2FXPA

Solution structure of the sars-coronavirus hr2 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
55
structure length
55
Chain Sequence
GSHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the severe acute respiratory syndrome-coronavirus heptad repeat 2 domain in the prefusion state
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords Spike glycoprotein
total genus 14
structure length 55
sequence length 55
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.790 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2fxpA01
2BEZF 2BEQD 2FXPA
chains in the Genus database with same CATH superfamily
2XNDH 3L71G 5BU8B 2JR8A 3A7OA 2ITAA 3SWKA 5APUA 1YITP 3H1JG 2O3JA 1QL1A 5GTIE 1PFIA 3CX5I 4KJMA 1KQSO 5M1BA 3RL0B 1EDJA 1URQD 3M9HA 2R5BA 3BCCD 5CCGA 1SQQE 4N6JA 2IYPA 3HE4B 3TGUG 4EYYQ 1M1JC 1Z56A 4U3FD 1OWAA 3KHUA 3PHLA 3SSUA 1GW3A 2M5AA 3CCVP 2DW3A 1OVVA 1G1JA 2AEJA 3H1JJ 2ZT9D 1MFZA 1ZRTE 3A0BH 3Q5RA 2H8PD 1HVVA 2N1TC 3RK3E 5KAFE 1N8RQ 1JUNA 1NKNA 3GF7A 4EOTA 2YMKA 2KNCA 2RKLA 1QX8A 3AEAC 3L36A 3M9BA 2FXMA 4WY4C 3V2RA 5KKZB 3AE6C 3H32B 3HD7D 1CZQA 2HYNA 1JB0J 3B5NA 3MP7B 4ZKPA 1N73B 3WU2H 1QEXA 4Y99C 1NTKJ 3II6A 2YO2A 1IFNA 1HF9A 1VQKP 1JTHB 3C9IA 1SQPE 3B4SA 2HLOA 1PGQA 2JWDA 2FYZA 1YBKA 2BASA 2ZYDA 3KQGA 2E5YA 1SQQG 1BE3E 2N1TB 2Q6QA 3U1CA 1YJ9P 3AE9C 1R8EA 1JTHA 2UWJE 1N73A 1NTZE 1PP9J 1FZCC 1CI6A 4OH8B 1YIJP 1LTBC 1N86A 1HTLC 5KLIB 4OGQD 1K73Q 4NPDA 1OIPA 2KUBA 3EFGA 2GUSA 2BCCJ 4WBAA 3AE4C 4OWFA 2A06G 5CBNA 1ZR2A 3NMDA 1FZEA 3TDKA 4HYTB 4PV1C 1SQBE 1W2BO 2M5AB 1NHLA 4IOIH 4RESB 5C39A 3LIDA 5KLVE 2A06E 1CI6B 3HUSB 4PV1B 3VMZA 3EWKA 4N3YB 1OZHA 3H1ID 1DH3A 2N9YB 3IR9A 4I1LA 3OAKA 4WB4A 1S2EA 5AVUB 2YKOA 1IO4A 1ZMEC 1MZ9A 1SQVE 3HE4A 3KXDA 2E76D 4W80A 2QVAA 3D71A 3CCLP 4AQRD 3V2PA 2K3RA 3GG2A 2WSFJ 1YHQP 1GU4A 4OVNF 2KLUA 2WWWA 2HFED 2ZAEB 3CCMP 4I2LC 2FFDA 5KAFH 2FYUJ 1NAYA 2E75B 3HTKB 4JBZA 1KILD 4I7ZC 5APQA 1BDCA 1UIXA 1YYCA 2WQYC 1GDTA 1KILC 4IL6E 1JCCA 1GW4A 1JY2N 1LT9C 1NTZJ 1PP9E 1RQUA 1S1CX 1VF5B 3GW6A 3MUDC 4H13C 1GL2D 1N7SC 3HE5A 4WWIA 1KQLA 2OYOA 2A45H 1BCCJ 2QRXA 2V4HA 2H89C 1MFTA 1OW8A 3CXHE 3L75E 2XU6A 1L0NJ 4WY4B 3T97B 1PGJA 2KLVA 2W6AA 3MD0A 1K8AQ 2E74D 1NU1J 1SQVG 1YTZT 1JMBA 1URQB 3L71E 1GL2A 1JOCA 3CX5H 1GK6A 1OFCX 5KJ7D 5AW7B 3AE7C 1W5CE 4UB8E 2PP6A 1AFOA 2FYUK 2P1JA 3CX5D 4DCKA 4PD4E 3RL0C 2D2CB 1KB9I 3TGUD 2VRSA 1BE3D 1L0NG 2LXBA 1LTJC 2HPCA 3L73E 3A0HE 1KB9D 4NPEA 1DD4A 4GODA 1EZVG 2KS1B 2QJKC 2IZ1A 1M56D 3EQ2A 3QWOC 3NTNA 2C0WA 3S9OA 1SQXJ 3L74G 4H0LD 3W67A 1R5LA 1L0NK 1S3JA 1OMIA 1Y8AA 3H1HE 1KTMA 2G3AA 3VMAA 5B5EH 1EXJA 2GM4A 2WSCH 2FYUG 4L76A 1L0LD 3KZIE 1KN7A 1AVOA 2IDBA 2FY8A 4IFDK 3AE2C 2I1KA 4TT3H 1ZRTD 5KLVJ 3H6PA 2KB7P 3KZIH 4H44D 1JY3N 2N1TD 4R4LA 3WUVA 4BRYB 3OA7A 2OYHC 1NO4A 1KZUB 3H1KJ 1K05A 4H13D 3G4SP 1VQ7P 1OX3A 2D2CD 2E76C 5EFWB 2LKMA 3G3ZA 3PRJA 1S5LE 2FBWC 2O1KA 2WSSH 1VQNP 3BRVB 4HH2A 2W6BA 3IAOA 4Y28J 1Q2NA 1J1EB 3IF4A 2O01N 2QJYC 1RQVA 2IX7C 3L74E 4M3LA 1DIPA 2ZFCA 3A2AA 3PTZA 4GDOA 1S4XA 4PV1D 2B89A 1K04A 3W68A 3L70G 2QM8A 2R5DA 2FYUE 1NTMK 2K37A 3HE5B 2P67A 3V2QA 2V7QH 5AVXB 1Q90D 2PFXA 4UB8H 2Q7CA 2JEEA 2JJLA 3G9RA 2NPSB 3E1IA 1LT1A 1ZN5A 4H44B 3UIAA 2RMZA 3FXEA 5AW2B 1R5SA 1RF1A 1QVGO 2K9JB 1AA0A 3B5ND 4D6TJ 4ZNCA 1URQC 2L91A 2M3BA 1DD3A 4EIJA 1KYOD 2ZT9B 1FZAA 1N7SA 2KP8A 5AVRB 2NZ2A 1BCCE 3L75J 1PPJD 4JYCA 1WT6A 3CMAP 1NOHA 2OYHB 3FGAD 1SQBJ 1YTZI 2BCCE 5AVTB 5AW5B 1M8OB 5B5EE 4N78E 1XTCC 4IFMA 2WSEH 1M1JB 1MV8A 2H88C 3HUSC 1EC5A 4ZKUA 1GL2C 1PV3A 1AV1A 2YMYA 1SP4A 2SPZA 4GOEA 1J1DB 3BCCG 1AQTA 4JF7A 3IN6A 2B9BA 3V4QA 5KJ7A 2H7HA 2W8ZA 3AEGC 3E1RA 1OW6A 3TK1A 3CCRP 1FZGA 3CXHD 1LTIC 1HGZA 3CCJP 1NTMG 3MTUE 3FXDA 1NU1G 1SQVJ 2RN0A 1LTSC 2KS1A 2ZXXA 3GHGA 4PD4D 1OW7A 1RE3C 2R3SA 3K5BA 1NGMB 1YQ4C 3QH9A 4L74A 5AVVB 2Y0EA 1G1IA 2IFMA 2YXRB 3L73D 3CMEP 1SQBK 2AXCA 1IFJA 3M91A 3TGUE 2OTLP 2KK7A 2KOGA 3FX0A 3L73G 1KYOI 4K35A 4CPGA 3M0DC 3SFEC 4LLHA 1FAVA 1WMKA 3BRTB 2AXTH 1U7MA 2CPSA 3I56P 3RK2D 2O01H 4D6TG 5CCGC 1X22A 1JNMA 3JSVC 3BASA 1NKZB 1U57A 1SQXK 3H1KE 1DEBA 1P84H 1L4AC 3C1LA 3GLMA 5KLVG 1KC8Q 1SQQJ 1FJPA 2KZIA 1H8AA 1RF1B 2Y9ZA 3L71J 1JY3O 1LJ2A 5CCHA 1L4AB 1SQBG 1Q86Q 1LTTC 3VN0A 1T6AA 4UB6E 3EFFK 1IFPA 2WSEJ 1PIXA 3CPWO 1NTMJ 1GZLA 2NPSC 1KILB 3B71A 3RK3B 1SQPD 2Y0CA 3A0BE 1N2DC 3IFMA 1NU1K 1VQPP 1VF5C 3D6ZA 2IBZD 1S72P 1FBMA 1N7SB 2YXQB 3H1JD 1Y47A 3FWNA 1QLED 1IFIA 1GU5A 1K9MQ 1VF5D 3D6YA 4C7RA 3LW5J 4BXLA 1M57D 3C8VA 1N7LA 1PL5A 2FFDC 3H1IG 3H1HJ 1JM0A 4O9BA 3SWFA 5CJ4A 2QJYB 5AVQB 1RE4A 3P8MC 4L73A 1A02F 2E75C 1G2CB 2QSIA 1KILA 3N4XA 2KSEA 2YKPA 1LT9A 3AECC 1NTKD 2BCCG 3D70A 3KDPB 1FZBA 1SFCD 1USDA 2BEZF 5CHXA 1NWQA 1IK7A 1T8ZA 1VQ8P 2JWAA 2QM7A 1SQPK 1VQ6P 4U3FE 5KAIE 3ABVC 3CC2P 1FU1A 1W2EA 1HH0A 3RK3D 3V2NA 2PAJA 3VTPC 3KPEA 3KYQA 5H2FE 1SFCA 5B66H 3V5BA 3Q1MA 1NU1E 2M3EA 2BCCD 1PGOA 1SQVK 2N1TA 2P2UA 2W6JH 3H1LD 1GMJA 2BEQD 3L70J 2V7QJ 5H2FH 1M1KQ 2FXPA 5AVYB 1NH4A 2IFNA 3M0AA 4IFFA 3S1KA 2R3CA 4KHXA 4PJ0H 1YI2P 2JDIH 2YO3A 3GHGC 3L72D 1SVFA 4Y99B 1M7LA 5AW4B 3TYYA 1HUCA 5AVSB 1DX7A 1ZV8A 4C7NB 1EZVD 3RBZA 2AEFA 1EQ7A 4D6TE 2P58A 3CL3D 4QMAA 1LP1B 3HRNA 3AE1C 3MUDA 1N7SD 1FC2C 2WMMA 3NFQA 4W7ZA 5AVWB 4DOJA 3M0DA 5CBOA 2GA1A 4KT0J 3WU2E 1PZQA 3Q3DA 1N73C 2MJZA 2YKQA 3A5TA 3CWBD 1CW5A 1YJNP 2W90A 1OVUA 1KB9H 1SQPG 3F89A 5KKZC 1KQFB 3H1JE 1IC2A 3A3YB 1IK9A 1L0NE 2OARA 3WMM0 2WT7A 2YIUB 2OYIB 1BDDA 1KB9E 3M06A 2E76B 1HBWA 1Y9BA 2L5GB 1KORA 4GT1A 3CCQP 5TJHA 5KTBA 1E5WA 1L0LE 2Q3IA 4H13B 3HD7C 1BGYD 3R2PA 1T3UA 1RF0A 3AE8C 3CX5E 1DEEG 3SFDC 2NPSA 5APXA 2OTKE 1P84D 3B8EB 2E75D 2K1AA 3GMAA 2A45I 1NTZG 1NTKE 4PD4H 1FJKA 3L74J 2FXOA 2M0BA 2Y9YA 4TLFA 3V6IA 3VP8A 1HJBA 2ZYGA 1EZVI 1JEKA 1ZXGA 3M9QA 3O6QB 4JQ0D 5TISE 3WUTA 5KLVK 2IZ0A 3TGUJ 4IL6X 1BE3J 3L37A 1X0TA 2W27A 5DJTB 4ASWA 5CCGD 1SQQK 1VPCA 3BCCJ 1OXZA 2QIWA 3RK2B 2ZVNB 2WPRA 2JP3A 4U3FJ 5L8RJ 1FZCA 2K9YA 2IBZE 2KIKA 2RH0A 2Y0DA 4PJ0E 1PGPA 2XNXA 4XE5B 2QA4P 4LGDE 3Q5PA 1AJYA 4YPCA 1KFMA 3BATA 1SQXG 1WRGA 1NVOA 4AYCA 2WPSA 3H1IE 3L4FA 4DJGA 4AUWA 2LR2A 2OYIA 5BU5A 1Q82Q 1SFCB 2AEMA 2ZT9C 1BSHA 1MKMA 2QE7H 1IJDB 3U59A 4DZOA 3G71P 5KLVD 1LWUC 2KZJA 3L70E 1Q7YQ 5AW1B 3I55P 3P8CD 1GTWA 2ZXEB 3RL0g 1USEA 3H1KD 3MIWA 1JY2P 2I8DA 5CJ0A 1S5LH 2C9LY 3N7NA 1T2KD 2H43A 1VQ9P 3AEDC 1JY3P 2MKVA 1E79H 1GK4A 1LTJA 1LT9B 2HG5D 3MHVA 2A06D 1RHZB 1RY3A 4GKGA 3VYIA 3VOPA 5KLIC 5CCHD 2E42A 2WITA 1PP9D 4WVZA 3H25A 2FFDB 1EDKA 3CXHH 1VQ5P 2OQQA 3I5CA 4XA4A 3HTKA 1VQMP 1A02J 3RL0D 1YQ3C 2WVRA 2QG4A 3PLNA 2Q1KA 1VQOP 2POHA 1QGKB 1FDOA 3BVHA 2KI7B 1URQA 3GHGB 1FS0E 3CC7P 1JO5A 1J2JB 1SS1A 3LW5H 3T97A 1JMMA 1CSBA 3B5NB 1H88A 1NTZK 3CC4P 1KYOE 1KV4A 1S5LX 3H1IJ 2KNCB 2N9BA 3ITKA 1U7JA 4RJTA 1L4AA 4D6TD 3V4WA 1EZVE 3TF5A 1NJIQ 1NTME 5CMZA 1NTKG 1ZOYC 4YXWH 1AQ5A 5AVZB 1P84I 4BWNA 2XKMA 5K5GB 3H1HG 2P10A 2R32A 3JCUE 3FWLA 1VQLP 1HJ0A 2FYUD 2P7JA 3Q5SA 1RF0C 2E74B 3MGNA 3RBXA 2NRGA 3B5NC 4L75A 2WTYA 3JCUH 3USSA 3SWYA 1HGVA 1KMIZ 1RE3A 1NTZD 2FKWB 1KD1Q 2B88A 1BGYE 1KFNA 1M90Q 2E5TA 2IBZG 3F5HA 1FDIA 1L0LG 2HODA 1BCCD 2O1JA 4OGQB 1ZLLA 2C9NY 2O01J 1BGYG 3H32A 2K88A 4PD4I 1L0ND 2WZ7A 5APSA 2FYNB 2LXCB 4C46A 2XDJA 1RE4C 4NPFX 1RF1C 1LTAC 1EXIA 1NU1D 2D2CC 2A45G 3U1AA 1FOSF 2ZJSE 1LTJB 3L72E 4H0LC 2M8RA 5APTA 4JPZB 2WPVB 2YIUC 3CWBG 5BVZA 2OYIC 4U3FG 2PRRA 4RKUJ 3R4YA 1FZFA 4IL6H 4K3AA 3RGUA 1YJWP 1XTGB 1TU3F 2G8YA 5DJUB 2XZRA 5APWA 3A0HH 1NTKK 3CCEP 1ZP0C 1KYOH 2CPBA 1SQXD 2J59M 4JYBA 2JKVA 4RO0A 1SQQD 4A7PA 1PPJG 1GD2E 4UB6H 4BRYA 5AW0B 3L71D 3P32A 1KQGB 2IYOA 4H0LB 2C0XA 2WPQA 2JO1A 4I7ZB 1L0LJ 4W7YA 3H1LE 1EDIA 1QL2A 1VDFA 1BCCG 2ZYAA 1NTMD 2Q3EA 4H44C 1SQPJ 2K9JA 3O8ZA 1PP9G 3H1LG 2PGDA 3L72G 1FE6A 1Q81Q 3CXHI 2J5UA 3OW2O 2OTJP 3JC22 3L75G 2Z4EA 3NXSA 4U7JA 1H0TA 1IFDA 4I6MC 3Q2YA 3H1HD 1J1DC 4MN4C 1HWTC 2OYHA 1M1JA 3MZWB 4EI2A 3CCUP 3OJAB 1OVRA 2E74C 1NYHA 3CLQA 2R44A 2WT7B 3P7KA 2WSFH 4LC1A 3CCSP 1BSNA 1IFMA 1GL2B 1KILE 5CCHC 3AEBC 1VQ4P 1QVFO 4ZMDA 1RH5B 3RK2C 2Q9IA 3AE3C 3HD7A 3LIEA 4WY4A 4GIFA 1L0LK 3AEFC 1LNQA 1H89A 4GOFA 4HJGH 2W83C 2NPSD 2KXPB 1FZCB 3TNUB 1JY2O 2B87A 5GTIH 3H1LJ 3PH0A 3PJSK 4C7NA 3L70D 2Q5UA 1LP1A 3ZDMA 3H1KG 1P84E 2KYVA 3L75D 1NAFA 3PP5A 5AW9B 2B87B 5APYA 1MUUA 3RK3C 2I1JA 1ZW0A 4Z1MH 4R4MA 1JCDA 1UIIA 1LWUB 1AVYA 1SQBD 2QJPB 3AEEC 5E79E 4YXDC 5GTHE 4B86A 1D7MA 3L72J 3P8CE 3GF3A 3VMYA 3E7KA 3AE5C 1LGHB 5E79H 3VP9A 2Z5IA 5GTHH 3G6EP 1BE3G 5AW8B 1X79B 2WSCJ 4HKZH 4XFJA 2HPCB 2KSJA 3TSIA 1J1EC 1ZR4A 1PPJE 2CK3H 3CD6P 2OGUA 2E43A 1LTGC 3HUSA 2Z5HA 1SFCC 1SQVD 1VL2A 1LWUA 2ZVOB 3CWBJ 4WY4D 1FDMA 2QJPC 5AW6B 5AW3B 4DT0A 2XV5A 2QEXP 1S9KD 3L74D 3S4RA 1S9KE 3WUUA 3L35A 2J58A 4ASVA 4EDFA 2YNYA 5KJ7C 1T2KC 3L73J 4N78D 1L4AD 3CWBE 3O6QA 1H0TB 1IZNB 1G2CA 3TNUA 3VMXA 4YTPC 5APVA 1X9VA 2QJKB 1BGYJ 1SLQA 2HR3A 2IPPA 1L2PA 3BCCE 5B66E 1FOSE 4OGQC 1T3JA 2GUVA 1EDLA 4HB1A 1X8YA 2FYNC 2IBZI 5KAIH 3HD7B 1SQXE 3CI9A 5TISH 2AXTE 2HODB
chains in the Genus database with same CATH topology
1KMIZ 2E76C 2D2CD 1GMJA 2BEQD 2V7QJ 1FDIA 2FXPA 4OGQB 2FBWC 5M1BA 2O01J 3IAOA 4Y28J 1EXIA 2QJYC 1RQVA 1DIPA 4GDOA 2D2CC 4PV1D 1K04A 2ZT9D 4H0LC 1ZRTE 3Q5RA 3RK3E 2WPVB 2YIUC 3AE1C 1Q90D 3GF7A 2YMKA 3AEAC 4KT0J 3G9RA 3Q3DA 4H44B 3AE6C 4RKUJ 3R4YA 1JB0J 2G8YA 1TU3F 5KKZC 1ZP0C 1KQFB 1HF9A 1DD3A 2ZT9B 2E76B 1KQGB 1Y9BA 2NZ2A 1KORA 4H0LB 2JO1A 4I7ZB 1R8EA 4H13B 3AE9C 3FGAD 3AE8C 3SFDC 4H44C 2H88C 2E75D 3GMAA 4OGQD 1PV3A 3AE4C 2J5UA 4PV1C 3IN6A 4U7JA 3AEGC 1OW6A 4IL6X 3Q2YA 4PV1B 3EWKA 2QIWA 2JP3A 1OW7A 5L8RJ 1NGMB 2E74C 1NYHA 1YQ4C 2K9YA 1ZMEC 1AJYA 3Q5PA 2E76D 3D71A 1KILE 3AEBC 2WSFJ 3AE3C 3SFEC 3AEFC 2ZT9C 1WMKA 1MKMA 2E75B 4I7ZC 1UIXA 1U57A 2WQYC 3RL0g 3GLMA 1S1CX 1RQUA 1VF5B 4H13C 3AEDC 2MKVA 2H89C 1OW8A 4Z1MH 5KLIC 4R4MA 3H25A 2WSEJ 3AEEC 1PIXA 4YXDC 2OQQA 3T97B 3GF3A 3B71A 2E74D 3AE5C 1VF5C 3D6ZA 1YQ3C 3AE7C 3D6YA 2WSCJ 4XFJA 1VF5D 3Q1MA 3LW5J 1FDOA 3C8VA 2D2CB 1PL5A 1VL2A 1DD4A 1S5LX 2QJPC 2E75C 2QSIA 2QJKC 3D70A 3AECC 3S9OA 4H0LD 2BEZF 1OMIA 1KTMA 1IK7A 3O6QA 2G3AA 1ZOYC 1EXJA 4YTPC 3ABVC 2P10A 2IDBA 1HJ0A 3AE2C 3Q5SA 4TT3H 2E74B 4OGQC 2FYNC 4H44D 4R4LA 4H13D 1K05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BEZ F;  2BEQ D;  2FXP A; 
#chains in the Genus database with same CATH topology
 2XND H;  3L71 G;  5BU8 B;  2JR8 A;  3A7O A;  2ITA A;  3SWK A;  5APU A;  1YIT P;  3H1J G;  2O3J A;  1QL1 A;  5GTI E;  1PFI A;  3CX5 I;  4KJM A;  1KQS O;  5M1B A;  3RL0 B;  1EDJ A;  1URQ D;  3M9H A;  2R5B A;  3BCC D;  5CCG A;  1SQQ E;  4N6J A;  2IYP A;  3HE4 B;  3TGU G;  4EYY Q;  1M1J C;  1Z56 A;  4U3F D;  1OWA A;  3KHU A;  3PHL A;  3SSU A;  1GW3 A;  2M5A A;  3CCV P;  2DW3 A;  1OVV A;  1G1J A;  2AEJ A;  3H1J J;  2ZT9 D;  1MFZ A;  1ZRT E;  3A0B H;  3Q5R A;  2H8P D;  1HVV A;  2N1T C;  3RK3 E;  5KAF E;  1N8R Q;  1JUN A;  1NKN A;  3GF7 A;  4EOT A;  2YMK A;  2KNC A;  2RKL A;  1QX8 A;  3AEA C;  3L36 A;  3M9B A;  2FXM A;  4WY4 C;  3V2R A;  5KKZ B;  3AE6 C;  3H32 B;  3HD7 D;  1CZQ A;  2HYN A;  1JB0 J;  3B5N A;  3MP7 B;  4ZKP A;  1N73 B;  3WU2 H;  1QEX A;  4Y99 C;  1NTK J;  3II6 A;  2YO2 A;  1IFN A;  1HF9 A;  1VQK P;  1JTH B;  3C9I A;  1SQP E;  3B4S A;  2HLO A;  1PGQ A;  2JWD A;  2FYZ A;  1YBK A;  2BAS A;  2ZYD A;  3KQG A;  2E5Y A;  1SQQ G;  1BE3 E;  2N1T B;  2Q6Q A;  3U1C A;  1YJ9 P;  3AE9 C;  1R8E A;  1JTH A;  2UWJ E;  1N73 A;  1NTZ E;  1PP9 J;  1FZC C;  1CI6 A;  4OH8 B;  1YIJ P;  1LTB C;  1N86 A;  1HTL C;  5KLI B;  4OGQ D;  1K73 Q;  4NPD A;  1OIP A;  2KUB A;  3EFG A;  2GUS A;  2BCC J;  4WBA A;  3AE4 C;  4OWF A;  2A06 G;  5CBN A;  1ZR2 A;  3NMD A;  1FZE A;  3TDK A;  4HYT B;  4PV1 C;  1SQB E;  1W2B O;  2M5A B;  1NHL A;  4IOI H;  4RES B;  5C39 A;  3LID A;  5KLV E;  2A06 E;  1CI6 B;  3HUS B;  4PV1 B;  3VMZ A;  3EWK A;  4N3Y B;  1OZH A;  3H1I D;  1DH3 A;  2N9Y B;  3IR9 A;  4I1L A;  3OAK A;  4WB4 A;  1S2E A;  5AVU B;  2YKO A;  1IO4 A;  1ZME C;  1MZ9 A;  1SQV E;  3HE4 A;  3KXD A;  2E76 D;  4W80 A;  2QVA A;  3D71 A;  3CCL P;  4AQR D;  3V2P A;  2K3R A;  3GG2 A;  2WSF J;  1YHQ P;  1GU4 A;  4OVN F;  2KLU A;  2WWW A;  2HFE D;  2ZAE B;  3CCM P;  4I2L C;  2FFD A;  5KAF H;  2FYU J;  1NAY A;  2E75 B;  3HTK B;  4JBZ A;  1KIL D;  4I7Z C;  5APQ A;  1BDC A;  1UIX A;  1YYC A;  2WQY C;  1GDT A;  1KIL C;  4IL6 E;  1JCC A;  1GW4 A;  1JY2 N;  1LT9 C;  1NTZ J;  1PP9 E;  1RQU A;  1S1C X;  1VF5 B;  3GW6 A;  3MUD C;  4H13 C;  1GL2 D;  1N7S C;  3HE5 A;  4WWI A;  1KQL A;  2OYO A;  2A45 H;  1BCC J;  2QRX A;  2V4H A;  2H89 C;  1MFT A;  1OW8 A;  3CXH E;  3L75 E;  2XU6 A;  1L0N J;  4WY4 B;  3T97 B;  1PGJ A;  2KLV A;  2W6A A;  3MD0 A;  1K8A Q;  2E74 D;  1NU1 J;  1SQV G;  1YTZ T;  1JMB A;  1URQ B;  3L71 E;  1GL2 A;  1JOC A;  3CX5 H;  1GK6 A;  1OFC X;  5KJ7 D;  5AW7 B;  3AE7 C;  1W5C E;  4UB8 E;  2PP6 A;  1AFO A;  2FYU K;  2P1J A;  3CX5 D;  4DCK A;  4PD4 E;  3RL0 C;  2D2C B;  1KB9 I;  3TGU D;  2VRS A;  1BE3 D;  1L0N G;  2LXB A;  1LTJ C;  2HPC A;  3L73 E;  3A0H E;  1KB9 D;  4NPE A;  1DD4 A;  4GOD A;  1EZV G;  2KS1 B;  2QJK C;  2IZ1 A;  1M56 D;  3EQ2 A;  3QWO C;  3NTN A;  2C0W A;  3S9O A;  1SQX J;  3L74 G;  4H0L D;  3W67 A;  1R5L A;  1L0N K;  1S3J A;  1OMI A;  1Y8A A;  3H1H E;  1KTM A;  2G3A A;  3VMA A;  5B5E H;  1EXJ A;  2GM4 A;  2WSC H;  2FYU G;  4L76 A;  1L0L D;  3KZI E;  1KN7 A;  1AVO A;  2IDB A;  2FY8 A;  4IFD K;  3AE2 C;  2I1K A;  4TT3 H;  1ZRT D;  5KLV J;  3H6P A;  2KB7 P;  3KZI H;  4H44 D;  1JY3 N;  2N1T D;  4R4L A;  3WUV A;  4BRY B;  3OA7 A;  2OYH C;  1NO4 A;  1KZU B;  3H1K J;  1K05 A;  4H13 D;  3G4S P;  1VQ7 P;  1OX3 A;  2D2C D;  2E76 C;  5EFW B;  2LKM A;  3G3Z A;  3PRJ A;  1S5L E;  2FBW C;  2O1K A;  2WSS H;  1VQN P;  3BRV B;  4HH2 A;  2W6B A;  3IAO A;  4Y28 J;  1Q2N A;  1J1E B;  3IF4 A;  2O01 N;  2QJY C;  1RQV A;  2IX7 C;  3L74 E;  4M3L A;  1DIP A;  2ZFC A;  3A2A A;  3PTZ A;  4GDO A;  1S4X A;  4PV1 D;  2B89 A;  1K04 A;  3W68 A;  3L70 G;  2QM8 A;  2R5D A;  2FYU E;  1NTM K;  2K37 A;  3HE5 B;  2P67 A;  3V2Q A;  2V7Q H;  5AVX B;  1Q90 D;  2PFX A;  4UB8 H;  2Q7C A;  2JEE A;  2JJL A;  3G9R A;  2NPS B;  3E1I A;  1LT1 A;  1ZN5 A;  4H44 B;  3UIA A;  2RMZ A;  3FXE A;  5AW2 B;  1R5S A;  1RF1 A;  1QVG O;  2K9J B;  1AA0 A;  3B5N D;  4D6T J;  4ZNC A;  1URQ C;  2L91 A;  2M3B A;  1DD3 A;  4EIJ A;  1KYO D;  2ZT9 B;  1FZA A;  1N7S A;  2KP8 A;  5AVR B;  2NZ2 A;  1BCC E;  3L75 J;  1PPJ D;  4JYC A;  1WT6 A;  3CMA P;  1NOH A;  2OYH B;  3FGA D;  1SQB J;  1YTZ I;  2BCC E;  5AVT B;  5AW5 B;  1M8O B;  5B5E E;  4N78 E;  1XTC C;  4IFM A;  2WSE H;  1M1J B;  1MV8 A;  2H88 C;  3HUS C;  1EC5 A;  4ZKU A;  1GL2 C;  1PV3 A;  1AV1 A;  2YMY A;  1SP4 A;  2SPZ A;  4GOE A;  1J1D B;  3BCC G;  1AQT A;  4JF7 A;  3IN6 A;  2B9B A;  3V4Q A;  5KJ7 A;  2H7H A;  2W8Z A;  3AEG C;  3E1R A;  1OW6 A;  3TK1 A;  3CCR P;  1FZG A;  3CXH D;  1LTI C;  1HGZ A;  3CCJ P;  1NTM G;  3MTU E;  3FXD A;  1NU1 G;  1SQV J;  2RN0 A;  1LTS C;  2KS1 A;  2ZXX A;  3GHG A;  4PD4 D;  1OW7 A;  1RE3 C;  2R3S A;  3K5B A;  1NGM B;  1YQ4 C;  3QH9 A;  4L74 A;  5AVV B;  2Y0E A;  1G1I A;  2IFM A;  2YXR B;  3L73 D;  3CME P;  1SQB K;  2AXC A;  1IFJ A;  3M91 A;  3TGU E;  2OTL P;  2KK7 A;  2KOG A;  3FX0 A;  3L73 G;  1KYO I;  4K35 A;  4CPG A;  3M0D C;  3SFE C;  4LLH A;  1FAV A;  1WMK A;  3BRT B;  2AXT H;  1U7M A;  2CPS A;  3I56 P;  3RK2 D;  2O01 H;  4D6T G;  5CCG C;  1X22 A;  1JNM A;  3JSV C;  3BAS A;  1NKZ B;  1U57 A;  1SQX K;  3H1K E;  1DEB A;  1P84 H;  1L4A C;  3C1L A;  3GLM A;  5KLV G;  1KC8 Q;  1SQQ J;  1FJP A;  2KZI A;  1H8A A;  1RF1 B;  2Y9Z A;  3L71 J;  1JY3 O;  1LJ2 A;  5CCH A;  1L4A B;  1SQB G;  1Q86 Q;  1LTT C;  3VN0 A;  1T6A A;  4UB6 E;  3EFF K;  1IFP A;  2WSE J;  1PIX A;  3CPW O;  1NTM J;  1GZL A;  2NPS C;  1KIL B;  3B71 A;  3RK3 B;  1SQP D;  2Y0C A;  3A0B E;  1N2D C;  3IFM A;  1NU1 K;  1VQP P;  1VF5 C;  3D6Z A;  2IBZ D;  1S72 P;  1FBM A;  1N7S B;  2YXQ B;  3H1J D;  1Y47 A;  3FWN A;  1QLE D;  1IFI A;  1GU5 A;  1K9M Q;  1VF5 D;  3D6Y A;  4C7R A;  3LW5 J;  4BXL A;  1M57 D;  3C8V A;  1N7L A;  1PL5 A;  2FFD C;  3H1I G;  3H1H J;  1JM0 A;  4O9B A;  3SWF A;  5CJ4 A;  2QJY B;  5AVQ B;  1RE4 A;  3P8M C;  4L73 A;  1A02 F;  2E75 C;  1G2C B;  2QSI A;  1KIL A;  3N4X A;  2KSE A;  2YKP A;  1LT9 A;  3AEC C;  1NTK D;  2BCC G;  3D70 A;  3KDP B;  1FZB A;  1SFC D;  1USD A;  2BEZ F;  5CHX A;  1NWQ A;  1IK7 A;  1T8Z A;  1VQ8 P;  2JWA A;  2QM7 A;  1SQP K;  1VQ6 P;  4U3F E;  5KAI E;  3ABV C;  3CC2 P;  1FU1 A;  1W2E A;  1HH0 A;  3RK3 D;  3V2N A;  2PAJ A;  3VTP C;  3KPE A;  3KYQ A;  5H2F E;  1SFC A;  5B66 H;  3V5B A;  3Q1M A;  1NU1 E;  2M3E A;  2BCC D;  1PGO A;  1SQV K;  2N1T A;  2P2U A;  2W6J H;  3H1L D;  1GMJ A;  2BEQ D;  3L70 J;  2V7Q J;  5H2F H;  1M1K Q;  2FXP A;  5AVY B;  1NH4 A;  2IFN A;  3M0A A;  4IFF A;  3S1K A;  2R3C A;  4KHX A;  4PJ0 H;  1YI2 P;  2JDI H;  2YO3 A;  3GHG C;  3L72 D;  1SVF A;  4Y99 B;  1M7L A;  5AW4 B;  3TYY A;  1HUC A;  5AVS B;  1DX7 A;  1ZV8 A;  4C7N B;  1EZV D;  3RBZ A;  2AEF A;  1EQ7 A;  4D6T E;  2P58 A;  3CL3 D;  4QMA A;  1LP1 B;  3HRN A;  3AE1 C;  3MUD A;  1N7S D;  1FC2 C;  2WMM A;  3NFQ A;  4W7Z A;  5AVW B;  4DOJ A;  3M0D A;  5CBO A;  2GA1 A;  4KT0 J;  3WU2 E;  1PZQ A;  3Q3D A;  1N73 C;  2MJZ A;  2YKQ A;  3A5T A;  3CWB D;  1CW5 A;  1YJN P;  2W90 A;  1OVU A;  1KB9 H;  1SQP G;  3F89 A;  5KKZ C;  1KQF B;  3H1J E;  1IC2 A;  3A3Y B;  1IK9 A;  1L0N E;  2OAR A;  3WMM 0;  2WT7 A;  2YIU B;  2OYI B;  1BDD A;  1KB9 E;  3M06 A;  2E76 B;  1HBW A;  1Y9B A;  2L5G B;  1KOR A;  4GT1 A;  3CCQ P;  5TJH A;  5KTB A;  1E5W A;  1L0L E;  2Q3I A;  4H13 B;  3HD7 C;  1BGY D;  3R2P A;  1T3U A;  1RF0 A;  3AE8 C;  3CX5 E;  1DEE G;  3SFD C;  2NPS A;  5APX A;  2OTK E;  1P84 D;  3B8E B;  2E75 D;  2K1A A;  3GMA A;  2A45 I;  1NTZ G;  1NTK E;  4PD4 H;  1FJK A;  3L74 J;  2FXO A;  2M0B A;  2Y9Y A;  4TLF A;  3V6I A;  3VP8 A;  1HJB A;  2ZYG A;  1EZV I;  1JEK A;  1ZXG A;  3M9Q A;  3O6Q B;  4JQ0 D;  5TIS E;  3WUT A;  5KLV K;  2IZ0 A;  3TGU J;  4IL6 X;  1BE3 J;  3L37 A;  1X0T A;  2W27 A;  5DJT B;  4ASW A;  5CCG D;  1SQQ K;  1VPC A;  3BCC J;  1OXZ A;  2QIW A;  3RK2 B;  2ZVN B;  2WPR A;  2JP3 A;  4U3F J;  5L8R J;  1FZC A;  2K9Y A;  2IBZ E;  2KIK A;  2RH0 A;  2Y0D A;  4PJ0 E;  1PGP A;  2XNX A;  4XE5 B;  2QA4 P;  4LGD E;  3Q5P A;  1AJY A;  4YPC A;  1KFM A;  3BAT A;  1SQX G;  1WRG A;  1NVO A;  4AYC A;  2WPS A;  3H1I E;  3L4F A;  4DJG A;  4AUW A;  2LR2 A;  2OYI A;  5BU5 A;  1Q82 Q;  1SFC B;  2AEM A;  2ZT9 C;  1BSH A;  1MKM A;  2QE7 H;  1IJD B;  3U59 A;  4DZO A;  3G71 P;  5KLV D;  1LWU C;  2KZJ A;  3L70 E;  1Q7Y Q;  5AW1 B;  3I55 P;  3P8C D;  1GTW A;  2ZXE B;  3RL0 g;  1USE A;  3H1K D;  3MIW A;  1JY2 P;  2I8D A;  5CJ0 A;  1S5L H;  2C9L Y;  3N7N A;  1T2K D;  2H43 A;  1VQ9 P;  3AED C;  1JY3 P;  2MKV A;  1E79 H;  1GK4 A;  1LTJ A;  1LT9 B;  2HG5 D;  3MHV A;  2A06 D;  1RHZ B;  1RY3 A;  4GKG A;  3VYI A;  3VOP A;  5KLI C;  5CCH D;  2E42 A;  2WIT A;  1PP9 D;  4WVZ A;  3H25 A;  2FFD B;  1EDK A;  3CXH H;  1VQ5 P;  2OQQ A;  3I5C A;  4XA4 A;  3HTK A;  1VQM P;  1A02 J;  3RL0 D;  1YQ3 C;  2WVR A;  2QG4 A;  3PLN A;  2Q1K A;  1VQO P;  2POH A;  1QGK B;  1FDO A;  3BVH A;  2KI7 B;  1URQ A;  3GHG B;  1FS0 E;  3CC7 P;  1JO5 A;  1J2J B;  1SS1 A;  3LW5 H;  3T97 A;  1JMM A;  1CSB A;  3B5N B;  1H88 A;  1NTZ K;  3CC4 P;  1KYO E;  1KV4 A;  1S5L X;  3H1I J;  2KNC B;  2N9B A;  3ITK A;  1U7J A;  4RJT A;  1L4A A;  4D6T D;  3V4W A;  1EZV E;  3TF5 A;  1NJI Q;  1NTM E;  5CMZ A;  1NTK G;  1ZOY C;  4YXW H;  1AQ5 A;  5AVZ B;  1P84 I;  4BWN A;  2XKM A;  5K5G B;  3H1H G;  2P10 A;  2R32 A;  3JCU E;  3FWL A;  1VQL P;  1HJ0 A;  2FYU D;  2P7J A;  3Q5S A;  1RF0 C;  2E74 B;  3MGN A;  3RBX A;  2NRG A;  3B5N C;  4L75 A;  2WTY A;  3JCU H;  3USS A;  3SWY A;  1HGV A;  1KMI Z;  1RE3 A;  1NTZ D;  2FKW B;  1KD1 Q;  2B88 A;  1BGY E;  1KFN A;  1M90 Q;  2E5T A;  2IBZ G;  3F5H A;  1FDI A;  1L0L G;  2HOD A;  1BCC D;  2O1J A;  4OGQ B;  1ZLL A;  2C9N Y;  2O01 J;  1BGY G;  3H32 A;  2K88 A;  4PD4 I;  1L0N D;  2WZ7 A;  5APS A;  2FYN B;  2LXC B;  4C46 A;  2XDJ A;  1RE4 C;  4NPF X;  1RF1 C;  1LTA C;  1EXI A;  1NU1 D;  2D2C C;  2A45 G;  3U1A A;  1FOS F;  2ZJS E;  1LTJ B;  3L72 E;  4H0L C;  2M8R A;  5APT A;  4JPZ B;  2WPV B;  2YIU C;  3CWB G;  5BVZ A;  2OYI C;  4U3F G;  2PRR A;  4RKU J;  3R4Y A;  1FZF A;  4IL6 H;  4K3A A;  3RGU A;  1YJW P;  1XTG B;  1TU3 F;  2G8Y A;  5DJU B;  2XZR A;  5APW A;  3A0H H;  1NTK K;  3CCE P;  1ZP0 C;  1KYO H;  2CPB A;  1SQX D;  2J59 M;  4JYB A;  2JKV A;  4RO0 A;  1SQQ D;  4A7P A;  1PPJ G;  1GD2 E;  4UB6 H;  4BRY A;  5AW0 B;  3L71 D;  3P32 A;  1KQG B;  2IYO A;  4H0L B;  2C0X A;  2WPQ A;  2JO1 A;  4I7Z B;  1L0L J;  4W7Y A;  3H1L E;  1EDI A;  1QL2 A;  1VDF A;  1BCC G;  2ZYA A;  1NTM D;  2Q3E A;  4H44 C;  1SQP J;  2K9J A;  3O8Z A;  1PP9 G;  3H1L G;  2PGD A;  3L72 G;  1FE6 A;  1Q81 Q;  3CXH I;  2J5U A;  3OW2 O;  2OTJ P;  3JC2 2;  3L75 G;  2Z4E A;  3NXS A;  4U7J A;  1H0T A;  1IFD A;  4I6M C;  3Q2Y A;  3H1H D;  1J1D C;  4MN4 C;  1HWT C;  2OYH A;  1M1J A;  3MZW B;  4EI2 A;  3CCU P;  3OJA B;  1OVR A;  2E74 C;  1NYH A;  3CLQ A;  2R44 A;  2WT7 B;  3P7K A;  2WSF H;  4LC1 A;  3CCS P;  1BSN A;  1IFM A;  1GL2 B;  1KIL E;  5CCH C;  3AEB C;  1VQ4 P;  1QVF O;  4ZMD A;  1RH5 B;  3RK2 C;  2Q9I A;  3AE3 C;  3HD7 A;  3LIE A;  4WY4 A;  4GIF A;  1L0L K;  3AEF C;  1LNQ A;  1H89 A;  4GOF A;  4HJG H;  2W83 C;  2NPS D;  2KXP B;  1FZC B;  3TNU B;  1JY2 O;  2B87 A;  5GTI H;  3H1L J;  3PH0 A;  3PJS K;  4C7N A;  3L70 D;  2Q5U A;  1LP1 A;  3ZDM A;  3H1K G;  1P84 E;  2KYV A;  3L75 D;  1NAF A;  3PP5 A;  5AW9 B;  2B87 B;  5APY A;  1MUU A;  3RK3 C;  2I1J A;  1ZW0 A;  4Z1M H;  4R4M A;  1JCD A;  1UII A;  1LWU B;  1AVY A;  1SQB D;  2QJP B;  3AEE C;  5E79 E;  4YXD C;  5GTH E;  4B86 A;  1D7M A;  3L72 J;  3P8C E;  3GF3 A;  3VMY A;  3E7K A;  3AE5 C;  1LGH B;  5E79 H;  3VP9 A;  2Z5I A;  5GTH H;  3G6E P;  1BE3 G;  5AW8 B;  1X79 B;  2WSC J;  4HKZ H;  4XFJ A;  2HPC B;  2KSJ A;  3TSI A;  1J1E C;  1ZR4 A;  1PPJ E;  2CK3 H;  3CD6 P;  2OGU A;  2E43 A;  1LTG C;  3HUS A;  2Z5H A;  1SFC C;  1SQV D;  1VL2 A;  1LWU A;  2ZVO B;  3CWB J;  4WY4 D;  1FDM A;  2QJP C;  5AW6 B;  5AW3 B;  4DT0 A;  2XV5 A;  2QEX P;  1S9K D;  3L74 D;  3S4R A;  1S9K E;  3WUU A;  3L35 A;  2J58 A;  4ASV A;  4EDF A;  2YNY A;  5KJ7 C;  1T2K C;  3L73 J;  4N78 D;  1L4A D;  3CWB E;  3O6Q A;  1H0T B;  1IZN B;  1G2C A;  3TNU A;  3VMX A;  4YTP C;  5APV A;  1X9V A;  2QJK B;  1BGY J;  1SLQ A;  2HR3 A;  2IPP A;  1L2P A;  3BCC E;  5B66 E;  1FOS E;  4OGQ C;  1T3J A;  2GUV A;  1EDL A;  4HB1 A;  1X8Y A;  2FYN C;  2IBZ I;  5KAI H;  3HD7 B;  1SQX E;  3CI9 A;  5TIS H;  2AXT E;  2HOD B; 
#chains in the Genus database with same CATH homology
 1KMI Z;  2E76 C;  2D2C D;  1GMJ A;  2BEQ D;  2V7Q J;  1FDI A;  2FXP A;  4OGQ B;  2FBW C;  5M1B A;  2O01 J;  3IAO A;  4Y28 J;  1EXI A;  2QJY C;  1RQV A;  1DIP A;  4GDO A;  2D2C C;  4PV1 D;  1K04 A;  2ZT9 D;  4H0L C;  1ZRT E;  3Q5R A;  3RK3 E;  2WPV B;  2YIU C;  3AE1 C;  1Q90 D;  3GF7 A;  2YMK A;  3AEA C;  4KT0 J;  3G9R A;  3Q3D A;  4H44 B;  3AE6 C;  4RKU J;  3R4Y A;  1JB0 J;  2G8Y A;  1TU3 F;  5KKZ C;  1ZP0 C;  1KQF B;  1HF9 A;  1DD3 A;  2ZT9 B;  2E76 B;  1KQG B;  1Y9B A;  2NZ2 A;  1KOR A;  4H0L B;  2JO1 A;  4I7Z B;  1R8E A;  4H13 B;  3AE9 C;  3FGA D;  3AE8 C;  3SFD C;  4H44 C;  2H88 C;  2E75 D;  3GMA A;  4OGQ D;  1PV3 A;  3AE4 C;  2J5U A;  4PV1 C;  3IN6 A;  4U7J A;  3AEG C;  1OW6 A;  4IL6 X;  3Q2Y A;  4PV1 B;  3EWK A;  2QIW A;  2JP3 A;  1OW7 A;  5L8R J;  1NGM B;  2E74 C;  1NYH A;  1YQ4 C;  2K9Y A;  1ZME C;  1AJY A;  3Q5P A;  2E76 D;  3D71 A;  1KIL E;  3AEB C;  2WSF J;  3AE3 C;  3SFE C;  3AEF C;  2ZT9 C;  1WMK A;  1MKM A;  2E75 B;  4I7Z C;  1UIX A;  1U57 A;  2WQY C;  3RL0 g;  3GLM A;  1S1C X;  1RQU A;  1VF5 B;  4H13 C;  3AED C;  2MKV A;  2H89 C;  1OW8 A;  4Z1M H;  5KLI C;  4R4M A;  3H25 A;  2WSE J;  3AEE C;  1PIX A;  4YXD C;  2OQQ A;  3T97 B;  3GF3 A;  3B71 A;  2E74 D;  3AE5 C;  1VF5 C;  3D6Z A;  1YQ3 C;  3AE7 C;  3D6Y A;  2WSC J;  4XFJ A;  1VF5 D;  3Q1M A;  3LW5 J;  1FDO A;  3C8V A;  2D2C B;  1PL5 A;  1VL2 A;  1DD4 A;  1S5L X;  2QJP C;  2E75 C;  2QSI A;  2QJK C;  3D70 A;  3AEC C;  3S9O A;  4H0L D;  2BEZ F;  1OMI A;  1KTM A;  1IK7 A;  3O6Q A;  2G3A A;  1ZOY C;  1EXJ A;  4YTP C;  3ABV C;  2P10 A;  2IDB A;  1HJ0 A;  3AE2 C;  3Q5S A;  4TT3 H;  2E74 B;  4OGQ C;  2FYN C;  4H44 D;  4R4L A;  4H13 D;  1K05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...