2FXPA

Solution structure of the sars-coronavirus hr2 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
55
structure length
55
Chain Sequence
b'GSHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spike glycoprotein
publication title Solution structure of the severe acute respiratory syndrome-coronavirus heptad repeat 2 domain in the prefusion state
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 14
structure length 55
sequence length 55
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.790 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2fxpA01
2BEZF 2FXPA 2BEQD
chains in the Genus database with same CATH superfamily
2V7QH 1P84H 2FY8A 2W6AA 1HBWA 3CXHI 1SQPJ 1VQ9P 1BCCD 2FYZA 1Y8AA 2V7QJ 3H1JG 4QMAA 2WMMA 4JQ0D 3CI9A 2N1TC 1DH3A 4YTPC 3WUUA 1BGYE 1ZP0C 2SPZA 1NJIQ 1KORA 1VF5C 1R5SA 3AEAC 3G71P 1PP9E 3RK3B 3E1IA 2W6BA 2ZYGA 2WITA 1LGHB 2L5GB 4H0LB 1BDCA 1JTHB 3AECC 2E42A 1LTJB 1MFZA 3AEGC 1NTME 4OGQC 1SQPG 3MGNA 2IBZG 1VF5D 3D6ZA 2IPPA 2ZVNB 1KQSO 2QVAA 2ZFCA 3E1RA 1BCCE 2QJKB 4UB8H 5CCGD 1X9VA 2QG4A 1FE6A 1H0TB 1LT9B 3F5HA 2E75C 1G2CB 2MKVA 3NMDA 2I1JA 3PHLA 3L75E 3SFDC 3Q5RA 2WQYC 4A7PA 4EOTA 2M5AA 1EXJA 4OGQD 4DT0A 2NPSA 3KZIE 4GDOA 1M1JB 2YKOA 1PGJA 1NTMK 3Q2YA 2IBZI 3P8CD 3CCQP 2KS1B 2G8YA 3CCVP 2KIKA 4I2LC 4GKGA 3B5NC 1Z56A 4BRYA 1LP1B 3IN6A 1X8YA 4AQRD 2OTJP 3WU2E 5KLVD 2ZT9C 4ASWA 5KJ7A 2BCCD 1SLQA 1Y9BA 1NH4A 2WPVB 3LIEA 5AW3B 3B5ND 1RHZB 3MUDA 3RBXA 1W5CE 5AW1B 2HFED 4JF7A 1KFMA 1J2JB 1PZQA 5APTA 1LJ2A 2ZT9D 1MUUA 3BCCD 1FJKA 4ASVA 5KTBA 2N1TB 2OYHA 1VF5B 1HF9A 2JO1A 2CPBA 2FYUE 1U57A 5KLVE 4L73A 1LTGC 4IFFA 2BEZF 2BCCE 5GTIE 3D70A 3UIAA 2W8ZA 2M3BA 4OGQB 1JOCA 2IYPA 3VMZA 2KZJA 4WY4D 2H89C 1S72P 1X0TA 2NZ2A 3KPEA 2ZAEB 1IFPA 1GK4A 4ZKPA 4YPCA 3BCCE 4WBAA 2H7HA 5B5EH 2E75B 2AXCA 2B87B 2FYUK 1R5LA 1S9KE 4UB6E 3L70D 5KLVK 1DEBA 1S5LX 4I6MC 1RF0C 3GW6A 2ZYDA 1LTAC 3F89A 2KNCA 2E43A 5CBNA 1KYOH 1GL2A 1IK7A 3B5NB 1VL2A 1DEEG 2KK7A 1DIPA 3QH9A 1VQ8P 3ABVC 1JB0J 4K3AA 3L73J 1Q82Q 1OIPA 2ZT9B 2IZ1A 1NTKE 1N73C 3NXSA 4DCKA 2K9JB 4H44D 2OYOA 1VQOP 3VTPC 1FOSF 3L70E 1S3JA 2WWWA 1L4AC 3R2PA 3L74D 1YQ4C 1L0LG 3H1HG 3OJAB 5AW0B 1S5LE 1M7LA 2K1AA 3KQGA 1OVVA 5KKZC 2GM4A 4HJGH 5AVUB 3L73G 1IK9A 1NTKK 1SQBJ 1GW4A 1A02F 1L4AD 4OVNF 5DJTB 1PIXA 2HR3A 3CMAP 1N8RQ 2ZYAA 5KAFH 4I1LA 4B86A 1U7JA 2D2CC 1EQ7A 2QIWA 2H8PD 3L74E 1VQ6P 1KYOI 4JYBA 5APYA 1QVGO 1M90Q 2OQQA 3M9HA 1EXIA 3CCRP 3MIWA 4LLHA 2IBZE 3V2NA 3GHGB 3L72J 3HD7C 1HJ0A 3RK2C 3HRNA 2D2CD 4RO0A 2NRGA 1JNMA 1L0ND 2H88C 1E5WA 5AVVB 5CJ0A 4H44B 5AVXB 3TNUA 5H2FE 1VQ4P 1SQQD 3A0BH 1ZR2A 1FBMA 1SFCC 2CK3H 3HD7D 1YJ9P 3RK2D 3AE8C 2C9NY 1SQPK 4GODA 1HVVA 4ZKUA 1N73B 1Q7YQ 1RF1C 1N7LA 3AEDC 2O1JA 1RE4A 1QEXA 2P58A 1FZEA 1GW3A 1L4AB 2WPQA 1NO4A 1SFCD 1JY3N 1NTZG 1L0NE 1NU1J 2I1KA 2QA4P 3LW5H 1SQQE 2KYVA 3HTKA 3HUSA 2H43A 2J5UA 5KKZB 5CCHA 2WVRA 3LW5J 1BE3J 2OYIA 2YO2A 5CHXA 1LTTC 2QEXP 1FZFA 4DZOA 3L71J 1VQLP 3MP7B 4GIFA 3H1IJ 2OGUA 4W80A 1SQVD 1FDOA 1H88A 2UWJE 1HTLC 1RY3A 1M1KQ 4PV1C 2D2CB 3FXEA 2AXTE 2O01H 2XKMA 4KHXA 3EQ2A 4Y28J 1NKNA 2ZXEB 3H1KD 2P1JA 5AVWB 3M0AA 2O01J 1VQKP 2KZIA 3A2AA 3IAOA 1PPJG 2C0XA 1PV3A 2G3AA 1SVFA 3HD7B 3L71G 3RK2B 1FC2C 1N7SA 2L91A 3G9RA 5E79E 1D7MA 1PGPA 4PD4I 1NTMD 3H1LJ 1EDIA 1EDLA 4TLFA 3SWFA 1NYHA 3CMEP 1GD2E 1SQVE 4GOFA 1KILA 5AVYB 1FS0E 1PL5A 3OW2O 1SFCB 1KB9H 1NGMB 2WTYA 4L76A 2P7JA 3PRJA 1G1JA 3H1KE 1X79B 1KFNA 3CCEP 3L75D 2OARA 3MZWB 1RF1B 2HODA 3H32B 4ZMDA 5CCGC 1ZR4A 1A02J 5GTHE 1PGOA 4U3FJ 3B71A 1OVRA 3H1LG 1YTZT 3R4YA 1SQVK 4D6TD 2QRXA 4W7YA 5B66H 3HE4B 3Q5SA 1NVOA 3QWOC 2OTKE 2Y9ZA 3CC4P 2JEEA 2KLVA 1GDTA 4EI2A 2M5AB 3Q1MA 1LTJA 3CCMP 4TT3H 2J59M 1K8AQ 1QL1A 1IZNB 1SQBD 1ZXGA 3CCSP 3U59A 5AW6B 1KYOE 2ITAA 3O6QB 4U3FG 2AEJA 3L73E 3V2QA 2E74C 2IX7C 5KAIH 1HWTC 3JCUH 4PV1B 2HPCA 1OZHA 4YXDC 1URQC 1P84I 4HH2A 1H0TA 3O8ZA 1LT9A 4D6TE 1KZUB 3CX5H 1G2CA 2PP6A 2P10A 1KQGB 3L37A 3T97B 4Y99C 1USEA 2IZ0A 2FYUD 1W2BO 2XDJA 1ZV8A 2Z5HA 1HH0A 3C8VA 4DOJA 2E74D 1GL2D 1EZVG 2A06D 3M0DC 3FGAD 1URQD 1JMBA 3RL0C 3L72D 1RE3A 2KS1A 1JY3P 1YJWP 1SQBE 3TDKA 3KHUA 1IFJA 2QJPC 2WPSA 1LP1A 1OXZA 1Q86Q 3BVHA 3A7OA 2Q1KA 4GOEA 1YTZI 2Q7CA 1J1EC 1S9KD 1SQXD 1EZVI 3RL0D 1NWQA 4WY4C 2FXMA 3TGUJ 4AUWA 3PH0A 4PJ0H 2W83C 5APXA 2KLUA 2IYOA 1SQBK 2A06E 1FJPA 3U1CA 3L72E 3S9OA 4H13D 2C9LY 1EC5A 2JDIH 2N1TA 3V2RA 1HGVA 1PFIA 4PD4D 3CWBG 1NU1D 2YMYA 1NOHA 2I8DA 5APSA 1NTKD 4GT1A 3TSIA 2RMZA 1MFTA 3CXHD 1BGYJ 3P32A 3EFFK 3VYIA 1K05A 3TGUG 1PP9J 2GUSA 2PAJA 4RKUJ 1SQXE 3GHGC 1BE3D 3A5TA 3NTNA 1JY3O 2KNCB 5TJHA 2E74B 2KOGA 3H1ID 3JSVC 1R8EA 2JWAA 1URQB 4WB4A 4H44C 1J1DB 1L0LJ 3H1HJ 3CCLP 2R32A 2B89A 1RH5B 2B87A 1T6AA 2Y9YA 1AFOA 3B8EB 4PD4E 3E7KA 2YXRB 4Y99B 3TYYA 1NU1E 1BCCJ 2XU6A 5TISE 3AEBC 3H1JD 1HJBA 1BGYG 4EDFA 1SQXK 1N2DC 1PP9G 1JMMA 2R44A 3CXHE 3KZIH 3I56P 1OMIA 3RL0B 4W7ZA 1BE3E 1X22A 3AEEC 3B5NA 4IL6X 2QJPB 3PTZA 1IFNA 4Z1MH 3H1IE 1CW5A 1IJDB 4R4MA 1FDIA 4WVZA 2JR8A 3WU2H 1J1EB 1NU1K 1SQPD 1USDA 2FFDC 2K9JA 3N7NA 1BCCG 2IBZD 2IDBA 1P84D 4WY4B 2Q6QA 4RJTA 2E5YA 3Q3DA 1K73Q 2M0BA 3OA7A 3H1JE 2K9YA 1FZGA 3FWLA 1Q90D 5CCHD 4U7JA 3P8MC 3G6EP 3RGUA 1Q81Q 2FXPA 2WZ7A 3V5BA 2R3SA 5AVSB 1AVYA 4HB1A 2O01N 3S1KA 5BU5A 4IL6E 3KXDA 3WMM0 1YHQP 1LNQA 1FOSE 1YBKA 3P7KA 1SQPE 4BXLA 3EFGA 3GF7A 1P84E 4XE5B 3AE3C 3A3YB 5KLVJ 2A45H 1KTMA 1S1CX 4OH8B 3L4FA 4WWIA 2BCCJ 1NTZJ 2M3EA 2YKPA 2XV5A 4C7NB 1QVFO 2LXBA 2YMKA 5AVRB 2WT7B 1OW6A 1N7SD 3VMXA 2B9BA 1WT6A 4OWFA 1ZLLA 1SP4A 1FZCA 1VQ7P 3AE7C 5AW5B 4UB6H 1Q2NA 4R4LA 2K3RA 2ZVOB 2PFXA 3BCCJ 2WSFH 1OVUA 1RF0A 5M1BA 5B66E 5KLVG 2KUBA 2WSFJ 1HUCA 3HE5B 2BCCG 3W68A 3V4QA 1EZVE 4UB8E 1JEKA 1NKZB 2A45G 2N9YB 4I7ZC 2BEQD 1N73A 2B88A 2W6JH 2FFDB 2O3JA 4LGDE 3BCCG 2LR2A 1AQ5A 1L4AA 2V4HA 2NPSC 2E76C 1LTIC 3BRTB 5C39A 1GU4A 1MKMA 3ITKA 1M56D 1MV8A 1DD4A 3IF4A 2RH0A 4C7RA 4KT0J 2A45I 3L70J 1S5LH 3LIDA 3WUTA 4EIJA 1GTWA 1BSHA 5K5GB 1XTGB 1CI6B 2NPSD 2E76D 3L36A 5KJ7C 3D6YA 2FXOA 2IFNA 2QM8A 3AE1C 1RQUA 2RKLA 2KSEA 1U7MA 4XA4A 5AW8B 3V4WA 2M8RA 2DW3A 4K35A 3MUDC 1LWUA 5AVQB 3TF5A 2C0WA 3L70G 2Z4EA 3VMAA 3TGUE 2KB7P 4JYCA 5KJ7D 3VOPA 3D71A 4IFDK 2OYHC 1ZRTD 2FYNC 4DJGA 3CC7P 3L74J 1L0LD 3H1HD 3HD7A 3M06A 2YIUC 2Y0EA 1VQMP 1PGQA 1FU1A 1S4XA 1LTBC 1KYOD 3L73D 5H2FH 5EFWB 1VQPP 3G3ZA 5BVZA 1XTCC 1SFCA 1GZLA 1M8OB 2ZJSE 3FX0A 3GMAA 4I7ZB 1GU5A 5B5EE 2OTLP 3RBZA 3L74G 4CPGA 1RF1A 2WSCH 3H32A 1JY2N 1ZRTE 2AEFA 1JTHA 2KSJA 1L0LE 3H1HE 2N1TD 4N78D 2NPSB 2E76B 2P67A 2WSCJ 1OFCX 3FXDA 2HPCB 1ZMEC 1WMKA 2AEMA 3HE4A 1GL2C 1HGZA 1L0NJ 1J1DC 4BRYB 2XNDH 5KLIC 1T2KC 1SQQJ 2Z5IA 1SS1A 1KB9I 4EYYQ 1EDKA 1L0LK 1M57D 1RQVA 3VN0A 1KQFB 5AW7B 3O6QA 2JJLA 5AW9B 1UIXA 1M1JA 1OWAA 1YITP 2E75D 4N78E 3BATA 2AXTH 2LXCB 1AQTA 1GMJA 1T2KD 3EWKA 2WSEH 2Q3IA 1BDDA 3C9IA 1L0NG 2XZRA 2QSIA 3A0HH 3T97A 1IO4A 3AE9C 3CWBJ 2OYHB 1NTZD 2FYNB 2WSEJ 1SQQG 4NPEA 4H13C 2YIUB 3MHVA 3AE2C 5KAFE 2N9BA 1VQ5P 5E79H 3KYQA 5AVZB 3NFQA 3CD6P 5L8RJ 2P2UA 3P8CE 2Q5UA 3JC22 1KN7A 2YO3A 3GG2A 1SQVJ 3CLQA 2Y0DA 1NTZE 5CCGA 2XNXA 3CX5I 2K88A 2KI7B 3AE5C 3H1KJ 1IFIA 5BU8B 3M91A 5GTHH 3RL0g 1CSBA 1PPJD 5APQA 3M9BA 4N6JA 3A0BE 1KQLA 2Q3EA 1ZW0A 1NAYA 3L71D 1QLED 3OAKA 4NPDA 1GL2B 5APUA 1G1IA 2CPSA 4L74A 3BASA 1SQVG 1NTMJ 1FZCC 5KLIB 1OW7A 2QM7A 3W67A 1NTZK 3H1KG 1T8ZA 3U1AA 3WUVA 4XFJA 4M3LA 1RE4C 3MD0A 3I55P 3SFEC 1S2EA 1URQA 3L75J 2VRSA 4RESB 2Y0CA 2FKWB 2R5BA 1PPJE 1VDFA 1OW8A 3L35A 3L71E 4YXWH 1DX7A 1AJYA 1H89A 2YXQB 3BRVB 3HUSC 1AVOA 4L75A 1NTMG 3H1LD 5CCHC 2LKMA 2QJYC 2W90A 2OYIC 1K9MQ 1LT1A 4D6TJ 1JY2P 4H13B 2O1KA 3M0DA 3CC2P 2Q9IA 4IFMA 3V2PA 3CPWO 1E79H 3IFMA 4IOIH 1KB9D 3L75G 1JO5A 4BWNA 3KDPB 3PJSK 1AV1A 4HKZH 4U3FD 2FBWC 2YNYA 2WSSH 4WY4A 1BSNA 1KMIZ 2HYNA 4HYTB 4D6TG 3H1LE 1DD3A 2PRRA 3MTUE 1JCCA 1TU3F 4LC1A 5APWA 1UIIA 2MJZA 1OX3A 1N7SC 2PGDA 4MN4C 1LWUC 2JKVA 2FYUJ 3TNUB 5GTIH 2E5TA 3Q5PA 3SWKA 1EZVD 3N4XA 1IC2A 1QGKB 1KILC 3II6A 1NHLA 1KB9E 1SQBG 3CCUP 3PP5A 1NAFA 3FWNA 1KC8Q 1FZCB 1L2PA 4U3FE 2R3CA 3VMYA 1JY2O 1K04A 3GHGA 4O9BA 2HG5D 3G4SP 2J58A 1KV4A 1H8AA 3AE6C 1VPCA 2GA1A 3SWYA 1W2EA 3AEFC 1KILD 2WPRA 1AA0A 3I5CA 1LTSC 2IFMA 2FYUG 3CCJP 1SQXJ 1ZN5A 2R5DA 3C1LA 4C7NA 1FDMA 3CX5D 1IFDA 2WT7A 2A06G 1T3JA 3M9QA 2KP8A 5AW2B 1JUNA 2JWDA 5CJ4A 4KJMA 1GK6A 3HTKB 3HUSB 3RK3C 3L72G 4PD4H 3SSUA 2QJYB 4JBZA 5AVTB 4H0LC 3B4SA 2OYIB 5TISH 3IR9A 5DJUB 3CWBD 1LTJC 2ZXXA 4AYCA 1FZAA 2K37A 4ZNCA 3CXHH 3S4RA 5KAIE 3JCUE 2HLOA 1NTKJ 1YI2P 3HE5A 1SQXG 2POHA 1Y47A 2GUVA 3RK3D 1KILE 3TGUD 3PLNA 1YJNP 2QJKC 2JP3A 4C46A 3TK1A 4H0LD 3CX5E 1KD1Q 1LT9C 5AW4B 1FAVA 1CZQA 5CMZA 2FFDA 4N3YB 3V6IA 4NPFX 1VQNP 5APVA 1JM0A 1QL2A 1WRGA 1FZBA 3AE4C 5CBOA 1YYCA 1L0NK 1QX8A 1M1JC 1NU1G 2QE7H 1N7SB 3CL3D 3CWBE 1LWUB 1SQQK 1RE3C 1NTKG 3K5BA 3VP9A 2YKQA 1BGYD 3H1JJ 3A0HE 4JPZB 1ZOYC 2KXPB 1PP9D 1KILB 1BE3G 1T3UA 1EDJA 2RN0A 3RK3E 1CI6A 3VP8A 4IL6H 4PV1D 3H1IG 2BASA 3GLMA 3H6PA 4PJ0E 2W27A 1IFMA 1YIJP 3GF3A 3H25A 1JCDA 1YQ3C 3USSA 2HODB 3ZDMA 1MZ9A 1N86A
chains in the Genus database with same CATH topology
2QSIA 1KMIZ 4KT0J 1OMIA 3IAOA 3Q1MA 1PV3A 1KTMA 1DD3A 2G8YA 2G3AA 2H89C 1S1CX 3AE8C 3AE9C 3GMAA 1OW7A 4I7ZB 1TU3F 4TT3H 5KKZC 2WSEJ 2NZ2A 3AEEC 4IL6X 2V7QJ 4H13C 3IN6A 3G9RA 4Z1MH 2YMKA 3AE2C 2E74C 2E75B 4XFJA 1OW6A 3AEDC 3S9OA 4PV1B 1PIXA 4H13D 1KILE 1ZRTE 2E76D 4YTPC 1ZP0C 4R4MA 2ZT9C 3Q5PA 4YXDC 2QJKC 3SFEC 1KORA 2JP3A 1VF5C 3AEAC 3D6YA 4H0LD 1NYHA 3AE1C 1FDIA 5L8RJ 3AE7C 2E76B 1RQUA 2WSCJ 1S5LX 1Y9BA 4R4LA 4H0LB 2IDBA 1PL5A 2D2CC 1OW8A 2WPVB 1ZMEC 3AECC 1WMKA 2P10A 1KQGB 3T97B 1NGMB 5M1BA 3Q3DA 1AJYA 2QIWA 1K05A 3AE4C 2J5UA 4RKUJ 1IK7A 2WSFJ 3C8VA 2QJYC 2K9YA 1K04A 2E74D 3AEGC 1VL2A 1Q90D 3LW5J 1DIPA 4OGQC 4U7JA 2OQQA 4H13B 1EXIA 3FGAD 2ZT9D 3ABVC 2FXPA 1VF5D 3D6ZA 2E74B 3AE6C 5KLIC 1JB0J 3D71A 3AEFC 4I7ZC 2BEQD 1R8EA 2ZT9B 2FYNC 4H44C 3AE5C 1VF5B 1HF9A 2JO1A 1HJ0A 1ZOYC 2QJPC 2D2CD 3B71A 1RQVA 1FDOA 1KQFB 4H44D 2YIUC 3R4YA 3RL0g 1U57A 2H88C 3O6QA 3RK3E 2E75C 2MKVA 4PV1C 2D2CB 1UIXA 4H44B 3SFDC 3Q5RA 2WQYC 3Q5SA 2E75D 4PV1D 2BEZF 1EXJA 4OGQD 2E76C 4Y28J 3AEBC 3D70A 1YQ4C 2FBWC 3GLMA 4GDOA 3GF7A 1GMJA 1MKMA 2O01J 4H0LC 1DD4A 3EWKA 3AE3C 4OGQB 3GF3A 1YQ3C 3H25A 3Q2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BEZ F;  2FXP A;  2BEQ D; 
#chains in the Genus database with same CATH topology
 2V7Q H;  1P84 H;  2FY8 A;  2W6A A;  1HBW A;  3CXH I;  1SQP J;  1VQ9 P;  1BCC D;  2FYZ A;  1Y8A A;  2V7Q J;  3H1J G;  4QMA A;  2WMM A;  4JQ0 D;  3CI9 A;  2N1T C;  1DH3 A;  4YTP C;  3WUU A;  1BGY E;  1ZP0 C;  2SPZ A;  1NJI Q;  1KOR A;  1VF5 C;  1R5S A;  3AEA C;  3G71 P;  1PP9 E;  3RK3 B;  3E1I A;  2W6B A;  2ZYG A;  2WIT A;  1LGH B;  2L5G B;  4H0L B;  1BDC A;  1JTH B;  3AEC C;  2E42 A;  1LTJ B;  1MFZ A;  3AEG C;  1NTM E;  4OGQ C;  1SQP G;  3MGN A;  2IBZ G;  1VF5 D;  3D6Z A;  2IPP A;  2ZVN B;  1KQS O;  2QVA A;  2ZFC A;  3E1R A;  1BCC E;  2QJK B;  4UB8 H;  5CCG D;  1X9V A;  2QG4 A;  1FE6 A;  1H0T B;  1LT9 B;  3F5H A;  2E75 C;  1G2C B;  2MKV A;  3NMD A;  2I1J A;  3PHL A;  3L75 E;  3SFD C;  3Q5R A;  2WQY C;  4A7P A;  4EOT A;  2M5A A;  1EXJ A;  4OGQ D;  4DT0 A;  2NPS A;  3KZI E;  4GDO A;  1M1J B;  2YKO A;  1PGJ A;  1NTM K;  3Q2Y A;  2IBZ I;  3P8C D;  3CCQ P;  2KS1 B;  2G8Y A;  3CCV P;  2KIK A;  4I2L C;  4GKG A;  3B5N C;  1Z56 A;  4BRY A;  1LP1 B;  3IN6 A;  1X8Y A;  4AQR D;  2OTJ P;  3WU2 E;  5KLV D;  2ZT9 C;  4ASW A;  5KJ7 A;  2BCC D;  1SLQ A;  1Y9B A;  1NH4 A;  2WPV B;  3LIE A;  5AW3 B;  3B5N D;  1RHZ B;  3MUD A;  3RBX A;  1W5C E;  5AW1 B;  2HFE D;  4JF7 A;  1KFM A;  1J2J B;  1PZQ A;  5APT A;  1LJ2 A;  2ZT9 D;  1MUU A;  3BCC D;  1FJK A;  4ASV A;  5KTB A;  2N1T B;  2OYH A;  1VF5 B;  1HF9 A;  2JO1 A;  2CPB A;  2FYU E;  1U57 A;  5KLV E;  4L73 A;  1LTG C;  4IFF A;  2BEZ F;  2BCC E;  5GTI E;  3D70 A;  3UIA A;  2W8Z A;  2M3B A;  4OGQ B;  1JOC A;  2IYP A;  3VMZ A;  2KZJ A;  4WY4 D;  2H89 C;  1S72 P;  1X0T A;  2NZ2 A;  3KPE A;  2ZAE B;  1IFP A;  1GK4 A;  4ZKP A;  4YPC A;  3BCC E;  4WBA A;  2H7H A;  5B5E H;  2E75 B;  2AXC A;  2B87 B;  2FYU K;  1R5L A;  1S9K E;  4UB6 E;  3L70 D;  5KLV K;  1DEB A;  1S5L X;  4I6M C;  1RF0 C;  3GW6 A;  2ZYD A;  1LTA C;  3F89 A;  2KNC A;  2E43 A;  5CBN A;  1KYO H;  1GL2 A;  1IK7 A;  3B5N B;  1VL2 A;  1DEE G;  2KK7 A;  1DIP A;  3QH9 A;  1VQ8 P;  3ABV C;  1JB0 J;  4K3A A;  3L73 J;  1Q82 Q;  1OIP A;  2ZT9 B;  2IZ1 A;  1NTK E;  1N73 C;  3NXS A;  4DCK A;  2K9J B;  4H44 D;  2OYO A;  1VQO P;  3VTP C;  1FOS F;  3L70 E;  1S3J A;  2WWW A;  1L4A C;  3R2P A;  3L74 D;  1YQ4 C;  1L0L G;  3H1H G;  3OJA B;  5AW0 B;  1S5L E;  1M7L A;  2K1A A;  3KQG A;  1OVV A;  5KKZ C;  2GM4 A;  4HJG H;  5AVU B;  3L73 G;  1IK9 A;  1NTK K;  1SQB J;  1GW4 A;  1A02 F;  1L4A D;  4OVN F;  5DJT B;  1PIX A;  2HR3 A;  3CMA P;  1N8R Q;  2ZYA A;  5KAF H;  4I1L A;  4B86 A;  1U7J A;  2D2C C;  1EQ7 A;  2QIW A;  2H8P D;  3L74 E;  1VQ6 P;  1KYO I;  4JYB A;  5APY A;  1QVG O;  1M90 Q;  2OQQ A;  3M9H A;  1EXI A;  3CCR P;  3MIW A;  4LLH A;  2IBZ E;  3V2N A;  3GHG B;  3L72 J;  3HD7 C;  1HJ0 A;  3RK2 C;  3HRN A;  2D2C D;  4RO0 A;  2NRG A;  1JNM A;  1L0N D;  2H88 C;  1E5W A;  5AVV B;  5CJ0 A;  4H44 B;  5AVX B;  3TNU A;  5H2F E;  1VQ4 P;  1SQQ D;  3A0B H;  1ZR2 A;  1FBM A;  1SFC C;  2CK3 H;  3HD7 D;  1YJ9 P;  3RK2 D;  3AE8 C;  2C9N Y;  1SQP K;  4GOD A;  1HVV A;  4ZKU A;  1N73 B;  1Q7Y Q;  1RF1 C;  1N7L A;  3AED C;  2O1J A;  1RE4 A;  1QEX A;  2P58 A;  1FZE A;  1GW3 A;  1L4A B;  2WPQ A;  1NO4 A;  1SFC D;  1JY3 N;  1NTZ G;  1L0N E;  1NU1 J;  2I1K A;  2QA4 P;  3LW5 H;  1SQQ E;  2KYV A;  3HTK A;  3HUS A;  2H43 A;  2J5U A;  5KKZ B;  5CCH A;  2WVR A;  3LW5 J;  1BE3 J;  2OYI A;  2YO2 A;  5CHX A;  1LTT C;  2QEX P;  1FZF A;  4DZO A;  3L71 J;  1VQL P;  3MP7 B;  4GIF A;  3H1I J;  2OGU A;  4W80 A;  1SQV D;  1FDO A;  1H88 A;  2UWJ E;  1HTL C;  1RY3 A;  1M1K Q;  4PV1 C;  2D2C B;  3FXE A;  2AXT E;  2O01 H;  2XKM A;  4KHX A;  3EQ2 A;  4Y28 J;  1NKN A;  2ZXE B;  3H1K D;  2P1J A;  5AVW B;  3M0A A;  2O01 J;  1VQK P;  2KZI A;  3A2A A;  3IAO A;  1PPJ G;  2C0X A;  1PV3 A;  2G3A A;  1SVF A;  3HD7 B;  3L71 G;  3RK2 B;  1FC2 C;  1N7S A;  2L91 A;  3G9R A;  5E79 E;  1D7M A;  1PGP A;  4PD4 I;  1NTM D;  3H1L J;  1EDI A;  1EDL A;  4TLF A;  3SWF A;  1NYH A;  3CME P;  1GD2 E;  1SQV E;  4GOF A;  1KIL A;  5AVY B;  1FS0 E;  1PL5 A;  3OW2 O;  1SFC B;  1KB9 H;  1NGM B;  2WTY A;  4L76 A;  2P7J A;  3PRJ A;  1G1J A;  3H1K E;  1X79 B;  1KFN A;  3CCE P;  3L75 D;  2OAR A;  3MZW B;  1RF1 B;  2HOD A;  3H32 B;  4ZMD A;  5CCG C;  1ZR4 A;  1A02 J;  5GTH E;  1PGO A;  4U3F J;  3B71 A;  1OVR A;  3H1L G;  1YTZ T;  3R4Y A;  1SQV K;  4D6T D;  2QRX A;  4W7Y A;  5B66 H;  3HE4 B;  3Q5S A;  1NVO A;  3QWO C;  2OTK E;  2Y9Z A;  3CC4 P;  2JEE A;  2KLV A;  1GDT A;  4EI2 A;  2M5A B;  3Q1M A;  1LTJ A;  3CCM P;  4TT3 H;  2J59 M;  1K8A Q;  1QL1 A;  1IZN B;  1SQB D;  1ZXG A;  3CCS P;  3U59 A;  5AW6 B;  1KYO E;  2ITA A;  3O6Q B;  4U3F G;  2AEJ A;  3L73 E;  3V2Q A;  2E74 C;  2IX7 C;  5KAI H;  1HWT C;  3JCU H;  4PV1 B;  2HPC A;  1OZH A;  4YXD C;  1URQ C;  1P84 I;  4HH2 A;  1H0T A;  3O8Z A;  1LT9 A;  4D6T E;  1KZU B;  3CX5 H;  1G2C A;  2PP6 A;  2P10 A;  1KQG B;  3L37 A;  3T97 B;  4Y99 C;  1USE A;  2IZ0 A;  2FYU D;  1W2B O;  2XDJ A;  1ZV8 A;  2Z5H A;  1HH0 A;  3C8V A;  4DOJ A;  2E74 D;  1GL2 D;  1EZV G;  2A06 D;  3M0D C;  3FGA D;  1URQ D;  1JMB A;  3RL0 C;  3L72 D;  1RE3 A;  2KS1 A;  1JY3 P;  1YJW P;  1SQB E;  3TDK A;  3KHU A;  1IFJ A;  2QJP C;  2WPS A;  1LP1 A;  1OXZ A;  1Q86 Q;  3BVH A;  3A7O A;  2Q1K A;  4GOE A;  1YTZ I;  2Q7C A;  1J1E C;  1S9K D;  1SQX D;  1EZV I;  3RL0 D;  1NWQ A;  4WY4 C;  2FXM A;  3TGU J;  4AUW A;  3PH0 A;  4PJ0 H;  2W83 C;  5APX A;  2KLU A;  2IYO A;  1SQB K;  2A06 E;  1FJP A;  3U1C A;  3L72 E;  3S9O A;  4H13 D;  2C9L Y;  1EC5 A;  2JDI H;  2N1T A;  3V2R A;  1HGV A;  1PFI A;  4PD4 D;  3CWB G;  1NU1 D;  2YMY A;  1NOH A;  2I8D A;  5APS A;  1NTK D;  4GT1 A;  3TSI A;  2RMZ A;  1MFT A;  3CXH D;  1BGY J;  3P32 A;  3EFF K;  3VYI A;  1K05 A;  3TGU G;  1PP9 J;  2GUS A;  2PAJ A;  4RKU J;  1SQX E;  3GHG C;  1BE3 D;  3A5T A;  3NTN A;  1JY3 O;  2KNC B;  5TJH A;  2E74 B;  2KOG A;  3H1I D;  3JSV C;  1R8E A;  2JWA A;  1URQ B;  4WB4 A;  4H44 C;  1J1D B;  1L0L J;  3H1H J;  3CCL P;  2R32 A;  2B89 A;  1RH5 B;  2B87 A;  1T6A A;  2Y9Y A;  1AFO A;  3B8E B;  4PD4 E;  3E7K A;  2YXR B;  4Y99 B;  3TYY A;  1NU1 E;  1BCC J;  2XU6 A;  5TIS E;  3AEB C;  3H1J D;  1HJB A;  1BGY G;  4EDF A;  1SQX K;  1N2D C;  1PP9 G;  1JMM A;  2R44 A;  3CXH E;  3KZI H;  3I56 P;  1OMI A;  3RL0 B;  4W7Z A;  1BE3 E;  1X22 A;  3AEE C;  3B5N A;  4IL6 X;  2QJP B;  3PTZ A;  1IFN A;  4Z1M H;  3H1I E;  1CW5 A;  1IJD B;  4R4M A;  1FDI A;  4WVZ A;  2JR8 A;  3WU2 H;  1J1E B;  1NU1 K;  1SQP D;  1USD A;  2FFD C;  2K9J A;  3N7N A;  1BCC G;  2IBZ D;  2IDB A;  1P84 D;  4WY4 B;  2Q6Q A;  4RJT A;  2E5Y A;  3Q3D A;  1K73 Q;  2M0B A;  3OA7 A;  3H1J E;  2K9Y A;  1FZG A;  3FWL A;  1Q90 D;  5CCH D;  4U7J A;  3P8M C;  3G6E P;  3RGU A;  1Q81 Q;  2FXP A;  2WZ7 A;  3V5B A;  2R3S A;  5AVS B;  1AVY A;  4HB1 A;  2O01 N;  3S1K A;  5BU5 A;  4IL6 E;  3KXD A;  3WMM 0;  1YHQ P;  1LNQ A;  1FOS E;  1YBK A;  3P7K A;  1SQP E;  4BXL A;  3EFG A;  3GF7 A;  1P84 E;  4XE5 B;  3AE3 C;  3A3Y B;  5KLV J;  2A45 H;  1KTM A;  1S1C X;  4OH8 B;  3L4F A;  4WWI A;  2BCC J;  1NTZ J;  2M3E A;  2YKP A;  2XV5 A;  4C7N B;  1QVF O;  2LXB A;  2YMK A;  5AVR B;  2WT7 B;  1OW6 A;  1N7S D;  3VMX A;  2B9B A;  1WT6 A;  4OWF A;  1ZLL A;  1SP4 A;  1FZC A;  1VQ7 P;  3AE7 C;  5AW5 B;  4UB6 H;  1Q2N A;  4R4L A;  2K3R A;  2ZVO B;  2PFX A;  3BCC J;  2WSF H;  1OVU A;  1RF0 A;  5M1B A;  5B66 E;  5KLV G;  2KUB A;  2WSF J;  1HUC A;  3HE5 B;  2BCC G;  3W68 A;  3V4Q A;  1EZV E;  4UB8 E;  1JEK A;  1NKZ B;  2A45 G;  2N9Y B;  4I7Z C;  2BEQ D;  1N73 A;  2B88 A;  2W6J H;  2FFD B;  2O3J A;  4LGD E;  3BCC G;  2LR2 A;  1AQ5 A;  1L4A A;  2V4H A;  2NPS C;  2E76 C;  1LTI C;  3BRT B;  5C39 A;  1GU4 A;  1MKM A;  3ITK A;  1M56 D;  1MV8 A;  1DD4 A;  3IF4 A;  2RH0 A;  4C7R A;  4KT0 J;  2A45 I;  3L70 J;  1S5L H;  3LID A;  3WUT A;  4EIJ A;  1GTW A;  1BSH A;  5K5G B;  1XTG B;  1CI6 B;  2NPS D;  2E76 D;  3L36 A;  5KJ7 C;  3D6Y A;  2FXO A;  2IFN A;  2QM8 A;  3AE1 C;  1RQU A;  2RKL A;  2KSE A;  1U7M A;  4XA4 A;  5AW8 B;  3V4W A;  2M8R A;  2DW3 A;  4K35 A;  3MUD C;  1LWU A;  5AVQ B;  3TF5 A;  2C0W A;  3L70 G;  2Z4E A;  3VMA A;  3TGU E;  2KB7 P;  4JYC A;  5KJ7 D;  3VOP A;  3D71 A;  4IFD K;  2OYH C;  1ZRT D;  2FYN C;  4DJG A;  3CC7 P;  3L74 J;  1L0L D;  3H1H D;  3HD7 A;  3M06 A;  2YIU C;  2Y0E A;  1VQM P;  1PGQ A;  1FU1 A;  1S4X A;  1LTB C;  1KYO D;  3L73 D;  5H2F H;  5EFW B;  1VQP P;  3G3Z A;  5BVZ A;  1XTC C;  1SFC A;  1GZL A;  1M8O B;  2ZJS E;  3FX0 A;  3GMA A;  4I7Z B;  1GU5 A;  5B5E E;  2OTL P;  3RBZ A;  3L74 G;  4CPG A;  1RF1 A;  2WSC H;  3H32 A;  1JY2 N;  1ZRT E;  2AEF A;  1JTH A;  2KSJ A;  1L0L E;  3H1H E;  2N1T D;  4N78 D;  2NPS B;  2E76 B;  2P67 A;  2WSC J;  1OFC X;  3FXD A;  2HPC B;  1ZME C;  1WMK A;  2AEM A;  3HE4 A;  1GL2 C;  1HGZ A;  1L0N J;  1J1D C;  4BRY B;  2XND H;  5KLI C;  1T2K C;  1SQQ J;  2Z5I A;  1SS1 A;  1KB9 I;  4EYY Q;  1EDK A;  1L0L K;  1M57 D;  1RQV A;  3VN0 A;  1KQF B;  5AW7 B;  3O6Q A;  2JJL A;  5AW9 B;  1UIX A;  1M1J A;  1OWA A;  1YIT P;  2E75 D;  4N78 E;  3BAT A;  2AXT H;  2LXC B;  1AQT A;  1GMJ A;  1T2K D;  3EWK A;  2WSE H;  2Q3I A;  1BDD A;  3C9I A;  1L0N G;  2XZR A;  2QSI A;  3A0H H;  3T97 A;  1IO4 A;  3AE9 C;  3CWB J;  2OYH B;  1NTZ D;  2FYN B;  2WSE J;  1SQQ G;  4NPE A;  4H13 C;  2YIU B;  3MHV A;  3AE2 C;  5KAF E;  2N9B A;  1VQ5 P;  5E79 H;  3KYQ A;  5AVZ B;  3NFQ A;  3CD6 P;  5L8R J;  2P2U A;  3P8C E;  2Q5U A;  3JC2 2;  1KN7 A;  2YO3 A;  3GG2 A;  1SQV J;  3CLQ A;  2Y0D A;  1NTZ E;  5CCG A;  2XNX A;  3CX5 I;  2K88 A;  2KI7 B;  3AE5 C;  3H1K J;  1IFI A;  5BU8 B;  3M91 A;  5GTH H;  3RL0 g;  1CSB A;  1PPJ D;  5APQ A;  3M9B A;  4N6J A;  3A0B E;  1KQL A;  2Q3E A;  1ZW0 A;  1NAY A;  3L71 D;  1QLE D;  3OAK A;  4NPD A;  1GL2 B;  5APU A;  1G1I A;  2CPS A;  4L74 A;  3BAS A;  1SQV G;  1NTM J;  1FZC C;  5KLI B;  1OW7 A;  2QM7 A;  3W67 A;  1NTZ K;  3H1K G;  1T8Z A;  3U1A A;  3WUV A;  4XFJ A;  4M3L A;  1RE4 C;  3MD0 A;  3I55 P;  3SFE C;  1S2E A;  1URQ A;  3L75 J;  2VRS A;  4RES B;  2Y0C A;  2FKW B;  2R5B A;  1PPJ E;  1VDF A;  1OW8 A;  3L35 A;  3L71 E;  4YXW H;  1DX7 A;  1AJY A;  1H89 A;  2YXQ B;  3BRV B;  3HUS C;  1AVO A;  4L75 A;  1NTM G;  3H1L D;  5CCH C;  2LKM A;  2QJY C;  2W90 A;  2OYI C;  1K9M Q;  1LT1 A;  4D6T J;  1JY2 P;  4H13 B;  2O1K A;  3M0D A;  3CC2 P;  2Q9I A;  4IFM A;  3V2P A;  3CPW O;  1E79 H;  3IFM A;  4IOI H;  1KB9 D;  3L75 G;  1JO5 A;  4BWN A;  3KDP B;  3PJS K;  1AV1 A;  4HKZ H;  4U3F D;  2FBW C;  2YNY A;  2WSS H;  4WY4 A;  1BSN A;  1KMI Z;  2HYN A;  4HYT B;  4D6T G;  3H1L E;  1DD3 A;  2PRR A;  3MTU E;  1JCC A;  1TU3 F;  4LC1 A;  5APW A;  1UII A;  2MJZ A;  1OX3 A;  1N7S C;  2PGD A;  4MN4 C;  1LWU C;  2JKV A;  2FYU J;  3TNU B;  5GTI H;  2E5T A;  3Q5P A;  3SWK A;  1EZV D;  3N4X A;  1IC2 A;  1QGK B;  1KIL C;  3II6 A;  1NHL A;  1KB9 E;  1SQB G;  3CCU P;  3PP5 A;  1NAF A;  3FWN A;  1KC8 Q;  1FZC B;  1L2P A;  4U3F E;  2R3C A;  3VMY A;  1JY2 O;  1K04 A;  3GHG A;  4O9B A;  2HG5 D;  3G4S P;  2J58 A;  1KV4 A;  1H8A A;  3AE6 C;  1VPC A;  2GA1 A;  3SWY A;  1W2E A;  3AEF C;  1KIL D;  2WPR A;  1AA0 A;  3I5C A;  1LTS C;  2IFM A;  2FYU G;  3CCJ P;  1SQX J;  1ZN5 A;  2R5D A;  3C1L A;  4C7N A;  1FDM A;  3CX5 D;  1IFD A;  2WT7 A;  2A06 G;  1T3J A;  3M9Q A;  2KP8 A;  5AW2 B;  1JUN A;  2JWD A;  5CJ4 A;  4KJM A;  1GK6 A;  3HTK B;  3HUS B;  3RK3 C;  3L72 G;  4PD4 H;  3SSU A;  2QJY B;  4JBZ A;  5AVT B;  4H0L C;  3B4S A;  2OYI B;  5TIS H;  3IR9 A;  5DJU B;  3CWB D;  1LTJ C;  2ZXX A;  4AYC A;  1FZA A;  2K37 A;  4ZNC A;  3CXH H;  3S4R A;  5KAI E;  3JCU E;  2HLO A;  1NTK J;  1YI2 P;  3HE5 A;  1SQX G;  2POH A;  1Y47 A;  2GUV A;  3RK3 D;  1KIL E;  3TGU D;  3PLN A;  1YJN P;  2QJK C;  2JP3 A;  4C46 A;  3TK1 A;  4H0L D;  3CX5 E;  1KD1 Q;  1LT9 C;  5AW4 B;  1FAV A;  1CZQ A;  5CMZ A;  2FFD A;  4N3Y B;  3V6I A;  4NPF X;  1VQN P;  5APV A;  1JM0 A;  1QL2 A;  1WRG A;  1FZB A;  3AE4 C;  5CBO A;  1YYC A;  1L0N K;  1QX8 A;  1M1J C;  1NU1 G;  2QE7 H;  1N7S B;  3CL3 D;  3CWB E;  1LWU B;  1SQQ K;  1RE3 C;  1NTK G;  3K5B A;  3VP9 A;  2YKQ A;  1BGY D;  3H1J J;  3A0H E;  4JPZ B;  1ZOY C;  2KXP B;  1PP9 D;  1KIL B;  1BE3 G;  1T3U A;  1EDJ A;  2RN0 A;  3RK3 E;  1CI6 A;  3VP8 A;  4IL6 H;  4PV1 D;  3H1I G;  2BAS A;  3GLM A;  3H6P A;  4PJ0 E;  2W27 A;  1IFM A;  1YIJ P;  3GF3 A;  3H25 A;  1JCD A;  1YQ3 C;  3USS A;  2HOD B;  3ZDM A;  1MZ9 A;  1N86 A; 
#chains in the Genus database with same CATH homology
 2QSI A;  1KMI Z;  4KT0 J;  1OMI A;  3IAO A;  3Q1M A;  1PV3 A;  1KTM A;  1DD3 A;  2G8Y A;  2G3A A;  2H89 C;  1S1C X;  3AE8 C;  3AE9 C;  3GMA A;  1OW7 A;  4I7Z B;  1TU3 F;  4TT3 H;  5KKZ C;  2WSE J;  2NZ2 A;  3AEE C;  4IL6 X;  2V7Q J;  4H13 C;  3IN6 A;  3G9R A;  4Z1M H;  2YMK A;  3AE2 C;  2E74 C;  2E75 B;  4XFJ A;  1OW6 A;  3AED C;  3S9O A;  4PV1 B;  1PIX A;  4H13 D;  1KIL E;  1ZRT E;  2E76 D;  4YTP C;  1ZP0 C;  4R4M A;  2ZT9 C;  3Q5P A;  4YXD C;  2QJK C;  3SFE C;  1KOR A;  2JP3 A;  1VF5 C;  3AEA C;  3D6Y A;  4H0L D;  1NYH A;  3AE1 C;  1FDI A;  5L8R J;  3AE7 C;  2E76 B;  1RQU A;  2WSC J;  1S5L X;  1Y9B A;  4R4L A;  4H0L B;  2IDB A;  1PL5 A;  2D2C C;  1OW8 A;  2WPV B;  1ZME C;  3AEC C;  1WMK A;  2P10 A;  1KQG B;  3T97 B;  1NGM B;  5M1B A;  3Q3D A;  1AJY A;  2QIW A;  1K05 A;  3AE4 C;  2J5U A;  4RKU J;  1IK7 A;  2WSF J;  3C8V A;  2QJY C;  2K9Y A;  1K04 A;  2E74 D;  3AEG C;  1VL2 A;  1Q90 D;  3LW5 J;  1DIP A;  4OGQ C;  4U7J A;  2OQQ A;  4H13 B;  1EXI A;  3FGA D;  2ZT9 D;  3ABV C;  2FXP A;  1VF5 D;  3D6Z A;  2E74 B;  3AE6 C;  5KLI C;  1JB0 J;  3D71 A;  3AEF C;  4I7Z C;  2BEQ D;  1R8E A;  2ZT9 B;  2FYN C;  4H44 C;  3AE5 C;  1VF5 B;  1HF9 A;  2JO1 A;  1HJ0 A;  1ZOY C;  2QJP C;  2D2C D;  3B71 A;  1RQV A;  1FDO A;  1KQF B;  4H44 D;  2YIU C;  3R4Y A;  3RL0 g;  1U57 A;  2H88 C;  3O6Q A;  3RK3 E;  2E75 C;  2MKV A;  4PV1 C;  2D2C B;  1UIX A;  4H44 B;  3SFD C;  3Q5R A;  2WQY C;  3Q5S A;  2E75 D;  4PV1 D;  2BEZ F;  1EXJ A;  4OGQ D;  2E76 C;  4Y28 J;  3AEB C;  3D70 A;  1YQ4 C;  2FBW C;  3GLM A;  4GDO A;  3GF7 A;  1GMJ A;  1MKM A;  2O01 J;  4H0L C;  1DD4 A;  3EWK A;  3AE3 C;  4OGQ B;  3GF3 A;  1YQ3 C;  3H25 A;  3Q2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...