2FYLB

Haddock model of the complex between double module of lrp, cr56, and first domain of receptor associated protein, rap-d1.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
82
structure length
82
Chain Sequence
SARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding Site Structure of One LRP-RAP Complex:Implications for a Common Ligand-Receptor Binding Motif.
pubmed doi rcsb
molecule keywords Alpha-2-macroglobulin receptor-associated protein
molecule tags Surface active protein
source organism Homo sapiens
total genus 10
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 2fylB00
1F5YA 2M7PA 2KNXA 1D2JA 1J8EA 1JRFA 1LDLA 1CR8A 1K7BA 2KNYA 2FCWB 1XFEA 1LDRA 2FYJA 2M96A 2FYLB 2JM4A 1N7DA 2M0PA 2LGPA 1D2LA 2I1PA
chains in the Genus database with same CATH superfamily
1F5YA 2M7PA 2KNXA 1D2JA 1J8EA 1JRFA 1LDLA 1CR8A 1K7BA 2KNYA 2FCWB 1XFEA 1LDRA 2FYJA 2M96A 2FYLB 2JM4A 1N7DA 2M0PA 2LGPA 1D2LA 2I1PA
chains in the Genus database with same CATH topology
1F5YA 2M7PA 2KNXA 1D2JA 1J8EA 1JRFA 1LDLA 1CR8A 1K7BA 2KNYA 2FCWB 1XFEA 1LDRA 2FYJA 2M96A 2FYLB 2JM4A 1N7DA 2M0PA 2LGPA 1D2LA 2I1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F5Y A;  2M7P A;  2KNX A;  1D2J A;  1J8E A;  1JRF A;  1LDL A;  1CR8 A;  1K7B A;  2KNY A;  2FCW B;  1XFE A;  1LDR A;  2FYJ A;  2M96 A;  2FYL B;  2JM4 A;  1N7D A;  2M0P A;  2LGP A;  1D2L A;  2I1P A; 
#chains in the Genus database with same CATH topology
 1F5Y A;  2M7P A;  2KNX A;  1D2J A;  1J8E A;  1JRF A;  1LDL A;  1CR8 A;  1K7B A;  2KNY A;  2FCW B;  1XFE A;  1LDR A;  2FYJ A;  2M96 A;  2FYL B;  2JM4 A;  1N7D A;  2M0P A;  2LGP A;  1D2L A;  2I1P A; 
#chains in the Genus database with same CATH homology
 1F5Y A;  2M7P A;  2KNX A;  1D2J A;  1J8E A;  1JRF A;  1LDL A;  1CR8 A;  1K7B A;  2KNY A;  2FCW B;  1XFE A;  1LDR A;  2FYJ A;  2M96 A;  2FYL B;  2JM4 A;  1N7D A;  2M0P A;  2LGP A;  1D2L A;  2I1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...