2FYDB

Catalytic domain of bovine beta 1, 4-galactosyltransferase in complex with alpha-lactalbumin, glucose, mn, and udp-n-acetylgalactosamine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYCGWGGEDDDIYNRLAFRGMSVSRPNAVIGKTRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-lactalbumin
publication title Structural Snapshots of beta-1,4-Galactosyltransferase-I Along the Kinetic Pathway.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 89
structure length 272
sequence length 272
chains with identical sequence D
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2006-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
B PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2fydB00
4KPXA 4KRVA 5CQLX 5C8RA 4Y9XA 4D11C 2GGQA 1ZDFA 5C4CA 4EEOA 2PX7A 1H5TA 2VS4A 1G23A 1V84A 2BO8A 2VXMA 4NAIA 3BCVA 3OH2A 4EVWA 3I0HA 1VZUA 1LL2A 4DE7A 2V0HA 5J49A 5JQQA 2D7IA 4BQHA 1G9RA 2VS3A 4FRDA 4HO0A 1HJLA 3T7OA 3DUVA 3F1CA 4EE5A 2OI6A 4L41C 1H4CA 1H5TB 3FOQA 4YS8A 4NANA 2XWMA 1R7TA 1WT1A 4JISA 1G8OA 1GQCA 2ZU7A 4KC4A 1H5SA 3V0OA 2WGZA 1VGWA 3K8DA 1G93A 1S4NA 2YQCA 2RIZA 3V90A 2XMHA 3CKOA 2VD4A 1TVYA 1ZJ1A 2Y4JA 3O3PA 1ZCYA 1WVCA 4G3SA 5FYEA 4B5BA 5C4FA 1ON6A 3OH1A 4K6RA 2AESA 4B4BA 4M2AA 2ICYA 1I52A 5CMJA 1LZ7A 2FY7A 3DJ4A 4P00A 3IOJA 1FR9A 3E26A 3U2WA 4ASYA 3OH4A 1LVWA 4HG6A 1OMXA 2QGIA 1GWVA 5EIYA 4FRMA 1NHEB 4HO8A 2V0JA 3SXAA 5FV9A 4FRQA 1GX4A 3R3IA 2Y4MA 2VFZA 4FCUA 1YROB 4M4KA 4M28A 1GQ9A 2A8WA 2E8BA 4Y7FA 4EE4A 4KQLA 2VSHA 1XZ6A 1G1LA 2VXLA 4NAKA 4ECMA 3Q4SA 1Z90A 3K8EA 4JD0A 4ASJA 3LW6A 2FYAA 1ZI5A 3I0CA 1VH1A 2X65A 5C38A 1JYLA 1OQMB 4B4GA 1H7QA 1VZXA 1H7HA 4B4MA 2O1GA 3SXGA 4AC3A 5CMGX 1H3MA 1H7LA 5L6SA 3CU0A 4M2BA 4D48A 1H5SC 1NMMB 4G87A 1ZIZA 3PNNA 1H5RB 4KPZA 3SXCA 3TQDA 3Q7UA 2P73A 4EEAA 1ZDGA 4MNDA 4KC2A 1ZCUA 1VGUA 1O7OA 2AECA 3D5NA 3FWWA 3OAMA 2Y7AA 3V0NA 4AAWA 4KNXA 3I0EA 3U2UA 3BRKX 3I0KA 1YP4A 5C3DA 1FO9A 1VICA 1S4OA 2APCA 2WAWA 3SPTA 5CQNX 5C3AA 2QH5A 2FYBA 2WE9A 1IIMA 1ZHJA 3SX8A 2Y4LA 1V83A 2I5EA 4CJBA 2W0WA 2RJ0A 1HM8A 2PGVA 2AM5A 4E1KA 1FZWA 2FYCB 4FRPA 2RJ1A 1HM9A 5C1HA 1VH3A 2JCKA 1KWSA 2RJ5A 4BMAA 1QGSA 4XWIA 3OH3A 1FXJA 4P02A 1W57A 2I5KA 1WT2A 3U2VA 1FOAA 4HO4A 3RMVA 3DK5A 3ZLKA 1LZ0A 1E5KA 1G3LA 3ZLLA 5I1FA 2AH9A 3I0FA 5FTVA 3HL3A 1INJA 3U0YA 3I0IX 5C4BA 2AM3A 1ZJ2A 5C1GA 2RIXA 1NQIB 4ZDQA 4FROA 1H4EA 4EEGA 2FFUA 1GX0A 3RMWA 3V91A 4B3UA 3U2TA 1TZFA 4CJCA 1VM8A 1H7GA 3V0PA 1SS9A 5AJOA 2WVKA 1H7TA 5DDVA 1WSZA 3V0MA 2WVMA 1FGXA 2OEFA 1MP4A 1H5SB 4FRAA 2XMEA 4FRLA 3CKNA 2E3DA 4G3QA 1WT3A 2NXVA 2YQHA 4LW6A 2V0LA 1R81A 3USRA 4DECA 4HCQA 2BO4A 2GGOA 3I0DA 1TW1A 3V0LA 1W77A 3SX5A 1PZTA 1V82A 4Y64A 2O1FA 1S4PA 3E25A 1G95A 4B42A 1R80A 1INIA 2PGYA 3SXDA 1ZI3A 4IRPA 4FRBA 3OC9A 2O1HA 5C4EA 5CQPA 2RJ4A 4HO6A 5EJ1A 3SXEA 4R7PA 2PA4A 3SX7A 5CMIA 1YP3A 2I7BA 4AYJA 3KIAA 4B2WA 2AE7A 2QKXA 2OEGA 2D0JA 2P72A 2YC5A 3ZGGA 3U2XA 2BO7A 5CQMX 2JCLA 4HO2A 2VSIA 2DPWA 2YQSA 1GA8A 5IDTA 5C49A 1ZJPA 2XWNA 1LZIA 1H5SD 4B2XA 1IINA 1FWYA 4Y7UA 3V8YA 3T7MA 4HO5A 5C3BA 3OH0A 2D7RA 5CMHA 1VZTA 1XHBA 3JTJA 1QG8A 4EEMA 2AM4A 1VGTA 4KT7A 4MYBA 3QVBA 1JV3A 2RJ7A 4CJ8A 1TW5A 1EYRA 1PZYB 1WT0A 1OMZA 2RIYA 2ZU8A 2AGDA 1R7UA 1LZJA 1ZJ0A 2W0VA 2Y4KA 3ZGFA 2YESA 4D0TA 1VGZA 1R7VA 1YP2A 2Z87A 2Y6PA 2A8UA 1NF5B 4G3PA 4IRQA 1FO8A 1R82A 4C2SA 3I0LA 3NGWA 1ZJ3A 2WVLA 4Y62A 3D98A 1JVDA 5FU8A 3V8ZA 5IDSA 5CMFX 1H7EA 5C36A 3R2WA 3N9WA 1ZI4A 3GUEA 3Q80A 2CU2A 4KXOA 5FU0A 1MP5A 5C4DA 5C47A 5EJZA 3USQA 1HM0A 4HOCA 2V0KA 2JCJA 1ZCTA 4Y63A 1NKHB 2OI7A 2WEEA 1JV1A 1ON8A 4Y7GA 1G97A 3TZTA 4ARWA 1VPAA 2YQJA 1R7XA 2RJ6A 3PKQA 4UEGA 5AJNA 1R7YA 3CGXA 1FGGA 2RJ8A 2X5ZA 5HS2A 3RSBA 4KC1A 4FRHA 1QWJA 2RJ9A 3SX3A 1ZJOA 3POLA 3ST8A 1H7FA 1GWWA 2BO6A 3CKJA 4Y7VA 2RITA 2ZU9A 4D11A 3V0QA 5L6VA 2OI5A 1NWGB 2ICXA 1O7QA 4EE3A 2X60A 1H4DA 1W55A 2MZBA 1JYKA 1HJJA 3T7NA 5C1LA 1FRWA 1G2VA 3OGZA 1O23B 4Y7TA 1QGQA 1K4VA 3I0GA 4LW3A 5BXCA 4FQWA 1LL0A 3D8VA 3OKRA 4FCEA 4CVHA 2YC3A 3PKPA 5IFYA 3F1YA 1O0RA 3U0XA 4HO3A 4Y6NA 3SXBA 2P6WA 3JUJA 3CKQA 4NALA 1H5RA 2UX8A 4FREA 2FYDB 4D0ZA 4DDZA 1LL3A 4KNRA 2X5SA 2VS5A 2V0IA 2XWLA 1ZCVA 3IOIA 3I0JA 5DDTA 1EZIA 2Z86A 3ZF8A 2FFVA 4AYLA 4HO9A 1FR8A 3IOHA 5FTSA 4GBPA 3JUKA 5FUHA 5C48A 1MC3A 1ZI1A 5AJPA 1HV9A 1FXOA 1JVGA 1MP3A 4J18A 1FG5N 1G0RA 2YCMA 4Y6UA 3EE5A 2JCOA 3CKVA 5CQOA 2Q4JA
chains in the Genus database with same CATH superfamily
4KPXA 4KRVA 5CQLX 5C8RA 4Y9XA 4D11C 2GGQA 1ZDFA 5C4CA 4EEOA 2PX7A 1H5TA 2VS4A 1G23A 1V84A 2BO8A 2VXMA 4NAIA 3BCVA 3OH2A 4EVWA 3I0HA 1VZUA 1LL2A 4DE7A 2V0HA 5J49A 5JQQA 2D7IA 4BQHA 1G9RA 2VS3A 4FRDA 4HO0A 1HJLA 3T7OA 3DUVA 3F1CA 4EE5A 2OI6A 4L41C 1H4CA 1H5TB 3FOQA 4YS8A 4NANA 2XWMA 1R7TA 4MIXA 1WT1A 4JISA 1G8OA 1GQCA 2ZU7A 4KC4A 1H5SA 3V0OA 2WGZA 1VGWA 3K8DA 1G93A 1S4NA 2YQCA 2RIZA 3V90A 2XMHA 3CKOA 2VD4A 1TVYA 1ZJ1A 2Y4JA 3O3PA 1ZCYA 1WVCA 2VK9A 4G3SA 5FYEA 4B5BA 5C4FA 1ON6A 3OH1A 4K6RA 2AESA 4B4BA 4M2AA 2ICYA 1I52A 5CMJA 1LZ7A 2FY7A 3DJ4A 4P00A 3IOJA 1FR9A 3E26A 3U2WA 4Q7CA 4ASYA 3OH4A 1LVWA 4HG6A 1OMXA 2QGIA 1GWVA 5EIYA 4FRMA 1NHEB 4HO8A 2V0JA 3SXAA 5FV9A 4FRQA 1GX4A 3R3IA 2Y4MA 2VFZA 4FCUA 1YROB 4M4KA 4M28A 1GQ9A 2A8WA 2E8BA 4Y7FA 4EE4A 4KQLA 2VSHA 1XZ6A 1G1LA 2VXLA 4NAKA 4ECMA 3Q4SA 1Z90A 3K8EA 4JD0A 4ASJA 3LW6A 2FYAA 1ZI5A 3I0CA 1VH1A 4O6NA 2X65A 5C38A 1JYLA 1OQMB 4B4GA 1H7QA 1VZXA 1H7HA 4B4MA 2O1GA 3SXGA 4AC3A 5CMGX 1H3MA 1H7LA 5L6SA 3CU0A 4M2BA 4D48A 1H5SC 1NMMB 4G87A 1ZIZA 3PNNA 1H5RB 4KPZA 3SXCA 3TQDA 3Q7UA 2P73A 4EEAA 1ZDGA 4MNDA 4KC2A 1ZCUA 1VGUA 1O7OA 2AECA 3D5NA 3FWWA 3OAMA 2Y7AA 3V0NA 4AAWA 4KNXA 3I0EA 3U2UA 3BRKX 3I0KA 1YP4A 5C3DA 1FO9A 1VICA 1S4OA 2APCA 2WAWA 3SPTA 5CQNX 5C3AA 2QH5A 5D91A 2FYBA 2WE9A 1IIMA 1ZHJA 3SX8A 2Y4LA 1V83A 2I5EA 4CJBA 2W0WA 2RJ0A 1HM8A 2PGVA 2AM5A 4E1KA 1FZWA 2FYCB 4FRPA 2RJ1A 1HM9A 5C1HA 1VH3A 2JCKA 1KWSA 2RJ5A 4BMAA 1QGSA 4XWIA 3OH3A 1FXJA 4P02A 1W57A 2I5KA 1WT2A 3U2VA 1FOAA 4HO4A 3RMVA 3DK5A 3ZLKA 1LZ0A 1E5KA 1G3LA 3ZLLA 5I1FA 2AH9A 3I0FA 5FTVA 3HL3A 1INJA 3U0YA 3I0IX 5C4BA 2AM3A 1ZJ2A 5C1GA 2RIXA 1NQIB 4ZDQA 4FROA 1H4EA 4EEGA 2FFUA 1GX0A 3RMWA 3V91A 4B3UA 3U2TA 1TZFA 4CJCA 1VM8A 1H7GA 3V0PA 1SS9A 5AJOA 2WVKA 1H7TA 5DDVA 1WSZA 3V0MA 2WVMA 1FGXA 2OEFA 1MP4A 1H5SB 4FRAA 2XMEA 4FRLA 3CKNA 2E3DA 4G3QA 1WT3A 2NXVA 2YQHA 4LW6A 2V0LA 1R81A 3USRA 4DECA 4HCQA 2BO4A 2GGOA 3I0DA 1TW1A 3V0LA 1W77A 3SX5A 1PZTA 1V82A 4Y64A 2O1FA 1S4PA 3E25A 1G95A 4B42A 1R80A 1INIA 2PGYA 3SXDA 1ZI3A 4IRPA 4FRBA 3OC9A 2O1HA 5C4EA 5CQPA 2RJ4A 4HO6A 5EJ1A 3SXEA 4R7PA 2PA4A 3SX7A 5CMIA 1YP3A 2I7BA 4AYJA 3KIAA 4B2WA 2AE7A 2QKXA 2OEGA 2D0JA 2P72A 2YC5A 3ZGGA 3U2XA 2BO7A 5CQMX 2JCLA 4HO2A 2VSIA 2DPWA 2YQSA 1GA8A 5IDTA 5C49A 1ZJPA 2XWNA 1LZIA 1H5SD 4B2XA 1IINA 1FWYA 4Y7UA 3V8YA 3T7MA 4HO5A 5C3BA 3OH0A 2D7RA 5D92A 5CMHA 1VZTA 2J0AA 1XHBA 3JTJA 1QG8A 4EEMA 2AM4A 1VGTA 4KT7A 4MYBA 3QVBA 1JV3A 2RJ7A 4CJ8A 1TW5A 1EYRA 1PZYB 1WT0A 1OMZA 2RIYA 2ZU8A 2AGDA 1R7UA 1LZJA 1ZJ0A 4O6MA 2W0VA 2Y4KA 3ZGFA 2YESA 4D0TA 1VGZA 1R7VA 1YP2A 2Z87A 2Y6PA 2A8UA 1NF5B 4G3PA 4IRQA 1FO8A 1R82A 4C2SA 3I0LA 3NGWA 1ZJ3A 2WVLA 4Y62A 3D98A 1JVDA 5FU8A 3V8ZA 5IDSA 5CMFX 1H7EA 5C36A 3R2WA 3N9WA 1ZI4A 3GUEA 3Q80A 2CU2A 4KXOA 5FU0A 1MP5A 5C4DA 5C47A 5EJZA 3USQA 1HM0A 4HOCA 2V0KA 2JCJA 1ZCTA 4Y63A 1NKHB 2OI7A 2WEEA 1JV1A 1ON8A 4FIXA 4Y7GA 1G97A 3TZTA 4ARWA 1VPAA 2YQJA 1R7XA 2RJ6A 3PKQA 4UEGA 2C0NA 5AJNA 1R7YA 3CGXA 1FGGA 2RJ8A 2X5ZA 5HS2A 3RSBA 4KC1A 4FRHA 1QWJA 2RJ9A 3SX3A 1ZJOA 3POLA 3ST8A 1H7FA 1GWWA 2BO6A 3CKJA 4Y7VA 2RITA 2ZU9A 4D11A 3V0QA 5L6VA 2OI5A 1NWGB 2ICXA 1O7QA 4EE3A 2X60A 1H4DA 1W55A 2MZBA 1JYKA 1HJJA 3T7NA 5C1LA 1FRWA 1G2VA 3OGZA 1O23B 4Y7TA 1QGQA 1K4VA 2J0BA 3I0GA 4LW3A 5BXCA 4FQWA 1LL0A 3D8VA 3OKRA 4FCEA 4CVHA 2YC3A 3PKPA 5IFYA 3F1YA 1O0RA 3U0XA 4HO3A 4Y6NA 3SXBA 4FIYA 2P6WA 3JUJA 3CKQA 4NALA 1H5RA 2UX8A 4FREA 2FYDB 4D0ZA 4DDZA 1LL3A 4KNRA 2X5SA 2VS5A 2V0IA 2XWLA 1ZCVA 3IOIA 3I0JA 5DDTA 1EZIA 2Z86A 3ZF8A 2FFVA 4AYLA 4HO9A 1FR8A 3IOHA 5FTSA 4GBPA 3JUKA 5FUHA 5C48A 1MC3A 1ZI1A 5AJPA 1HV9A 1FXOA 1JVGA 1MP3A 4J18A 1FG5N 1G0RA 2YCMA 4Y6UA 3EE5A 2JCOA 3CKVA 5CQOA 2Q4JA
chains in the Genus database with same CATH topology
4KPXA 4KRVA 5CQLX 5C8RA 4Y9XA 4D11C 2GGQA 1ZDFA 5C4CA 4EEOA 2PX7A 1H5TA 2VS4A 1G23A 1V84A 2BO8A 2VXMA 4NAIA 3BCVA 3OH2A 4EVWA 3I0HA 1VZUA 1LL2A 4DE7A 2V0HA 5J49A 5JQQA 2D7IA 4BQHA 1G9RA 2VS3A 4FRDA 4HO0A 1HJLA 3T7OA 3DUVA 3F1CA 4EE5A 2OI6A 4L41C 1H4CA 1H5TB 3FOQA 4YS8A 4NANA 2XWMA 1R7TA 4MIXA 1WT1A 4JISA 1G8OA 1GQCA 2ZU7A 4KC4A 1H5SA 3V0OA 2WGZA 1VGWA 3K8DA 1G93A 1S4NA 2YQCA 2RIZA 3V90A 2XMHA 3CKOA 2VD4A 1TVYA 1ZJ1A 2Y4JA 3O3PA 1ZCYA 1WVCA 2VK9A 4G3SA 5FYEA 4B5BA 5C4FA 1ON6A 3OH1A 4K6RA 2AESA 4B4BA 4M2AA 2ICYA 1I52A 5CMJA 1LZ7A 2FY7A 3DJ4A 4P00A 3IOJA 1FR9A 3E26A 3U2WA 4Q7CA 4ASYA 3OH4A 1LVWA 4HG6A 1OMXA 2QGIA 1GWVA 5EIYA 4FRMA 1NHEB 4HO8A 2V0JA 3SXAA 5FV9A 4FRQA 1GX4A 3R3IA 2Y4MA 2VFZA 4FCUA 1YROB 4M4KA 4M28A 1GQ9A 2A8WA 2E8BA 4Y7FA 4EE4A 4KQLA 2VSHA 1XZ6A 1G1LA 2VXLA 4NAKA 4ECMA 3Q4SA 1Z90A 3K8EA 4JD0A 4ASJA 3LW6A 2FYAA 1ZI5A 3I0CA 1VH1A 4O6NA 2X65A 5C38A 1JYLA 1OQMB 4B4GA 1H7QA 1VZXA 1H7HA 4B4MA 2O1GA 3SXGA 4AC3A 5CMGX 1H3MA 1H7LA 5L6SA 3CU0A 4M2BA 4D48A 1H5SC 1NMMB 4G87A 1ZIZA 3PNNA 1H5RB 4KPZA 3SXCA 3TQDA 3Q7UA 2P73A 4EEAA 1ZDGA 4MNDA 4KC2A 1ZCUA 1VGUA 1O7OA 2AECA 3D5NA 3FWWA 3OAMA 2Y7AA 3V0NA 4AAWA 4KNXA 3I0EA 3U2UA 3BRKX 3I0KA 1YP4A 5C3DA 1FO9A 1VICA 1S4OA 2APCA 2WAWA 3SPTA 5CQNX 5C3AA 2QH5A 5D91A 2FYBA 2WE9A 1IIMA 1ZHJA 3SX8A 2Y4LA 1V83A 2I5EA 4CJBA 2W0WA 2RJ0A 1HM8A 2PGVA 2AM5A 4E1KA 1FZWA 2FYCB 4FRPA 2RJ1A 1HM9A 5C1HA 1VH3A 2JCKA 1KWSA 2RJ5A 4BMAA 1QGSA 4XWIA 3OH3A 1FXJA 4P02A 1W57A 2I5KA 1WT2A 3U2VA 1FOAA 4HO4A 3RMVA 3DK5A 3ZLKA 1LZ0A 1E5KA 1G3LA 3ZLLA 5I1FA 2AH9A 3I0FA 5FTVA 3HL3A 1INJA 3U0YA 3I0IX 5C4BA 2AM3A 1ZJ2A 5C1GA 2RIXA 1NQIB 4ZDQA 4FROA 1H4EA 4EEGA 2FFUA 1GX0A 3RMWA 3V91A 4B3UA 3U2TA 1TZFA 4CJCA 1VM8A 1H7GA 3V0PA 1SS9A 5AJOA 2WVKA 1H7TA 5DDVA 1WSZA 3V0MA 2WVMA 1FGXA 2OEFA 1MP4A 1H5SB 4FRAA 2XMEA 4FRLA 3CKNA 2E3DA 4G3QA 1WT3A 2NXVA 2YQHA 4LW6A 2V0LA 1R81A 3USRA 4DECA 4HCQA 2BO4A 2GGOA 3I0DA 1TW1A 3V0LA 1W77A 3SX5A 1PZTA 1V82A 4Y64A 2O1FA 1S4PA 3E25A 1G95A 4B42A 1R80A 1INIA 2PGYA 3SXDA 1ZI3A 4IRPA 4FRBA 3OC9A 2O1HA 5C4EA 5CQPA 2RJ4A 4HO6A 5EJ1A 3SXEA 4R7PA 2PA4A 3SX7A 5CMIA 1YP3A 2I7BA 4AYJA 3KIAA 4B2WA 2AE7A 2QKXA 2OEGA 2D0JA 2P72A 2YC5A 3ZGGA 3U2XA 2BO7A 5CQMX 2JCLA 4HO2A 2VSIA 2DPWA 2YQSA 1GA8A 5IDTA 5C49A 1ZJPA 2XWNA 1LZIA 1H5SD 4B2XA 1IINA 1FWYA 4Y7UA 3V8YA 3T7MA 4HO5A 5C3BA 3OH0A 2D7RA 5D92A 5CMHA 1VZTA 2J0AA 1XHBA 3JTJA 1QG8A 4EEMA 2AM4A 1VGTA 4KT7A 4MYBA 3QVBA 1JV3A 2RJ7A 4CJ8A 1TW5A 1EYRA 1PZYB 1WT0A 1OMZA 2RIYA 2ZU8A 2AGDA 1R7UA 1LZJA 1ZJ0A 4O6MA 2W0VA 2Y4KA 3ZGFA 2YESA 4D0TA 1VGZA 1R7VA 1YP2A 2Z87A 2Y6PA 2A8UA 1NF5B 4G3PA 4IRQA 1FO8A 1R82A 4C2SA 3I0LA 3NGWA 1ZJ3A 2WVLA 4Y62A 3D98A 1JVDA 5FU8A 3V8ZA 5IDSA 5CMFX 1H7EA 5C36A 3R2WA 3N9WA 1ZI4A 3GUEA 3Q80A 2CU2A 4KXOA 5FU0A 1MP5A 5C4DA 5C47A 5EJZA 3USQA 1HM0A 4HOCA 2V0KA 2JCJA 1ZCTA 4Y63A 1NKHB 2OI7A 2WEEA 1JV1A 1ON8A 4FIXA 4Y7GA 1G97A 3TZTA 4ARWA 1VPAA 2YQJA 1R7XA 2RJ6A 3PKQA 4UEGA 2C0NA 5AJNA 1R7YA 3CGXA 1FGGA 2RJ8A 2X5ZA 5HS2A 3RSBA 4KC1A 4FRHA 1QWJA 2RJ9A 3SX3A 1ZJOA 3POLA 3ST8A 1H7FA 1GWWA 2BO6A 3CKJA 4Y7VA 2RITA 2ZU9A 4D11A 3V0QA 5L6VA 2OI5A 1NWGB 2ICXA 1O7QA 4EE3A 2X60A 1H4DA 1W55A 2MZBA 1JYKA 1HJJA 3T7NA 5C1LA 1FRWA 1G2VA 3OGZA 1O23B 4Y7TA 1QGQA 1K4VA 2J0BA 3I0GA 4LW3A 5BXCA 4FQWA 1LL0A 3D8VA 3OKRA 4FCEA 4CVHA 2YC3A 3PKPA 5IFYA 3F1YA 1O0RA 3U0XA 4HO3A 4Y6NA 3SXBA 4FIYA 2P6WA 3JUJA 3CKQA 4NALA 1H5RA 2UX8A 4FREA 2FYDB 4D0ZA 4DDZA 1LL3A 4KNRA 2X5SA 2VS5A 2V0IA 2XWLA 1ZCVA 3IOIA 3I0JA 5DDTA 1EZIA 2Z86A 3ZF8A 2FFVA 4AYLA 4HO9A 1FR8A 3IOHA 5FTSA 4GBPA 3JUKA 5FUHA 5C48A 1MC3A 1ZI1A 5AJPA 1HV9A 1FXOA 1JVGA 1MP3A 4J18A 1FG5N 1G0RA 2YCMA 4Y6UA 3EE5A 2JCOA 3CKVA 5CQOA 2Q4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KPX A;  4KRV A;  5CQL X;  5C8R A;  4Y9X A;  4D11 C;  2GGQ A;  1ZDF A;  5C4C A;  4EEO A;  2PX7 A;  1H5T A;  2VS4 A;  1G23 A;  1V84 A;  2BO8 A;  2VXM A;  4NAI A;  3BCV A;  3OH2 A;  4EVW A;  3I0H A;  1VZU A;  1LL2 A;  4DE7 A;  2V0H A;  5J49 A;  5JQQ A;  2D7I A;  4BQH A;  1G9R A;  2VS3 A;  4FRD A;  4HO0 A;  1HJL A;  3T7O A;  3DUV A;  3F1C A;  4EE5 A;  2OI6 A;  4L41 C;  1H4C A;  1H5T B;  3FOQ A;  4YS8 A;  4NAN A;  2XWM A;  1R7T A;  1WT1 A;  4JIS A;  1G8O A;  1GQC A;  2ZU7 A;  4KC4 A;  1H5S A;  3V0O A;  2WGZ A;  1VGW A;  3K8D A;  1G93 A;  1S4N A;  2YQC A;  2RIZ A;  3V90 A;  2XMH A;  3CKO A;  2VD4 A;  1TVY A;  1ZJ1 A;  2Y4J A;  3O3P A;  1ZCY A;  1WVC A;  4G3S A;  5FYE A;  4B5B A;  5C4F A;  1ON6 A;  3OH1 A;  4K6R A;  2AES A;  4B4B A;  4M2A A;  2ICY A;  1I52 A;  5CMJ A;  1LZ7 A;  2FY7 A;  3DJ4 A;  4P00 A;  3IOJ A;  1FR9 A;  3E26 A;  3U2W A;  4ASY A;  3OH4 A;  1LVW A;  4HG6 A;  1OMX A;  2QGI A;  1GWV A;  5EIY A;  4FRM A;  1NHE B;  4HO8 A;  2V0J A;  3SXA A;  5FV9 A;  4FRQ A;  1GX4 A;  3R3I A;  2Y4M A;  2VFZ A;  4FCU A;  1YRO B;  4M4K A;  4M28 A;  1GQ9 A;  2A8W A;  2E8B A;  4Y7F A;  4EE4 A;  4KQL A;  2VSH A;  1XZ6 A;  1G1L A;  2VXL A;  4NAK A;  4ECM A;  3Q4S A;  1Z90 A;  3K8E A;  4JD0 A;  4ASJ A;  3LW6 A;  2FYA A;  1ZI5 A;  3I0C A;  1VH1 A;  2X65 A;  5C38 A;  1JYL A;  1OQM B;  4B4G A;  1H7Q A;  1VZX A;  1H7H A;  4B4M A;  2O1G A;  3SXG A;  4AC3 A;  5CMG X;  1H3M A;  1H7L A;  5L6S A;  3CU0 A;  4M2B A;  4D48 A;  1H5S C;  1NMM B;  4G87 A;  1ZIZ A;  3PNN A;  1H5R B;  4KPZ A;  3SXC A;  3TQD A;  3Q7U A;  2P73 A;  4EEA A;  1ZDG A;  4MND A;  4KC2 A;  1ZCU A;  1VGU A;  1O7O A;  2AEC A;  3D5N A;  3FWW A;  3OAM A;  2Y7A A;  3V0N A;  4AAW A;  4KNX A;  3I0E A;  3U2U A;  3BRK X;  3I0K A;  1YP4 A;  5C3D A;  1FO9 A;  1VIC A;  1S4O A;  2APC A;  2WAW A;  3SPT A;  5CQN X;  5C3A A;  2QH5 A;  2FYB A;  2WE9 A;  1IIM A;  1ZHJ A;  3SX8 A;  2Y4L A;  1V83 A;  2I5E A;  4CJB A;  2W0W A;  2RJ0 A;  1HM8 A;  2PGV A;  2AM5 A;  4E1K A;  1FZW A;  2FYC B;  4FRP A;  2RJ1 A;  1HM9 A;  5C1H A;  1VH3 A;  2JCK A;  1KWS A;  2RJ5 A;  4BMA A;  1QGS A;  4XWI A;  3OH3 A;  1FXJ A;  4P02 A;  1W57 A;  2I5K A;  1WT2 A;  3U2V A;  1FOA A;  4HO4 A;  3RMV A;  3DK5 A;  3ZLK A;  1LZ0 A;  1E5K A;  1G3L A;  3ZLL A;  5I1F A;  2AH9 A;  3I0F A;  5FTV A;  3HL3 A;  1INJ A;  3U0Y A;  3I0I X;  5C4B A;  2AM3 A;  1ZJ2 A;  5C1G A;  2RIX A;  1NQI B;  4ZDQ A;  4FRO A;  1H4E A;  4EEG A;  2FFU A;  1GX0 A;  3RMW A;  3V91 A;  4B3U A;  3U2T A;  1TZF A;  4CJC A;  1VM8 A;  1H7G A;  3V0P A;  1SS9 A;  5AJO A;  2WVK A;  1H7T A;  5DDV A;  1WSZ A;  3V0M A;  2WVM A;  1FGX A;  2OEF A;  1MP4 A;  1H5S B;  4FRA A;  2XME A;  4FRL A;  3CKN A;  2E3D A;  4G3Q A;  1WT3 A;  2NXV A;  2YQH A;  4LW6 A;  2V0L A;  1R81 A;  3USR A;  4DEC A;  4HCQ A;  2BO4 A;  2GGO A;  3I0D A;  1TW1 A;  3V0L A;  1W77 A;  3SX5 A;  1PZT A;  1V82 A;  4Y64 A;  2O1F A;  1S4P A;  3E25 A;  1G95 A;  4B42 A;  1R80 A;  1INI A;  2PGY A;  3SXD A;  1ZI3 A;  4IRP A;  4FRB A;  3OC9 A;  2O1H A;  5C4E A;  5CQP A;  2RJ4 A;  4HO6 A;  5EJ1 A;  3SXE A;  4R7P A;  2PA4 A;  3SX7 A;  5CMI A;  1YP3 A;  2I7B A;  4AYJ A;  3KIA A;  4B2W A;  2AE7 A;  2QKX A;  2OEG A;  2D0J A;  2P72 A;  2YC5 A;  3ZGG A;  3U2X A;  2BO7 A;  5CQM X;  2JCL A;  4HO2 A;  2VSI A;  2DPW A;  2YQS A;  1GA8 A;  5IDT A;  5C49 A;  1ZJP A;  2XWN A;  1LZI A;  1H5S D;  4B2X A;  1IIN A;  1FWY A;  4Y7U A;  3V8Y A;  3T7M A;  4HO5 A;  5C3B A;  3OH0 A;  2D7R A;  5CMH A;  1VZT A;  1XHB A;  3JTJ A;  1QG8 A;  4EEM A;  2AM4 A;  1VGT A;  4KT7 A;  4MYB A;  3QVB A;  1JV3 A;  2RJ7 A;  4CJ8 A;  1TW5 A;  1EYR A;  1PZY B;  1WT0 A;  1OMZ A;  2RIY A;  2ZU8 A;  2AGD A;  1R7U A;  1LZJ A;  1ZJ0 A;  2W0V A;  2Y4K A;  3ZGF A;  2YES A;  4D0T A;  1VGZ A;  1R7V A;  1YP2 A;  2Z87 A;  2Y6P A;  2A8U A;  1NF5 B;  4G3P A;  4IRQ A;  1FO8 A;  1R82 A;  4C2S A;  3I0L A;  3NGW A;  1ZJ3 A;  2WVL A;  4Y62 A;  3D98 A;  1JVD A;  5FU8 A;  3V8Z A;  5IDS A;  5CMF X;  1H7E A;  5C36 A;  3R2W A;  3N9W A;  1ZI4 A;  3GUE A;  3Q80 A;  2CU2 A;  4KXO A;  5FU0 A;  1MP5 A;  5C4D A;  5C47 A;  5EJZ A;  3USQ A;  1HM0 A;  4HOC A;  2V0K A;  2JCJ A;  1ZCT A;  4Y63 A;  1NKH B;  2OI7 A;  2WEE A;  1JV1 A;  1ON8 A;  4Y7G A;  1G97 A;  3TZT A;  4ARW A;  1VPA A;  2YQJ A;  1R7X A;  2RJ6 A;  3PKQ A;  4UEG A;  5AJN A;  1R7Y A;  3CGX A;  1FGG A;  2RJ8 A;  2X5Z A;  5HS2 A;  3RSB A;  4KC1 A;  4FRH A;  1QWJ A;  2RJ9 A;  3SX3 A;  1ZJO A;  3POL A;  3ST8 A;  1H7F A;  1GWW A;  2BO6 A;  3CKJ A;  4Y7V A;  2RIT A;  2ZU9 A;  4D11 A;  3V0Q A;  5L6V A;  2OI5 A;  1NWG B;  2ICX A;  1O7Q A;  4EE3 A;  2X60 A;  1H4D A;  1W55 A;  2MZB A;  1JYK A;  1HJJ A;  3T7N A;  5C1L A;  1FRW A;  1G2V A;  3OGZ A;  1O23 B;  4Y7T A;  1QGQ A;  1K4V A;  3I0G A;  4LW3 A;  5BXC A;  4FQW A;  1LL0 A;  3D8V A;  3OKR A;  4FCE A;  4CVH A;  2YC3 A;  3PKP A;  5IFY A;  3F1Y A;  1O0R A;  3U0X A;  4HO3 A;  4Y6N A;  3SXB A;  2P6W A;  3JUJ A;  3CKQ A;  4NAL A;  1H5R A;  2UX8 A;  4FRE A;  2FYD B;  4D0Z A;  4DDZ A;  1LL3 A;  4KNR A;  2X5S A;  2VS5 A;  2V0I A;  2XWL A;  1ZCV A;  3IOI A;  3I0J A;  5DDT A;  1EZI A;  2Z86 A;  3ZF8 A;  2FFV A;  4AYL A;  4HO9 A;  1FR8 A;  3IOH A;  5FTS A;  4GBP A;  3JUK A;  5FUH A;  5C48 A;  1MC3 A;  1ZI1 A;  5AJP A;  1HV9 A;  1FXO A;  1JVG A;  1MP3 A;  4J18 A;  1FG5 N;  1G0R A;  2YCM A;  4Y6U A;  3EE5 A;  2JCO A;  3CKV A;  5CQO A;  2Q4J A; 
#chains in the Genus database with same CATH topology
 4KPX A;  4KRV A;  5CQL X;  5C8R A;  4Y9X A;  4D11 C;  2GGQ A;  1ZDF A;  5C4C A;  4EEO A;  2PX7 A;  1H5T A;  2VS4 A;  1G23 A;  1V84 A;  2BO8 A;  2VXM A;  4NAI A;  3BCV A;  3OH2 A;  4EVW A;  3I0H A;  1VZU A;  1LL2 A;  4DE7 A;  2V0H A;  5J49 A;  5JQQ A;  2D7I A;  4BQH A;  1G9R A;  2VS3 A;  4FRD A;  4HO0 A;  1HJL A;  3T7O A;  3DUV A;  3F1C A;  4EE5 A;  2OI6 A;  4L41 C;  1H4C A;  1H5T B;  3FOQ A;  4YS8 A;  4NAN A;  2XWM A;  1R7T A;  4MIX A;  1WT1 A;  4JIS A;  1G8O A;  1GQC A;  2ZU7 A;  4KC4 A;  1H5S A;  3V0O A;  2WGZ A;  1VGW A;  3K8D A;  1G93 A;  1S4N A;  2YQC A;  2RIZ A;  3V90 A;  2XMH A;  3CKO A;  2VD4 A;  1TVY A;  1ZJ1 A;  2Y4J A;  3O3P A;  1ZCY A;  1WVC A;  2VK9 A;  4G3S A;  5FYE A;  4B5B A;  5C4F A;  1ON6 A;  3OH1 A;  4K6R A;  2AES A;  4B4B A;  4M2A A;  2ICY A;  1I52 A;  5CMJ A;  1LZ7 A;  2FY7 A;  3DJ4 A;  4P00 A;  3IOJ A;  1FR9 A;  3E26 A;  3U2W A;  4Q7C A;  4ASY A;  3OH4 A;  1LVW A;  4HG6 A;  1OMX A;  2QGI A;  1GWV A;  5EIY A;  4FRM A;  1NHE B;  4HO8 A;  2V0J A;  3SXA A;  5FV9 A;  4FRQ A;  1GX4 A;  3R3I A;  2Y4M A;  2VFZ A;  4FCU A;  1YRO B;  4M4K A;  4M28 A;  1GQ9 A;  2A8W A;  2E8B A;  4Y7F A;  4EE4 A;  4KQL A;  2VSH A;  1XZ6 A;  1G1L A;  2VXL A;  4NAK A;  4ECM A;  3Q4S A;  1Z90 A;  3K8E A;  4JD0 A;  4ASJ A;  3LW6 A;  2FYA A;  1ZI5 A;  3I0C A;  1VH1 A;  4O6N A;  2X65 A;  5C38 A;  1JYL A;  1OQM B;  4B4G A;  1H7Q A;  1VZX A;  1H7H A;  4B4M A;  2O1G A;  3SXG A;  4AC3 A;  5CMG X;  1H3M A;  1H7L A;  5L6S A;  3CU0 A;  4M2B A;  4D48 A;  1H5S C;  1NMM B;  4G87 A;  1ZIZ A;  3PNN A;  1H5R B;  4KPZ A;  3SXC A;  3TQD A;  3Q7U A;  2P73 A;  4EEA A;  1ZDG A;  4MND A;  4KC2 A;  1ZCU A;  1VGU A;  1O7O A;  2AEC A;  3D5N A;  3FWW A;  3OAM A;  2Y7A A;  3V0N A;  4AAW A;  4KNX A;  3I0E A;  3U2U A;  3BRK X;  3I0K A;  1YP4 A;  5C3D A;  1FO9 A;  1VIC A;  1S4O A;  2APC A;  2WAW A;  3SPT A;  5CQN X;  5C3A A;  2QH5 A;  5D91 A;  2FYB A;  2WE9 A;  1IIM A;  1ZHJ A;  3SX8 A;  2Y4L A;  1V83 A;  2I5E A;  4CJB A;  2W0W A;  2RJ0 A;  1HM8 A;  2PGV A;  2AM5 A;  4E1K A;  1FZW A;  2FYC B;  4FRP A;  2RJ1 A;  1HM9 A;  5C1H A;  1VH3 A;  2JCK A;  1KWS A;  2RJ5 A;  4BMA A;  1QGS A;  4XWI A;  3OH3 A;  1FXJ A;  4P02 A;  1W57 A;  2I5K A;  1WT2 A;  3U2V A;  1FOA A;  4HO4 A;  3RMV A;  3DK5 A;  3ZLK A;  1LZ0 A;  1E5K A;  1G3L A;  3ZLL A;  5I1F A;  2AH9 A;  3I0F A;  5FTV A;  3HL3 A;  1INJ A;  3U0Y A;  3I0I X;  5C4B A;  2AM3 A;  1ZJ2 A;  5C1G A;  2RIX A;  1NQI B;  4ZDQ A;  4FRO A;  1H4E A;  4EEG A;  2FFU A;  1GX0 A;  3RMW A;  3V91 A;  4B3U A;  3U2T A;  1TZF A;  4CJC A;  1VM8 A;  1H7G A;  3V0P A;  1SS9 A;  5AJO A;  2WVK A;  1H7T A;  5DDV A;  1WSZ A;  3V0M A;  2WVM A;  1FGX A;  2OEF A;  1MP4 A;  1H5S B;  4FRA A;  2XME A;  4FRL A;  3CKN A;  2E3D A;  4G3Q A;  1WT3 A;  2NXV A;  2YQH A;  4LW6 A;  2V0L A;  1R81 A;  3USR A;  4DEC A;  4HCQ A;  2BO4 A;  2GGO A;  3I0D A;  1TW1 A;  3V0L A;  1W77 A;  3SX5 A;  1PZT A;  1V82 A;  4Y64 A;  2O1F A;  1S4P A;  3E25 A;  1G95 A;  4B42 A;  1R80 A;  1INI A;  2PGY A;  3SXD A;  1ZI3 A;  4IRP A;  4FRB A;  3OC9 A;  2O1H A;  5C4E A;  5CQP A;  2RJ4 A;  4HO6 A;  5EJ1 A;  3SXE A;  4R7P A;  2PA4 A;  3SX7 A;  5CMI A;  1YP3 A;  2I7B A;  4AYJ A;  3KIA A;  4B2W A;  2AE7 A;  2QKX A;  2OEG A;  2D0J A;  2P72 A;  2YC5 A;  3ZGG A;  3U2X A;  2BO7 A;  5CQM X;  2JCL A;  4HO2 A;  2VSI A;  2DPW A;  2YQS A;  1GA8 A;  5IDT A;  5C49 A;  1ZJP A;  2XWN A;  1LZI A;  1H5S D;  4B2X A;  1IIN A;  1FWY A;  4Y7U A;  3V8Y A;  3T7M A;  4HO5 A;  5C3B A;  3OH0 A;  2D7R A;  5D92 A;  5CMH A;  1VZT A;  2J0A A;  1XHB A;  3JTJ A;  1QG8 A;  4EEM A;  2AM4 A;  1VGT A;  4KT7 A;  4MYB A;  3QVB A;  1JV3 A;  2RJ7 A;  4CJ8 A;  1TW5 A;  1EYR A;  1PZY B;  1WT0 A;  1OMZ A;  2RIY A;  2ZU8 A;  2AGD A;  1R7U A;  1LZJ A;  1ZJ0 A;  4O6M A;  2W0V A;  2Y4K A;  3ZGF A;  2YES A;  4D0T A;  1VGZ A;  1R7V A;  1YP2 A;  2Z87 A;  2Y6P A;  2A8U A;  1NF5 B;  4G3P A;  4IRQ A;  1FO8 A;  1R82 A;  4C2S A;  3I0L A;  3NGW A;  1ZJ3 A;  2WVL A;  4Y62 A;  3D98 A;  1JVD A;  5FU8 A;  3V8Z A;  5IDS A;  5CMF X;  1H7E A;  5C36 A;  3R2W A;  3N9W A;  1ZI4 A;  3GUE A;  3Q80 A;  2CU2 A;  4KXO A;  5FU0 A;  1MP5 A;  5C4D A;  5C47 A;  5EJZ A;  3USQ A;  1HM0 A;  4HOC A;  2V0K A;  2JCJ A;  1ZCT A;  4Y63 A;  1NKH B;  2OI7 A;  2WEE A;  1JV1 A;  1ON8 A;  4FIX A;  4Y7G A;  1G97 A;  3TZT A;  4ARW A;  1VPA A;  2YQJ A;  1R7X A;  2RJ6 A;  3PKQ A;  4UEG A;  2C0N A;  5AJN A;  1R7Y A;  3CGX A;  1FGG A;  2RJ8 A;  2X5Z A;  5HS2 A;  3RSB A;  4KC1 A;  4FRH A;  1QWJ A;  2RJ9 A;  3SX3 A;  1ZJO A;  3POL A;  3ST8 A;  1H7F A;  1GWW A;  2BO6 A;  3CKJ A;  4Y7V A;  2RIT A;  2ZU9 A;  4D11 A;  3V0Q A;  5L6V A;  2OI5 A;  1NWG B;  2ICX A;  1O7Q A;  4EE3 A;  2X60 A;  1H4D A;  1W55 A;  2MZB A;  1JYK A;  1HJJ A;  3T7N A;  5C1L A;  1FRW A;  1G2V A;  3OGZ A;  1O23 B;  4Y7T A;  1QGQ A;  1K4V A;  2J0B A;  3I0G A;  4LW3 A;  5BXC A;  4FQW A;  1LL0 A;  3D8V A;  3OKR A;  4FCE A;  4CVH A;  2YC3 A;  3PKP A;  5IFY A;  3F1Y A;  1O0R A;  3U0X A;  4HO3 A;  4Y6N A;  3SXB A;  4FIY A;  2P6W A;  3JUJ A;  3CKQ A;  4NAL A;  1H5R A;  2UX8 A;  4FRE A;  2FYD B;  4D0Z A;  4DDZ A;  1LL3 A;  4KNR A;  2X5S A;  2VS5 A;  2V0I A;  2XWL A;  1ZCV A;  3IOI A;  3I0J A;  5DDT A;  1EZI A;  2Z86 A;  3ZF8 A;  2FFV A;  4AYL A;  4HO9 A;  1FR8 A;  3IOH A;  5FTS A;  4GBP A;  3JUK A;  5FUH A;  5C48 A;  1MC3 A;  1ZI1 A;  5AJP A;  1HV9 A;  1FXO A;  1JVG A;  1MP3 A;  4J18 A;  1FG5 N;  1G0R A;  2YCM A;  4Y6U A;  3EE5 A;  2JCO A;  3CKV A;  5CQO A;  2Q4J A; 
#chains in the Genus database with same CATH homology
 4KPX A;  4KRV A;  5CQL X;  5C8R A;  4Y9X A;  4D11 C;  2GGQ A;  1ZDF A;  5C4C A;  4EEO A;  2PX7 A;  1H5T A;  2VS4 A;  1G23 A;  1V84 A;  2BO8 A;  2VXM A;  4NAI A;  3BCV A;  3OH2 A;  4EVW A;  3I0H A;  1VZU A;  1LL2 A;  4DE7 A;  2V0H A;  5J49 A;  5JQQ A;  2D7I A;  4BQH A;  1G9R A;  2VS3 A;  4FRD A;  4HO0 A;  1HJL A;  3T7O A;  3DUV A;  3F1C A;  4EE5 A;  2OI6 A;  4L41 C;  1H4C A;  1H5T B;  3FOQ A;  4YS8 A;  4NAN A;  2XWM A;  1R7T A;  4MIX A;  1WT1 A;  4JIS A;  1G8O A;  1GQC A;  2ZU7 A;  4KC4 A;  1H5S A;  3V0O A;  2WGZ A;  1VGW A;  3K8D A;  1G93 A;  1S4N A;  2YQC A;  2RIZ A;  3V90 A;  2XMH A;  3CKO A;  2VD4 A;  1TVY A;  1ZJ1 A;  2Y4J A;  3O3P A;  1ZCY A;  1WVC A;  2VK9 A;  4G3S A;  5FYE A;  4B5B A;  5C4F A;  1ON6 A;  3OH1 A;  4K6R A;  2AES A;  4B4B A;  4M2A A;  2ICY A;  1I52 A;  5CMJ A;  1LZ7 A;  2FY7 A;  3DJ4 A;  4P00 A;  3IOJ A;  1FR9 A;  3E26 A;  3U2W A;  4Q7C A;  4ASY A;  3OH4 A;  1LVW A;  4HG6 A;  1OMX A;  2QGI A;  1GWV A;  5EIY A;  4FRM A;  1NHE B;  4HO8 A;  2V0J A;  3SXA A;  5FV9 A;  4FRQ A;  1GX4 A;  3R3I A;  2Y4M A;  2VFZ A;  4FCU A;  1YRO B;  4M4K A;  4M28 A;  1GQ9 A;  2A8W A;  2E8B A;  4Y7F A;  4EE4 A;  4KQL A;  2VSH A;  1XZ6 A;  1G1L A;  2VXL A;  4NAK A;  4ECM A;  3Q4S A;  1Z90 A;  3K8E A;  4JD0 A;  4ASJ A;  3LW6 A;  2FYA A;  1ZI5 A;  3I0C A;  1VH1 A;  4O6N A;  2X65 A;  5C38 A;  1JYL A;  1OQM B;  4B4G A;  1H7Q A;  1VZX A;  1H7H A;  4B4M A;  2O1G A;  3SXG A;  4AC3 A;  5CMG X;  1H3M A;  1H7L A;  5L6S A;  3CU0 A;  4M2B A;  4D48 A;  1H5S C;  1NMM B;  4G87 A;  1ZIZ A;  3PNN A;  1H5R B;  4KPZ A;  3SXC A;  3TQD A;  3Q7U A;  2P73 A;  4EEA A;  1ZDG A;  4MND A;  4KC2 A;  1ZCU A;  1VGU A;  1O7O A;  2AEC A;  3D5N A;  3FWW A;  3OAM A;  2Y7A A;  3V0N A;  4AAW A;  4KNX A;  3I0E A;  3U2U A;  3BRK X;  3I0K A;  1YP4 A;  5C3D A;  1FO9 A;  1VIC A;  1S4O A;  2APC A;  2WAW A;  3SPT A;  5CQN X;  5C3A A;  2QH5 A;  5D91 A;  2FYB A;  2WE9 A;  1IIM A;  1ZHJ A;  3SX8 A;  2Y4L A;  1V83 A;  2I5E A;  4CJB A;  2W0W A;  2RJ0 A;  1HM8 A;  2PGV A;  2AM5 A;  4E1K A;  1FZW A;  2FYC B;  4FRP A;  2RJ1 A;  1HM9 A;  5C1H A;  1VH3 A;  2JCK A;  1KWS A;  2RJ5 A;  4BMA A;  1QGS A;  4XWI A;  3OH3 A;  1FXJ A;  4P02 A;  1W57 A;  2I5K A;  1WT2 A;  3U2V A;  1FOA A;  4HO4 A;  3RMV A;  3DK5 A;  3ZLK A;  1LZ0 A;  1E5K A;  1G3L A;  3ZLL A;  5I1F A;  2AH9 A;  3I0F A;  5FTV A;  3HL3 A;  1INJ A;  3U0Y A;  3I0I X;  5C4B A;  2AM3 A;  1ZJ2 A;  5C1G A;  2RIX A;  1NQI B;  4ZDQ A;  4FRO A;  1H4E A;  4EEG A;  2FFU A;  1GX0 A;  3RMW A;  3V91 A;  4B3U A;  3U2T A;  1TZF A;  4CJC A;  1VM8 A;  1H7G A;  3V0P A;  1SS9 A;  5AJO A;  2WVK A;  1H7T A;  5DDV A;  1WSZ A;  3V0M A;  2WVM A;  1FGX A;  2OEF A;  1MP4 A;  1H5S B;  4FRA A;  2XME A;  4FRL A;  3CKN A;  2E3D A;  4G3Q A;  1WT3 A;  2NXV A;  2YQH A;  4LW6 A;  2V0L A;  1R81 A;  3USR A;  4DEC A;  4HCQ A;  2BO4 A;  2GGO A;  3I0D A;  1TW1 A;  3V0L A;  1W77 A;  3SX5 A;  1PZT A;  1V82 A;  4Y64 A;  2O1F A;  1S4P A;  3E25 A;  1G95 A;  4B42 A;  1R80 A;  1INI A;  2PGY A;  3SXD A;  1ZI3 A;  4IRP A;  4FRB A;  3OC9 A;  2O1H A;  5C4E A;  5CQP A;  2RJ4 A;  4HO6 A;  5EJ1 A;  3SXE A;  4R7P A;  2PA4 A;  3SX7 A;  5CMI A;  1YP3 A;  2I7B A;  4AYJ A;  3KIA A;  4B2W A;  2AE7 A;  2QKX A;  2OEG A;  2D0J A;  2P72 A;  2YC5 A;  3ZGG A;  3U2X A;  2BO7 A;  5CQM X;  2JCL A;  4HO2 A;  2VSI A;  2DPW A;  2YQS A;  1GA8 A;  5IDT A;  5C49 A;  1ZJP A;  2XWN A;  1LZI A;  1H5S D;  4B2X A;  1IIN A;  1FWY A;  4Y7U A;  3V8Y A;  3T7M A;  4HO5 A;  5C3B A;  3OH0 A;  2D7R A;  5D92 A;  5CMH A;  1VZT A;  2J0A A;  1XHB A;  3JTJ A;  1QG8 A;  4EEM A;  2AM4 A;  1VGT A;  4KT7 A;  4MYB A;  3QVB A;  1JV3 A;  2RJ7 A;  4CJ8 A;  1TW5 A;  1EYR A;  1PZY B;  1WT0 A;  1OMZ A;  2RIY A;  2ZU8 A;  2AGD A;  1R7U A;  1LZJ A;  1ZJ0 A;  4O6M A;  2W0V A;  2Y4K A;  3ZGF A;  2YES A;  4D0T A;  1VGZ A;  1R7V A;  1YP2 A;  2Z87 A;  2Y6P A;  2A8U A;  1NF5 B;  4G3P A;  4IRQ A;  1FO8 A;  1R82 A;  4C2S A;  3I0L A;  3NGW A;  1ZJ3 A;  2WVL A;  4Y62 A;  3D98 A;  1JVD A;  5FU8 A;  3V8Z A;  5IDS A;  5CMF X;  1H7E A;  5C36 A;  3R2W A;  3N9W A;  1ZI4 A;  3GUE A;  3Q80 A;  2CU2 A;  4KXO A;  5FU0 A;  1MP5 A;  5C4D A;  5C47 A;  5EJZ A;  3USQ A;  1HM0 A;  4HOC A;  2V0K A;  2JCJ A;  1ZCT A;  4Y63 A;  1NKH B;  2OI7 A;  2WEE A;  1JV1 A;  1ON8 A;  4FIX A;  4Y7G A;  1G97 A;  3TZT A;  4ARW A;  1VPA A;  2YQJ A;  1R7X A;  2RJ6 A;  3PKQ A;  4UEG A;  2C0N A;  5AJN A;  1R7Y A;  3CGX A;  1FGG A;  2RJ8 A;  2X5Z A;  5HS2 A;  3RSB A;  4KC1 A;  4FRH A;  1QWJ A;  2RJ9 A;  3SX3 A;  1ZJO A;  3POL A;  3ST8 A;  1H7F A;  1GWW A;  2BO6 A;  3CKJ A;  4Y7V A;  2RIT A;  2ZU9 A;  4D11 A;  3V0Q A;  5L6V A;  2OI5 A;  1NWG B;  2ICX A;  1O7Q A;  4EE3 A;  2X60 A;  1H4D A;  1W55 A;  2MZB A;  1JYK A;  1HJJ A;  3T7N A;  5C1L A;  1FRW A;  1G2V A;  3OGZ A;  1O23 B;  4Y7T A;  1QGQ A;  1K4V A;  2J0B A;  3I0G A;  4LW3 A;  5BXC A;  4FQW A;  1LL0 A;  3D8V A;  3OKR A;  4FCE A;  4CVH A;  2YC3 A;  3PKP A;  5IFY A;  3F1Y A;  1O0R A;  3U0X A;  4HO3 A;  4Y6N A;  3SXB A;  4FIY A;  2P6W A;  3JUJ A;  3CKQ A;  4NAL A;  1H5R A;  2UX8 A;  4FRE A;  2FYD B;  4D0Z A;  4DDZ A;  1LL3 A;  4KNR A;  2X5S A;  2VS5 A;  2V0I A;  2XWL A;  1ZCV A;  3IOI A;  3I0J A;  5DDT A;  1EZI A;  2Z86 A;  3ZF8 A;  2FFV A;  4AYL A;  4HO9 A;  1FR8 A;  3IOH A;  5FTS A;  4GBP A;  3JUK A;  5FUH A;  5C48 A;  1MC3 A;  1ZI1 A;  5AJP A;  1HV9 A;  1FXO A;  1JVG A;  1MP3 A;  4J18 A;  1FG5 N;  1G0R A;  2YCM A;  4Y6U A;  3EE5 A;  2JCO A;  3CKV A;  5CQO A;  2Q4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...