2OQG A;  4L18 B;  4G7O F;  2YX4 A;  3MCZ A;  2M30 A;  1YS6 A;  2DI3 A;  2D2W A;  4HX7 A;  5ICG A;  1Z6R A;  2PN6 A;  1O3Q A;  2GZW A;  2ACJ A;  4OIN F;  5BS6 A;  1UFM A;  2CG4 A;  2EJR A;  1YTY A;  4Q47 A;  1Z7U A;  1K78 B;  1ZRD A;  1RZ4 A;  3ZN0 A;  2OBP A;  1OMI A;  4UVC A;  1CF7 B;  2FOK A;  3ZMT A;  2O3F A;  2F5E A;  2O03 A;  4PZJ A;  1IN6 A;  2JRT A;  1E2X A;  5KVR A;  4BAY A;  3F21 A;  2GXB A;  3LST A;  1G3W A;  2WC2 A;  2R3S A;  1TTY A;  5DCF A;  1O7F A;  1KU7 A;  2GQQ A;  4G6D A;  4S05 A;  1FYM A;  4LB6 B;  4EM1 A;  4MQV A;  1BC7 C;  2FF4 A;  3K9T A;  2OU2 A;  3JSO A;  5K1Y A;  3COA C;  3WE2 A;  3Q5F A;  4BNC A;  3J80 K;  3FZV A;  3GW2 A;  1IN5 A;  3R0J A;  4PCQ A;  5DDG A;  2NNY A;  4HLY A;  5FD6 A;  1P2F A;  1EH8 A;  4U7B A;  4N9I A;  4OMZ A;  4R1H A;  4L9J A;  4RB1 A;  3TKY A;  4AVP A;  4O6J A;  3F8M A;  2R7F A;  1FOK A;  2VOO A;  1O3R A;  4KIG A;  3REO A;  1MJA A;  2EWN A;  3SFZ A;  2IJL A;  5D6F A;  4G8X A;  4WCG A;  1ZRF A;  5DCM A;  3O3K A;  2F5F A;  1FY7 A;  2FE3 A;  4HZF A;  4WWC A;  2FMY A;  1KGS A;  4IRI A;  2OA4 A;  1QGP A;  2OAZ A;  1LJ9 A;  1JXS A;  1K79 A;  4CXF A;  3RKW A;  1R5G A;  3BPX A;  2A69 F;  2J5P A;  2E1N A;  3EET A;  1S7O A;  3ECO A;  5CYV A;  4I0B A;  3KEQ A;  3WTS C;  4OIQ F;  3KP3 A;  3TOB A;  1QNT A;  2H27 A;  1KQ0 A;  2YPR A;  2MC3 A;  2G7U A;  2O0Y A;  2O8X A;  4XRF A;  4UV8 A;  2ZME A;  3GZ5 A;  6PAX A;  1SMY F;  3K1N A;  4ZYH A;  2PJP A;  3N97 A;  4M9Z A;  2AS5 F;  2FU4 A;  4L5I A;  4LLL A;  1R23 A;  3RTR A;  4OIO F;  1TQP A;  1KU3 A;  1BIB A;  3WOD F;  1IN4 A;  5DV5 A;  2DQR A;  3WTW C;  2A6H F;  1TW2 A;  4HAM A;  1G3Y A;  1FBQ A;  1SMT A;  4KIF A;  3ZMU A;  4UVB A;  3M9A A;  2PEX A;  2E1C A;  1IF1 A;  2LDU A;  2RVC A;  5A2Q K;  3I71 A;  1B9M A;  2Q2E A;  3E97 A;  4XLP F;  3NRV A;  1J0R A;  2MBF A;  1BBY A;  5D8K B;  2DBB A;  2HFH A;  3GFM A;  3GF2 A;  1T6S A;  3F72 A;  2DO7 A;  3I64 A;  5FLX K;  3HOS A;  1E17 A;  2B0L A;  2CYY A;  5IT9 K;  1AOY A;  4LJZ F;  1FNN A;  1R00 A;  3DPL C;  2V1D A;  3VEP A;  1C0W A;  4OOI A;  4ENM A;  1LDK B;  3RIR A;  4KIC A;  1ZG3 A;  2Q8K A;  2FBH A;  4I0A A;  1MJ9 A;  2LF8 A;  4NQW A;  2FA5 A;  1HQC A;  1FZP B;  3BJA A;  3AAF A;  1R1T A;  3VFZ A;  1H0M A;  1W7P B;  2QEN A;  3MEX A;  4JK1 X;  3ERE D;  3TQN A;  2DK8 A;  5DUI A;  4WXD A;  4M71 A;  2H6C A;  2M1B A;  3U9G A;  3JW4 A;  2RKH A;  2E7W A;  2G9W A;  5L3D A;  2HZT A;  4UV9 A;  2VE9 A;  4A5N A;  1LQ1 A;  2XIG A;  1B4A A;  5HLI A;  4UXN A;  1BI2 A;  2XAH A;  3Q9V A;  2C6Y A;  4BHB A;  3L09 A;  4H0E A;  1GVJ A;  5LGT A;  3CUQ C;  1G3T A;  1ZGA A;  3E5X A;  3QPH A;  3FXU A;  2A6E F;  1QO0 D;  2BGC A;  1IZ1 A;  3BOQ A;  1J2X A;  5H20 A;  2RGV A;  2MLG A;  1ZLK A;  5JI6 A;  3E3V A;  4L9V A;  1U78 A;  2IT0 A;  3WTZ A;  4ENJ A;  4UVA A;  3SQN A;  2K4J A;  3L9F A;  2M87 A;  1KQ8 A;  2PQ8 A;  2VBX A;  2BEO A;  1U5T A;  4LGW A;  1FSH A;  2D1V A;  1BC8 C;  2ELH A;  1XGS A;  1T98 A;  2P5K A;  1ZYR F;  2ZKZ A;  1B59 A;  4A0Z A;  2IW5 A;  1XMK A;  1FX7 A;  5AON A;  3V7C A;  1U5T C;  2QQA A;  3TGN A;  1XCV A;  5J8C A;  4ZYD A;  1R36 A;  2CWE A;  3SXY A;  1ZH5 A;  3WTT C;  2PI0 A;  3TO7 A;  3JTG A;  2FBI A;  5HDN A;  2Z3Y A;  2EV5 A;  3P9K A;  5FGM A;  4M6Y A;  2STW A;  3F6O A;  3M8F A;  2HKX A;  1BJA A;  4M9S A;  2RQP A;  3HYI A;  3HRT A;  3K0L A;  3H92 A;  5LHG A;  1S8N A;  4IRG A;  1I1G A;  2EFN A;  2L4A A;  3ZMV A;  4WF2 A;  4L5J A;  2J5O A;  4DQ2 A;  2WWY A;  1YO5 C;  1TQI A;  2EFW A;  4LK1 F;  5LHH A;  2VC1 A;  2KKO A;  4IXA A;  4CO8 A;  2K86 A;  4U88 A;  2IA0 A;  5E8G A;  3EYY A;  4L0Y B;  4UUV A;  4ZZD A;  2IA1 A;  4YII A;  4ESJ A;  3LAJ A;  5L3E A;  1T2K A;  5E17 F;  3JAM K;  2HTS A;  1HKT A;  4KUM A;  1PP7 U;  1PUE E;  3C18 A;  3V8J A;  5FLX Z;  2MD5 A;  4A6E A;  3MAJ A;  2KJC A;  1D8K A;  2M45 A;  2FEZ A;  1P92 A;  3BJ6 A;  4ENN A;  5ILS A;  2PG4 A;  4KT5 C;  1IN7 A;  5AIP A;  2ESN A;  1KYW A;  2A07 F;  3WGI A;  3GFI A;  1YW7 A;  1W4M A;  5FO5 A;  2ZNZ A;  3GEZ A;  1IUY A;  4N0B A;  2FXA A;  4FX0 A;  3WE3 A;  1XGN A;  3D0S A;  4ZH4 F;  5BMZ A;  1ZGJ A;  1G6N A;  1FYL A;  2XGX A;  2O61 A;  1W7P D;  1MD0 A;  3G73 A;  3TDU C;  4P55 A;  4HLX A;  5E1Z B;  1FBS A;  2K4B A;  4LFU A;  3QRF F;  2O6G E;  3IWZ A;  4WXC A;  5HS8 A;  1HXD A;  2Z33 A;  4IHT A;  2ZO4 A;  1ON2 A;  4NB5 A;  1AWC A;  3I0T A;  3F8F A;  5J8F A;  5ICC A;  4K2E A;  4ENK A;  2MH9 A;  2STT A;  1MGT A;  2QVO A;  3CLO A;  1T38 A;  4EJU A;  2QYO A;  1F9N A;  2P4W A;  5D4R A;  1IN8 A;  1HBX G;  2QBY A;  2XUB A;  4B09 A;  3RYR A;  3I5U A;  1BOA A;  1TQM A;  5LLQ A;  2QM3 A;  3HHH A;  4U0Y A;  1Z6T A;  3KE2 A;  2XKP A;  3G3Z A;  2IP2 A;  2F5D A;  2Y75 A;  2W85 A;  4KN4 X;  3RKY A;  3RPU A;  4RGR A;  5LEJ A;  1WSU A;  3GUD A;  1SFU A;  3FF5 A;  3F3X A;  1QQI A;  2ZBK A;  2UWM A;  5HVQ C;  2ZNY A;  4Y15 A;  3FXQ A;  1X3U A;  5EEH A;  4O5V A;  1O3T A;  2BE5 F;  3W6K B;  5F6F A;  3F8N A;  3CO6 C;  1EV7 A;  1K6O A;  2EFO A;  3P9C A;  3V8K A;  4ON0 A;  3E5Q A;  1HW5 A;  1ZRC A;  3WTU C;  1LB2 A;  3E6D A;  1MJB A;  3LA7 A;  3CO7 C;  3ZMZ A;  3K2Z A;  3BDD A;  4IF4 A;  3VB2 A;  2RN7 A;  1ZLJ A;  3P7N A;  4P9F A;  3DF8 A;  3H3U A;  3IL2 A;  4RGS A;  4KNY A;  4Q48 A;  3T8T A;  2FQ3 A;  1I1S A;  1ODD A;  3CUO A;  1RUO A;  5FFZ A;  4KYW A;  1DPR A;  1KU2 A;  4G7H F;  1VTN C;  1XDU A;  2LF7 A;  3I59 B;  4JQF A;  4AD9 A;  1QZZ A;  1XSV A;  5HOO A;  2PFB A;  3RDI A;  4A6D A;  3J81 K;  3FMS A;  4A5M A;  2XAQ A;  3JAM Z;  3O6B B;  2D1H A;  3R0A A;  3F8C A;  4FT8 A;  3N4M A;  5H6R A;  5BQT A;  1PDN C;  1I27 A;  4LG0 B;  2GA1 A;  2L54 A;  2VBY A;  2COM A;  5ILV A;  1FWZ A;  2HDC A;  5D8L B;  2JPB A;  4FX4 A;  3BPV A;  3HOT A;  2Z5U A;  1SD5 A;  1ONV A;  4PDK A;  1BI3 A;  1MDM A;  2EA2 A;  4RB2 C;  1IXC A;  2IA2 A;  2K7L A;  1UHM A;  3M7G A;  4XLN F;  2DPU A;  4R79 A;  3T8R A;  4P9U A;  2OZU A;  5HDK A;  2EV6 A;  3KCC A;  3M1E A;  4BXU A;  3EDP A;  4YIF A;  3VOE A;  2HEO A;  1XMA A;  1WI9 A;  3WU1 B;  3ZP5 A;  5JR3 A;  4EGZ A;  2JPC A;  1K7A A;  1SD6 A;  1LDD A;  1F5T A;  3WG9 A;  2VC0 A;  1QBJ A;  3I4P A;  1CGP A;  2V1X A;  3LQQ A;  5TJJ A;  4IRH A;  3IRQ A;  3DFG A;  1ZG1 A;  1FC3 A;  3I54 A;  1D8J A;  5LBQ A;  1DDN A;  3OV8 A;  1FT9 A;  1J5Y A;  3E5U A;  2F5C A;  1RNL A;  4HW0 A;  3LA2 A;  2W57 A;  2V9V A;  4EM2 A;  4HF1 A;  4RAZ A;  4RB3 C;  2LSO A;  2P6T A;  4GYI A;  2X4H A;  2VT2 A;  1KQ9 A;  2XVC A;  5K5R A;  4PGH A;  1LDJ A;  3KP6 A;  2DPD A;  4LLN A;  4M6X A;  4HOB A;  3EQL F;  3FWE A;  2XAJ A;  4HV5 A;  1ZRE A;  5K5O A;  1BN5 A;  2OQR A;  2DK5 A;  2YU3 A;  1YG2 A;  2FBK A;  4AIJ A;  3HIF A;  3IWF A;  3WTX C;  3K69 A;  3B73 A;  2P7C B;  1BI1 A;  2QLZ A;  2XHK A;  4GO1 A;  2TDX A;  2Z9O A;  3QOP A;  4MQ9 F;  1EH6 A;  3KP2 A;  4HF0 A;  4EJV A;  4JBA A;  4UNO A;  3K1M A;  4CIC A;  3TDZ C;  4D0P A;  3KLN A;  2EFQ A;  2XV4 S;  4WX9 A;  5D4S A;  1O7L A;  5H6Q A;  4XBF A;  3ZMS A;  1XDS A;  2CW0 F;  5LRR A;  2QZ8 A;  4G9Y A;  3R4K A;  3CDH A;  3HHG A;  3FM3 A;  2QWW A;  1Z9C A;  3DEU A;  4BHC A;  3E6M A;  2GXG A;  5E1W A;  4L0Z B;  4P5O A;  2QQB A;  4KA4 A;  3KLO A;  3PQK A;  3L7W A;  4BH9 A;  1T0F A;  4HYE A;  4P96 A;  2VXZ A;  2YR2 A;  1J75 A;  3IC7 A;  5HLH A;  2NRA C;  4EQQ A;  4YFN F;  4EVI A;  2L3D A;  3DP7 A;  3TO6 A;  4MNU A;  4NHJ A;  2XAS A;  4A0X A;  3GYH X;  1UCR A;  2KIM A;  1ULY A;  3J81 Z;  1K78 A;  4GXO A;  1CF7 A;  4EMS A;  5L3B A;  2YX7 A;  3NQO A;  2FNP A;  3O2P E;  3RKX A;  2UXN A;  3RYP A;  1V4R A;  1I5Z A;  1O57 A;  4OIP F;  3I53 A;  2LNB A;  3DV8 A;  5BOX A;  2NS0 A;  4IPA A;  1P6R A;  3HRS A;  3F6V A;  4HDU A;  4XSX F;  2V6C A;  2YSR A;  1UHW A;  1Z1D A;  5HLG A;  1MZB A;  4Y13 A;  2UXX A;  5D6E A;  2R7D A;  3U1D A;  2ZCW A;  1I6X A;  4TV7 A;  1WKM A;  3QU3 A;  2HS5 A;  2KJB A;  2ADU A;  4QWQ A;  1R1U A;  4U7D A;  2M8E A;  3LAP A;  4KIB A;  4G7Z F;  1XB4 A;  2IPQ X;  1JGS A;  3IHU A;  5CVU A;  2VOD A;  1QZY A;  1YLF A;  1FYK A;  3CUQ B;  2EK5 A;  3WU0 A;  3QP5 A;  2DAO A;  1U2W A;  1FP2 A;  3HSR A;  2PLY A;  2HYG D;  4EGY A;  1WRJ A;  3FXR A;  3FMQ A;  1IAW A;  5LGU A;  3ECH A;  1S29 A;  4KDP A;  4EV0 A;  2H09 A;  1OYW A;  3CJN A;  4B8X A;  5LHI A;  1R5H A;  2OD5 A;  1LEB A;  3JSP A;  2ISZ A;  2GIV A;  1B9N A;  3I59 A;  2JTV A;  2HWV A;  2DT5 A;  3D5L A;  4OIR F;  5E8I A;  5HDG A;  3R61 A;  3KZZ A;  4MEY F;  3U2R A;  1XGO A;  1U5T B;  2H6B A;  4GYG A;  2VBZ A;  2IVM A;  3KZY A;  1HST A;  1J59 A;  5L3C A;  2Q0O A;  4Q5S F;  2HTJ A;  4RGX A;  3VOD A;  2P5L C;  3PQJ A;  4LG0 A;  3ZN1 A;  3BP8 A;  3P9I A;  2BV6 A;  3I58 A;  2P5V A;  1IXS B;  1PP8 F;  2GAU A;  4A2U A;  3WGG A;  4RAY A;  4YG2 F;  1NHA A;  3ABT A;  2L01 A;  4YFX F;  2DFI A;  2DLL A;  4A12 A;  1DPU A;  4M73 A;  4L9T A;  2QQ9 A;  1O3S A;  3NEU A;  5ED4 A;  1U8R A;  3KFW X;  5TRD A;  5CLS A;  4M72 A;  4HBL A;  3LWF A;  4G94 A;  4MEX F;  3SZP A;  3S2W A;  2EV0 A;  1IXR C;  3HSF A;  3WTY C;  4ZYG A;  4LD5 A;  2VE8 A;  3E6B A;  4MHG A;  5J6X A;  4R8H A;  3R60 A;  3EYI A;  2EA4 A;  2LKP A;  1DUX C;  4CHU A;  4ESB A;  2VOP A;  3JTH A;  4G6Q A;  5FB2 A;  1XCB A;  3TOA A;  4ZYE A;  1HW1 A;  2KIU A;  1JHF A;  3HSE A;  1TBX A;  1SD7 A;  3MZY A;  5F64 A;  2XKO A;  1XSD A;  1Q1H A;  1R1V A;  1R58 A;  1OYI A;  3QPT A;  5L3F A;  4WXH A;  2Y0M A;  1F4K A;  2EB7 A;  5HS7 A;  5LGN A;  1W7P A;  3ZQ7 A;  1D5V A;  2PMH A;  3ELK A;  1F1Z A;  2MLK A;  2CQK A;  1JHH A;  2P6S A;  4GCV A;  4U0W A;  5JVT A;  1HSJ A;  4I7H A;  4AIK A;  1XN7 A;  4I09 A;  2V79 A;  4I2O A;  3FHZ A;  4CGZ A;  3DKW A;  3F22 A;  3E6C C;  3BY6 A;  3BJO A;  4MTD A;  4HQM A;  4O3M A;  3V7R A;  5ILU A;  1BI0 A;  1GHC A;  2E7X A;  3KET A;  3GFJ A;  4KN7 X;  3T0Y A;  1WWX A;  1FP1 D;  3HTS B;  1DP7 P;  1TNS A;  2KRF A;  5AIQ A;  1LVA A;  2Z99 A;  3ABU A;  2JSC A;  2A5Y B;  1G4D A;  2ETH A;  4I01 A;  3QAH A;  2HQR A;  2L4M A;  2HGC A;  1GXQ A;  4EJO A;  2XAG A;  3GLX A;  3GZ6 A; 
#chains in the Genus database with same CATH topology
 2BYV E;  1RUN A;  2R7Q A;  3JR9 A;  3ZQF A;  2ELK A;  1QPM A;  3HTU A;  5FKL A;  5M3M J;  1JKP C;  2VBW A;  5E20 A;  1JJ6 C;  1U3E M;  3PFI A;  4XOR A;  5E1X A;  4PJ0 C;  5ERI A;  1Z0X A;  2NXN B;  5DYM A;  3GTK J;  1OQY A;  1YE9 A;  3LSI A;  3GTQ J;  2QUF A;  4LB5 A;  2VPR A;  2HR3 A;  2DQL A;  4KT6 A;  1H9G A;  1UZC A;  1L0O C;  4AIH A;  3IRR A;  3QU6 A;  3L00 A;  1E3H A;  1HKS A;  4IHS A;  4F93 B;  5LEK A;  3MZH A;  2IBD A;  1LPQ A;  1XGM A;  2PBI A;  3V4G A;  1W5T A;  2L9S A;  2JA7 J;  2IS1 A;  2HQN A;  1IC8 A;  3T5X A;  3DXJ F;  4HX4 A;  3OYJ A;  3K10 A;  4JX6 A;  3DBH B;  1USS A;  3W6J B;  5DD4 A;  2QBY B;  1IW7 F;  1ETO A;  4I98 B;  2I8D A;  3SDG A;  3S2H J;  4GGG A;  3LSR A;  2FRH A;  5KK1 A;  3CZ6 A;  2HOT A;  3GXO A;  4Y17 A;  1S6L A;  2FML A;  5FFX A;  3I55 I;  1TC3 C;  2UZK A;  4A0Y A;  4A3K J;  1U6G A;  1X1D A;  2W00 A;  3QOD A;  2O8K A;  2V6E A;  5M5W J;  3A4C A;  3FXM A;  2O9L A;  5K7Z A;  1OCC H;  1HKQ A;  1TW3 A;  3G1M A;  3X2Q H;  5E18 F;  2M2E A;  4RGU A;  2QKM B;  1OKR A;  2EFP A;  5D5U B;  2XRO A;  1S3J A;  5B1B H;  4N9H A;  3ZQI A;  2XGE A;  3FM5 A;  1X1C A;  4OWR B;  1OJL A;  2W7N A;  5HS9 A;  1WGX A;  2KT0 A;  4BS9 A;  3BZ6 A;  4IZZ A;  1T95 A;  1MKM A;  2CW7 A;  2P7V B;  5F1R A;  1UST A;  5K5Q A;  2BW3 B;  3BRO A;  3KEO A;  4BBR J;  2HOE A;  5D5W B;  1SC7 A;  2L0K A;  2WA0 A;  4CCK A;  4AID A;  2CO5 A;  1ZAR A;  5CJ9 A;  2KIF A;  3G1L A;  2P8T A;  4C3H J;  3FK7 A;  1FSE A;  3TO9 A;  4OU0 A;  2MH2 A;  2CSO A;  3LFK A;  1GLN A;  5CVJ A;  1X58 A;  3SZT A;  4FAS D;  4MTE A;  2BY2 A;  3FKI J;  2HDW A;  1FLI A;  3CCV I;  2G7H A;  1BIA A;  3VYT B;  2VN2 A;  2MYS A;  1HW2 A;  4KIS A;  4HA8 A;  2ISY A;  2JN6 A;  4KMF A;  3GTM J;  1UB9 A;  3A02 A;  2DU9 A;  2DW4 A;  1LE8 A;  2PJR A;  1XSX A;  3A0H C;  2XRN A;  2HYF A;  1ZG5 A;  2VKE A;  3DBL B;  4M74 A;  2CUF A;  3AL0 B;  1B6A A;  2LC2 A;  1JE8 A;  2HYJ A;  3G2B A;  3GWZ A;  3ZPL A;  2ID6 A;  1KA8 A;  1D3Y A;  4Y4R A;  3K4J A;  4QSH A;  2LBF A;  2E36 A;  4XN3 A;  1X3Z B;  2OZ6 A;  2RC4 A;  1O4X A;  2HVS A;  5DCM B;  3H0D A;  3GVA A;  4E7H A;  2NVQ J;  2HXI A;  1R7J A;  1Y6I A;  2VJI A;  3CCM I;  1K61 A;  1D1C A;  3HM5 A;  2NAZ A;  2JA6 J;  3HUG A;  2VJJ A;  3C1D A;  3SEZ A;  2XB5 A;  4XLE A;  1OPC A;  5E3M A;  4RB0 A;  5GAE J;  4LMY A;  5IT3 A;  2PMU A;  9ANT A;  4U0V A;  1P4W A;  3ROU A;  1YW9 A;  3MQ0 A;  3DPT A;  2HDD A;  4L9N A;  3OOP A;  4QLC U;  1QU3 A;  3M8E A;  5ICF A;  3JRG A;  4FHT A;  1YIT I;  1UG0 A;  5JHU A;  4RDU A;  1ZHF A;  4RLF A;  4B44 A;  3F23 A;  1L3L A;  1ZKG A;  3GFL A;  2W24 A;  4IL6 C;  1SD4 A;  3OIO A;  4D1Q A;  1TL8 A;  4Q4Z F;  3A01 B;  4HDV A;  3CUQ A;  1Y0N A;  4ETS A;  1HDD C;  2JQ7 A;  3FMR A;  2Q1Z B;  1P4A A;  5CQG A;  5DD8 A;  3ZCO A;  4FQG A;  1AU7 A;  3J80 Z;  2NNN A;  4HV6 A;  2F2E A;  5L3G A;  4RS8 A;  1YW8 A;  3C3W A;  5JVG F;  3AFH A;  4XRM A;  5FD5 A;  3WTV C;  2R7U A;  2XB0 X;  1SAN A;  2ZME B;  5D5X B;  1YQA A;  2EIL H;  1POG A;  3SHF A;  1UJ8 A;  4PFO A;  1Z05 A;  4BYY A;  4LLG F;  3JRI A;  2X0L A;  3EUH A;  1YS7 A;  4BXF A;  3J7A O;  3C7J A;  4EJT A;  2ZJ2 A;  1V3F A;  5DEQ A;  3ZMD A;  1GXP A;  4XSZ F;  1RKW A;  2K5C A;  1BR2 A;  3VDX A;  1N77 A;  1REP C;  4C2T A;  4ASN A;  1ITY A;  4BBS J;  4BEH A;  3KP4 A;  3PSI A;  1V55 H;  1TLH B;  1WQ2 A;  3GTJ J;  4BL0 B;  1JI8 A;  1RIO H;  2NYX A;  1B1B A;  2JRM A;  4Z2Y A;  4UHT A;  3CCS I;  1T39 A;  4D7N A;  1S7A A;  5D5V B;  1KZH A;  2L02 A;  2CFX A;  4MGR A;  4CDG A;  1OR7 A;  4IJA A;  2XF7 A;  4B47 A;  4QIW N;  3OYK A;  3S3O A;  3GLX A;  4BQA A;  4WK8 F;  2ZJR F;  1MDM B;  1Z67 A;  1DGR M;  2JT1 A;  2FNA A;  4W97 A;  4XKW A;  2CV2 A;  2ZXJ A;  2WTE A;  1W5C C;  3IKT A;  4ZZL A;  1HCR A;  3ML6 A;  1WHU A;  1A04 A;  3KYC B;  1P4X A;  1LNW A;  2LH9 A;  3CTA A;  1TWG J;  3HPH A;  4EJW A;  4KMU X;  2V1U A;  2OTL I;  1OFC X;  2DTR A;  3QP6 A;  1Z3X A;  3ULQ B;  1XPX A;  2IEK A;  2A61 A;  4OMY A;  3WGH A;  1WVR A;  2CU7 A;  3S15 J;  1G3S A;  5CVI A;  4M9X A;  1BM9 A;  1ZAO A;  1IRG A;  3LA3 A;  3OL4 A;  4HNU A;  2DDA A;  1VQL I;  1P7I A;  3QQA A;  2BBY A;  2DA5 A;  1NH3 A;  4E70 A;  4F7Z A;  2GWR A;  4YFK F;  4KFC A;  1GV5 A;  2XPW A;  4PJL A;  4CA0 A;  3K1P A;  3F8B A;  1SFX A;  2KHM A;  2VXD A;  4LK0 F;  2RNJ A;  2M5W A;  3NAR A;  2A68 F;  1KU9 A;  1VFC A;  3JRF A;  2UV1 A;  1ZQ3 P;  5J4V A;  3LQR A;  1XD7 A;  3FXJ A;  5BPD A;  3CP8 A;  5E3L A;  2JZY A;  2VJ4 A;  2Y48 A;  4EM0 B;  5JFR A;  5ICE A;  2ZB9 A;  3IUO A;  2E2H J;  4UY8 I;  1DU6 A;  4ANJ A;  2DJI A;  4M3D A;  1JUP A;  3G71 I;  2LFB A;  2GOM A;  1X19 A;  1E3O C;  4BJ6 C;  4S04 A;  2HI3 A;  1Y0U A;  2D45 A;  1VI0 A;  2F5V A;  4I02 A;  4XRS G;  5J47 A;  1YYV A;  2EZI A;  4BHP A;  1FBU A;  1VQK I;  5HLT A;  2W84 A;  3C2G A;  4C2M J;  3HRU A;  4F91 B;  1TNT A;  2CH0 A;  1RI7 A;  3PNY A;  3W2A A;  3B6C A;  2ESH A;  4DJA A;  2ZJP F;  3OYE A;  2CUJ A;  2K27 A;  5LD2 C;  2M4K A;  3T1B A;  1J9I A;  5J3L A;  3OS1 A;  2IRF G;  5EZG A;  4CYD A;  2OF7 A;  3RPQ A;  2OC6 A;  3BZC A;  3VYU B;  1SFE A;  3IAM 2;  2IS4 A;  5J1R A;  3HRM A;  1SAX A;  2RAE A;  3RI4 A;  2E5Z A;  1KON A;  2VT3 A;  5A2Q Z;  5CPR B;  1ON1 A;  3TP0 A;  2AXT C;  3MD2 A;  2IGO A;  2WAQ N;  1LEA A;  3RPU D;  2RDP A;  1G8X A;  2FSW A;  2MA3 A;  4HX8 A;  3M3Y J;  2CGP A;  2YU9 J;  1FPQ A;  3H3Z A;  2ZFW A;  1J7K A;  3HG9 A;  3V8L A;  2GIZ A;  3RJP A;  2IAI A;  4ESF A;  3DQV C;  1H9T A;  2W25 A;  3K7A J;  3L2C A;  3RZD J;  3S1N J;  1YFH A;  4V19 K;  3R6S A;  2EPF A;  1I39 A;  1MMA A;  5BPI A;  1Z91 A;  4QPQ A;  2AXL A;  2IGN A;  1XS9 A;  1EH7 A;  3V7S A;  2K9M A;  2LMD A;  2DFE A;  5IT9 Z;  1W5S A;  3ZQH A;  4DYQ A;  5EEG A;  3SZG A;  3OS0 A;  1OCR H;  3KX2 A;  4IVN A;  3I3L A;  5H2F C;  4Y3O A;  5CVR A;  1STZ A;  3VPR A;  2H94 A;  3KP7 A;  4AWX B;  3GX4 X;  1IRF A;  3KP5 A;  3Q9S A;  2GA2 A;  2F4O B;  1ZN2 A;  3BG6 A;  2WV0 A;  4BE0 A;  2VIX A;  3IKV A;  3ISP A;  3MFK A;  5CVV A;  1VQ7 I;  5DUK A;  4HQE A;  2WAD A;  3GCM A;  2XGD A;  4CH7 A;  4CZZ A;  2QSF X;  4HF2 A;  1FTT A;  4D5F A;  3FX3 A;  5E3O A;  3C2B A;  2A3S A;  4PGG A;  2XAF A;  2X51 A;  1R22 A;  1WPK A;  4FIS A;  1KYZ A;  5LFA A;  3MWM A;  5LRS A;  3GO5 A;  4C2U A;  3BWG A;  2BXY A;  4DNC A;  3B02 A;  5C4X J;  2WV1 A;  2K02 A;  4DZJ A;  1Y8R B;  4XLA A;  2EIM H;  5TGT A;  4ZDP A;  2HKO A;  3HDD A;  2VON A;  3PSF A;  1HC8 A;  1OYY A;  2K40 A;  2LY9 A;  2RV8 A;  3TP3 A;  1YIO A;  2OQG A;  4XL9 A;  4L18 B;  4G7O F;  2YX4 A;  3I56 I;  2QEX I;  2V4J C;  3MCZ A;  2M30 A;  1QHH D;  4CCL A;  1YS6 A;  3QYB A;  2DI3 A;  2D2W A;  4HX7 A;  1T33 A;  2W4S A;  5ICG A;  5GPA A;  3FBI B;  5EGO B;  1Z6R A;  1LVK A;  3GLL A;  1MMG A;  4RA2 A;  2PN6 A;  3BCA A;  4M6V A;  2WBM A;  1O3Q A;  1H89 C;  4NC7 A;  2F4M B;  1E3P A;  1FIA A;  1U9N A;  2GZW A;  3UR3 C;  2DA4 A;  2X85 A;  5CQE A;  4OIN F;  2ACJ A;  3JRA A;  5BS6 A;  1UFM A;  2CG4 A;  2EJR A;  1HF0 A;  1YTY A;  5IPA A;  3KEY A;  4Q47 A;  1Z7U A;  3NWT A;  1K78 B;  5EEA A;  1ZRD A;  1RZ4 A;  2ECC A;  2V1N A;  3ZN0 A;  1W36 C;  2OBP A;  1IDY A;  3CC7 I;  1TWF J;  1OMI A;  2XF5 A;  1X4P A;  4UVC A;  4XIC A;  2FOK A;  3ZMT A;  1CF7 B;  2O3F A;  2F5E A;  1Y1W J;  1T08 B;  2O03 A;  2XAU A;  2M3A A;  4PZJ A;  1IN6 A;  1ETW A;  2JRT A;  5B5E C;  1E2X A;  4M3G A;  5KVR A;  4BAY A;  3F21 A;  2GXB A;  1FOX A;  3LST A;  4RM2 A;  1ERD A;  2JMW A;  3IH4 A;  1G3W A;  2WC2 A;  2R3S A;  3FXK A;  3ABM H;  1TTY A;  2HZD A;  5DCF A;  1O7F A;  1KU7 A;  2WB1 N;  4XR6 A;  1EF4 A;  4ZDL A;  2GQQ A;  3BC8 A;  4G6D A;  4S05 A;  1FYM A;  1T8I A;  2D5V A;  4LB6 B;  5GP9 A;  4EM1 A;  2EIN H;  4MQV A;  1BC7 C;  3CF5 F;  2FF4 A;  1MH4 A;  3K9T A;  1NG6 A;  2FX0 A;  3HKZ N;  1MBE A;  2OU2 A;  2CRG A;  3JSO A;  5C44 J;  4JP0 A;  1X2M A;  2H8W A;  4IHY A;  3A2K A;  5K1Y A;  3COA C;  3WE2 A;  3Q5F A;  4BNC A;  3PIO F;  2O5R A;  5IOY A;  3J80 K;  4BJ5 C;  3FZV A;  3GW2 A;  1IN5 A;  3R0J A;  4PCQ A;  5DDG A;  2CFO A;  2NNY A;  4HLY A;  5FD6 A;  1P2F A;  1EH8 A;  5M5Y J;  1HA8 A;  4U7B A;  4N9I A;  4OMZ A;  4XRS A;  4R1H A;  1EA3 A;  3CQZ J;  3CCJ I;  1VQM I;  4L9J A;  5JLW A;  4RB1 A;  3TKY A;  2E1M C;  4AVP A;  4O6J A;  2OTJ I;  2V9K A;  2CQQ A;  2R7O A;  1GDT A;  3F8M A;  2H8R A;  1A6Q A;  4MIM A;  2QQ8 A;  5FKM A;  2HXO A;  2R7F A;  1SFK A;  3LSJ A;  2EZK A;  2OCC H;  1FOK A;  2VOO A;  1O3R A;  4KIG A;  4MFD A;  3WG7 H;  3REO A;  1MJA A;  2EWN A;  3SFZ A;  2IJL A;  5D6F A;  4G8X A;  4WCG A;  1ZRF A;  4BGD A;  3CJQ B;  3OMY A;  3Q3S A;  5DCM A;  2ECB A;  3O3K A;  2F5F A;  4RBO A;  2K3P A;  1FY7 A;  4OAZ A;  2MC4 A;  2BOL A;  3HBL A;  3OIQ A;  2FE3 A;  3CCY A;  4HZF A;  3WHB A;  1ETK A;  2FMY A;  4WWC A;  4B3A A;  1OCP A;  1KGS A;  3JRE A;  1JKO C;  4IRI A;  2OA4 A;  3SJM A;  2YS9 A;  1QGP A;  2OAZ A;  5IOZ A;  4HNT A;  1LJ9 A;  1JXS A;  4D9J A;  4CXF A;  1K79 A;  2L9N A;  3RKW A;  1R5G A;  5F08 A;  3BPX A;  4IHX A;  3ZOB A;  2A69 F;  2J5P A;  1IDZ A;  4XKC A;  3BZK A;  2E1N A;  1FOY A;  3K70 C;  3EET A;  3A01 A;  1S7O A;  4B4C A;  3ECO A;  5CYV A;  4I0B A;  2M9H A;  5FKN A;  3KEQ A;  3WTS C;  1MMD A;  4OIQ F;  3CES A;  3KP3 A;  1YJ9 I;  3TOB A;  4BAC A;  1QNT A;  4B1R A;  2H27 A;  1SVL A;  4BDY A;  1KQ0 A;  2YPR A;  2MC3 A;  2G7U A;  2O0Y A;  2O8X A;  4XRF A;  3EUA A;  3LSM A;  4UV8 A;  2ZME A;  2B63 J;  3GZ5 A;  3PNT A;  6PAX A;  1SMY F;  3K1N A;  2R4G A;  4ZYH A;  2PJP A;  5F0F A;  3N97 A;  1Y8Q B;  2F4I A;  4M9Z A;  2AS5 F;  2FU4 A;  4L5I A;  2X1C A;  2I10 A;  1GVD A;  2LY1 A;  4LLL A;  1R23 A;  3RTR A;  4NNJ A;  2AQF A;  4OIO F;  1TQP A;  1KU3 A;  1BIB A;  1P9Q C;  3WOD F;  1IN4 A;  5DV5 A;  2X6W A;  4E7K A;  2DQR A;  3WTW C;  1FTZ A;  2A6H F;  1TW2 A;  1QHG A;  4HAM A;  1N25 A;  1W0T A;  3DKX A;  3PL8 A;  1XG1 A;  1I3Q J;  2M7A A;  1G3Y A;  1FBQ A;  1S9H A;  1SMT A;  4KIF A;  4XMY A;  3ZMU A;  4AU7 A;  4UVB A;  2L7M P;  1JGG A;  3M9A A;  3OSG A;  3DWL E;  2PEX A;  2E1C A;  4BDZ A;  1IF1 A;  2FOW A;  2E19 A;  5JHF A;  1FIP A;  2KFD A;  2LDU A;  2RVC A;  5A2Q K;  1V5G A;  1B9M A;  1UMQ A;  3I71 A;  2Q2E A;  2Y0S N;  3E97 A;  4XLP F;  2KLO A;  1TP4 A;  2FD5 A;  2XC7 A;  3NRV A;  1J0R A;  3ZQG A;  2MBF A;  3EUK L;  1BBY A;  5D8K B;  2DBB A;  1X1B A;  2HFH A;  5F27 A;  2GBY A;  1WJD A;  3GFM A;  3GF2 A;  4BU2 A;  1T6S A;  3F72 A;  4W1U A;  3L2R A;  1R49 A;  3S3N A;  1QVU A;  2DO7 A;  3JCU C;  4C3I J;  2X9D A;  3I64 A;  2LYC A;  5FLX K;  3HOS A;  1E17 A;  2B0L A;  3LSK A;  2CYY A;  5IT9 K;  1AOY A;  2DFF A;  3M4O J;  3VYR B;  2UUZ A;  4LJZ F;  4RAG A;  1FNN A;  1R00 A;  2ELJ A;  2JUC A;  2DMN A;  5FLM J;  1FEX A;  1VQ6 I;  1JUM A;  1VQ8 I;  3DPL C;  2V1D A;  3VEP A;  1PYV A;  1C0W A;  4OOI A;  4ENM A;  3S32 A;  4FET A;  2Y69 H;  3M8J A;  4FTH A;  3PUF A;  4M3E A;  4ZDO A;  1LDK B;  2VQG A;  3RIR A;  4KIC A;  2JJ7 A;  4BY7 J;  1ZG3 A;  5EZH A;  2Q8K A;  3GBG A;  2FBH A;  2KMU A;  1LFP A;  2VL8 A;  4I0A A;  1MJ9 A;  2LF8 A;  4NQW A;  4XON A;  4AYB A;  2E1O A;  4IX7 A;  2FA5 A;  1HQC A;  3RQI A;  1FZP B;  3BJA A;  3AAF A;  1ETQ A;  2L7K A;  2HPI A;  2R0Q C;  1LKX A;  1R1T A;  3VFZ A;  1H0M A;  3B6A A;  1W7P B;  2QEN A;  2VUM J;  3MEX A;  4JK1 X;  3JRC A;  3ERE D;  1RET A;  1MIJ A;  2PX9 A;  3TQN A;  2DK8 A;  5DUI A;  2K9Q A;  4WXD A;  4NC8 A;  3GME A;  4XM3 A;  4I99 C;  3NAU A;  4ZC3 A;  5F04 A;  3H5R A;  2Z1D A;  2JUG A;  4M71 A;  1ZR4 A;  1MH3 A;  1WFX A;  4G6T B;  1W1W E;  1WJF A;  1VQP I;  3S93 A;  2HVR A;  2H6C A;  2M1B A;  1ETV A;  3U9G A;  3JW4 A;  2RKH A;  2E7W A;  3LSH A;  3DPU A;  2G9W A;  5L3D A;  1MNM C;  1ZGW A;  5DM6 F;  3ABL H;  1GT0 C;  2HZT A;  4B3X A;  3L2W A;  4UV9 A;  2V26 A;  3GTO J;  2CQ7 A;  1YOV B;  2BVL A;  2VE9 A;  4A5N A;  3RCO A;  1DGW Y;  4M3F A;  2Y31 A;  1LQ1 A;  2XIG A;  1B4A A;  3FK6 A;  5HLI A;  3OS2 A;  2E2I J;  4UXN A;  1BI2 A;  2G0E A;  2XAH A;  3OYI A;  2DMU A;  3Q9V A;  4XNF A;  1R4M B;  3RQ4 A;  3J7A Y;  2C6Y A;  1FOW A;  4BHB A;  4C3J J;  3L09 A;  1YJW I;  1Z3Y A;  4H0E A;  1GVJ A;  4I6Z A;  4MLO A;  5LGT A;  3CUQ C;  4ZJZ A;  3UKG A;  1G3T A;  1ZGA A;  1EKE A;  3E5X A;  1BJZ A;  3LFU A;  1ZEL A;  3QPH A;  2VLA A;  3FXU A;  2R5Z B;  3M07 A;  2A6E F;  1QO0 D;  2BGC A;  1IZ1 A;  1I50 J;  3QPS A;  3BOQ A;  3BTJ A;  1J2X A;  2CUZ A;  4IQ4 A;  5H20 A;  2RGV A;  5EF6 A;  2MLG A;  2DTZ A;  5JI6 A;  3CF2 A;  4CYC A;  5KCM A;  2KDZ A;  1ZLK A;  3BQY A;  3E3V A;  4L9V A;  1U78 A;  5K7H A;  3MMY B;  2IT0 A;  3WTZ A;  4ENJ A;  4UVA A;  3SQN A;  3KYL A;  2X48 A;  1JUS A;  2HU9 A;  3W2W A;  2M8G X;  2K4J A;  3L9F A;  2M87 A;  1KQ8 A;  2PQ8 A;  3EUH C;  2VBX A;  2P0W A;  2EIJ H;  3DEE A;  1BR4 A;  3TMO A;  4LOC A;  3TBI A;  3ZGK A;  2BEO A;  1U5T A;  3QYF A;  4LGW A;  1FSH A;  2JA8 J;  2D1V A;  1BC8 C;  5EG0 A;  1TZL A;  2ELH A;  4KJZ A;  1XGS A;  1T98 A;  3O8H A;  2P5K A;  1ZYR F;  3RSN A;  1OR7 C;  1RR7 A;  2ZKZ A;  3VSL A;  1HOM A;  4V2F A;  3OYH A;  1B59 A;  4A0Z A;  4ZTF A;  1BL0 A;  2IW5 A;  5EGO A;  1XMK A;  1FX7 A;  4IOA F;  3IP4 B;  5AON A;  3BG9 A;  3V7C A;  2DT6 A;  1U5T C;  2QQA A;  3TGN A;  1XCV A;  5J8C A;  4PJN A;  4ZYD A;  2DA3 A;  3OYG A;  1R36 A;  3AG3 H;  3QWL A;  2CWE A;  3SXY A;  1ZH5 A;  3WTT C;  2PI0 A;  2R5Y A;  1XX5 A;  2KIQ A;  2P81 A;  4LG3 A;  4G12 A;  3TO7 A;  3JTG A;  2FBI A;  5HDN A;  2Z3Y A;  2EV5 A;  3OYB A;  3P9K A;  5FGM A;  1WI3 A;  4M6Y A;  3DTE A;  2STW A;  3F6O A;  3HEF A;  4E6K G;  1A31 A;  4DZP A;  3M8F A;  2WAQ A;  2ZJQ F;  2HKX A;  3LSP A;  1DU0 A;  1BJA A;  4M9S A;  2RQP A;  4IEJ A;  3HYI A;  3HRT A;  3U21 A;  2CV0 A;  3K0L A;  5E3N A;  3H92 A;  3K6G A;  5LHG A;  1S8N A;  4IRG A;  1UEL B;  1SEU A;  1I1G A;  2EFN A;  1VF9 A;  2L4A A;  4E7L A;  1ZTR A;  2BHY A;  1R9T J;  3C2H A;  3ZMV A;  1G2H A;  4WF2 A;  4L5J A;  1V5F A;  2J5O A;  1U9O A;  3D5R C;  4DQ2 A;  2WWY A;  1YO5 C;  1TQI A;  3H0G J;  2EFW A;  2R7V A;  4LK1 F;  2A6T A;  2WY7 Q;  2NS8 A;  2LVS A;  2EZL A;  5LHH A;  2VC1 A;  2KKO A;  2PJR B;  2K86 A;  4IXA A;  4CO8 A;  2LG4 A;  4A3G J;  2COB A;  4U88 A;  1LFU P;  2IA0 A;  3A1Y A;  4FCY A;  5E8G A;  1YRN B;  3EYY A;  2X6O A;  4L0Y B;  2LRD A;  4DIQ A;  4UUV A;  4ZZD A;  2IA1 A;  1IUF A;  1X1A A;  3DU6 A;  1TT0 A;  3MKL A;  4X1E A;  4YII A;  5J4Y A;  1BR1 A;  4ESJ A;  5IYB J;  1ETY A;  2M7B A;  5L3E A;  3LAJ A;  2QSH X;  1T2K A;  5E17 F;  3JAM K;  1T56 A;  3BG3 A;  3I4N J;  2HTS A;  1WJC A;  3CME I;  1HKT A;  3MVP A;  4KUM A;  3HUG B;  3ZQQ A;  4BQN A;  3PIP F;  2EH3 A;  1PP7 U;  1PUE E;  2TRT A;  3HOV J;  3C18 A;  5DTD A;  3V8J A;  2Y2Z A;  1MBJ A;  5FLX Z;  2MD5 A;  4EEF G;  4A6E A;  3MAJ A;  1H8A C;  2KJC A;  3CCL I;  5EYR A;  4DYR A;  1D8K A;  2M45 A;  2FEZ A;  4I76 A;  4Y33 A;  1P92 A;  3BJ6 A;  4ENN A;  1Y39 A;  5IP6 A;  3BR0 A;  5ILS A;  4CZC A;  1IO2 A;  4UUS A;  2PG4 A;  3H35 A;  4A3D J;  2PMZ A;  1WZ2 A;  2ME6 A;  2KZG A;  4KT5 C;  2CV1 A;  5FRO A;  1IN7 A;  1IV8 A;  1Z77 A;  5AIP A;  2ESN A;  1KYW A;  2A07 F;  1NTC A;  4PUS A;  1WJB A;  3WGI A;  1D0Y A;  1LUJ B;  4EAT A;  3GFI A;  2B7E A;  1YW7 A;  1W4M A;  3BR2 A;  5FO5 A;  2ZNZ A;  3GEZ A;  1WJA A;  3OYF A;  2L9R A;  1IUY A;  4N0B A;  2DT7 B;  2FXA A;  4FX0 A;  1Y1V J;  3WE3 A;  1XGN A;  3D0S A;  2LP0 A;  4ZH4 F;  3G6E I;  5BMZ A;  1ZGJ A;  4S0H B;  1G6N A;  2DFH A;  4MO7 A;  4A3L J;  1B72 A;  4AVZ A;  1FYL A;  1PUF A;  1MBF A;  3QOE A;  2XGX A;  2O61 A;  1W7P D;  2LKS A;  3CDI A;  1MD0 A;  3G73 A;  2WAE A;  1BOB A;  3H5A A;  2KRC A;  4BEH B;  2RRE A;  1K6Y A;  3TDU C;  2Y9Z A;  4P55 A;  4HLX A;  3PO3 J;  5E1Z B;  1FBS A;  2K4B A;  4LFU A;  3I9V 2;  4CCO A;  4JOM A;  3QRF F;  2O6G E;  3FIS A;  3IWZ A;  1ACI A;  4WXC A;  5HS8 A;  1HXD A;  2L5Q A;  3K4B A;  3W3C A;  2Z33 A;  1HLV A;  3MZ8 A;  2IGM A;  4A3F J;  2ID3 A;  3K4M A;  4IHT A;  2L7Z A;  2ZO4 A;  1ON2 A;  4NB5 A;  1VQO I;  2XRL A;  2XSJ C;  4CSW A;  4F55 A;  1AWC A;  3W6V A;  2BY3 A;  3I0T A;  5FRM A;  4UB6 C;  3F8F A;  5J8F A;  1BW6 A;  2OUM A;  4BJT A;  5ICC A;  4K2E A;  2YUS A;  4ENK A;  1DP3 A;  4HEA 2;  5IYD J;  2MH9 A;  2F48 A;  1MGT A;  2STT A;  3OR2 C;  3HC7 A;  3EPZ A;  3FXL A;  3UNG C;  2QVO A;  3CLO A;  1MBH A;  5C4J J;  1AHD P;  1T38 A;  3CMM A;  4EJU A;  4GFB A;  2TCT A;  2K9S A;  2QYO A;  1F9N A;  4A3E J;  1K4S A;  2EIK H;  2P4W A;  5D4R A;  1IN8 A;  1HBX G;  2QBY A;  2XUB A;  4B09 A;  1OIS A;  2JVG A;  3RYR A;  3I5U A;  3SEQ A;  4F92 B;  1BOA A;  1TQM A;  3E0J B;  2DMQ A;  2V9P A;  5LLQ A;  5IP9 J;  1GUU A;  2QM3 A;  3HHH A;  3KZI C;  4U0Y A;  1Z6T A;  1JT6 A;  3KE2 A;  2XKP A;  3G3Z A;  2IP2 A;  3M1C A;  4XKV A;  2F5D A;  2NOJ B;  2Y75 A;  2W85 A;  3BR5 A;  4KN4 X;  3RKY A;  4RGR A;  3RPU A;  5LEJ A;  3LSG A;  1WSU A;  3GUD A;  2DMP A;  1SFU A;  3CJT B;  3KYD B;  2H1K A;  3FF5 A;  3F3X A;  2EQR A;  4YEJ A;  2IS6 A;  1QQI A;  2ZBK A;  3AG2 H;  3L2V A;  2UWM A;  2HOA A;  1YX5 A;  3VYS B;  5HVQ C;  4U87 A;  4L5E A;  2ZNY A;  4Y15 A;  3FXQ A;  1ZK8 A;  1X3U A;  5EEH A;  4O5V A;  3CC4 I;  5J1Y A;  1SVM A;  2BW3 A;  2NS7 A;  1O3T A;  2BE5 F;  4IO9 F;  1QVT A;  3W6K B;  2OPT A;  1G59 A;  4ZYA A;  3BR1 A;  5HNF A;  4ABZ A;  1I6H J;  5F6F A;  3F8N A;  3CO6 C;  1EV7 A;  4RAF A;  1K6O A;  2EFO A;  3P9C A;  3V8K A;  3KIO A;  2KL4 A;  3OOU A;  1X4O A;  2N8G A;  4ON0 A;  1IRX A;  3CLQ A;  3OSF A;  3H3V K;  3E5Q A;  4AC0 A;  1HW5 A;  1TWA J;  2RQQ A;  2ZSH B;  4N4N B;  1ZRC A;  3HOY J;  5FJ8 J;  2X6Y A;  3WTU C;  3GZN B;  1LB2 A;  3TW6 A;  1YHQ I;  1QA6 A;  3SFI A;  2CS3 A;  1IGN A;  3E6D A;  1MJB A;  3PFY A;  2A05 A;  3LA7 A;  5J40 A;  4AUX A;  3CO7 C;  3F0C A;  2X1D A;  2R7W A;  2GOX B;  3ZMZ A;  3OYC A;  3K2Z A;  3BDD A;  3MN2 A;  4IF4 A;  3VB2 A;  4KIT B;  4X0G A;  1UG2 A;  2RN7 A;  3HGY A;  2HQ5 A;  3LNQ A;  3Q0V A;  1ZLJ A;  3BQZ A;  2H1L A;  2Y9Y A;  3BCB A;  5DS9 A;  3P7N A;  4P9F A;  2DMT A;  3DF8 A;  3H3U A;  1D5Y A;  3AL0 C;  1QZE A;  2XPU A;  3IL2 A;  3JRD A;  4HRI A;  4RGS A;  4KNY A;  4Q48 A;  3T8T A;  3LL7 A;  3CMA I;  2FQ3 A;  3K4C A;  1I1S A;  1ODD A;  2ZXI A;  3CUO A;  2LY2 A;  3BG7 A;  1RUO A;  5FFZ A;  1XTA A;  4KYW A;  1DPR A;  1VND A;  1KU2 A;  1XDU A;  2LF7 A;  3I59 B;  4JQF A;  4AD9 A;  3L2Q A;  4G7H F;  3Q0W A;  1VTN C;  1QZZ A;  3A03 A;  1R71 A;  2LOO A;  1K4T A;  2OV7 A;  2L7F P;  1XSV A;  2AQE A;  5EDN A;  4JX5 A;  2R7S A;  5HOO A;  2PFB A;  3RDI A;  4A6D A;  3J81 K;  3FMS A;  4A5M A;  2XAQ A;  4YIR X;  3JAM Z;  3O6B B;  3MKY B;  2CUE A;  2D1H A;  1MNE A;  2FQ4 A;  1Q1V A;  5GPC A;  1S5L C;  2EBI A;  3R0A A;  3F8C A;  5KAI C;  5F0C A;  5KNL A;  1R5I D;  3DTK A;  2F6C A;  4FT8 A;  1CQT A;  4PJJ A;  3N4M A;  5H6R A;  5BQT A;  1PDN C;  2MW8 A;  4DBQ A;  2R5Z A;  1I27 A;  3J7Y J;  4LG0 B;  3SYT A;  2GA1 A;  2L54 A;  2VBY A;  2COM A;  4BQO A;  5ILV A;  4XN0 A;  1FWZ A;  3HOX J;  5D8L B;  2HDC A;  3AKZ A;  3WU2 C;  1NG7 A;  2JPB A;  2ZME C;  4FX4 A;  2DOD A;  3BPV A;  3G4S I;  3HOT A;  1NK3 P;  2Z5U A;  1SD5 A;  1ONV A;  4PDK A;  1BI3 A;  1MDM A;  2EA2 A;  4RB2 C;  1IXC A;  2IA2 A;  2K7L A;  3ZQC A;  1UHM A;  4RM3 A;  3M7G A;  4XLN F;  2DPU A;  4R79 A;  3T8R A;  2K3F A;  4P9U A;  2OZU A;  5HDK A;  2EV6 A;  1AKH B;  2ZC2 A;  3KCC A;  3M1E A;  4BXU A;  3EDP A;  4XLF A;  1V54 H;  4YIF A;  3VOE A;  2HEO A;  2CQN A;  1XMA A;  1WI9 A;  4CCM A;  3ESW B;  5FRN A;  2VPL A;  4GRI A;  3WU1 B;  3ZP5 A;  5JR3 A;  4EGZ A;  1U0J A;  1X3W B;  1XC5 A;  2JPC A;  4FE7 A;  1SD6 A;  1LDD A;  1K7A A;  3WG9 A;  1F5T A;  2VC0 A;  4XQF A;  1QBJ A;  3I4P A;  2DOA A;  1CGP A;  2MSY A;  3GTL J;  2DN0 A;  4XLH A;  2V1X A;  5F1J A;  1A36 A;  3LQQ A;  5TJJ A;  3WHC A;  4IRH A;  3RKQ A;  1Y56 A;  2OCE A;  3IRQ A;  3DFG A;  4ZTJ A;  1ZG1 A;  1VQ9 I;  1FC3 A;  4BY1 J;  2KPM A;  3I54 A;  4N4O B;  3PJR A;  1D8J A;  5LBQ A;  1DDN A;  1JT0 A;  2KQR A;  1F43 A;  2KIS A;  3OV8 A;  1FT9 A;  1SAU A;  4Y52 J;  1J5Y A;  2E1M B;  1F36 A;  2JSP A;  3E5U A;  3PO2 J;  2F5C A;  1RNL A;  4HW0 A;  3O8G A;  1JJ8 C;  1Z7L A;  3LA2 A;  2QF7 A;  2W57 A;  2V9V A;  4EM2 A;  4HF1 A;  4RAZ A;  4RB3 C;  2LSO A;  2JWT A;  1MSE C;  2P6T A;  2ME0 A;  2NOG A;  4GYI A;  4HNV A;  2X4H A;  4CUG A;  2VT2 A;  3FDY A;  4PSW A;  1KQ9 A;  2KDO A;  2ICW G;  2XVC A;  5K5R A;  4A3I J;  2M34 A;  4NUB A;  1R4N B;  4PGH A;  4HPQ A;  1J09 A;  1LDJ A;  2VI6 A;  3KP6 A;  4RLQ A;  3ERM A;  3MKZ A;  1U8B A;  2NVY J;  2DPD A;  4LLN A;  2VQL A;  1OCZ H;  4M6X A;  1YRN A;  4HOB A;  3EQL F;  4RMN A;  2E5N A;  3FWE A;  3S1M J;  2M4G A;  2XAJ A;  4HV5 A;  1ZRE A;  5K5O A;  1P7J A;  1BN5 A;  3CC2 I;  2OQR A;  2DK5 A;  2YU3 A;  3S2D J;  1YG2 A;  4DBR A;  1UHS A;  2FBK A;  4AIJ A;  2MG4 A;  3HIF A;  3IWF A;  3WTX C;  3K69 A;  2BY0 A;  4E7S A;  3B73 A;  2R7R A;  2P7C B;  1RKT A;  1BI1 A;  2QLZ A;  2DDB A;  5C3E J;  3S16 J;  1QPI A;  3CJR B;  2XHK A;  1S7E A;  3P5J A;  1B8I B;  2R7T A;  4GO1 A;  2TDX A;  2L9V A;  2BXZ A;  2XF6 A;  2Z9O A;  4A3C J;  3ZQL A;  2DA7 A;  3QOP A;  5EJC A;  3VSK A;  1XMX A;  3OYD A;  4MQ9 F;  1EH6 A;  3KP2 A;  4HF0 A;  2CJJ A;  4EJV A;  5F0H A;  1EJ9 A;  4DOZ A;  4JBA A;  1TT5 B;  4UNO A;  1NK2 P;  3K1M A;  1MW7 A;  3HL2 A;  4JYK A;  1N75 A;  3TDZ C;  4CIC A;  1RES A;  5KAF C;  4BE1 A;  4D0P A;  3KLN A;  2EFQ A;  2XV4 S;  3G1O A;  4WX9 A;  5D4S A;  4DYC A;  1A35 A;  2E71 A;  1O7L A;  5H6Q A;  4AYB N;  2JA2 A;  4HG2 A;  4XBF A;  3ZMS A;  3D5S C;  1WCM J;  3CP2 A;  1XDS A;  2WAF A;  2CW0 F;  3HOU J;  5LRR A;  2QZ8 A;  1MMS A;  4G9Y A;  3KPH A;  3R4K A;  3CDH A;  1PJR A;  4AM3 A;  3HHG A;  2W1O A;  3FM3 A;  1WJ5 A;  3JRB A;  2QWW A;  1Z9C A;  3DEU A;  4BHC A;  1UAA A;  2DA1 A;  2JA5 J;  3E6M A;  2GXG A;  2KZV A;  5TIS C;  5E1W A;  4L0Z B;  2FUG 2;  4P5O A;  2QQB A;  1ETX A;  4KA4 A;  1IV6 A;  3KLO A;  4XK4 A;  3GTG J;  3BT9 A;  3PQK A;  3L7W A;  2MD0 A;  4BH9 A;  1T0F A;  4HYE A;  1TWC J;  4P96 A;  3MKW B;  5B66 C;  3S8P A;  2VXZ A;  2YR2 A;  5M3F J;  1Z21 A;  1J75 A;  1IRZ A;  3IC7 A;  1OLT A;  3FXO A;  5HLH A;  2ZSI B;  2NRA C;  2QA4 I;  4EQQ A;  4YFN F;  3D1N I;  4EVI A;  2L3D A;  5HNH A;  3BTC A;  3DP7 A;  3W2V A;  3TO6 A;  4HST A;  4MNU A;  5JLX A;  4II2 A;  2VKD A;  4NHJ A;  2XAS A;  4A0X A;  2E2J J;  5E79 C;  3GYH X;  1T0F C;  2GXA A;  3CMY A;  1VZ0 A;  2NVX J;  3DU5 A;  3HXL A;  5IYC J;  1UCR A;  1BA5 A;  3I4M J;  2IGK A;  4BKX A;  2KIM A;  2Q2E B;  4B48 A;  2WY8 Q;  3A0B C;  1ULY A;  1SFO J;  4IHV A;  1BW5 A;  1AA7 A;  3J81 Z;  3ASN H;  1K78 A;  2K9N A;  4YRV A;  1IG7 A;  4GXO A;  2KRH A;  5K7F A;  4GDF A;  3L1P A;  3N05 A;  3FIW A;  1CF7 A;  2DJN A;  4EMS A;  1W0U A;  4XKB A;  5L3B A;  5FKK A;  2YX7 A;  3NQO A;  2FNP A;  3O2P E;  4J01 A;  3RKX A;  3PM1 A;  2LRE A;  1S72 I;  4NC6 A;  3HJE A;  2Z16 A;  2UXN A;  3IV5 A;  3RYP A;  4PK4 A;  4QPO A;  1W36 D;  3K4L A;  1V4R A;  1I5Z A;  1O57 A;  4OIP F;  4A3B J;  5BNG A;  3I53 A;  4CCJ A;  2LNB A;  4C30 A;  2LLK A;  4LIU A;  5B3S H;  3DV8 A;  5GTI C;  1LE8 B;  2OJE D;  5BOX A;  2LK2 A;  2NS0 A;  4IPA A;  1MBK A;  3FKJ A;  4NQW B;  3U1K A;  1P6R A;  3HRS A;  2E60 A;  3OR1 C;  3F6V A;  4HDU A;  3BR6 A;  4XSX F;  4E4H A;  2V6C A;  3RZO J;  2YSR A;  3DEW A;  2I5U A;  4ITV A;  1UHW A;  2LBF B;  1Z1D A;  5HLG A;  1MZB A;  4Y13 A;  1A5J A;  1FMV A;  4PSX A;  3HZJ A;  2UXX A;  1TWH J;  2QCO A;  5D6E A;  1I3A A;  1X2N A;  1RC9 A;  3DLL F;  4BE2 A;  2R7D A;  5FLV A;  2DYS H;  3U1D A;  2DA6 A;  5B1A H;  2ZCW A;  1I6X A;  1LFB A;  2R92 J;  4A3J J;  2AO9 A;  4TV7 A;  1WKM A;  3QU3 A;  2HS5 A;  2KJB A;  2ADU A;  2ZXH A;  4QWQ A;  1ENH A;  2GM4 A;  4H4K C;  2CMP A;  1R1U A;  1QRY A;  4U7D A;  2M8E A;  3HGG A;  3LAP A;  2LTP A;  4KIB A;  4G7Z F;  3TED A;  5GAH J;  1A6I A;  5KHD A;  2VB6 A;  1XB4 A;  2IPQ X;  2IXS A;  2ZFU A;  1JGS A;  3IHU A;  3K4K A;  5CVU A;  2VOD A;  1QZY A;  3H9G A;  3S17 J;  5GAD J;  3OL3 A;  1JTY A;  3HOZ J;  3CD6 I;  3BR3 A;  1YLF A;  3QPL A;  3AG1 H;  1FYK A;  2W48 A;  3DKY A;  3BG5 A;  3CUQ B;  2EK5 A;  3WU0 A;  1D1A A;  3QP5 A;  4UUT A;  2B9S A;  2ZXW H;  3VWB A;  4DW6 A;  2DAO A;  1YI2 I;  1U2W A;  1FP2 A;  2Z2S B;  3HSR A;  4XID A;  1JKR C;  4IKF A;  3K4N A;  2PLY A;  2HYG D;  1VQ5 I;  3L2U A;  4EGY A;  1WRJ A;  4LIT A;  4PFP A;  1GV2 A;  3CCQ I;  3FXR A;  3H36 A;  3ASO H;  2HQA A;  4P1W A;  3FMQ A;  2XPV A;  1IAW A;  5LGU A;  3ECH A;  1S29 A;  1ORK A;  4KDP A;  4F3Q A;  4EV0 A;  2H09 A;  1OYW A;  2VQC A;  3PNV A;  3OYN A;  3CJN A;  4B8X A;  4J00 A;  2A5W A;  1PVE A;  5FKO A;  5LHI A;  1R5H A;  2OD5 A;  1LEB A;  3FHN A;  3JSP A;  1M1E B;  2K9L A;  2ISZ A;  2BZT A;  4CYC B;  2GIV A;  2X1E A;  3OY9 A;  1MMN A;  1B9N A;  3I59 A;  2JTV A;  4A3M J;  2XGC A;  2HWV A;  2DT5 A;  3D5L A;  4OIR F;  4FE4 A;  5E8I A;  4IOC F;  5HDG A;  2BHZ A;  2LR8 A;  3R61 A;  4DGW B;  1E0E A;  3KZZ A;  1VQ4 I;  4MEY F;  3OYL A;  3U2R A;  4QTR A;  2MAB A;  3K2A A;  1XGO A;  2WB1 A;  1U5T B;  2DCE A;  2H6B A;  4MFE A;  4GYG A;  1MSF C;  2EZH A;  2VBZ A;  2IVM A;  3KZY A;  3SDB A;  5EG0 B;  1HST A;  2XSD C;  1J59 A;  5L3C A;  3DTI A;  2QSG X;  2Q0O A;  3K70 D;  3BTL A;  2PMZ N;  2HVQ A;  2HOS A;  4Q5S F;  3IH2 A;  3HKZ A;  2HTJ A;  4RGX A;  1RR8 C;  3DBR B;  3VOD A;  1MND A;  2P5L C;  3PQJ A;  4LG0 A;  3ZN1 A;  2K85 A;  4XOT A;  4C9Y A;  3BP8 A;  3P9I A;  2BV6 A;  3DLA A;  3I58 A;  3S14 J;  1WH5 A;  4IHW A;  2P5V A;  1IXS B;  3S1R J;  3CDL A;  2R7Z J;  1PP8 F;  2DOE A;  3OYM A;  2GAU A;  2M0M A;  1RPW A;  4A2U A;  4LIV A;  3V42 A;  3WGG A;  2R5Y B;  4RAY A;  4YG2 F;  2HPM A;  2NVT J;  2BY1 A;  1NHA A;  3ABT A;  2L01 A;  3Q0U A;  4YFX F;  2DFI A;  2QKL B;  2DLL A;  4A12 A;  1IJW C;  2Y30 A;  5HOD A;  3CCR I;  3AG4 H;  1D0Z A;  2CQX A;  1DPU A;  3ONQ A;  4XOP A;  1MBG A;  4E7J A;  4M73 A;  4L9T A;  2HNH A;  3HPG A;  3GTP J;  2QQ9 A;  1O3S A;  1DQU A;  3NEU A;  1AKH A;  2DYR H;  3H5N A;  2GLO A;  2VAS A;  5ED4 A;  1ZR2 A;  1U8R A;  3KFW X;  5TRD A;  2RNG A;  5CLS A;  4M72 A;  3HB9 A;  4CCN A;  4HBL A;  3LWF A;  2JVH A;  4OAY A;  4G94 A;  4MEX F;  3H9J A;  3SZP A;  3J7Z I;  2R93 J;  2QGU A;  3S2W A;  2EV0 A;  1R6R A;  2W82 A;  3TL4 X;  4E7Z A;  3OYA A;  1K83 J;  4M3B A;  1IXR C;  2VQH A;  2LD5 A;  3HSF A;  4BQQ A;  3WTY C;  4ZYG A;  3HOW J;  3H9Q A;  2FJ1 A;  4LD5 A;  1D0X A;  2VE8 A;  4D7M A;  4II3 A;  2L2O A;  3E6B A;  4MHG A;  4PJM A;  1RRJ A;  5J6X A;  1D1B A;  4R8H A;  2AHQ A;  3R60 A;  3EYI A;  2EA4 A;  1N78 A;  2DXI A;  3ZRG A;  3BTI A;  2LKP A;  1DUX C;  2O7O A;  4CHU A;  4ESB A;  2VOP A;  2M0C A;  3JTH A;  4XLC A;  5GAG J;  4G6Q A;  5FB2 A;  3IH3 A;  1XCB A;  3TOA A;  2R7X A;  4ZYE A;  2LKX A;  1HW1 A;  1FJL A;  2KIU A;  2MGQ A;  4UB8 C;  1JHF A;  1X1P A;  2E35 A;  2JK3 A;  3HSE A;  1TBX A;  4Y7N J;  1SD7 A;  3MZY A;  5CKT A;  3LOC A;  5F64 A;  3JRH A;  2XKO A;  1H88 C;  3H1C A;  1XSD A;  1Q1H A;  3S1Q J;  2IS2 A;  2VKH A;  1R1V A;  3BLY A;  3OWT A;  5J1U A;  4A69 C;  1R58 A;  1OYI A;  2V7F A;  3QPT A;  3ABK H;  4WXH A;  5L3F A;  2Y0M A;  1F4K A;  1APL C;  3FBN B;  2X6X A;  2EB7 A;  4B43 A;  4IQJ A;  4X6A J;  5HS7 A;  1FMW A;  5LGN A;  1HDP A;  1WJE A;  4JX4 A;  1W7P A;  3OIP A;  5M5X J;  1SVO A;  3ZQ7 A;  5DM7 F;  2PMH A;  3ELK A;  1D5V A;  1F1Z A;  2MLK A;  4HSR A;  4YEL A;  1JTX A;  4A93 J;  2CQK A;  4NDL A;  4UUS B;  4E7I A;  1JHH A;  3ZXS A;  2P6S A;  4GCV A;  4U0W A;  4D5C A;  2XDV A;  5JVT A;  1OCT C;  1HSJ A;  4I7H A;  4AIK A;  1XN7 A;  5GTH C;  4BXX J;  4I09 A;  2V79 A;  3S3M A;  4I2O A;  3NWS A;  3QYE A;  3FHZ A;  2DA2 A;  3IAS 2;  4CGZ A;  3DKW A;  3F22 A;  3E6C C;  3BY6 A;  3BJO A;  4MTD A;  1VQN I;  3ZR8 X;  1V5E A;  4J19 A;  5IP7 J;  4HQM A;  1YX3 A;  4O3M A;  3V7R A;  5ILU A;  1OCO H;  3F9K A;  3E1S A;  1BI0 A;  1GHC A;  2E7X A;  3E7L A;  1YJN I;  3KET A;  3GFJ A;  4KN7 X;  3T0Y A;  1B8I A;  4BUP A;  3CCU I;  1B72 B;  3PUB A;  2MFZ A;  1WWX A;  1FP1 D;  2NVU B;  1PUF B;  1DP7 P;  3HTS B;  1TNS A;  2KP6 A;  1JKQ C;  2KRF A;  5AIQ A;  4F52 A;  5IY5 H;  1LVA A;  3CCE I;  2Z99 A;  2E34 A;  3LMM A;  2VJ5 A;  3ABU A;  2JSC A;  2A5Y B;  1YIJ I;  1G4D A;  2Y0S A;  4NBQ A;  2ETH A;  2BVM A;  4Z6Y A;  4I01 A;  3QAH A;  2HQR A;  2L4M A;  1WH7 A;  2HGC A;  4V2G A;  3TW7 A;  1GXQ A;  2CW8 A;  4EJO A;  2VKV A;  2XAG A;  2DOF A;  3DCF A;  3GZ6 A; 
#chains in the Genus database with same CATH homology
 2BYV E;  1RUN A;  1QPM A;  3HTU A;  2VBW A;  5E20 A;  1U3E M;  3PFI A;  5E1X A;  5ERI A;  5DYM A;  2QUF A;  4LB5 A;  2HR3 A;  2DQL A;  1H9G A;  1L0O C;  4AIH A;  3IRR A;  3QU6 A;  3L00 A;  1HKS A;  4IHS A;  5LEK A;  3MZH A;  1XGM A;  2PBI A;  3V4G A;  1W5T A;  2HQN A;  3T5X A;  3DXJ F;  4HX4 A;  1USS A;  3W6J B;  5DD4 A;  2QBY B;  1IW7 F;  4I98 B;  4GGG A;  2FRH A;  5KK1 A;  3GXO A;  4Y17 A;  1S6L A;  2FML A;  5FFX A;  2UZK A;  4A0Y A;  1U6G A;  1HKQ A;  1TW3 A;  5E18 F;  4RGU A;  1OKR A;  2EFP A;  5D5U B;  2XRO A;  1S3J A;  4N9H A;  3FM5 A;  5HS9 A;  3BZ6 A;  1MKM A;  2P7V B;  5F1R A;  1UST A;  5K5Q A;  3BRO A;  3KEO A;  2HOE A;  5D5W B;  2CO5 A;  1ZAR A;  5CJ9 A;  2KIF A;  2P8T A;  1FSE A;  3TO9 A;  4OU0 A;  2MH2 A;  2CSO A;  3LFK A;  5CVJ A;  3SZT A;  4MTE A;  1FLI A;  2G7H A;  1BIA A;  1HW2 A;  2VN2 A;  4HA8 A;  2ISY A;  4KMF A;  1UB9 A;  2DU9 A;  2DW4 A;  1XSX A;  2XRN A;  2HYF A;  1ZG5 A;  4M74 A;  1B6A A;  1JE8 A;  3ZPL A;  3GWZ A;  1KA8 A;  1D3Y A;  2OZ6 A;  2RC4 A;  5DCM B;  3GVA A;  1R7J A;  2NAZ A;  3HUG A;  3C1D A;  1OPC A;  4RB0 A;  4LMY A;  5IT3 A;  2PMU A;  4U0V A;  1P4W A;  3ROU A;  1YW9 A;  3MQ0 A;  3DPT A;  4L9N A;  3OOP A;  4QLC U;  3M8E A;  5ICF A;  4FHT A;  5JHU A;  1ZHF A;  3F23 A;  1L3L A;  3GFL A;  2W24 A;  1SD4 A;  4Q4Z F;  4HDV A;  3CUQ A;  4ETS A;  3FMR A;  1P4A A;  5DD8 A;  3J80 Z;  2NNN A;  4HV6 A;  2F2E A;  5L3G A;  4RS8 A;  1YW8 A;  3C3W A;  5FD5 A;  3WTV C;  2ZME B;  5D5X B;  1YQA A;  3SHF A;  1Z05 A;  4BYY A;  4LLG F;  2X0L A;  3EUH A;  1YS7 A;  3J7A O;  3C7J A;  4EJT A;  2ZJ2 A;  1V3F A;  5DEQ A;  3ZMD A;  1GXP A;  4XSZ F;  1REP C;  4ASN A;  3KP4 A;  1TLH B;  1WQ2 A;  1RIO H;  2NYX A;  1B1B A;  4Z2Y A;  4UHT A;  1T39 A;  1S7A A;  5D5V B;  2L02 A;  2CFX A;  4MGR A;  4CDG A;  1OR7 A;  4IJA A;  4BQA A;  4WK8 F;  1MDM B;  2JT1 A;  2FNA A;  2ZXJ A;  2WTE A;  3IKT A;  4ZZL A;  3ML6 A;  1A04 A;  1P4X A;  1LNW A;  3CTA A;  4EJW A;  4KMU X;  2V1U A;  2DTR A;  3QP6 A;  3ULQ B;  2A61 A;  4OMY A;  3WGH A;  1G3S A;  5CVI A;  4M9X A;  1BM9 A;  1ZAO A;  1IRG A;  3LA3 A;  2BBY A;  4E70 A;  4F7Z A;  2GWR A;  4YFK F;  4KFC A;  3K1P A;  3F8B A;  1SFX A;  4LK0 F;  2RNJ A;  2M5W A;  2A68 F;  1KU9 A;  3LQR A;  1XD7 A;  5BPD A;  2JZY A;  2Y48 A;  4EM0 B;  5JFR A;  5ICE A;  4S04 A;  1Y0U A;  2D45 A;  4I02 A;  1YYV A;  4BHP A;  1FBU A;  2W84 A;  3HRU A;  1TNT A;  1RI7 A;  2ESH A;  2K27 A;  3T1B A;  1J9I A;  2IRF G;  4CYD A;  3RPQ A;  1SFE A;  3HRM A;  1SAX A;  3RI4 A;  2VT3 A;  5A2Q Z;  1ON1 A;  1LEA A;  2RDP A;  4HX8 A;  2FSW A;  2MA3 A;  2CGP A;  1FPQ A;  3H3Z A;  2ZFW A;  1J7K A;  3V8L A;  3RJP A;  1H9T A;  4ESF A;  3DQV C;  2W25 A;  3L2C A;  1YFH A;  3R6S A;  5BPI A;  1Z91 A;  2AXL A;  1EH7 A;  3V7S A;  5IT9 Z;  1W5S A;  5EEG A;  4IVN A;  5CVR A;  1STZ A;  4AWX B;  2H94 A;  3KP7 A;  3GX4 X;  1IRF A;  3KP5 A;  3Q9S A;  2GA2 A;  1ZN2 A;  2WV0 A;  3IKV A;  3ISP A;  3MFK A;  5CVV A;  5DUK A;  4HQE A;  4CZZ A;  4HF2 A;  3FX3 A;  2A3S A;  4PGG A;  2XAF A;  1R22 A;  1KYZ A;  3MWM A;  5LRS A;  3GO5 A;  3BWG A;  4DNC A;  3B02 A;  2K02 A;  2HKO A;  2VON A;  1OYY A;  2RV8 A;  1YIO A;  2OQG A;  4L18 B;  4G7O F;  2YX4 A;  3MCZ A;  2M30 A;  1YS6 A;  2DI3 A;  2D2W A;  4HX7 A;  5ICG A;  1Z6R A;  2PN6 A;  1O3Q A;  2GZW A;  2ACJ A;  4OIN F;  5BS6 A;  1UFM A;  2CG4 A;  2EJR A;  1YTY A;  4Q47 A;  1Z7U A;  1K78 B;  1ZRD A;  1RZ4 A;  3ZN0 A;  2OBP A;  1OMI A;  4UVC A;  1CF7 B;  2FOK A;  3ZMT A;  2O3F A;  2F5E A;  2O03 A;  4PZJ A;  1IN6 A;  2JRT A;  1E2X A;  5KVR A;  4BAY A;  3F21 A;  2GXB A;  3LST A;  1G3W A;  2WC2 A;  2R3S A;  1TTY A;  5DCF A;  1O7F A;  1KU7 A;  2GQQ A;  4G6D A;  4S05 A;  1FYM A;  4LB6 B;  4EM1 A;  4MQV A;  1BC7 C;  2FF4 A;  3K9T A;  2OU2 A;  3JSO A;  5K1Y A;  3COA C;  3WE2 A;  3Q5F A;  4BNC A;  3J80 K;  3FZV A;  3GW2 A;  1IN5 A;  3R0J A;  4PCQ A;  5DDG A;  2NNY A;  4HLY A;  5FD6 A;  1P2F A;  1EH8 A;  4U7B A;  4N9I A;  4OMZ A;  4R1H A;  4L9J A;  4RB1 A;  3TKY A;  4AVP A;  4O6J A;  3F8M A;  2R7F A;  1FOK A;  2VOO A;  1O3R A;  4KIG A;  3REO A;  1MJA A;  2EWN A;  3SFZ A;  2IJL A;  5D6F A;  4G8X A;  4WCG A;  1ZRF A;  5DCM A;  3O3K A;  2F5F A;  1FY7 A;  2FE3 A;  4HZF A;  4WWC A;  2FMY A;  1KGS A;  4IRI A;  2OA4 A;  1QGP A;  2OAZ A;  1LJ9 A;  1JXS A;  1K79 A;  4CXF A;  3RKW A;  1R5G A;  3BPX A;  2A69 F;  2J5P A;  2E1N A;  3EET A;  1S7O A;  3ECO A;  5CYV A;  4I0B A;  3KEQ A;  3WTS C;  4OIQ F;  3KP3 A;  3TOB A;  1QNT A;  2H27 A;  1KQ0 A;  2YPR A;  2MC3 A;  2G7U A;  2O0Y A;  2O8X A;  4XRF A;  4UV8 A;  2ZME A;  3GZ5 A;  6PAX A;  1SMY F;  3K1N A;  4ZYH A;  2PJP A;  3N97 A;  4M9Z A;  2AS5 F;  2FU4 A;  4L5I A;  4LLL A;  1R23 A;  3RTR A;  4OIO F;  1TQP A;  1KU3 A;  1BIB A;  3WOD F;  1IN4 A;  5DV5 A;  2DQR A;  3WTW C;  2A6H F;  1TW2 A;  4HAM A;  1G3Y A;  1FBQ A;  1SMT A;  4KIF A;  3ZMU A;  4UVB A;  3M9A A;  2PEX A;  2E1C A;  1IF1 A;  2LDU A;  2RVC A;  5A2Q K;  3I71 A;  1B9M A;  2Q2E A;  3E97 A;  4XLP F;  3NRV A;  1J0R A;  2MBF A;  1BBY A;  5D8K B;  2DBB A;  2HFH A;  3GFM A;  3GF2 A;  1T6S A;  3F72 A;  2DO7 A;  3I64 A;  5FLX K;  3HOS A;  1E17 A;  2B0L A;  2CYY A;  5IT9 K;  1AOY A;  4LJZ F;  1FNN A;  1R00 A;  3DPL C;  2V1D A;  3VEP A;  1C0W A;  4OOI A;  4ENM A;  1LDK B;  3RIR A;  4KIC A;  1ZG3 A;  2Q8K A;  2FBH A;  4I0A A;  1MJ9 A;  2LF8 A;  4NQW A;  2FA5 A;  1HQC A;  1FZP B;  3BJA A;  3AAF A;  1R1T A;  3VFZ A;  1H0M A;  1W7P B;  2QEN A;  3MEX A;  4JK1 X;  3ERE D;  3TQN A;  2DK8 A;  5DUI A;  4WXD A;  4M71 A;  2H6C A;  2M1B A;  3U9G A;  3JW4 A;  2RKH A;  2E7W A;  2G9W A;  5L3D A;  2HZT A;  4UV9 A;  2VE9 A;  4A5N A;  1LQ1 A;  2XIG A;  1B4A A;  5HLI A;  4UXN A;  1BI2 A;  2XAH A;  3Q9V A;  2C6Y A;  4BHB A;  3L09 A;  4H0E A;  1GVJ A;  5LGT A;  3CUQ C;  1G3T A;  1ZGA A;  3E5X A;  3QPH A;  3FXU A;  2A6E F;  1QO0 D;  2BGC A;  1IZ1 A;  3BOQ A;  1J2X A;  5H20 A;  2RGV A;  2MLG A;  1ZLK A;  5JI6 A;  3E3V A;  4L9V A;  1U78 A;  2IT0 A;  3WTZ A;  4ENJ A;  4UVA A;  3SQN A;  2K4J A;  3L9F A;  2M87 A;  1KQ8 A;  2PQ8 A;  2VBX A;  2BEO A;  1U5T A;  4LGW A;  1FSH A;  2D1V A;  1BC8 C;  2ELH A;  1XGS A;  1T98 A;  2P5K A;  1ZYR F;  2ZKZ A;  1B59 A;  4A0Z A;  2IW5 A;  1XMK A;  1FX7 A;  5AON A;  3V7C A;  1U5T C;  2QQA A;  3TGN A;  1XCV A;  5J8C A;  4ZYD A;  1R36 A;  2CWE A;  3SXY A;  1ZH5 A;  3WTT C;  2PI0 A;  3TO7 A;  3JTG A;  2FBI A;  5HDN A;  2Z3Y A;  2EV5 A;  3P9K A;  5FGM A;  4M6Y A;  2STW A;  3F6O A;  3M8F A;  2HKX A;  1BJA A;  4M9S A;  2RQP A;  3HYI A;  3HRT A;  3K0L A;  3H92 A;  5LHG A;  1S8N A;  4IRG A;  1I1G A;  2EFN A;  2L4A A;  3ZMV A;  4WF2 A;  4L5J A;  2J5O A;  4DQ2 A;  2WWY A;  1YO5 C;  1TQI A;  2EFW A;  4LK1 F;  5LHH A;  2VC1 A;  2KKO A;  4IXA A;  4CO8 A;  2K86 A;  4U88 A;  2IA0 A;  5E8G A;  3EYY A;  4L0Y B;  4UUV A;  4ZZD A;  2IA1 A;  4YII A;  4ESJ A;  3LAJ A;  5L3E A;  1T2K A;  5E17 F;  3JAM K;  2HTS A;  1HKT A;  4KUM A;  1PP7 U;  1PUE E;  3C18 A;  3V8J A;  5FLX Z;  2MD5 A;  4A6E A;  3MAJ A;  2KJC A;  1D8K A;  2M45 A;  2FEZ A;  1P92 A;  3BJ6 A;  4ENN A;  5ILS A;  2PG4 A;  4KT5 C;  1IN7 A;  5AIP A;  2ESN A;  1KYW A;  2A07 F;  3WGI A;  3GFI A;  1YW7 A;  1W4M A;  5FO5 A;  2ZNZ A;  3GEZ A;  1IUY A;  4N0B A;  2FXA A;  4FX0 A;  3WE3 A;  1XGN A;  3D0S A;  4ZH4 F;  5BMZ A;  1ZGJ A;  1G6N A;  1FYL A;  2XGX A;  2O61 A;  1W7P D;  1MD0 A;  3G73 A;  3TDU C;  4P55 A;  4HLX A;  5E1Z B;  1FBS A;  2K4B A;  4LFU A;  3QRF F;  2O6G E;  3IWZ A;  4WXC A;  5HS8 A;  1HXD A;  2Z33 A;  4IHT A;  2ZO4 A;  1ON2 A;  4NB5 A;  1AWC A;  3I0T A;  3F8F A;  5J8F A;  5ICC A;  4K2E A;  4ENK A;  2MH9 A;  2STT A;  1MGT A;  2QVO A;  3CLO A;  1T38 A;  4EJU A;  2QYO A;  1F9N A;  2P4W A;  5D4R A;  1IN8 A;  1HBX G;  2QBY A;  2XUB A;  4B09 A;  3RYR A;  3I5U A;  1BOA A;  1TQM A;  5LLQ A;  2QM3 A;  3HHH A;  4U0Y A;  1Z6T A;  3KE2 A;  2XKP A;  3G3Z A;  2IP2 A;  2F5D A;  2Y75 A;  2W85 A;  4KN4 X;  3RKY A;  3RPU A;  4RGR A;  5LEJ A;  1WSU A;  3GUD A;  1SFU A;  3FF5 A;  3F3X A;  1QQI A;  2ZBK A;  2UWM A;  5HVQ C;  2ZNY A;  4Y15 A;  3FXQ A;  1X3U A;  5EEH A;  4O5V A;  1O3T A;  2BE5 F;  3W6K B;  5F6F A;  3F8N A;  3CO6 C;  1EV7 A;  1K6O A;  2EFO A;  3P9C A;  3V8K A;  4ON0 A;  3E5Q A;  1HW5 A;  1ZRC A;  3WTU C;  1LB2 A;  3E6D A;  1MJB A;  3LA7 A;  3CO7 C;  3ZMZ A;  3K2Z A;  3BDD A;  4IF4 A;  3VB2 A;  2RN7 A;  1ZLJ A;  3P7N A;  4P9F A;  3DF8 A;  3H3U A;  3IL2 A;  4RGS A;  4KNY A;  4Q48 A;  3T8T A;  2FQ3 A;  1I1S A;  1ODD A;  3CUO A;  1RUO A;  5FFZ A;  4KYW A;  1DPR A;  1KU2 A;  4G7H F;  1VTN C;  1XDU A;  2LF7 A;  3I59 B;  4JQF A;  4AD9 A;  1QZZ A;  1XSV A;  5HOO A;  2PFB A;  3RDI A;  4A6D A;  3J81 K;  3FMS A;  4A5M A;  2XAQ A;  3JAM Z;  3O6B B;  2D1H A;  3R0A A;  3F8C A;  4FT8 A;  3N4M A;  5H6R A;  5BQT A;  1PDN C;  1I27 A;  4LG0 B;  2GA1 A;  2L54 A;  2VBY A;  2COM A;  5ILV A;  1FWZ A;  2HDC A;  5D8L B;  2JPB A;  4FX4 A;  3BPV A;  3HOT A;  2Z5U A;  1SD5 A;  1ONV A;  4PDK A;  1BI3 A;  1MDM A;  2EA2 A;  4RB2 C;  1IXC A;  2IA2 A;  2K7L A;  1UHM A;  3M7G A;  4XLN F;  2DPU A;  4R79 A;  3T8R A;  4P9U A;  2OZU A;  5HDK A;  2EV6 A;  3KCC A;  3M1E A;  4BXU A;  3EDP A;  4YIF A;  3VOE A;  2HEO A;  1XMA A;  1WI9 A;  3WU1 B;  3ZP5 A;  5JR3 A;  4EGZ A;  2JPC A;  1K7A A;  1SD6 A;  1LDD A;  1F5T A;  3WG9 A;  2VC0 A;  1QBJ A;  3I4P A;  1CGP A;  2V1X A;  3LQQ A;  5TJJ A;  4IRH A;  3IRQ A;  3DFG A;  1ZG1 A;  1FC3 A;  3I54 A;  1D8J A;  5LBQ A;  1DDN A;  3OV8 A;  1FT9 A;  1J5Y A;  3E5U A;  2F5C A;  1RNL A;  4HW0 A;  3LA2 A;  2W57 A;  2V9V A;  4EM2 A;  4HF1 A;  4RAZ A;  4RB3 C;  2LSO A;  2P6T A;  4GYI A;  2X4H A;  2VT2 A;  1KQ9 A;  2XVC A;  5K5R A;  4PGH A;  1LDJ A;  3KP6 A;  2DPD A;  4LLN A;  4M6X A;  4HOB A;  3EQL F;  3FWE A;  2XAJ A;  4HV5 A;  1ZRE A;  5K5O A;  1BN5 A;  2OQR A;  2DK5 A;  2YU3 A;  1YG2 A;  2FBK A;  4AIJ A;  3HIF A;  3IWF A;  3WTX C;  3K69 A;  3B73 A;  2P7C B;  1BI1 A;  2QLZ A;  2XHK A;  4GO1 A;  2TDX A;  2Z9O A;  3QOP A;  4MQ9 F;  1EH6 A;  3KP2 A;  4HF0 A;  4EJV A;  4JBA A;  4UNO A;  3K1M A;  4CIC A;  3TDZ C;  4D0P A;  3KLN A;  2EFQ A;  2XV4 S;  4WX9 A;  5D4S A;  1O7L A;  5H6Q A;  4XBF A;  3ZMS A;  1XDS A;  2CW0 F;  5LRR A;  2QZ8 A;  4G9Y A;  3R4K A;  3CDH A;  3HHG A;  3FM3 A;  2QWW A;  1Z9C A;  3DEU A;  4BHC A;  3E6M A;  2GXG A;  5E1W A;  4L0Z B;  4P5O A;  2QQB A;  4KA4 A;  3KLO A;  3PQK A;  3L7W A;  4BH9 A;  1T0F A;  4HYE A;  4P96 A;  2VXZ A;  2YR2 A;  1J75 A;  3IC7 A;  5HLH A;  2NRA C;  4EQQ A;  4YFN F;  4EVI A;  2L3D A;  3DP7 A;  3TO6 A;  4MNU A;  4NHJ A;  2XAS A;  4A0X A;  3GYH X;  1UCR A;  2KIM A;  1ULY A;  3J81 Z;  1K78 A;  4GXO A;  1CF7 A;  4EMS A;  5L3B A;  2YX7 A;  3NQO A;  2FNP A;  3O2P E;  3RKX A;  2UXN A;  3RYP A;  1V4R A;  1I5Z A;  1O57 A;  4OIP F;  3I53 A;  2LNB A;  3DV8 A;  5BOX A;  2NS0 A;  4IPA A;  1P6R A;  3HRS A;  3F6V A;  4HDU A;  4XSX F;  2V6C A;  2YSR A;  1UHW A;  1Z1D A;  5HLG A;  1MZB A;  4Y13 A;  2UXX A;  5D6E A;  2R7D A;  3U1D A;  2ZCW A;  1I6X A;  4TV7 A;  1WKM A;  3QU3 A;  2HS5 A;  2KJB A;  2ADU A;  4QWQ A;  1R1U A;  4U7D A;  2M8E A;  3LAP A;  4KIB A;  4G7Z F;  1XB4 A;  2IPQ X;  1JGS A;  3IHU A;  5CVU A;  2VOD A;  1QZY A;  1YLF A;  1FYK A;  3CUQ B;  2EK5 A;  3WU0 A;  3QP5 A;  2DAO A;  1U2W A;  1FP2 A;  3HSR A;  2PLY A;  2HYG D;  4EGY A;  1WRJ A;  3FXR A;  3FMQ A;  1IAW A;  5LGU A;  3ECH A;  1S29 A;  4KDP A;  4EV0 A;  2H09 A;  1OYW A;  3CJN A;  4B8X A;  5LHI A;  1R5H A;  2OD5 A;  1LEB A;  3JSP A;  2ISZ A;  2GIV A;  1B9N A;  3I59 A;  2JTV A;  2HWV A;  2DT5 A;  3D5L A;  4OIR F;  5E8I A;  5HDG A;  3R61 A;  3KZZ A;  4MEY F;  3U2R A;  1XGO A;  1U5T B;  2H6B A;  4GYG A;  2VBZ A;  2IVM A;  3KZY A;  1HST A;  1J59 A;  5L3C A;  2Q0O A;  4Q5S F;  2HTJ A;  4RGX A;  3VOD A;  2P5L C;  3PQJ A;  4LG0 A;  3ZN1 A;  3BP8 A;  3P9I A;  2BV6 A;  3I58 A;  2P5V A;  1IXS B;  1PP8 F;  2GAU A;  4A2U A;  3WGG A;  4RAY A;  4YG2 F;  1NHA A;  3ABT A;  2L01 A;  4YFX F;  2DFI A;  2DLL A;  4A12 A;  1DPU A;  4M73 A;  4L9T A;  2QQ9 A;  1O3S A;  3NEU A;  5ED4 A;  1U8R A;  3KFW X;  5TRD A;  5CLS A;  4M72 A;  4HBL A;  3LWF A;  4G94 A;  4MEX F;  3SZP A;  3S2W A;  2EV0 A;  1IXR C;  3HSF A;  3WTY C;  4ZYG A;  4LD5 A;  2VE8 A;  3E6B A;  4MHG A;  5J6X A;  4R8H A;  3R60 A;  3EYI A;  2EA4 A;  2LKP A;  1DUX C;  4CHU A;  4ESB A;  2VOP A;  3JTH A;  4G6Q A;  5FB2 A;  1XCB A;  3TOA A;  4ZYE A;  1HW1 A;  2KIU A;  1JHF A;  3HSE A;  1TBX A;  1SD7 A;  3MZY A;  5F64 A;  2XKO A;  1XSD A;  1Q1H A;  1R1V A;  1R58 A;  1OYI A;  3QPT A;  5L3F A;  4WXH A;  2Y0M A;  1F4K A;  2EB7 A;  5HS7 A;  5LGN A;  1W7P A;  3ZQ7 A;  1D5V A;  2PMH A;  3ELK A;  1F1Z A;  2MLK A;  2CQK A;  1JHH A;  2P6S A;  4GCV A;  4U0W A;  5JVT A;  1HSJ A;  4I7H A;  4AIK A;  1XN7 A;  4I09 A;  2V79 A;  4I2O A;  3FHZ A;  4CGZ A;  3DKW A;  3F22 A;  3E6C C;  3BY6 A;  3BJO A;  4MTD A;  4HQM A;  4O3M A;  3V7R A;  5ILU A;  1BI0 A;  1GHC A;  2E7X A;  3KET A;  3GFJ A;  4KN7 X;  3T0Y A;  1WWX A;  1FP1 D;  3HTS B;  1DP7 P;  1TNS A;  2KRF A;  5AIQ A;  1LVA A;  2Z99 A;  3ABU A;  2JSC A;  2A5Y B;  1G4D A;  2ETH A;  4I01 A;  3QAH A;  2HQR A;  2L4M A;  2HGC A;  1GXQ A;  4EJO A;  2XAG A;  3GLX A;  3GZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...