2FXPA

Solution structure of the sars-coronavirus hr2 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
55
structure length
55
Chain Sequence
GSHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the severe acute respiratory syndrome-coronavirus heptad repeat 2 domain in the prefusion state
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords Spike glycoprotein
total genus 14
structure length 55
sequence length 55
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.790 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2fxpA01
2BEQD 2FXPA 2BEZF
chains in the Genus database with same CATH superfamily
1NTME 1GL2B 1WRGA 2NPSD 1ZXGA 1IFMA 2QJPB 1FOSE 3L72E 3I55P 3HE5B 1NAFA 4JF7A 3MUDA 1SQXG 1NJIQ 2OYIA 1SQXE 1N7SD 2P67A 3C1LA 5KTBA 4TT3H 4OGQB 3HD7B 1JY2P 4ASWA 1S9KD 1SQBK 3CCSP 3CCVP 2WSFH 1AA0A 3AEBC 4W80A 4L76A 2WITA 1OX3A 1SQXJ 5B5EE 2ZAEB 3ITKA 3I56P 5GTHE 1GU5A 1VF5B 2FYZA 1IJDB 1SVFA 2B88A 2Y0DA 1SQXD 2DW3A 3AE6C 1CW5A 2A06E 1JCDA 1AQ5A 1N2DC 1NAYA 4XFJA 2N1TB 4B86A 2BCCJ 2L91A 5CCGA 1DH3A 3CC7P 1W2BO 3JCUE 5BU8B 1NKNA 1HH0A 1LTJC 2C0WA 2P10A 2QJKB 2ZXXA 1URQA 1D7MA 2OARA 1YBKA 2IDBA 4N78D 1OWAA 3QH9A 2O1KA 1NKZB 1LNQA 2R3SA 2E75C 3NTNA 5KJ7A 4C7RA 1CSBA 3V2PA 1OZHA 4D6TJ 5E79H 1P84I 2E75B 2R5DA 2ZVOB 5KAFH 2IFNA 3CCRP 1XTCC 5K5GB 1GTWA 1U57A 2XZRA 1SQPE 2WT7B 2W8ZA 3SSUA 1ZV8A 3RK3C 1KILA 2HODB 2M3BA 2XU6A 1LJ2A 4EOTA 2Z4EA 1NU1J 2NPSC 4I7ZB 2H43A 1LWUC 3CWBD 4DZOA 2BEQD 4DOJA 3B5NB 5AW3B 1NU1D 1S9KE 1S1CX 1VPCA 4JYCA 3CX5E 4JPZB 1LTGC 1SFCC 1M1JB 2LR2A 1KB9H 4H13D 3R4YA 1IFDA 5AVSB 3WU2H 3TGUJ 2OYHB 2A45G 3AE2C 5KLVD 3VMXA 1LTSC 4UB8H 1IK9A 2A06D 4PJ0H 3TDKA 1BSHA 1N7SA 1GK4A 2W6AA 3L73G 4WY4A 3L70G 3H1IG 1RE4A 1L0LJ 1MKMA 2N1TD 1VL2A 1KN7A 2QRXA 3SWKA 3H1LJ 2E5YA 2Z5HA 1NTKD 1L0LD 2KI7B 1GMJA 2QJPC 1KYOI 2JP3A 2R5BA 1KB9I 3CX5D 4IL6H 1L0LK 5L8RJ 4DCKA 5KLVG 2JJLA 1GL2C 1ZP0C 5C39A 5E79E 1NTKJ 2N9BA 4HKZH 1N73B 4IFFA 3MUDC 3L73D 4H0LB 1SLQA 2O3JA 3CPWO 2P58A 2OYHC 2PRRA 4C7NB 3CD6P 1DD4A 1PZQA 1J1DC 5AVYB 1SQPD 1PGJA 2NZ2A 2G3AA 3HD7D 2IYPA 3P8CE 3JCUH 1BGYE 1Q81Q 2OYHA 1BGYG 4RJTA 1SQPJ 2YKQA 1SQQE 3AE1C 1NU1K 2OTKE 1LT9B 2YO2A 4EDFA 2KNCB 5AVRB 2Q5UA 5TJHA 2Q3IA 3N7NA 3C8VA 4NPFX 2FYUD 1YITP 2GM4A 3A3YB 3HTKB 2BASA 4GT1A 1MV8A 4N78E 3KDPB 1Z56A 5AW6B 5CCGC 3SFEC 3L74J 1QVGO 2C9LY 2E76C 4WVZA 4WWIA 2RN0A 4U3FG 1URQC 2JO1A 3M06A 3WUTA 2IBZG 2LKMA 3Q5SA 2M3EA 1Q86Q 3F5HA 1H88A 5KJ7C 2BCCE 4AUWA 2WSCJ 3AEFC 2ZYDA 1LGHB 3B8EB 4GKGA 4H0LD 2HPCA 3L70E 3D70A 3H1HE 4IL6E 1YIJP 1NU1G 2IYOA 3IN6A 2ITAA 3MP7B 4QMAA 3T97B 3MGNA 2E74D 2XNDH 4IOIH 4U3FD 2J5UA 3BRTB 3AE4C 4WBAA 5GTIH 1YJNP 4NPEA 1EDIA 1NGMB 2IBZD 1KILC 3L71D 1MFTA 2V4HA 3RK2D 3WUUA 3CI9A 2NPSA 5EFWB 3VYIA 3Q1MA 1ZR4A 1AQTA 4UB8E 2D2CD 3RK3B 2O01N 2YXQB 2N1TA 4EI2A 3VMAA 3WU2E 2NRGA 1IFJA 2BCCG 4WY4D 3TNUA 1JEKA 1GZLA 2KNCA 2OYOA 2WMMA 1L4AC 2IFMA 3B4SA 3G6EP 1L0LG 1SFCA 3E7KA 3CCMP 2HYNA 2C0XA 3H32A 3BRVB 5AW4B 1EZVI 1TU3F 1GD2E 4H13B 3GF3A 5KAIE 4WY4C 1EDLA 3LW5H 1USEA 1IC2A 2K9JB 1KYOE 2W6BA 4M3LA 1X0TA 1QVFO 1JY2N 2UWJE 1RHZB 3PJSK 2M0BA 2YKOA 1J2JB 2E42A 4U3FE 3H1KJ 3VOPA 1IZNB 2WTYA 3VP9A 1GL2A 2IPPA 3L36A 1OXZA 3L75D 2K9YA 3CCUP 1M1KQ 3H1HD 1SP4A 1FDMA 4KHXA 2D2CC 2ZFCA 2FYUG 1SQVJ 5CCHA 3GW6A 4U7JA 1SQVE 2FYUK 3LW5J 2M8RA 1EC5A 1NTKG 3HE4B 3PH0A 1LTIC 4GDOA 4YPCA 2B87A 1L0NE 3OAKA 1S5LX 1URQD 3SWFA 2Q9IA 2RH0A 3GMAA 3RK2B 1KFMA 1S3JA 2BEZF 1L0NK 3I5CA 3HRNA 2K3RA 1SFCB 2R44A 3TF5A 2KLUA 4U3FJ 2FYUE 1K05A 3NFQA 3BCCE 1PGPA 1Q2NA 1SQVK 2LXBA 1QEXA 4OGQD 2PP6A 3TNUB 2HG5D 4LC1A 2I1KA 3G9RA 3H1KE 1SQPG 4HH2A 1OVVA 1SQXK 3AE9C 3H1JE 3LIEA 1S2EA 3L72G 4HJGH 1NVOA 4YXWH 1PIXA 3P8CD 1VF5D 3M0AA 3ZDMA 1CZQA 2H88C 2ZT9C 1RE3C 2HLOA 1VQOP 1HBWA 1HTLC 1KB9D 1NTMK 1KYOD 1BCCJ 3CX5I 3CWBG 3EQ2A 3H6PA 1FBMA 3RL0D 2FXPA 4Z1MH 3PTZA 3CC4P 2GA1A 3L73E 2QG4A 2WQYC 3V5BA 3KYQA 4R4LA 3TK1A 1A02J 4OWFA 3MTUE 3TSIA 3VMYA 3KHUA 5B66E 1EZVD 2FXOA 3RL0C 3Q3DA 1OVUA 3AE7C 2JWAA 2WSEH 3B5NC 1J1EC 3M9BA 4K3AA 1FZCB 2A06G 5CBOA 2WT7A 2MJZA 5CHXA 3L70D 3P8MC 2N1TC 2R3CA 1GW3A 1PP9E 4H44C 1G2CA 3CC2P 1KC8Q 3H1HJ 3GF7A 1FC2C 4K35A 4Y99B 1L4AA 2V7QJ 3Q5PA 1JB0J 3CXHI 5KLVK 4O9BA 3H25A 2ZT9B 1HJBA 1VF5C 1SFCD 3M0DC 4GOEA 1OFCX 4IL6X 1EXJA 2JEEA 3KZIH 5BU5A 1NHLA 4KJMA 1JY3N 3CWBE 2AEMA 2PAJA 3HD7A 5AW2B 1HGVA 1SQQD 3FXDA 2AXCA 1M90Q 1EDJA 3L74E 1HVVA 2H8PD 3RBXA 1CI6A 1KQSO 3CXHH 1OIPA 1FDOA 1BGYD 1RQUA 1SQQJ 3CL3D 2KP8A 2V7QH 3H1IJ 5BVZA 5TISH 2QSIA 1NH4A 1IFNA 1NTZJ 2LXCB 3G3ZA 4L74A 3KQGA 5APTA 1S5LH 1BGYJ 2K1AA 1JTHA 1KQLA 3CXHE 2WSSH 1MUUA 3A0BE 3AEEC 1E5WA 2Y0EA 5CCHC 2YKPA 1LTBC 1JY3O 1X22A 1S4XA 1T6AA 1SQQG 2FYNB 3EWKA 3FXEA 4RESB 4N3YB 1M57D 4C7NA 1YTZT 3HE4A 3PHLA 3HUSC 2WPVB 1SQQK 4WB4A 1YI2P 3A5TA 4OH8B 1NTKE 3H32B 4YXDC 1LP1A 2E74C 2XKMA 4UB6H 1M7LA 2CPSA 1FDIA 2KXPB 2OTLP 2JKVA 1LT9A 1NYHA 1UIIA 2WPRA 1AVOA 5AVTB 4ZKUA 1YTZI 3RK3D 1PFIA 3G71P 2OGUA 4BRYB 1T2KC 4HB1A 1H0TB 5CBNA 1AVYA 1LWUB 2Z5IA 3L35A 5KLVE 3L71E 3P7KA 1T2KD 3H1LE 1VQKP 1U7MA 5KLVJ 2XV5A 3IF4A 4PV1D 3V2RA 1L0LE 2AEJA 2WPQA 2KS1A 1DD3A 3F89A 2CPBA 5KAFE 1RE3A 1VQLP 4RKUJ 1HJ0A 1U7JA 5CJ0A 2XDJA 1NOHA 3D6ZA 2KOGA 2Q7CA 3A0BH 1OW6A 1QL1A 3C9IA 4JQ0D 2HPCB 1CI6B 2FY8A 3SWYA 2BCCD 2QM8A 4HYTB 3OJAB 5AW9B 3USSA 3U1AA 1KZUB 3L72D 1VQ8P 2K37A 1JO5A 5KKZB 4H44D 2VRSA 2FFDB 5CCHD 2E76D 2JR8A 2YMYA 3CCLP 1GW4A 3KXDA 3BVHA 1LT1A 1KILB 2HODA 3B5NA 3RGUA 2M5AB 2ZXEB 3CMEP 3D6YA 2FKWB 5KLIB 1USDA 2NPSB 2A45H 1P84H 1FU1A 1E79H 3PRJA 1PP9G 2ZYAA 5AW1B 5KJ7D 1M1JA 1IFPA 4UB6E 1EZVG 1GL2D 3O8ZA 5KKZC 1SQPK 3M0DA 1VQ9P 1FS0E 3W68A 5CJ4A 1PL5A 1LTJB 1VDFA 3FGAD 3H1HG 3CWBJ 3L75G 1T3UA 3R2PA 1ZLLA 3AEDC 2Y0CA 1BE3G 3B71A 3RK3E 5H2FH 3HD7C 5DJUB 2ZYGA 3S1KA 1FZEA 2YNYA 5B66H 1VQPP 3QWOC 2OQQA 5TISE 4BWNA 1YJ9P 1VQ6P 3O6QB 2QIWA 1VQMP 3AEGC 1J1DB 3AE5C 4OVNF 2AXTH 3V4QA 1JY3P 1KQFB 3V2QA 5H2FE 1HF9A 2FYNC 1NTKK 4OGQC 3S4RA 1VQNP 3HUSA 4MN4C 2M5AA 1KTMA 2YIUB 1GU4A 3GG2A 4C46A 2O01H 3MIWA 2I8DA 3IR9A 1SS1A 1NTMG 3L72J 1N7LA 1FZAA 3L73J 2E74B 3H1LD 4I2LC 3U59A 3V2NA 3H1JG 1YHQP 1LT9C 1PGOA 1AFOA 2W83C 2C9NY 3IFMA 1ZOYC 2ZVNB 3BCCG 1NTMJ 4GODA 2WPSA 2E75D 3BATA 3M91A 5AVUB 5GTHH 1N7SB 4IFDK 2YMKA 2WSFJ 3CMAP 1R5LA 3Q5RA 2A45I 2QE7H 3H1JJ 1NTZG 1JTHB 4CPGA 4H13C 3IAOA 3ABVC 4PD4I 4XE5B 4D6TD 4ZMDA 5GTIE 1AJYA 3H1JD 3II6A 1LTAC 1OMIA 2PFXA 2Q3EA 3BCCJ 2FYUJ 1Y9BA 2AEFA 3NXSA 1RF0C 2D2CB 1ZR2A 1WT6A 1YJWP 1N73C 1RF1A 1L4AD 2WZ7A 1K8AQ 1LTTC 3FWLA 3EFFK 1RQVA 4GOFA 1L0NJ 1KD1Q 1BDCA 1FJPA 1VQ4P 3N4XA 2QVAA 1KV4A 2KZIA 4PV1B 2K88A 2YIUC 3WUVA 2JDIH 3KPEA 1A02F 1SQBG 3RL0g 3GHGA 1KYOH 2POHA 1KILD 4I6MC 3RL0B 3P32A 3D71A 1JNMA 1N86A 1PPJE 3TGUD 1WMKA 1EDKA 4Y99C 1X8YA 1KORA 1M1JC 2KSJA 4KT0J 4BRYA 1G1JA 4H44B 1GDTA 1KMIZ 1MFZA 2GUSA 3OA7A 1P84E 3JC22 2WWWA 2E43A 1VQ5P 1K04A 1ZRTE 1YQ3C 1SQBD 1EZVE 2QJKC 1X79B 2P1JA 1OW8A 2GUVA 1URQB 2WSEJ 4GIFA 4W7ZA 2AXTE 3BASA 5APVA 1HGZA 2QJYB 2QJYC 3NMDA 3TGUG 1PP9D 1FZGA 3CCEP 3FWNA 3L71J 1ZW0A 1FE6A 2IZ1A 3AE3C 2KK7A 1PGQA 2IX7C 1HUCA 2Q6QA 3V6IA 4ZNCA 4L75A 1K73Q 1OW7A 1R5SA 2WVRA 1NTMD 1BE3J 1GK6A 1RH5B 3E1IA 4JBZA 3WMM0 5DJTB 2JWDA 1Q7YQ 1QLED 4LGDE 2B87B 1BE3D 3H1KG 5AW5B 4I1LA 2Y9ZA 4EIJA 5KLIC 3T97A 1JMMA 4ZKPA 1QX8A 1EXIA 1PPJG 3BCCD 1FZCC 1DEBA 5AVZB 2O1JA 3CXHD 1M8OB 1PV3A 3HTKA 4N6JA 4EYYQ 1QL2A 3A2AA 2QEXP 2OTJP 4H0LC 4PJ0E 2FFDC 3AEAC 1SQBE 1NO4A 3L75J 1IFIA 1L0ND 1LP1B 1T3JA 3L70J 5M1BA 1NTZE 1RY3A 4PD4E 1W2EA 2L5GB 3H1IE 3L74D 1SQVD 1FOSF 3VMZA 3HUSB 3UIAA 1DIPA 2J58A 3MHVA 4L73A 5APQA 5AW7B 4ASVA 1S72P 1QGKB 1Y47A 1NTZK 1FZBA 1YQ4C 1JUNA 1FAVA 5APSA 4WY4B 1KILE 3LIDA 5AVQB 1G1IA 3O6QA 1H89A 1S5LE 2ZT9D 3L74G 2W90A 1SQVG 1RF0A 4RO0A 1SQBJ 3PLNA 1N73A 3MZWB 1RF1C 1H8AA 1RF1B 2KYVA 3G4SP 3HE5A 3RBZA 2H7HA 1G2CB 4DJGA 2OYIC 1IO4A 2KB7P 2K9JA 2P2UA 3L75E 3H1ID 1DEEG 3PP5A 1L2PA 1PP9J 1NTZD 4I7ZC 2W27A 3KZIE 1JCCA 4D6TG 5APUA 3GHGC 5AW0B 1BCCD 1ZN5A 1Q82Q 2CK3H 4XA4A 3SFDC 2MKVA 1M56D 1Y8AA 2G8YA 5AVVB 1JY2O 3FX0A 4DT0A 1ZMEC 3MD0A 2WSCH 3Q2YA 1HWTC 3A7OA 1NWQA 1L4AB 2QA4P 1XTGB 2QM7A 1EQ7A 3L37A 1BSNA 1FJKA 2I1JA 2SPZA 1KB9E 4YTPC 1BE3E 2FBWC 2H89C 4PD4H 3VN0A 5CCGD 3CX5H 2RMZA 1BCCE 5APWA 1BCCG 1ZRTD 4BXLA 5B5EH 2E5TA 4LLHA 1P84D 2HFED 1LTJA 2B9BA 3GLMA 1YYCA 2YXRB 3H1KD 1T8ZA 2Y9YA 4W7YA 1K9MQ 2O01J 2R32A 4AQRD 3AE8C 1VQ7P 1PPJD 4IFMA 4Y28J 3JSVC 2P7JA 3L4FA 3TGUE 3CCJP 5AVXB 3M9QA 5APYA 1R8EA 3B5ND 2IBZE 3AECC 1OVRA 4TLFA 2KUBA 1DX7A 3H1LG 3CLQA 3VTPC 4NPDA 3E1RA 3GHGB 2PGDA 2KZJA 1NU1E 1AV1A 3U1CA 4AYCA 3OW2O 1IK7A 2B89A 2KSEA 3K5BA 1FZCA 1J1EB 2KIKA 2OYIB 1JM0A 1LWUA 2ZJSE 1KFNA 5KAIH 2HR3A 4PD4D 2XNXA 2YO3A 4R4MA 2FFDA 1FZFA 1H0TA 3A0HE 3V4WA 4D6TE 2J59M 1UIXA 4A7PA 3RK2C 2W6JH 3EFGA 1N8RQ 2Q1KA 1JOCA 5APXA 3A0HH 3M9HA 5AVWB 3L71G 2KLVA 5AW8B 2IBZI 1JMBA 3W67A 4JYBA 2RKLA 1KQGB 1N7SC 1W5CE 1Q90D 2IZ0A 3VP8A 3CCQP 1MZ9A 2FXMA 3S9OA 1RE4C 2KS1B 2E76B 5CMZA 1L0NG 4PV1C 3TYYA 1BDDA 1X9VA 2N9YB
chains in the Genus database with same CATH topology
2J5UA 3AE4C 4YXDC 1OW8A 2E74C 1NGMB 2WSEJ 1FDIA 3Q1MA 1NYHA 2QJYC 2D2CD 3T97B 4TT3H 3AE3C 4OGQB 3D70A 1OW7A 3AEBC 4PV1D 1DD3A 4RKUJ 1HJ0A 1TU3F 1VF5B 3GF3A 4H13B 3D6ZA 1OW6A 5KLIC 1EXIA 3AE6C 1PV3A 4H44D 4XFJA 4H0LC 2E76D 3AEAC 5M1BA 2P10A 3D6YA 2IDBA 2K9YA 1DIPA 2D2CC 2E75C 1YQ3C 4U7JA 1YQ4C 3LW5J 4GDOA 1KILE 2E75B 1S5LX 3O6QA 3GMAA 1U57A 1PL5A 2BEZF 2ZT9D 3FGAD 3AEDC 1K05A 3B71A 3RK3E 4I7ZB 4OGQD 2BEQD 3G9RA 1S1CX 3AE9C 4I7ZC 2OQQA 1PIXA 1VF5D 4H13D 3R4YA 3SFDC 2MKVA 2G8YA 2H88C 2ZT9C 3AE2C 1ZMEC 3Q2YA 2QIWA 3AEGC 3AE5C 2FXPA 1KQFB 4Z1MH 4YTPC 2WQYC 1HF9A 2FYNC 4OGQC 4R4LA 1MKMA 1KTMA 1VL2A 2FBWC 2H89C 5KKZC 1GMJA 2QJPC 5L8RJ 2JP3A 3AE7C 3H25A 3Q3DA 2E74B 1ZP0C 3GLMA 2O01J 4H0LB 3AE8C 1ZOYC 4Y28J 4H44C 2E75D 3GF7A 1DD4A 2V7QJ 2YMKA 2WSFJ 3AECC 3Q5PA 1JB0J 3Q5RA 2NZ2A 2G3AA 2ZT9B 1VF5C 3IAOA 3ABVC 4H13C 1AJYA 4IL6X 1OMIA 1EXJA 1Y9BA 3AE1C 2D2CB 1IK7A 3C8VA 1RQVA 4R4MA 4PV1B 3SFEC 1RQUA 1FDOA 2YIUC 2E76C 1UIXA 3RL0g 2QSIA 2JO1A 3Q5SA 3D71A 3AEEC 2WSCJ 3AEFC 1R8EA 1KQGB 1WMKA 4H0LD 1Q90D 1KORA 4KT0J 3EWKA 3S9OA 4H44B 1KMIZ 2E76B 3IN6A 2WPVB 4PV1C 1K04A 1ZRTE 2E74D 2QJKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BEQ D;  2FXP A;  2BEZ F; 
#chains in the Genus database with same CATH topology
 1NTM E;  1GL2 B;  1WRG A;  2NPS D;  1ZXG A;  1IFM A;  2QJP B;  1FOS E;  3L72 E;  3I55 P;  3HE5 B;  1NAF A;  4JF7 A;  3MUD A;  1SQX G;  1NJI Q;  2OYI A;  1SQX E;  1N7S D;  2P67 A;  3C1L A;  5KTB A;  4TT3 H;  4OGQ B;  3HD7 B;  1JY2 P;  4ASW A;  1S9K D;  1SQB K;  3CCS P;  3CCV P;  2WSF H;  1AA0 A;  3AEB C;  4W80 A;  4L76 A;  2WIT A;  1OX3 A;  1SQX J;  5B5E E;  2ZAE B;  3ITK A;  3I56 P;  5GTH E;  1GU5 A;  1VF5 B;  2FYZ A;  1IJD B;  1SVF A;  2B88 A;  2Y0D A;  1SQX D;  2DW3 A;  3AE6 C;  1CW5 A;  2A06 E;  1JCD A;  1AQ5 A;  1N2D C;  1NAY A;  4XFJ A;  2N1T B;  4B86 A;  2BCC J;  2L91 A;  5CCG A;  1DH3 A;  3CC7 P;  1W2B O;  3JCU E;  5BU8 B;  1NKN A;  1HH0 A;  1LTJ C;  2C0W A;  2P10 A;  2QJK B;  2ZXX A;  1URQ A;  1D7M A;  2OAR A;  1YBK A;  2IDB A;  4N78 D;  1OWA A;  3QH9 A;  2O1K A;  1NKZ B;  1LNQ A;  2R3S A;  2E75 C;  3NTN A;  5KJ7 A;  4C7R A;  1CSB A;  3V2P A;  1OZH A;  4D6T J;  5E79 H;  1P84 I;  2E75 B;  2R5D A;  2ZVO B;  5KAF H;  2IFN A;  3CCR P;  1XTC C;  5K5G B;  1GTW A;  1U57 A;  2XZR A;  1SQP E;  2WT7 B;  2W8Z A;  3SSU A;  1ZV8 A;  3RK3 C;  1KIL A;  2HOD B;  2M3B A;  2XU6 A;  1LJ2 A;  4EOT A;  2Z4E A;  1NU1 J;  2NPS C;  4I7Z B;  2H43 A;  1LWU C;  3CWB D;  4DZO A;  2BEQ D;  4DOJ A;  3B5N B;  5AW3 B;  1NU1 D;  1S9K E;  1S1C X;  1VPC A;  4JYC A;  3CX5 E;  4JPZ B;  1LTG C;  1SFC C;  1M1J B;  2LR2 A;  1KB9 H;  4H13 D;  3R4Y A;  1IFD A;  5AVS B;  3WU2 H;  3TGU J;  2OYH B;  2A45 G;  3AE2 C;  5KLV D;  3VMX A;  1LTS C;  4UB8 H;  1IK9 A;  2A06 D;  4PJ0 H;  3TDK A;  1BSH A;  1N7S A;  1GK4 A;  2W6A A;  3L73 G;  4WY4 A;  3L70 G;  3H1I G;  1RE4 A;  1L0L J;  1MKM A;  2N1T D;  1VL2 A;  1KN7 A;  2QRX A;  3SWK A;  3H1L J;  2E5Y A;  2Z5H A;  1NTK D;  1L0L D;  2KI7 B;  1GMJ A;  2QJP C;  1KYO I;  2JP3 A;  2R5B A;  1KB9 I;  3CX5 D;  4IL6 H;  1L0L K;  5L8R J;  4DCK A;  5KLV G;  2JJL A;  1GL2 C;  1ZP0 C;  5C39 A;  5E79 E;  1NTK J;  2N9B A;  4HKZ H;  1N73 B;  4IFF A;  3MUD C;  3L73 D;  4H0L B;  1SLQ A;  2O3J A;  3CPW O;  2P58 A;  2OYH C;  2PRR A;  4C7N B;  3CD6 P;  1DD4 A;  1PZQ A;  1J1D C;  5AVY B;  1SQP D;  1PGJ A;  2NZ2 A;  2G3A A;  3HD7 D;  2IYP A;  3P8C E;  3JCU H;  1BGY E;  1Q81 Q;  2OYH A;  1BGY G;  4RJT A;  1SQP J;  2YKQ A;  1SQQ E;  3AE1 C;  1NU1 K;  2OTK E;  1LT9 B;  2YO2 A;  4EDF A;  2KNC B;  5AVR B;  2Q5U A;  5TJH A;  2Q3I A;  3N7N A;  3C8V A;  4NPF X;  2FYU D;  1YIT P;  2GM4 A;  3A3Y B;  3HTK B;  2BAS A;  4GT1 A;  1MV8 A;  4N78 E;  3KDP B;  1Z56 A;  5AW6 B;  5CCG C;  3SFE C;  3L74 J;  1QVG O;  2C9L Y;  2E76 C;  4WVZ A;  4WWI A;  2RN0 A;  4U3F G;  1URQ C;  2JO1 A;  3M06 A;  3WUT A;  2IBZ G;  2LKM A;  3Q5S A;  2M3E A;  1Q86 Q;  3F5H A;  1H88 A;  5KJ7 C;  2BCC E;  4AUW A;  2WSC J;  3AEF C;  2ZYD A;  1LGH B;  3B8E B;  4GKG A;  4H0L D;  2HPC A;  3L70 E;  3D70 A;  3H1H E;  4IL6 E;  1YIJ P;  1NU1 G;  2IYO A;  3IN6 A;  2ITA A;  3MP7 B;  4QMA A;  3T97 B;  3MGN A;  2E74 D;  2XND H;  4IOI H;  4U3F D;  2J5U A;  3BRT B;  3AE4 C;  4WBA A;  5GTI H;  1YJN P;  4NPE A;  1EDI A;  1NGM B;  2IBZ D;  1KIL C;  3L71 D;  1MFT A;  2V4H A;  3RK2 D;  3WUU A;  3CI9 A;  2NPS A;  5EFW B;  3VYI A;  3Q1M A;  1ZR4 A;  1AQT A;  4UB8 E;  2D2C D;  3RK3 B;  2O01 N;  2YXQ B;  2N1T A;  4EI2 A;  3VMA A;  3WU2 E;  2NRG A;  1IFJ A;  2BCC G;  4WY4 D;  3TNU A;  1JEK A;  1GZL A;  2KNC A;  2OYO A;  2WMM A;  1L4A C;  2IFM A;  3B4S A;  3G6E P;  1L0L G;  1SFC A;  3E7K A;  3CCM P;  2HYN A;  2C0X A;  3H32 A;  3BRV B;  5AW4 B;  1EZV I;  1TU3 F;  1GD2 E;  4H13 B;  3GF3 A;  5KAI E;  4WY4 C;  1EDL A;  3LW5 H;  1USE A;  1IC2 A;  2K9J B;  1KYO E;  2W6B A;  4M3L A;  1X0T A;  1QVF O;  1JY2 N;  2UWJ E;  1RHZ B;  3PJS K;  2M0B A;  2YKO A;  1J2J B;  2E42 A;  4U3F E;  3H1K J;  3VOP A;  1IZN B;  2WTY A;  3VP9 A;  1GL2 A;  2IPP A;  3L36 A;  1OXZ A;  3L75 D;  2K9Y A;  3CCU P;  1M1K Q;  3H1H D;  1SP4 A;  1FDM A;  4KHX A;  2D2C C;  2ZFC A;  2FYU G;  1SQV J;  5CCH A;  3GW6 A;  4U7J A;  1SQV E;  2FYU K;  3LW5 J;  2M8R A;  1EC5 A;  1NTK G;  3HE4 B;  3PH0 A;  1LTI C;  4GDO A;  4YPC A;  2B87 A;  1L0N E;  3OAK A;  1S5L X;  1URQ D;  3SWF A;  2Q9I A;  2RH0 A;  3GMA A;  3RK2 B;  1KFM A;  1S3J A;  2BEZ F;  1L0N K;  3I5C A;  3HRN A;  2K3R A;  1SFC B;  2R44 A;  3TF5 A;  2KLU A;  4U3F J;  2FYU E;  1K05 A;  3NFQ A;  3BCC E;  1PGP A;  1Q2N A;  1SQV K;  2LXB A;  1QEX A;  4OGQ D;  2PP6 A;  3TNU B;  2HG5 D;  4LC1 A;  2I1K A;  3G9R A;  3H1K E;  1SQP G;  4HH2 A;  1OVV A;  1SQX K;  3AE9 C;  3H1J E;  3LIE A;  1S2E A;  3L72 G;  4HJG H;  1NVO A;  4YXW H;  1PIX A;  3P8C D;  1VF5 D;  3M0A A;  3ZDM A;  1CZQ A;  2H88 C;  2ZT9 C;  1RE3 C;  2HLO A;  1VQO P;  1HBW A;  1HTL C;  1KB9 D;  1NTM K;  1KYO D;  1BCC J;  3CX5 I;  3CWB G;  3EQ2 A;  3H6P A;  1FBM A;  3RL0 D;  2FXP A;  4Z1M H;  3PTZ A;  3CC4 P;  2GA1 A;  3L73 E;  2QG4 A;  2WQY C;  3V5B A;  3KYQ A;  4R4L A;  3TK1 A;  1A02 J;  4OWF A;  3MTU E;  3TSI A;  3VMY A;  3KHU A;  5B66 E;  1EZV D;  2FXO A;  3RL0 C;  3Q3D A;  1OVU A;  3AE7 C;  2JWA A;  2WSE H;  3B5N C;  1J1E C;  3M9B A;  4K3A A;  1FZC B;  2A06 G;  5CBO A;  2WT7 A;  2MJZ A;  5CHX A;  3L70 D;  3P8M C;  2N1T C;  2R3C A;  1GW3 A;  1PP9 E;  4H44 C;  1G2C A;  3CC2 P;  1KC8 Q;  3H1H J;  3GF7 A;  1FC2 C;  4K35 A;  4Y99 B;  1L4A A;  2V7Q J;  3Q5P A;  1JB0 J;  3CXH I;  5KLV K;  4O9B A;  3H25 A;  2ZT9 B;  1HJB A;  1VF5 C;  1SFC D;  3M0D C;  4GOE A;  1OFC X;  4IL6 X;  1EXJ A;  2JEE A;  3KZI H;  5BU5 A;  1NHL A;  4KJM A;  1JY3 N;  3CWB E;  2AEM A;  2PAJ A;  3HD7 A;  5AW2 B;  1HGV A;  1SQQ D;  3FXD A;  2AXC A;  1M90 Q;  1EDJ A;  3L74 E;  1HVV A;  2H8P D;  3RBX A;  1CI6 A;  1KQS O;  3CXH H;  1OIP A;  1FDO A;  1BGY D;  1RQU A;  1SQQ J;  3CL3 D;  2KP8 A;  2V7Q H;  3H1I J;  5BVZ A;  5TIS H;  2QSI A;  1NH4 A;  1IFN A;  1NTZ J;  2LXC B;  3G3Z A;  4L74 A;  3KQG A;  5APT A;  1S5L H;  1BGY J;  2K1A A;  1JTH A;  1KQL A;  3CXH E;  2WSS H;  1MUU A;  3A0B E;  3AEE C;  1E5W A;  2Y0E A;  5CCH C;  2YKP A;  1LTB C;  1JY3 O;  1X22 A;  1S4X A;  1T6A A;  1SQQ G;  2FYN B;  3EWK A;  3FXE A;  4RES B;  4N3Y B;  1M57 D;  4C7N A;  1YTZ T;  3HE4 A;  3PHL A;  3HUS C;  2WPV B;  1SQQ K;  4WB4 A;  1YI2 P;  3A5T A;  4OH8 B;  1NTK E;  3H32 B;  4YXD C;  1LP1 A;  2E74 C;  2XKM A;  4UB6 H;  1M7L A;  2CPS A;  1FDI A;  2KXP B;  2OTL P;  2JKV A;  1LT9 A;  1NYH A;  1UII A;  2WPR A;  1AVO A;  5AVT B;  4ZKU A;  1YTZ I;  3RK3 D;  1PFI A;  3G71 P;  2OGU A;  4BRY B;  1T2K C;  4HB1 A;  1H0T B;  5CBN A;  1AVY A;  1LWU B;  2Z5I A;  3L35 A;  5KLV E;  3L71 E;  3P7K A;  1T2K D;  3H1L E;  1VQK P;  1U7M A;  5KLV J;  2XV5 A;  3IF4 A;  4PV1 D;  3V2R A;  1L0L E;  2AEJ A;  2WPQ A;  2KS1 A;  1DD3 A;  3F89 A;  2CPB A;  5KAF E;  1RE3 A;  1VQL P;  4RKU J;  1HJ0 A;  1U7J A;  5CJ0 A;  2XDJ A;  1NOH A;  3D6Z A;  2KOG A;  2Q7C A;  3A0B H;  1OW6 A;  1QL1 A;  3C9I A;  4JQ0 D;  2HPC B;  1CI6 B;  2FY8 A;  3SWY A;  2BCC D;  2QM8 A;  4HYT B;  3OJA B;  5AW9 B;  3USS A;  3U1A A;  1KZU B;  3L72 D;  1VQ8 P;  2K37 A;  1JO5 A;  5KKZ B;  4H44 D;  2VRS A;  2FFD B;  5CCH D;  2E76 D;  2JR8 A;  2YMY A;  3CCL P;  1GW4 A;  3KXD A;  3BVH A;  1LT1 A;  1KIL B;  2HOD A;  3B5N A;  3RGU A;  2M5A B;  2ZXE B;  3CME P;  3D6Y A;  2FKW B;  5KLI B;  1USD A;  2NPS B;  2A45 H;  1P84 H;  1FU1 A;  1E79 H;  3PRJ A;  1PP9 G;  2ZYA A;  5AW1 B;  5KJ7 D;  1M1J A;  1IFP A;  4UB6 E;  1EZV G;  1GL2 D;  3O8Z A;  5KKZ C;  1SQP K;  3M0D A;  1VQ9 P;  1FS0 E;  3W68 A;  5CJ4 A;  1PL5 A;  1LTJ B;  1VDF A;  3FGA D;  3H1H G;  3CWB J;  3L75 G;  1T3U A;  3R2P A;  1ZLL A;  3AED C;  2Y0C A;  1BE3 G;  3B71 A;  3RK3 E;  5H2F H;  3HD7 C;  5DJU B;  2ZYG A;  3S1K A;  1FZE A;  2YNY A;  5B66 H;  1VQP P;  3QWO C;  2OQQ A;  5TIS E;  4BWN A;  1YJ9 P;  1VQ6 P;  3O6Q B;  2QIW A;  1VQM P;  3AEG C;  1J1D B;  3AE5 C;  4OVN F;  2AXT H;  3V4Q A;  1JY3 P;  1KQF B;  3V2Q A;  5H2F E;  1HF9 A;  2FYN C;  1NTK K;  4OGQ C;  3S4R A;  1VQN P;  3HUS A;  4MN4 C;  2M5A A;  1KTM A;  2YIU B;  1GU4 A;  3GG2 A;  4C46 A;  2O01 H;  3MIW A;  2I8D A;  3IR9 A;  1SS1 A;  1NTM G;  3L72 J;  1N7L A;  1FZA A;  3L73 J;  2E74 B;  3H1L D;  4I2L C;  3U59 A;  3V2N A;  3H1J G;  1YHQ P;  1LT9 C;  1PGO A;  1AFO A;  2W83 C;  2C9N Y;  3IFM A;  1ZOY C;  2ZVN B;  3BCC G;  1NTM J;  4GOD A;  2WPS A;  2E75 D;  3BAT A;  3M91 A;  5AVU B;  5GTH H;  1N7S B;  4IFD K;  2YMK A;  2WSF J;  3CMA P;  1R5L A;  3Q5R A;  2A45 I;  2QE7 H;  3H1J J;  1NTZ G;  1JTH B;  4CPG A;  4H13 C;  3IAO A;  3ABV C;  4PD4 I;  4XE5 B;  4D6T D;  4ZMD A;  5GTI E;  1AJY A;  3H1J D;  3II6 A;  1LTA C;  1OMI A;  2PFX A;  2Q3E A;  3BCC J;  2FYU J;  1Y9B A;  2AEF A;  3NXS A;  1RF0 C;  2D2C B;  1ZR2 A;  1WT6 A;  1YJW P;  1N73 C;  1RF1 A;  1L4A D;  2WZ7 A;  1K8A Q;  1LTT C;  3FWL A;  3EFF K;  1RQV A;  4GOF A;  1L0N J;  1KD1 Q;  1BDC A;  1FJP A;  1VQ4 P;  3N4X A;  2QVA A;  1KV4 A;  2KZI A;  4PV1 B;  2K88 A;  2YIU C;  3WUV A;  2JDI H;  3KPE A;  1A02 F;  1SQB G;  3RL0 g;  3GHG A;  1KYO H;  2POH A;  1KIL D;  4I6M C;  3RL0 B;  3P32 A;  3D71 A;  1JNM A;  1N86 A;  1PPJ E;  3TGU D;  1WMK A;  1EDK A;  4Y99 C;  1X8Y A;  1KOR A;  1M1J C;  2KSJ A;  4KT0 J;  4BRY A;  1G1J A;  4H44 B;  1GDT A;  1KMI Z;  1MFZ A;  2GUS A;  3OA7 A;  1P84 E;  3JC2 2;  2WWW A;  2E43 A;  1VQ5 P;  1K04 A;  1ZRT E;  1YQ3 C;  1SQB D;  1EZV E;  2QJK C;  1X79 B;  2P1J A;  1OW8 A;  2GUV A;  1URQ B;  2WSE J;  4GIF A;  4W7Z A;  2AXT E;  3BAS A;  5APV A;  1HGZ A;  2QJY B;  2QJY C;  3NMD A;  3TGU G;  1PP9 D;  1FZG A;  3CCE P;  3FWN A;  3L71 J;  1ZW0 A;  1FE6 A;  2IZ1 A;  3AE3 C;  2KK7 A;  1PGQ A;  2IX7 C;  1HUC A;  2Q6Q A;  3V6I A;  4ZNC A;  4L75 A;  1K73 Q;  1OW7 A;  1R5S A;  2WVR A;  1NTM D;  1BE3 J;  1GK6 A;  1RH5 B;  3E1I A;  4JBZ A;  3WMM 0;  5DJT B;  2JWD A;  1Q7Y Q;  1QLE D;  4LGD E;  2B87 B;  1BE3 D;  3H1K G;  5AW5 B;  4I1L A;  2Y9Z A;  4EIJ A;  5KLI C;  3T97 A;  1JMM A;  4ZKP A;  1QX8 A;  1EXI A;  1PPJ G;  3BCC D;  1FZC C;  1DEB A;  5AVZ B;  2O1J A;  3CXH D;  1M8O B;  1PV3 A;  3HTK A;  4N6J A;  4EYY Q;  1QL2 A;  3A2A A;  2QEX P;  2OTJ P;  4H0L C;  4PJ0 E;  2FFD C;  3AEA C;  1SQB E;  1NO4 A;  3L75 J;  1IFI A;  1L0N D;  1LP1 B;  1T3J A;  3L70 J;  5M1B A;  1NTZ E;  1RY3 A;  4PD4 E;  1W2E A;  2L5G B;  3H1I E;  3L74 D;  1SQV D;  1FOS F;  3VMZ A;  3HUS B;  3UIA A;  1DIP A;  2J58 A;  3MHV A;  4L73 A;  5APQ A;  5AW7 B;  4ASV A;  1S72 P;  1QGK B;  1Y47 A;  1NTZ K;  1FZB A;  1YQ4 C;  1JUN A;  1FAV A;  5APS A;  4WY4 B;  1KIL E;  3LID A;  5AVQ B;  1G1I A;  3O6Q A;  1H89 A;  1S5L E;  2ZT9 D;  3L74 G;  2W90 A;  1SQV G;  1RF0 A;  4RO0 A;  1SQB J;  3PLN A;  1N73 A;  3MZW B;  1RF1 C;  1H8A A;  1RF1 B;  2KYV A;  3G4S P;  3HE5 A;  3RBZ A;  2H7H A;  1G2C B;  4DJG A;  2OYI C;  1IO4 A;  2KB7 P;  2K9J A;  2P2U A;  3L75 E;  3H1I D;  1DEE G;  3PP5 A;  1L2P A;  1PP9 J;  1NTZ D;  4I7Z C;  2W27 A;  3KZI E;  1JCC A;  4D6T G;  5APU A;  3GHG C;  5AW0 B;  1BCC D;  1ZN5 A;  1Q82 Q;  2CK3 H;  4XA4 A;  3SFD C;  2MKV A;  1M56 D;  1Y8A A;  2G8Y A;  5AVV B;  1JY2 O;  3FX0 A;  4DT0 A;  1ZME C;  3MD0 A;  2WSC H;  3Q2Y A;  1HWT C;  3A7O A;  1NWQ A;  1L4A B;  2QA4 P;  1XTG B;  2QM7 A;  1EQ7 A;  3L37 A;  1BSN A;  1FJK A;  2I1J A;  2SPZ A;  1KB9 E;  4YTP C;  1BE3 E;  2FBW C;  2H89 C;  4PD4 H;  3VN0 A;  5CCG D;  3CX5 H;  2RMZ A;  1BCC E;  5APW A;  1BCC G;  1ZRT D;  4BXL A;  5B5E H;  2E5T A;  4LLH A;  1P84 D;  2HFE D;  1LTJ A;  2B9B A;  3GLM A;  1YYC A;  2YXR B;  3H1K D;  1T8Z A;  2Y9Y A;  4W7Y A;  1K9M Q;  2O01 J;  2R32 A;  4AQR D;  3AE8 C;  1VQ7 P;  1PPJ D;  4IFM A;  4Y28 J;  3JSV C;  2P7J A;  3L4F A;  3TGU E;  3CCJ P;  5AVX B;  3M9Q A;  5APY A;  1R8E A;  3B5N D;  2IBZ E;  3AEC C;  1OVR A;  4TLF A;  2KUB A;  1DX7 A;  3H1L G;  3CLQ A;  3VTP C;  4NPD A;  3E1R A;  3GHG B;  2PGD A;  2KZJ A;  1NU1 E;  1AV1 A;  3U1C A;  4AYC A;  3OW2 O;  1IK7 A;  2B89 A;  2KSE A;  3K5B A;  1FZC A;  1J1E B;  2KIK A;  2OYI B;  1JM0 A;  1LWU A;  2ZJS E;  1KFN A;  5KAI H;  2HR3 A;  4PD4 D;  2XNX A;  2YO3 A;  4R4M A;  2FFD A;  1FZF A;  1H0T A;  3A0H E;  3V4W A;  4D6T E;  2J59 M;  1UIX A;  4A7P A;  3RK2 C;  2W6J H;  3EFG A;  1N8R Q;  2Q1K A;  1JOC A;  5APX A;  3A0H H;  3M9H A;  5AVW B;  3L71 G;  2KLV A;  5AW8 B;  2IBZ I;  1JMB A;  3W67 A;  4JYB A;  2RKL A;  1KQG B;  1N7S C;  1W5C E;  1Q90 D;  2IZ0 A;  3VP8 A;  3CCQ P;  1MZ9 A;  2FXM A;  3S9O A;  1RE4 C;  2KS1 B;  2E76 B;  5CMZ A;  1L0N G;  4PV1 C;  3TYY A;  1BDD A;  1X9V A;  2N9Y B; 
#chains in the Genus database with same CATH homology
 2J5U A;  3AE4 C;  4YXD C;  1OW8 A;  2E74 C;  1NGM B;  2WSE J;  1FDI A;  3Q1M A;  1NYH A;  2QJY C;  2D2C D;  3T97 B;  4TT3 H;  3AE3 C;  4OGQ B;  3D70 A;  1OW7 A;  3AEB C;  4PV1 D;  1DD3 A;  4RKU J;  1HJ0 A;  1TU3 F;  1VF5 B;  3GF3 A;  4H13 B;  3D6Z A;  1OW6 A;  5KLI C;  1EXI A;  3AE6 C;  1PV3 A;  4H44 D;  4XFJ A;  4H0L C;  2E76 D;  3AEA C;  5M1B A;  2P10 A;  3D6Y A;  2IDB A;  2K9Y A;  1DIP A;  2D2C C;  2E75 C;  1YQ3 C;  4U7J A;  1YQ4 C;  3LW5 J;  4GDO A;  1KIL E;  2E75 B;  1S5L X;  3O6Q A;  3GMA A;  1U57 A;  1PL5 A;  2BEZ F;  2ZT9 D;  3FGA D;  3AED C;  1K05 A;  3B71 A;  3RK3 E;  4I7Z B;  4OGQ D;  2BEQ D;  3G9R A;  1S1C X;  3AE9 C;  4I7Z C;  2OQQ A;  1PIX A;  1VF5 D;  4H13 D;  3R4Y A;  3SFD C;  2MKV A;  2G8Y A;  2H88 C;  2ZT9 C;  3AE2 C;  1ZME C;  3Q2Y A;  2QIW A;  3AEG C;  3AE5 C;  2FXP A;  1KQF B;  4Z1M H;  4YTP C;  2WQY C;  1HF9 A;  2FYN C;  4OGQ C;  4R4L A;  1MKM A;  1KTM A;  1VL2 A;  2FBW C;  2H89 C;  5KKZ C;  1GMJ A;  2QJP C;  5L8R J;  2JP3 A;  3AE7 C;  3H25 A;  3Q3D A;  2E74 B;  1ZP0 C;  3GLM A;  2O01 J;  4H0L B;  3AE8 C;  1ZOY C;  4Y28 J;  4H44 C;  2E75 D;  3GF7 A;  1DD4 A;  2V7Q J;  2YMK A;  2WSF J;  3AEC C;  3Q5P A;  1JB0 J;  3Q5R A;  2NZ2 A;  2G3A A;  2ZT9 B;  1VF5 C;  3IAO A;  3ABV C;  4H13 C;  1AJY A;  4IL6 X;  1OMI A;  1EXJ A;  1Y9B A;  3AE1 C;  2D2C B;  1IK7 A;  3C8V A;  1RQV A;  4R4M A;  4PV1 B;  3SFE C;  1RQU A;  1FDO A;  2YIU C;  2E76 C;  1UIX A;  3RL0 g;  2QSI A;  2JO1 A;  3Q5S A;  3D71 A;  3AEE C;  2WSC J;  3AEF C;  1R8E A;  1KQG B;  1WMK A;  4H0L D;  1Q90 D;  1KOR A;  4KT0 J;  3EWK A;  3S9O A;  4H44 B;  1KMI Z;  2E76 B;  3IN6 A;  2WPV B;  4PV1 C;  1K04 A;  1ZRT E;  2E74 D;  2QJK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...