2FXPA

Solution structure of the sars-coronavirus hr2 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
55
structure length
55
Chain Sequence
GSHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spike glycoprotein
publication title Solution structure of the severe acute respiratory syndrome-coronavirus heptad repeat 2 domain in the prefusion state
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 14
structure length 55
sequence length 55
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.790 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2fxpA01
2FXPA 2BEZF 2BEQD
chains in the Genus database with same CATH superfamily
1SQBE 2FYUE 3QWOC 3CCJP 3W67A 1CI6A 1T2KD 2GUSA 1NAYA 3RK2D 1L0NK 2N1TB 2IBZI 3L72D 3WUVA 1T2KC 5B66H 1NTKD 4XFJA 2KIKA 2AEMA 1M8OB 4H44B 1SFCB 1L0ND 4EOTA 2P10A 1Y47A 1AJYA 1X22A 3WUTA 1FBMA 3NFQA 1OVUA 2OYIC 1KQGB 3Q3DA 3AE8C 1Q2NA 3GHGA 2GM4A 1BCCD 1W2EA 1IO4A 2I1KA 2KK7A 3H32B 1VQLP 2L91A 3VTPC 2A45H 2R5DA 5KTBA 3KYQA 1H0TB 2L5GB 2QE7H 1G1JA 2WT7B 3VMYA 5E79E 4YXDC 1GU5A 1FZGA 2E42A 4PD4H 1VQ8P 1ZN5A 1OIPA 2WSFH 4IOIH 2WMMA 1DD4A 3TGUG 1IC2A 1IFIA 1GU4A 3WU2E 1A02F 3A0BE 5CMZA 2WQYC 2LXCB 1NJIQ 1N7SB 3HE4B 2SPZA 3EFFK 1SLQA 1LT1A 3KZIH 2VRSA 1BGYE 1AA0A 3KDPB 4GDOA 5M1BA 2LR2A 2IFNA 2O1KA 5BU5A 3V4WA 1KILC 1PPJG 1NGMB 3B5NB 3GW6A 3VMAA 1OVRA 2YXRB 1FZFA 1Q82Q 4PJ0E 1H89A 4RESB 1KB9D 5L8RJ 2GUVA 3E1IA 3M91A 1S1CX 3HUSC 5KLIB 2K9JA 3V4QA 1GMJA 4OVNF 2FXOA 3RK3D 2D2CC 1KYOD 1CI6B 3BRVB 1FC2C 3L35A 4H0LB 5AVWB 4D6TG 5DJTB 1NYHA 1N73C 3HTKA 3Q5PA 4DT0A 1NKNA 3Q5RA 1PGJA 4N6JA 2HFED 2KUBA 1MZ9A 2N9BA 1KILA 1KTMA 5CJ0A 3G6EP 1Z56A 1RF1C 1M1JC 3SWFA 1M7LA 1USDA 1E5WA 2ZVNB 1P84I 4UB8E 4GKGA 2Q9IA 1LTIC 2YKQA 5CJ4A 3CXHE 2KS1A 2BCCJ 3AEFC 1BSNA 1X9VA 2N1TD 1KC8Q 1N8RQ 2WSCH 3KHUA 1GL2A 2OYHB 1IJDB 2QRXA 3G3ZA 4U3FD 3AE2C 5KJ7D 2IX7C 2C9NY 5B5EE 1SFCD 4LLHA 4HH2A 1N73A 4K3AA 1GZLA 5KJ7C 2NPSA 1SQVK 1YITP 1NU1J 3MP7B 4JPZB 4L74A 1JY2O 5GTHH 1NTMK 3CMAP 3OW2O 3EQ2A 3T97A 2PRRA 1VQ9P 1OXZA 1SQXK 1MKMA 4GODA 3UIAA 4UB6H 1NU1E 2OYIB 3RL0C 3VP8A 1RF1A 1M1JA 2QJKC 3N7NA 3L70G 5CCGA 5AW5B 1JOCA 2ZVOB 3TGUJ 2K88A 3G71P 1JTHA 2WVRA 4ZKPA 4Y99C 3H1HJ 2FYUK 1NAFA 2K9JB 1KFMA 3BRTB 3AEAC 3RK3E 2XNXA 3HD7C 4PD4D 3L73G 1N7SD 3TGUE 2Y0DA 1SQPJ 2WSEH 1SP4A 3L75J 1EZVG 1LT9C 2QEXP 5KKZC 2MKVA 4OGQC 1VQ5P 4BRYA 3H1HE 5KAFH 1N7SC 3ABVC 3M0DC 1EXJA 1QEXA 3TNUB 3R2PA 1VQKP 4N3YB 3BVHA 2B87B 2HR3A 3B5ND 5C39A 1SQPE 2Z4EA 1AVOA 1QL1A 1PPJE 2IZ0A 5CCHD 3P32A 2P67A 3CCQP 3B71A 2AXTH 1KILB 1YBKA 1CSBA 1T3JA 1VF5D 3LW5H 4D6TJ 3IAOA 2M5AB 1NTZG 1JUNA 1VQ7P 3OA7A 2KS1B 1VF5C 1JEKA 2JP3A 3L74J 3I55P 3HUSB 4K35A 2RMZA 4D6TE 2E74C 2P2UA 3CXHI 3L73D 2ZAEB 4WY4A 3HD7A 5AW6B 5EFWB 1EZVD 2D2CB 3H1ID 1X0TA 2OARA 1GTWA 2E43A 1VQNP 3H6PA 3H1JD 1PGOA 3L72G 2JWDA 1NTKG 1N73B 1YYCA 3M0DA 3LIEA 2ZXEB 4DOJA 4C46A 3CCRP 2K1AA 1L0NG 2O01J 1JY2N 2WSSH 3HE5A 3GHGC 1KORA 2KLVA 2ZXXA 3CPWO 2Q6QA 2ZT9C 2R5BA 1JB0J 1NTZD 1M1JB 2KSEA 1RF1B 3ZDMA 2O01N 1L0LD 1R5LA 3AE3C 3VMZA 2KI7B 1FZBA 2YXQB 5BU8B 2K9YA 1FDMA 5AVYB 4NPFX 2W90A 5AW4B 2LXBA 3B8EB 2Y0EA 4ASVA 1J2JB 1KYOI 5AVTB 2H43A 1L4AC 5APWA 1RQUA 5CBOA 1S2EA 2ZFCA 2JR8A 3B4SA 3L70J 4YXWH 1YHQP 3JCUE 3L71G 5APTA 2M8RA 2OQQA 1P84E 2W8ZA 2JWAA 3S9OA 3MHVA 5APSA 3S1KA 2J59M 1TU3F 3RL0B 3AEDC 1NHLA 2OYHC 3L70E 2MJZA 2KXPB 1YIJP 2QJKB 3U59A 3D70A 1DEBA 1IZNB 1FDIA 5AVRB 2C9LY 1H8AA 3CWBG 4YPCA 3CX5H 1U57A 3M0AA 3O6QA 3AE4C 1JMBA 4Y99B 4Y28J 4ZKUA 2FXPA 3P8CE 5APXA 3Q1MA 2W6JH 1BGYJ 4PV1D 3E7KA 3HD7B 3NXSA 1K73Q 1U7JA 2A06G 1VQOP 2BASA 1M1KQ 1BE3J 1LT9B 1OVVA 5KKZB 1HJBA 4OGQB 4PV1C 2KNCA 1L4AA 1AVYA 1VL2A 3FXDA 1KILD 2K3RA 3L71D 1SQQJ 1LWUC 1GDTA 5AW3B 1UIIA 5AW0B 3MIWA 1BE3E 3IF4A 1NU1K 1K9MQ 4KJMA 3BCCG 1QGKB 1IFMA 2Q7CA 1N2DC 1L2PA 1P84H 3VYIA 1SQQE 3TDKA 4RKUJ 1ZP0C 2PAJA 1DEEG 2J58A 3CWBD 4DZOA 1GL2D 2E75C 3L72J 1KQLA 5H2FE 2Y0CA 1GK6A 3MZWB 2D2CD 2OTLP 1HH0A 1M90Q 1VF5B 1GL2C 1OFCX 4GOFA 1FZCA 2BEZF 2PP6A 5TISE 1GW3A 4B86A 2C0WA 1L0NJ 2E74B 2IYPA 2A06D 2NPSD 1S9KD 3TSIA 3L72E 2IBZD 1PP9G 3TK1A 5E79H 4U3FG 3AEBC 5CBNA 1NTKE 1CZQA 1EXIA 3NTNA 2V7QJ 1NOHA 1Q81Q 1RQVA 2NPSC 1J1EB 1L0NE 1BCCJ 1ZRTD 1SQPK 1LGHB 2R44A 1LWUA 3CCVP 5DJUB 3WU2H 3A0BH 3H1KG 2QVAA 1K8AQ 4DJGA 3BCCD 2CK3H 3OJAB 1A02J 1NVOA 2E5TA 1SQVG 3MTUE 1K04A 5CCGD 4JBZA 1BCCE 3E1RA 1IFJA 3L75D 2KP8A 1LP1A 3GHGB 5TJHA 2ZT9B 5AW9B 1URQC 5CCGC 3CC7P 1SQXG 4I7ZC 4PJ0H 1S4XA 2XU6A 3SWKA 1EDLA 2A45G 4JQ0D 1HUCA 4KHXA 3A0HE 3O6QB 3WUUA 4IL6E 3SSUA 5H2FH 2YMYA 3FX0A 3I56P 1PP9D 4H13D 3C8VA 3CL3D 5KAIE 1FJKA 4W7YA 2FY8A 2QA4P 4AUWA 1T8ZA 1VDFA 4H13C 3C1LA 1BDCA 2FYUG 1SS1A 1SVFA 1LTAC 3GG2A 2WPSA 1R8EA 1EZVI 3SWYA 4WBAA 1L4AB 1WMKA 3A2AA 1KILE 3H1KD 2HPCA 1S5LE 3RL0D 2FYNB 1BDDA 2P1JA 2Q1KA 4R4LA 2AXCA 1EQ7A 1SQVD 4HKZH 2B89A 5KLVK 1LTBC 1FAVA 1RE4C 1KN7A 5AW2B 1NTMD 3Q2YA 3KPEA 2UWJE 4IFMA 1KB9E 1Q90D 2G8YA 2DW3A 1SQXD 3O8ZA 1URQA 3CWBE 2XDJA 1JCDA 5KLVD 3BASA 2PFXA 1JNMA 4N78D 3H1LD 4GIFA 4UB8H 4WY4D 3HD7D 2Z5IA 1SQBK 3CX5D 3CXHH 1FS0E 3FWLA 4EDFA 1FZCB 1AQ5A 1KYOE 3V2RA 2Z5HA 3Q5SA 4WY4C 4OGQD 3NMDA 2WPQA 4HJGH 1M57D 1RF0C 4NPDA 1S9KE 2R32A 3H1IG 1SQBD 2FYUD 1IFNA 2KZIA 3H1JG 2KLUA 1KQFB 1OW7A 1JY3P 3HTKB 2HYNA 5B5EH 1K05A 2JDIH 4PV1B 1X8YA 3CCMP 2NRGA 1R5SA 1LWUB 4EI2A 1FDOA 3BCCE 2Q3EA 2E5YA 3IR9A 1LTJC 2FFDC 1JY3N 4C7NA 1VQ6P 5GTIE 1FZAA 1RE4A 1S72P 1ZXGA 5AVQB 4L73A 3R4YA 2AEJA 4U3FJ 5APYA 5APQA 1L0LG 2E74D 2J5UA 2E75B 1RE3A 1FOSE 2KB7P 3N4XA 3V2QA 1KQSO 3ITKA 1YQ3C 3AECC 1FE6A 1GL2B 4L76A 2BEQD 3KQGA 1PP9E 4U3FE 1FZEA 2I8DA 1RF0A 4MN4C 2WT7A 3CCSP 3F89A 2W27A 1J1EC 3RBZA 1KYOH 3IN6A 2G3AA 2NPSB 1JM0A 1RHZB 3LIDA 1ZMEC 3AE9C 1VQMP 3P7KA 1PGQA 1BSHA 1MUUA 2HPCB 3KXDA 1YI2P 3T97B 2YKPA 1SQVE 2ZT9D 1LTJA 2FFDA 4WWIA 4OH8B 3C9IA 4I2LC 3USSA 3V6IA 3II6A 3P8MC 4I6MC 1SQQK 3CC2P 2QJYC 3RL0g 4XE5B 4JYCA 3PHLA 1SQXE 4IFDK 2CPBA 1HGZA 1YTZI 4JF7A 4EIJA 5GTIH 1URQB 5AW7B 4YTPC 1YTZT 5CCHA 2M3BA 2WSFJ 5AVVB 4I7ZB 3L36A 1JTHB 1NO4A 2XV5A 1KB9I 3WMM0 4PD4E 3VP9A 1G2CA 4GOEA 1EDJA 3RBXA 3GMAA 1LTTC 2FYZA 1L4AD 2WPRA 3EFGA 5AVUB 1W2BO 2YIUC 2WWWA 3CCUP 4BRYB 4H13B 1OMIA 1E79H 1RH5B 3RGUA 1IFDA 2FYNC 3BATA 2QM7A 3L4FA 2BCCG 3KZIE 3G4SP 2V4HA 3RK2C 4AQRD 1PFIA 1QLED 1HWTC 3A7OA 3JSVC 1NH4A 4C7NB 3PJSK 1AV1A 5AVZB 2QSIA 2YMKA 3M9BA 4W80A 3L73J 3M06A 3HRNA 3H1IJ 2W6AA 4ASWA 4U7JA 3W68A 1NU1G 3H1JJ 1HTLC 4TT3H 1Y8AA 1FZCC 2CPSA 2O01H 1OW8A 3M9QA 3L73E 3CXHD 4C7RA 2XNDH 3CC4P 1DIPA 1EZVE 3H1IE 4WY4B 1HF9A 3MUDC 5APUA 3H1JE 2OYHA 2IBZG 1WT6A 2AEFA 2HODA 2QM8A 1YQ4C 1PL5A 2BCCD 2P58A 3K5BA 1NTZJ 4DCKA 1L0LJ 2ZYDA 2M0BA 3H1HG 2R3SA 4XA4A 2RN0A 1LTJB 2FFDB 3HE5B 3H25A 3JCUH 4I1LA 1KZUB 4ZNCA 2KSJA 2KOGA 2E75D 4CPGA 2ITAA 4LGDE 1NTZE 1U7MA 2WSCJ 5AW8B 1SQPG 3L75G 3CCEP 2OYIA 3CI9A 1L0LE 1ZLLA 1NU1D 1OWAA 2FXMA 1N86A 1NTKJ 1T3UA 3I5CA 2OTJP 2PGDA 2ZYGA 1ZW0A 3G9RA 4EYYQ 1CW5A 2A45I 1G2CB 3MUDA 2B9BA 2WITA 3CX5I 1XTGB 3D6YA 4OWFA 1HVVA 1MV8A 1YJ9P 3SFEC 1LNQA 5CHXA 2JO1A 2N9YB 2IFMA 3V5BA 4PD4I 2C0XA 2GA1A 3V2NA 2E76D 1DX7A 3TGUD 1JY3O 3GF3A 1DD3A 2YNYA 1S3JA 3MGNA 3RK3C 4Z1MH 4BXLA 3FGAD 5GTHE 2FKWB 3CD6P 3H1HD 3IFMA 2E76C 3TNUA 2ZJSE 3AEEC 3L74G 4WB4A 3D71A 2IPPA 2B87A 4UB6E 3PH0A 1PZQA 1GW4A 1URQD 1RY3A 2XKMA 1SQPD 1QX8A 1PPJD 1MFZA 3JC22 5APVA 2R3CA 1OW6A 2QJYB 1NTMG 2IYOA 3PRJA 2QJPC 4IFFA 1Y9BA 2POHA 5KLVG 4BWNA 2WSEJ 2M5AA 4KT0J 2WTYA 1YJWP 1J1DC 3H1LG 1D7MA 3D6ZA 3L71J 2IZ1A 2P7JA 1GD2E 3HUSA 3A3YB 5BVZA 5TISH 1FJPA 2XZRA 4D6TD 2YIUB 1SQBG 2N1TC 5KAFE 2Y9ZA 2WZ7A 2KNCB 2HODB 2BCCE 1JO5A 4H44D 1OX3A 3U1AA 3L71E 1X79B 1KFNA 4RJTA 3L74D 1HJ0A 3LW5J 3CWBJ 4H44C 3RK2B 1SFCC 2OGUA 2LKMA 3U1CA 3AE1C 1FOSF 2W6BA 1EDIA 1IFPA 2YO2A 4AYCA 2H88C 2QIWA 2Y9YA 2AXTE 4W7ZA 2V7QH 1T6AA 4LC1A 1JMMA 3AE6C 3AEGC 2KZJA 4IL6X 1PV3A 1QVGO 2RH0A 3PTZA 2ZYAA 3S4RA 2Q5UA 1RE3C 2JKVA 1VQPP 2KYVA 3PLNA 2WPVB 3GLMA 2B88A 2A06E 2IBZE 3AE5C 3A0HH 4NPEA 1S5LX 4IL6H 3BCCJ 4WVZA 5KAIH 3CLQA 2N1TA 1IK7A 4JYBA 4TLFA 1ZRTE 1ZOYC 1AQTA 2JEEA 5K5GB 1Q7YQ 1AFOA 3QH9A 2O3JA 2M3EA 1QL2A 1DH3A 1FU1A 3VMXA 5KJ7A 2FBWC 1VPCA 3M9HA 1SFCA 4A7PA 3PP5A 1IK9A 1S5LH 4GT1A 2OYOA 1XTCC 3L75E 1QVFO 1BGYG 2NZ2A 1G1IA 1P84D 1VQ4P 1LP1B 4L75A 1WRGA 3B5NC 3CMEP 1PP9J 1ZV8A 1BE3G 3EWKA 3TF5A 1LTGC 5CCHC 4O9BA 2HG5D 2YKOA 1KB9H 1PIXA 4HB1A 3L70D 2H89C 2K37A 3H32A 1N7LA 3A5TA 1PGPA 1SQQG 1LTSC 1YJNP 2OTKE 4QMAA 1OZHA 2O1JA 1H0TA 3GF7A 5KLIC 3H1KJ 4H0LD 3L37A 4M3LA 4HYTB 5AVXB 1USEA 2JJLA 1ZR2A 3V2PA 5B66E 1SQVJ 4H0LC 1W5CE 1GK4A 3P8CD 3F5HA 1ZR4A 2RKLA 1HGVA 1NTMJ 5AVSB 3H1KE 1UIXA 3AE7C 1LT9A 1HBWA 4R4MA 3L74E 3RK3B 4RO0A 1SQXJ 3OAKA 2HLOA 3VN0A 1JY2P 1N7SA 3HE4A 2H7HA 3VOPA 2Q3IA 5KLVJ 2E76B 5AW1B 1EC5A 3H1LJ 3SFDC 1BGYD 1NTME 1EDKA 2W83C 2QG4A 1NTZK 1NKZB 1Q86Q 4ZMDA 1BE3D 1L0LK 2YO3A 3B5NA 1LJ2A 3TYYA 1MFTA 1KMIZ 5KLVE 3MD0A 1NWQA 4N78E 3H1LE 2QJPB 1SQBJ 1SQQD 2FYUJ 1JCCA 1H88A 3CX5E 3FXEA 2IDBA 1BCCG 1M56D 1J1DB 3FWNA 2H8PD 3CCLP 2I1JA 1KD1Q 1NTKK 1KV4A
chains in the Genus database with same CATH topology
1KORA 1VF5B 3H25A 4H13D 3C8VA 3Q5PA 1ZMEC 3AE9C 3D70A 3GF7A 1FDIA 5KLIC 2ZT9C 2E75D 1JB0J 2BEZF 1DD4A 1KQFB 1OW7A 3B71A 4H0LD 2QJPC 2WSCJ 1Y9BA 1K05A 4PV1B 1MKMA 1U57A 2WPVB 3GLMA 3Q5RA 3T97B 2E74B 2WSEJ 3O6QA 4H13C 3AE4C 4KT0J 2QSIA 2WQYC 2ZT9D 4H0LC 1VF5D 3IAOA 2YMKA 4Y28J 3AEBC 3AE5C 1R8EA 2FXPA 1EXIA 1S5LX 2V7QJ 4XFJA 3Q1MA 3AE3C 1WMKA 1RQVA 1FDOA 2QJKC 2QJYC 1KILE 4GDOA 3RL0g 3D6ZA 5M1BA 4PV1D 1UIXA 1VF5C 2K9YA 3AE7C 4U7JA 1KTMA 4R4MA 4H44B 2JP3A 1IK7A 3G9RA 4R4LA 2P10A 1AJYA 4TT3H 1ZRTE 1ZOYC 1NGMB 4OGQB 4PV1C 4YTPC 2E76B 1OW8A 2E74C 2WSFJ 1VL2A 4I7ZB 3R4YA 1KQGB 3D6YA 3SFDC 2D2CB 1DIPA 2FBWC 4H44D 3SFEC 2JO1A 3Q2YA 3Q3DA 3AE8C 3AEAC 3AEFC 5L8RJ 3RK3E 1HF9A 2E74D 1Q90D 2E75B 2J5UA 1RQUA 2G8YA 1K04A 1HJ0A 2E76D 3LW5J 3GF3A 4H44C 1DD3A 1KMIZ 1S1CX 3AE1C 4Z1MH 1YQ3C 3GMAA 3AECC 2NZ2A 5KKZC 2MKVA 3FGAD 1YQ4C 2BEQD 2ZT9B 4OGQC 2OQQA 1PL5A 2E76C 2H88C 2QIWA 3AE2C 2YIUC 1GMJA 3EWKA 3S9OA 3ABVC 4RKUJ 3AEEC 2IDBA 4I7ZC 3D71A 4H13B 3AE6C 3AEGC 1ZP0C 1EXJA 2D2CC 1OMIA 1TU3F 4H0LB 2O01J 4IL6X 3Q5SA 4OGQD 1PV3A 3AEDC 1PIXA 2H89C 2E75C 4YXDC 3IN6A 2FYNC 2G3AA 1OW6A 1NYHA 2D2CD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FXP A;  2BEZ F;  2BEQ D; 
#chains in the Genus database with same CATH topology
 1SQB E;  2FYU E;  3QWO C;  3CCJ P;  3W67 A;  1CI6 A;  1T2K D;  2GUS A;  1NAY A;  3RK2 D;  1L0N K;  2N1T B;  2IBZ I;  3L72 D;  3WUV A;  1T2K C;  5B66 H;  1NTK D;  4XFJ A;  2KIK A;  2AEM A;  1M8O B;  4H44 B;  1SFC B;  1L0N D;  4EOT A;  2P10 A;  1Y47 A;  1AJY A;  1X22 A;  3WUT A;  1FBM A;  3NFQ A;  1OVU A;  2OYI C;  1KQG B;  3Q3D A;  3AE8 C;  1Q2N A;  3GHG A;  2GM4 A;  1BCC D;  1W2E A;  1IO4 A;  2I1K A;  2KK7 A;  3H32 B;  1VQL P;  2L91 A;  3VTP C;  2A45 H;  2R5D A;  5KTB A;  3KYQ A;  1H0T B;  2L5G B;  2QE7 H;  1G1J A;  2WT7 B;  3VMY A;  5E79 E;  4YXD C;  1GU5 A;  1FZG A;  2E42 A;  4PD4 H;  1VQ8 P;  1ZN5 A;  1OIP A;  2WSF H;  4IOI H;  2WMM A;  1DD4 A;  3TGU G;  1IC2 A;  1IFI A;  1GU4 A;  3WU2 E;  1A02 F;  3A0B E;  5CMZ A;  2WQY C;  2LXC B;  1NJI Q;  1N7S B;  3HE4 B;  2SPZ A;  3EFF K;  1SLQ A;  1LT1 A;  3KZI H;  2VRS A;  1BGY E;  1AA0 A;  3KDP B;  4GDO A;  5M1B A;  2LR2 A;  2IFN A;  2O1K A;  5BU5 A;  3V4W A;  1KIL C;  1PPJ G;  1NGM B;  3B5N B;  3GW6 A;  3VMA A;  1OVR A;  2YXR B;  1FZF A;  1Q82 Q;  4PJ0 E;  1H89 A;  4RES B;  1KB9 D;  5L8R J;  2GUV A;  3E1I A;  3M91 A;  1S1C X;  3HUS C;  5KLI B;  2K9J A;  3V4Q A;  1GMJ A;  4OVN F;  2FXO A;  3RK3 D;  2D2C C;  1KYO D;  1CI6 B;  3BRV B;  1FC2 C;  3L35 A;  4H0L B;  5AVW B;  4D6T G;  5DJT B;  1NYH A;  1N73 C;  3HTK A;  3Q5P A;  4DT0 A;  1NKN A;  3Q5R A;  1PGJ A;  4N6J A;  2HFE D;  2KUB A;  1MZ9 A;  2N9B A;  1KIL A;  1KTM A;  5CJ0 A;  3G6E P;  1Z56 A;  1RF1 C;  1M1J C;  3SWF A;  1M7L A;  1USD A;  1E5W A;  2ZVN B;  1P84 I;  4UB8 E;  4GKG A;  2Q9I A;  1LTI C;  2YKQ A;  5CJ4 A;  3CXH E;  2KS1 A;  2BCC J;  3AEF C;  1BSN A;  1X9V A;  2N1T D;  1KC8 Q;  1N8R Q;  2WSC H;  3KHU A;  1GL2 A;  2OYH B;  1IJD B;  2QRX A;  3G3Z A;  4U3F D;  3AE2 C;  5KJ7 D;  2IX7 C;  2C9N Y;  5B5E E;  1SFC D;  4LLH A;  4HH2 A;  1N73 A;  4K3A A;  1GZL A;  5KJ7 C;  2NPS A;  1SQV K;  1YIT P;  1NU1 J;  3MP7 B;  4JPZ B;  4L74 A;  1JY2 O;  5GTH H;  1NTM K;  3CMA P;  3OW2 O;  3EQ2 A;  3T97 A;  2PRR A;  1VQ9 P;  1OXZ A;  1SQX K;  1MKM A;  4GOD A;  3UIA A;  4UB6 H;  1NU1 E;  2OYI B;  3RL0 C;  3VP8 A;  1RF1 A;  1M1J A;  2QJK C;  3N7N A;  3L70 G;  5CCG A;  5AW5 B;  1JOC A;  2ZVO B;  3TGU J;  2K88 A;  3G71 P;  1JTH A;  2WVR A;  4ZKP A;  4Y99 C;  3H1H J;  2FYU K;  1NAF A;  2K9J B;  1KFM A;  3BRT B;  3AEA C;  3RK3 E;  2XNX A;  3HD7 C;  4PD4 D;  3L73 G;  1N7S D;  3TGU E;  2Y0D A;  1SQP J;  2WSE H;  1SP4 A;  3L75 J;  1EZV G;  1LT9 C;  2QEX P;  5KKZ C;  2MKV A;  4OGQ C;  1VQ5 P;  4BRY A;  3H1H E;  5KAF H;  1N7S C;  3ABV C;  3M0D C;  1EXJ A;  1QEX A;  3TNU B;  3R2P A;  1VQK P;  4N3Y B;  3BVH A;  2B87 B;  2HR3 A;  3B5N D;  5C39 A;  1SQP E;  2Z4E A;  1AVO A;  1QL1 A;  1PPJ E;  2IZ0 A;  5CCH D;  3P32 A;  2P67 A;  3CCQ P;  3B71 A;  2AXT H;  1KIL B;  1YBK A;  1CSB A;  1T3J A;  1VF5 D;  3LW5 H;  4D6T J;  3IAO A;  2M5A B;  1NTZ G;  1JUN A;  1VQ7 P;  3OA7 A;  2KS1 B;  1VF5 C;  1JEK A;  2JP3 A;  3L74 J;  3I55 P;  3HUS B;  4K35 A;  2RMZ A;  4D6T E;  2E74 C;  2P2U A;  3CXH I;  3L73 D;  2ZAE B;  4WY4 A;  3HD7 A;  5AW6 B;  5EFW B;  1EZV D;  2D2C B;  3H1I D;  1X0T A;  2OAR A;  1GTW A;  2E43 A;  1VQN P;  3H6P A;  3H1J D;  1PGO A;  3L72 G;  2JWD A;  1NTK G;  1N73 B;  1YYC A;  3M0D A;  3LIE A;  2ZXE B;  4DOJ A;  4C46 A;  3CCR P;  2K1A A;  1L0N G;  2O01 J;  1JY2 N;  2WSS H;  3HE5 A;  3GHG C;  1KOR A;  2KLV A;  2ZXX A;  3CPW O;  2Q6Q A;  2ZT9 C;  2R5B A;  1JB0 J;  1NTZ D;  1M1J B;  2KSE A;  1RF1 B;  3ZDM A;  2O01 N;  1L0L D;  1R5L A;  3AE3 C;  3VMZ A;  2KI7 B;  1FZB A;  2YXQ B;  5BU8 B;  2K9Y A;  1FDM A;  5AVY B;  4NPF X;  2W90 A;  5AW4 B;  2LXB A;  3B8E B;  2Y0E A;  4ASV A;  1J2J B;  1KYO I;  5AVT B;  2H43 A;  1L4A C;  5APW A;  1RQU A;  5CBO A;  1S2E A;  2ZFC A;  2JR8 A;  3B4S A;  3L70 J;  4YXW H;  1YHQ P;  3JCU E;  3L71 G;  5APT A;  2M8R A;  2OQQ A;  1P84 E;  2W8Z A;  2JWA A;  3S9O A;  3MHV A;  5APS A;  3S1K A;  2J59 M;  1TU3 F;  3RL0 B;  3AED C;  1NHL A;  2OYH C;  3L70 E;  2MJZ A;  2KXP B;  1YIJ P;  2QJK B;  3U59 A;  3D70 A;  1DEB A;  1IZN B;  1FDI A;  5AVR B;  2C9L Y;  1H8A A;  3CWB G;  4YPC A;  3CX5 H;  1U57 A;  3M0A A;  3O6Q A;  3AE4 C;  1JMB A;  4Y99 B;  4Y28 J;  4ZKU A;  2FXP A;  3P8C E;  5APX A;  3Q1M A;  2W6J H;  1BGY J;  4PV1 D;  3E7K A;  3HD7 B;  3NXS A;  1K73 Q;  1U7J A;  2A06 G;  1VQO P;  2BAS A;  1M1K Q;  1BE3 J;  1LT9 B;  1OVV A;  5KKZ B;  1HJB A;  4OGQ B;  4PV1 C;  2KNC A;  1L4A A;  1AVY A;  1VL2 A;  3FXD A;  1KIL D;  2K3R A;  3L71 D;  1SQQ J;  1LWU C;  1GDT A;  5AW3 B;  1UII A;  5AW0 B;  3MIW A;  1BE3 E;  3IF4 A;  1NU1 K;  1K9M Q;  4KJM A;  3BCC G;  1QGK B;  1IFM A;  2Q7C A;  1N2D C;  1L2P A;  1P84 H;  3VYI A;  1SQQ E;  3TDK A;  4RKU J;  1ZP0 C;  2PAJ A;  1DEE G;  2J58 A;  3CWB D;  4DZO A;  1GL2 D;  2E75 C;  3L72 J;  1KQL A;  5H2F E;  2Y0C A;  1GK6 A;  3MZW B;  2D2C D;  2OTL P;  1HH0 A;  1M90 Q;  1VF5 B;  1GL2 C;  1OFC X;  4GOF A;  1FZC A;  2BEZ F;  2PP6 A;  5TIS E;  1GW3 A;  4B86 A;  2C0W A;  1L0N J;  2E74 B;  2IYP A;  2A06 D;  2NPS D;  1S9K D;  3TSI A;  3L72 E;  2IBZ D;  1PP9 G;  3TK1 A;  5E79 H;  4U3F G;  3AEB C;  5CBN A;  1NTK E;  1CZQ A;  1EXI A;  3NTN A;  2V7Q J;  1NOH A;  1Q81 Q;  1RQV A;  2NPS C;  1J1E B;  1L0N E;  1BCC J;  1ZRT D;  1SQP K;  1LGH B;  2R44 A;  1LWU A;  3CCV P;  5DJU B;  3WU2 H;  3A0B H;  3H1K G;  2QVA A;  1K8A Q;  4DJG A;  3BCC D;  2CK3 H;  3OJA B;  1A02 J;  1NVO A;  2E5T A;  1SQV G;  3MTU E;  1K04 A;  5CCG D;  4JBZ A;  1BCC E;  3E1R A;  1IFJ A;  3L75 D;  2KP8 A;  1LP1 A;  3GHG B;  5TJH A;  2ZT9 B;  5AW9 B;  1URQ C;  5CCG C;  3CC7 P;  1SQX G;  4I7Z C;  4PJ0 H;  1S4X A;  2XU6 A;  3SWK A;  1EDL A;  2A45 G;  4JQ0 D;  1HUC A;  4KHX A;  3A0H E;  3O6Q B;  3WUU A;  4IL6 E;  3SSU A;  5H2F H;  2YMY A;  3FX0 A;  3I56 P;  1PP9 D;  4H13 D;  3C8V A;  3CL3 D;  5KAI E;  1FJK A;  4W7Y A;  2FY8 A;  2QA4 P;  4AUW A;  1T8Z A;  1VDF A;  4H13 C;  3C1L A;  1BDC A;  2FYU G;  1SS1 A;  1SVF A;  1LTA C;  3GG2 A;  2WPS A;  1R8E A;  1EZV I;  3SWY A;  4WBA A;  1L4A B;  1WMK A;  3A2A A;  1KIL E;  3H1K D;  2HPC A;  1S5L E;  3RL0 D;  2FYN B;  1BDD A;  2P1J A;  2Q1K A;  4R4L A;  2AXC A;  1EQ7 A;  1SQV D;  4HKZ H;  2B89 A;  5KLV K;  1LTB C;  1FAV A;  1RE4 C;  1KN7 A;  5AW2 B;  1NTM D;  3Q2Y A;  3KPE A;  2UWJ E;  4IFM A;  1KB9 E;  1Q90 D;  2G8Y A;  2DW3 A;  1SQX D;  3O8Z A;  1URQ A;  3CWB E;  2XDJ A;  1JCD A;  5KLV D;  3BAS A;  2PFX A;  1JNM A;  4N78 D;  3H1L D;  4GIF A;  4UB8 H;  4WY4 D;  3HD7 D;  2Z5I A;  1SQB K;  3CX5 D;  3CXH H;  1FS0 E;  3FWL A;  4EDF A;  1FZC B;  1AQ5 A;  1KYO E;  3V2R A;  2Z5H A;  3Q5S A;  4WY4 C;  4OGQ D;  3NMD A;  2WPQ A;  4HJG H;  1M57 D;  1RF0 C;  4NPD A;  1S9K E;  2R32 A;  3H1I G;  1SQB D;  2FYU D;  1IFN A;  2KZI A;  3H1J G;  2KLU A;  1KQF B;  1OW7 A;  1JY3 P;  3HTK B;  2HYN A;  5B5E H;  1K05 A;  2JDI H;  4PV1 B;  1X8Y A;  3CCM P;  2NRG A;  1R5S A;  1LWU B;  4EI2 A;  1FDO A;  3BCC E;  2Q3E A;  2E5Y A;  3IR9 A;  1LTJ C;  2FFD C;  1JY3 N;  4C7N A;  1VQ6 P;  5GTI E;  1FZA A;  1RE4 A;  1S72 P;  1ZXG A;  5AVQ B;  4L73 A;  3R4Y A;  2AEJ A;  4U3F J;  5APY A;  5APQ A;  1L0L G;  2E74 D;  2J5U A;  2E75 B;  1RE3 A;  1FOS E;  2KB7 P;  3N4X A;  3V2Q A;  1KQS O;  3ITK A;  1YQ3 C;  3AEC C;  1FE6 A;  1GL2 B;  4L76 A;  2BEQ D;  3KQG A;  1PP9 E;  4U3F E;  1FZE A;  2I8D A;  1RF0 A;  4MN4 C;  2WT7 A;  3CCS P;  3F89 A;  2W27 A;  1J1E C;  3RBZ A;  1KYO H;  3IN6 A;  2G3A A;  2NPS B;  1JM0 A;  1RHZ B;  3LID A;  1ZME C;  3AE9 C;  1VQM P;  3P7K A;  1PGQ A;  1BSH A;  1MUU A;  2HPC B;  3KXD A;  1YI2 P;  3T97 B;  2YKP A;  1SQV E;  2ZT9 D;  1LTJ A;  2FFD A;  4WWI A;  4OH8 B;  3C9I A;  4I2L C;  3USS A;  3V6I A;  3II6 A;  3P8M C;  4I6M C;  1SQQ K;  3CC2 P;  2QJY C;  3RL0 g;  4XE5 B;  4JYC A;  3PHL A;  1SQX E;  4IFD K;  2CPB A;  1HGZ A;  1YTZ I;  4JF7 A;  4EIJ A;  5GTI H;  1URQ B;  5AW7 B;  4YTP C;  1YTZ T;  5CCH A;  2M3B A;  2WSF J;  5AVV B;  4I7Z B;  3L36 A;  1JTH B;  1NO4 A;  2XV5 A;  1KB9 I;  3WMM 0;  4PD4 E;  3VP9 A;  1G2C A;  4GOE A;  1EDJ A;  3RBX A;  3GMA A;  1LTT C;  2FYZ A;  1L4A D;  2WPR A;  3EFG A;  5AVU B;  1W2B O;  2YIU C;  2WWW A;  3CCU P;  4BRY B;  4H13 B;  1OMI A;  1E79 H;  1RH5 B;  3RGU A;  1IFD A;  2FYN C;  3BAT A;  2QM7 A;  3L4F A;  2BCC G;  3KZI E;  3G4S P;  2V4H A;  3RK2 C;  4AQR D;  1PFI A;  1QLE D;  1HWT C;  3A7O A;  3JSV C;  1NH4 A;  4C7N B;  3PJS K;  1AV1 A;  5AVZ B;  2QSI A;  2YMK A;  3M9B A;  4W80 A;  3L73 J;  3M06 A;  3HRN A;  3H1I J;  2W6A A;  4ASW A;  4U7J A;  3W68 A;  1NU1 G;  3H1J J;  1HTL C;  4TT3 H;  1Y8A A;  1FZC C;  2CPS A;  2O01 H;  1OW8 A;  3M9Q A;  3L73 E;  3CXH D;  4C7R A;  2XND H;  3CC4 P;  1DIP A;  1EZV E;  3H1I E;  4WY4 B;  1HF9 A;  3MUD C;  5APU A;  3H1J E;  2OYH A;  2IBZ G;  1WT6 A;  2AEF A;  2HOD A;  2QM8 A;  1YQ4 C;  1PL5 A;  2BCC D;  2P58 A;  3K5B A;  1NTZ J;  4DCK A;  1L0L J;  2ZYD A;  2M0B A;  3H1H G;  2R3S A;  4XA4 A;  2RN0 A;  1LTJ B;  2FFD B;  3HE5 B;  3H25 A;  3JCU H;  4I1L A;  1KZU B;  4ZNC A;  2KSJ A;  2KOG A;  2E75 D;  4CPG A;  2ITA A;  4LGD E;  1NTZ E;  1U7M A;  2WSC J;  5AW8 B;  1SQP G;  3L75 G;  3CCE P;  2OYI A;  3CI9 A;  1L0L E;  1ZLL A;  1NU1 D;  1OWA A;  2FXM A;  1N86 A;  1NTK J;  1T3U A;  3I5C A;  2OTJ P;  2PGD A;  2ZYG A;  1ZW0 A;  3G9R A;  4EYY Q;  1CW5 A;  2A45 I;  1G2C B;  3MUD A;  2B9B A;  2WIT A;  3CX5 I;  1XTG B;  3D6Y A;  4OWF A;  1HVV A;  1MV8 A;  1YJ9 P;  3SFE C;  1LNQ A;  5CHX A;  2JO1 A;  2N9Y B;  2IFM A;  3V5B A;  4PD4 I;  2C0X A;  2GA1 A;  3V2N A;  2E76 D;  1DX7 A;  3TGU D;  1JY3 O;  3GF3 A;  1DD3 A;  2YNY A;  1S3J A;  3MGN A;  3RK3 C;  4Z1M H;  4BXL A;  3FGA D;  5GTH E;  2FKW B;  3CD6 P;  3H1H D;  3IFM A;  2E76 C;  3TNU A;  2ZJS E;  3AEE C;  3L74 G;  4WB4 A;  3D71 A;  2IPP A;  2B87 A;  4UB6 E;  3PH0 A;  1PZQ A;  1GW4 A;  1URQ D;  1RY3 A;  2XKM A;  1SQP D;  1QX8 A;  1PPJ D;  1MFZ A;  3JC2 2;  5APV A;  2R3C A;  1OW6 A;  2QJY B;  1NTM G;  2IYO A;  3PRJ A;  2QJP C;  4IFF A;  1Y9B A;  2POH A;  5KLV G;  4BWN A;  2WSE J;  2M5A A;  4KT0 J;  2WTY A;  1YJW P;  1J1D C;  3H1L G;  1D7M A;  3D6Z A;  3L71 J;  2IZ1 A;  2P7J A;  1GD2 E;  3HUS A;  3A3Y B;  5BVZ A;  5TIS H;  1FJP A;  2XZR A;  4D6T D;  2YIU B;  1SQB G;  2N1T C;  5KAF E;  2Y9Z A;  2WZ7 A;  2KNC B;  2HOD B;  2BCC E;  1JO5 A;  4H44 D;  1OX3 A;  3U1A A;  3L71 E;  1X79 B;  1KFN A;  4RJT A;  3L74 D;  1HJ0 A;  3LW5 J;  3CWB J;  4H44 C;  3RK2 B;  1SFC C;  2OGU A;  2LKM A;  3U1C A;  3AE1 C;  1FOS F;  2W6B A;  1EDI A;  1IFP A;  2YO2 A;  4AYC A;  2H88 C;  2QIW A;  2Y9Y A;  2AXT E;  4W7Z A;  2V7Q H;  1T6A A;  4LC1 A;  1JMM A;  3AE6 C;  3AEG C;  2KZJ A;  4IL6 X;  1PV3 A;  1QVG O;  2RH0 A;  3PTZ A;  2ZYA A;  3S4R A;  2Q5U A;  1RE3 C;  2JKV A;  1VQP P;  2KYV A;  3PLN A;  2WPV B;  3GLM A;  2B88 A;  2A06 E;  2IBZ E;  3AE5 C;  3A0H H;  4NPE A;  1S5L X;  4IL6 H;  3BCC J;  4WVZ A;  5KAI H;  3CLQ A;  2N1T A;  1IK7 A;  4JYB A;  4TLF A;  1ZRT E;  1ZOY C;  1AQT A;  2JEE A;  5K5G B;  1Q7Y Q;  1AFO A;  3QH9 A;  2O3J A;  2M3E A;  1QL2 A;  1DH3 A;  1FU1 A;  3VMX A;  5KJ7 A;  2FBW C;  1VPC A;  3M9H A;  1SFC A;  4A7P A;  3PP5 A;  1IK9 A;  1S5L H;  4GT1 A;  2OYO A;  1XTC C;  3L75 E;  1QVF O;  1BGY G;  2NZ2 A;  1G1I A;  1P84 D;  1VQ4 P;  1LP1 B;  4L75 A;  1WRG A;  3B5N C;  3CME P;  1PP9 J;  1ZV8 A;  1BE3 G;  3EWK A;  3TF5 A;  1LTG C;  5CCH C;  4O9B A;  2HG5 D;  2YKO A;  1KB9 H;  1PIX A;  4HB1 A;  3L70 D;  2H89 C;  2K37 A;  3H32 A;  1N7L A;  3A5T A;  1PGP A;  1SQQ G;  1LTS C;  1YJN P;  2OTK E;  4QMA A;  1OZH A;  2O1J A;  1H0T A;  3GF7 A;  5KLI C;  3H1K J;  4H0L D;  3L37 A;  4M3L A;  4HYT B;  5AVX B;  1USE A;  2JJL A;  1ZR2 A;  3V2P A;  5B66 E;  1SQV J;  4H0L C;  1W5C E;  1GK4 A;  3P8C D;  3F5H A;  1ZR4 A;  2RKL A;  1HGV A;  1NTM J;  5AVS B;  3H1K E;  1UIX A;  3AE7 C;  1LT9 A;  1HBW A;  4R4M A;  3L74 E;  3RK3 B;  4RO0 A;  1SQX J;  3OAK A;  2HLO A;  3VN0 A;  1JY2 P;  1N7S A;  3HE4 A;  2H7H A;  3VOP A;  2Q3I A;  5KLV J;  2E76 B;  5AW1 B;  1EC5 A;  3H1L J;  3SFD C;  1BGY D;  1NTM E;  1EDK A;  2W83 C;  2QG4 A;  1NTZ K;  1NKZ B;  1Q86 Q;  4ZMD A;  1BE3 D;  1L0L K;  2YO3 A;  3B5N A;  1LJ2 A;  3TYY A;  1MFT A;  1KMI Z;  5KLV E;  3MD0 A;  1NWQ A;  4N78 E;  3H1L E;  2QJP B;  1SQB J;  1SQQ D;  2FYU J;  1JCC A;  1H88 A;  3CX5 E;  3FXE A;  2IDB A;  1BCC G;  1M56 D;  1J1D B;  3FWN A;  2H8P D;  3CCL P;  2I1J A;  1KD1 Q;  1NTK K;  1KV4 A; 
#chains in the Genus database with same CATH homology
 1KOR A;  1VF5 B;  3H25 A;  4H13 D;  3C8V A;  3Q5P A;  1ZME C;  3AE9 C;  3D70 A;  3GF7 A;  1FDI A;  5KLI C;  2ZT9 C;  2E75 D;  1JB0 J;  2BEZ F;  1DD4 A;  1KQF B;  1OW7 A;  3B71 A;  4H0L D;  2QJP C;  2WSC J;  1Y9B A;  1K05 A;  4PV1 B;  1MKM A;  1U57 A;  2WPV B;  3GLM A;  3Q5R A;  3T97 B;  2E74 B;  2WSE J;  3O6Q A;  4H13 C;  3AE4 C;  4KT0 J;  2QSI A;  2WQY C;  2ZT9 D;  4H0L C;  1VF5 D;  3IAO A;  2YMK A;  4Y28 J;  3AEB C;  3AE5 C;  1R8E A;  2FXP A;  1EXI A;  1S5L X;  2V7Q J;  4XFJ A;  3Q1M A;  3AE3 C;  1WMK A;  1RQV A;  1FDO A;  2QJK C;  2QJY C;  1KIL E;  4GDO A;  3RL0 g;  3D6Z A;  5M1B A;  4PV1 D;  1UIX A;  1VF5 C;  2K9Y A;  3AE7 C;  4U7J A;  1KTM A;  4R4M A;  4H44 B;  2JP3 A;  1IK7 A;  3G9R A;  4R4L A;  2P10 A;  1AJY A;  4TT3 H;  1ZRT E;  1ZOY C;  1NGM B;  4OGQ B;  4PV1 C;  4YTP C;  2E76 B;  1OW8 A;  2E74 C;  2WSF J;  1VL2 A;  4I7Z B;  3R4Y A;  1KQG B;  3D6Y A;  3SFD C;  2D2C B;  1DIP A;  2FBW C;  4H44 D;  3SFE C;  2JO1 A;  3Q2Y A;  3Q3D A;  3AE8 C;  3AEA C;  3AEF C;  5L8R J;  3RK3 E;  1HF9 A;  2E74 D;  1Q90 D;  2E75 B;  2J5U A;  1RQU A;  2G8Y A;  1K04 A;  1HJ0 A;  2E76 D;  3LW5 J;  3GF3 A;  4H44 C;  1DD3 A;  1KMI Z;  1S1C X;  3AE1 C;  4Z1M H;  1YQ3 C;  3GMA A;  3AEC C;  2NZ2 A;  5KKZ C;  2MKV A;  3FGA D;  1YQ4 C;  2BEQ D;  2ZT9 B;  4OGQ C;  2OQQ A;  1PL5 A;  2E76 C;  2H88 C;  2QIW A;  3AE2 C;  2YIU C;  1GMJ A;  3EWK A;  3S9O A;  3ABV C;  4RKU J;  3AEE C;  2IDB A;  4I7Z C;  3D71 A;  4H13 B;  3AE6 C;  3AEG C;  1ZP0 C;  1EXJ A;  2D2C C;  1OMI A;  1TU3 F;  4H0L B;  2O01 J;  4IL6 X;  3Q5S A;  4OGQ D;  1PV3 A;  3AED C;  1PIX A;  2H89 C;  2E75 C;  4YXD C;  3IN6 A;  2FYN C;  2G3A A;  1OW6 A;  1NYH A;  2D2C D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...