2FYUD

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2fyuD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2fyuD02
1C6SA 5CIDB 3TGUD 4GYDA 2C9XB 2DGEA 1KIBA 3OCDA 1R0QA 2C1DB 2D0WA 3SVWA 4AAMA 1DW0A 4UB6V 3RN1A 1HH7A 1C6OA 1PP9D 4EICA 1AOQA 1EZVD 4AALA 5DF5A 2HV4A 1HJ3A 4Y5RA 1H31A 3VNWA 1I5TA 5IY51 5B66V 1WVEC 2LITA 3X39A 1CSVA 1KYOD 1SQPD 4L3HA 4EIDA 1M6ZA 1SQQD 1LFMA 1ETPA 1F1FA 4J20A 3L70D 2Y0CA 2FYNB 1E2RA 4EIFA 3KZIV 1LC1A 1SQXD 3PRJA 1NMLA 1FI3A 4FANA 1DW1A 3CU4A 1RZ6A 4FB1A 1FHBA 4A7PA 2A06D 1CIFA 1I6DA 1CNOA 2BCCD 1H33B 3BCCD 1N15A 4O1WA 3WFBC 5KAIV 1AKKA 3JBTB 4GEDB 3H1HD 1AOFA 3TDKA 4H0JA 1LS9A 3PHLA 2N9IA 1BGYD 2EXVA 3PH2B 3O20A 1NMIA 1KV9A 1CTZA 1EB7A 2KNCB 3SLEA 3A0BV 2BLFB 155CA 1C6RA 5B5EV 2CA3B 4N0KA 3PLNA 1CCHA 5TISV 1FI7A 3A9FA 3H1KD 1CORA 3OA8B 4L1QA 1VYDA 5CIEB 2CE0A 2B11B 5C9MA 1L9JC 3OCDB 2AI5A 1IZL0 4AANA 3WFDC 3O0RC 3ZOXA 1CIGA 1S5LV 3VYMA 2C2CA 3MK7B 1CCRA 1YFCA 1FJ0A 3ZCFA 5KKZB 1H31B 2ZOOA 3O5CA 2AXTV 1L0ND 4WQCA 3PTZA 2ZBOA 3H1ID 1A56A 3CX5D 5GTIV 1MG3D 4PD4D 1CSWA 1L9BC 1OAEA 2C1VA 3L72D 1OCDA 2CXBA 1CYCA 1YEAA 2Q3EA 4NFGB 2GB8B 2FYUD 2Y0EA 2I8FA 3HQ7A 3L74D 4XXLA 1P84D 2B0ZB 4IL6V 2B4ZA 4FA9A 3HQ6A 1NIRA 4UB8V 1LMSA 2MTAC 1KX2A 1ZZHA 1HRCA 1QN2A 4V2KA 2XTSB 4JCGA 3H1JD 3WU2V 3ZBMA 2QJKB 1H32A 5CIFB 5CICB 2PCCB 1NTZD 4WQ9A 1DW2A 1CHJA 2YCCA 3VMAA 3L75D 4AAOA 1GJQA 4EDFA 1HJ4A 2FRCA 3CXHW 1SQBD 1SQVD 2QJPB 2BCNB 1RAPA 1IQCA 2B12B 1K3HA 3WUIA 4RJTA 4YE1A 5AURA 451CA 1CSUA 1K3GA 1QYZA 3L71D 1IRWA 1DVVA 1CTJA 1CTYA 3RN0A 1NTKD 4AX3A 351CA 1CIHA 1M60A 5C0ZA 5DFSA 1H9XA 1AYGA 4WQBA 1YICA 5H2FV 3NWVA 3MK7C 1CRHA 3ZOYA 1COTA 3CYTI 5TJHA 1BE3D 2JWAA 1CIEA 4DY9A 1IRVA 1HJ5A 3H1LD 2Y0DA 1FI9A 5GTHV 1KX7A 2L91A 3GG2A 4FA4A 1YCCA 3O1YA 1YEBA 2D0SA 2AIUA 2V08A 1RAQA 2MHMA 1NTMD 1YTCA 1FOCA 1CC5A 3NBSA 2YQBA 4PW9B 4WQAA 2KS1A 1WEJF 1MG2D 3NBTA 1E8EA 3CX5W 2PCBB 3M97X 2BGVX 3RLMA 2JTIB 1J3SA 1PPJD 4D6TD 4RSZA 1DIIC 2K9JB 2OZ1A 5KLIB 3TYIA 1KB9D 1HCMA 4O1QA 3DMIA 4QAOA 4P4QB 1H32B 3ZOOA 3CWBD 1CRJA 4WQEA 1U75B 5CIBB 1GQ1A 5CIHB 1CRIA 3PXWA 4PJ0V 1I55A 1DT1A 3PXSA 1I8PA 1H9YA 1KYOW 5E79V 2BPBB 3ITKA 1GKSA 2GIWA 1W5CT 2ZXYA 5B6QA 1CYJA 2N9JA 1ZRTD 1C2NA 5CYTR 1YNRA 2YIUB 2PACA 3SJLA 1HZVA 2C8SA 4FA5A 1BCCD 3WC8A 3GW6A 3SXTA 1I54A 2ZZS1 1CXCA 4FAVA 3A0HV 1M70A 3VRDA 1C75A 1E29A 2CE1A 3TF5A 1I6EA 1N90A 3C2CA 5KLVD 2ZONG 2O3JA 4WQ8A 1W2LA 3HQ8A 1DW3A 1N50A 2JQRA 1MZ4A 4U3FD 2C1DA 3WFCC 2N3YA 5EXQA 1A8CA 1CHHA 4KMGA 2C1UA 1HROA 1A2SA 1I8OA 2BH5X 3L73D 1IO3A 2V07A 4WQ7A 5DJQC 2RN0A 1CO6A 1B7VA 1CRGA 4K3IA 2IBZD 4LJIA 3CP5A 1U74B 2BH4X 1BL9A 3ZOWA 5KAFV 2DVHA 3CXHD 2N3BA 1C2RA 4PWAA 1DIQC 2OZ1B 3FWLA 2QJYB 2L4DA 3HQ9A 3ORVA 1QL4A 4EIEA 4L3GA 4H0KA 1C52A 2B10B 2LIRA 1N9CA 1CHIA 1GDVA 3DP5A 2N18C 5DJQB 1H33A 1HZUA 2ORLA 3RMZA 2YK3A 1YIQA 3KHUA 2GC7D 1DVHA 1L0LD 1S6VB 1F1CA 2RMZA 1JDLA 2QG4A 3PXTA 4XYDB 1CXAA 1CSXA 4WQDA 3WFEC 3SWSA 1CYIA 1GU2A 5CIGB 1LC2A 1CEDA 1FCDC 3L4MA 2N18B 1RZ5A 2VHDA 1H1OA 4MU8A 2CA4B 2FWLA 4FA1A 1NNOA 1GIWA 1KB0A 3ZIYA 2N9YB 1NU1D 1QL3A 1CRCA 1C7MA 1CRYA 4Q5PA 1QKSA 3OA8A 2GC4D 3L4OA 3DR0A
chains in the Genus database with same CATH superfamily
4YTPC 1JY2O 2PRRA 1IFIA 2C9XB 3R4YA 3P8CE 3SVWA 3L70E 4AAMA 1SQQK 4UB6V 4H13C 1CW5A 1FZCB 1HH7A 3CI9A 5AVUB 3TNUB 1PP9D 5APTA 1JCCA 2NPSA 1JTHB 3FWNA 3CD6P 3N7NA 3CCJP 1FZFA 1HJ3A 4Y5RA 4H13D 5APWA 3MTUE 2M0BA 3FXDA 5B66V 1EDIA 4OH8B 4L3HA 1SQPD 4EIDA 2QEXP 1SVFA 2PFXA 1SQBK 3VMYA 4KT0J 2Y0CA 3W67A 2K1AA 4H13B 4EIFA 1S3JA 1SS1A 3BASA 3E1RA 1FI3A 4KHXA 3CU4A 5CCGC 1CNOA 2BCCD 1H33B 1JY2P 1SFCC 4GIFA 3BCCD 5KAFH 1AKKA 1IO4A 1BSNA 1KTMA 5CCGD 3GF7A 1VQOP 1AOFA 1QVGO 1AFOA 1SFCD 4H0JA 1FZEA 1OW7A 3RBZA 1IK7A 2EXVA 3PH2B 3O20A 1KV9A 1CTZA 1KYOI 3H1HG 3VN0A 3H32A 3SLEA 2H8PD 2CA3B 3MP7B 2NPSC 1NAFA 1JO5A 1VQPP 5TISV 4KJMA 4R4MA 2WPVB 1L0NE 1K73Q 2NPSD 3GMAA 3FXEA 1U7MA 1G1JA 2E76C 3O0RC 3II6A 4LGDE 1L0LG 1K04A 3U1CA 2NPSB 1PP9E 2C2CA 2PGDA 1FJ0A 2E76D 1VQNP 1QEXA 3O5CA 3O6QA 3M9HA 4WQCA 3VTPC 1N73B 1SP4A 2ZBOA 4XFJA 1SQPE 1OFCX 2K9YA 3MHVA 1FU1A 1L9BC 3L72D 2CXBA 2KZJA 1CYCA 1NHLA 2ZVOB 2AXCA 3AEAC 4U7JA 3L74D 1NU1J 3TGUG 1KYOH 1N7SA 2BCCE 4IL6V 2B4ZA 1VQLP 2KB7P 4UB8V 1SQVE 4MN4C 5AW7B 1PGQA 2I1KA 2SPZA 1KX2A 1HRCA 3M0DA 3SFEC 1IFJA 2YKOA 1H32A 3SWYA 3H32B 1OVVA 1CHJA 2L5GB 3VMAA 1NTKE 4RESB 3AE1C 4AAOA 4PD4I 4EDFA 1HJ4A 1YI2P 2FRCA 3CCRP 1T8ZA 1U7JA 2M5AA 3P7KA 1VPCA 1LP1A 5M1BA 1K3HA 2A06G 1P84I 4RJTA 5B5EH 3RL0g 451CA 4WVZA 1SQXJ 1K3GA 3CC2P 4BRYA 2C9LY 2N1TA 1T2KC 4DOJA 1CTJA 1FJKA 5APVA 1CIHA 1FOSE 4GOFA 4K35A 1H9XA 4WQBA 2YXRB 1N7SC 3O6QB 3MK7C 1GW3A 1T2KD 1BGYG 2QIWA 1COTA 3EQ2A 3CCUP 3G9RA 5BU5A 1N7SD 1RE3A 1S5LH 3M0DC 1KILD 1Y47A 3NXSA 4I6MC 4L73A 3L72E 1YTCA 1OIPA 1PGJA 3RK2C 1S2EA 3D6YA 2YQBA 2KS1A 5BVZA 1WEJF 1N7SB 3CX5W 2W8ZA 3L74E 2Q5UA 3RLMA 1JM0A 1PPJD 4D6TD 3RK2D 3AE4C 4PD4H 4WBAA 1YIJP 4UB6H 2OZ1A 3PP5A 4O1QA 3DMIA 1QGKB 2V7QH 1H32B 3ZOOA 5CIBB 1GQ1A 1HF9A 1P84H 2N1TC 3RK2B 1HH0A 2D2CC 4PJ0V 1I55A 4ASVA 5B66H 1H9YA 1KYOW 2W6JH 1J2JB 1AJYA 3M06A 5B6QA 2N1TD 5KLVE 2M5AB 3AE7C 2D2CD 2IPPA 3WU2H 2YIUB 3CCVP 2IZ0A 1LP1B 2LKMA 3SJLA 1OW8A 1RE3C 1K9MQ 3TYYA 1DX7A 5AVXB 2AEFA 3KXDA 4BRYB 2N1TB 4FAVA 2D2CB 1NKNA 3L73E 2FYUJ 1PGPA 2QE7H 1VDFA 5K5GB 2N9BA 3VRDA 1C75A 3CMAP 1OW6A 4GT1A 2DW3A 5AW1B 2ZONG 5CHXA 1SQQJ 1NVOA 4U3FD 5CBOA 2N3YA 3L75G 3VMXA 2C1UA 1A2SA 3HUSA 1N2DC 1IC2A 3B5NA 3VP9A 2KS1B 1CRGA 3LIEA 2QVAA 3V5BA 2IBZD 1WT6A 1Q7YQ 1SQBJ 3USSA 2I1JA 1BL9A 1MKMA 1GD2E 3S9OA 5KAFV 2DVHA 3CXHD 3L71G 1YJNP 4D6TE 2K3RA 2OZ1B 2L4DA 4YPCA 3NTNA 4L75A 4L3GA 4H0KA 4DT0A 1C52A 4TT3H 3S1KA 2P67A 1Q81Q 1RQUA 1L0LD 1S6VB 1NU1K 5AW4B 3V4WA 1VQMP 3PXTA 1CSXA 3CCQP 3SWSA 1GU2A 5CIGB 1LC2A 1JY3O 3L4MA 1H1OA 1GIWA 1KB0A 3HUSC 3ZIYA 4IL6H 3A0HE 3CPWO 2WQYC 3B5NC 1C7MA 4UB8H 1Q86Q 5APQA 1CI6A 1C6SA 3TGUD 3CWBG 2E74C 3B5ND 1KIBA 3OCDA 2D0WA 1LTIC 2J5UA 3L35A 1YQ4C 1N86A 4EICA 2IDBA 1H89A 3HUSB 3B5NB 3MUDC 1T3UA 3VNWA 1VF5B 5IY51 2LITA 3AEDC 2W83C 4ZNCA 3H1HE 1M6ZA 1E5WA 2E74B 2YXQB 3JSVC 1X79B 1F1FA 3CXHE 3L70D 4W7ZA 1BCCJ 3KZIV 1YTZT 3OJAB 1FOSF 5GTHE 3PRJA 1NMLA 2Z5HA 4FB1A 4A7PA 3N4XA 2A06D 1RY3A 1AQ5A 1N15A 4O1WA 4L76A 3B4SA 4GEDB 3Q1MA 3H1KE 4ASWA 1ZOYC 1NWQA 1L0LE 1EZVI 1QX8A 1M56D 1LS9A 4PV1C 2QM8A 2ZFCA 1BGYD 2KYVA 3CCLP 2XZRA 1EB7A 2E75C 4NPEA 2K37A 3A0BV 4PV1D 1X0TA 2BLFB 1C6RA 5B5EV 4N0KA 3V4QA 2JP3A 1CCHA 1FDOA 2P58A 2E75D 2ZT9C 4IL6X 2WZ7A 1VYDA 4C46A 5CIEB 1CI6B 1NJIQ 2B11B 3OCDB 2ZT9D 3TGUE 5DJTB 2WSEJ 2NZ2A 1IZL0 4PD4E 3WFDC 2E75B 4UB6E 1VQ4P 2QM7A 4PJ0H 3PJSK 1MFZA 4OWFA 1S5LV 2W27A 1RHZB 3QWOC 2P2UA 1OWAA 1KQGB 4BWNA 1P84E 3D71A 2ZOOA 3HE4A 4JBZA 2AXTV 1L0ND 5B66E 2QSIA 1IFDA 1OAEA 5AW3B 1ZLLA 1FAVA 4DJGA 1LTGC 2GB8B 2Y0EA 3G6EP 2RKLA 3BVHA 2A06E 5AW8B 3G3ZA 4IFMA 3HQ6A 1HGVA 1NIRA 2KXPB 2QJPC 1N73A 1LMSA 2K9JA 3U1AA 1QN2A 1NAYA 1PZQA 4WB4A 4JCGA 3WU2V 3ZBMA 1BGYE 2XV5A 5CIFB 1PP9J 1FE6A 5APUA 3CX5I 1DW2A 1JB0J 2KZIA 1SQQG 2YCCA 2HR3A 3M91A 3L75D 1GJQA 2LXCB 2M8RA 5TISE 1GK4A 1SQPJ 1SQVD 5CBNA 2QJPB 2YO3A 3AE5C 1W5CE 1RAPA 2E5TA 2LXBA 3SSUA 2E5YA 2B12B 4YE1A 1KC8Q 3L4FA 1CSUA 1QYZA 3L71D 1AV1A 3RBXA 2AEJA 4B86A 1NTME 1CTYA 3RN0A 2BCCJ 3BCCJ 1NTKD 1M60A 5C0ZA 3IAOA 1AYGA 2OARA 3HE4B 3CYTI 3F89A 4GDOA 1L0LK 4TLFA 2XKMA 1N73C 2WPQA 1OXZA 3RL0C 2AIUA 1RAQA 3R2PA 3H1KG 2WWWA 4O9BA 1VQKP 2OGUA 3RL0D 3A3YB 3NBTA 4DZOA 5AVRB 5GTIH 2PCBB 3M97X 4IL6E 2BGVX 3CX5H 1J3SA 2O01J 1DIIC 4CPGA 2GM4A 4UB8E 3LIDA 4RKUJ 2K9JB 3RL0B 3RGUA 3I5CA 3TYIA 5AVYB 1KB9D 1HCMA 2Q1KA 3CWBD 1R5SA 1PV3A 2ZYDA 3Q5SA 3SWKA 1CRIA 2IZ1A 2B87A 1W2BO 3H1IG 5AW5B 4AUWA 1EDJA 3BATA 5APYA 3L75E 1W5CT 2N9JA 1ZRTD 2Y9YA 3KZIH 1D7MA 3HRNA 1J1DC 3LW5J 3L72J 3M9BA 3SXTA 2ZZS1 2YO2A 1HJ0A 2IX7C 2OYIA 3L71E 1JNMA 1XTGB 3L74J 1M70A 2ITAA 2CE1A 3WUTA 3TF5A 1BCCG 5KLVD 3H1JG 4IFFA 1MZ9A 2LR2A 1N50A 1OX3A 4Z1MH 1NTZG 1J1DB 2C1DA 1X8YA 1M1KQ 5C39A 1CHHA 3A0BH 1HWTC 1OZHA 1I8OA 3L73D 1CO6A 3CP5A 1PFIA 4N6JA 2N3BA 1GW4A 2NRGA 2WPRA 1LTBC 1G1IA 4W7YA 2UWJE 3AE3C 2AEMA 1FZAA 1KB9E 1N9CA 1CHIA 3CWBE 1S9KD 1HZUA 1JMBA 2B87B 5DJUB 2OYIC 1IFMA 4YXWH 1BE3G 2AXTH 1QL2A 3H1LG 2GC7D 1NKZB 1WMKA 2C0XA 2MJZA 1GL2A 1L0NK 2QG4A 1NTMG 1ZRTE 2YIUC 1FC2C 1M90Q 1GU4A 4WQDA 4N78D 1IFNA 1FCDC 1RZ5A 1NGMB 1LTAC 2CA4B 2OYIB 2KIKA 2G8YA 2H89C 4EOTA 5APXA 4Q5PA 2KSJA 3AEEC 5BU8B 1M1JA 4D6TJ 3L4OA 1IK9A 3VYIA 1ZR2A 5CIDB 4XE5B 4GYDA 1X22A 2C1DB 1SQPK 3QH9A 2FYNC 3V2PA 1C6OA 2Z5IA 3EFGA 5APSA 5KJ7A 2HV4A 1H31A 3B8EB 3X39A 2VRSA 1YHQP 1KYOD 1SQQD 3D6ZA 1LFMA 2OTJP 1ETPA 1GL2C 5KAFE 1KZUB 1SQVK 2KLVA 1KQFB 4GOEA 2FYNB 2O01N 1E2RA 4C7NA 1A02F 1JY3N 1GL2D 1DW1A 2BEZF 2ZXEB 2ZJSE 1FHBA 1S5LX 4H0LC 1I6DA 2ZVNB 5KAIV 1S9KE 5AVSB 3AEFC 3CCMP 1NTKK 3H1HD 3AE9C 3BRTB 2YKPA 5CJ0A 4H0LD 1GL2B 1M1JC 1UIXA 3TDKA 2WSEH 1DEEG 1MV8A 4U3FJ 1IJDB 3PHLA 3BCCG 2N9IA 4HJGH 1QL1A 2WMMA 3HD7A 1OVRA 4N78E 4H0LB 155CA 1PL5A 1U57A 3PLNA 3SFDC 3V2RA 5KJ7C 1FI7A 3A9FA 3H1KD 4ZKUA 4ZKPA 1M1JB 4L1QA 1FBMA 4EYYQ 2WT7A 3CX5E 4OVNF 1L9JC 1JCDA 2R44A 3OW2O 4AANA 2WITA 1YYCA 1RH5B 3VYMA 2OTKE 3ZCFA 5KKZB 1H31B 1JEKA 4RO0A 1L0LJ 4WY4A 1J1EC 1RE4A 1VF5C 1MFTA 1X9VA 3H1ID 5GTIV 1KYOE 1MG3D 1SQQE 3NFQA 4PD4D 1CSWA 4C7NB 1NU1G 1VF5D 1PGOA 3HD7C 2Q3EA 2E74D 2JWDA 4XXLA 1Q90D 1P84D 2B0ZB 1HVVA 2BEQD 1J1EB 1HJBA 3HD7D 2OTLP 2WSFJ 3JC22 2KK7A 1JUNA 3TGUJ 5KLVK 1FDMA 2WTYA 1ZZHA 1EZVG 4V2KA 3KDPB 2XTSB 4AYCA 3H1JD 4R4LA 3M9QA 1M8OB 2QRXA 3HD7B 1ZMEC 2PCCB 1NTZD 2Z4EA 4WQ9A 5B5EE 1ZN5A 2JKVA 3AE8C 1AQTA 1KV4A 1LTJA 1RF0A 2H7HA 4WY4C 1RE4C 1SQXG 2KOGA 2BCNB 2J59M 1IQCA 1IFPA 2WT7B 1JY2N 3UIAA 3L70J 4BXLA 1OVUA 4WY4D 1VL2A 1S4XA 1IRWA 1S5LE 4JPZB 2HPCA 4EI2A 351CA 2O01H 1S72P 1YICA 3O8ZA 5H2FV 3NWVA 2E43A 4WY4B 1CRHA 1VQ8P 1GDTA 2AXTE 2YMKA 1ZXGA 5TJHA 3CL3D 1BE3D 2JWAA 1EXIA 1CIEA 1K8AQ 1IRVA 3H1LD 4JYCA 3OAKA 1FI9A 5GTHV 1KX7A 1FDIA 4I7ZC 2L91A 3H1IE 1BGYJ 4FA4A 1YCCA 1YEBA 3CMEP 2W90A 2V08A 2ZYAA 1MUUA 2M3BA 1AVOA 1GU5A 1HBWA 1NTMD 1N7LA 2B89A 2KP8A 2V4HA 2HLOA 2ZYGA 1BDCA 1LTJC 3W68A 1RF0C 1LWUA 2JTIB 1ZR4A 1CSBA 1SLQA 4I7ZB 5L8RJ 1T3JA 3LW5H 2C0WA 1KD1Q 1DIPA 2R3CA 1H0TA 1BCCE 3WU2E 1CRJA 4WQEA 1SFCA 1U75B 3H1JE 5CIHB 3PH0A 1USDA 1NTZE 2B9BA 1JOCA 1LTJB 5E79V 2BPBB 3ITKA 1GKSA 1L0NJ 1NOHA 2ZXYA 5CYTR 1DH3A 1W2EA 2J58A 3CLQA 1YJ9P 5CCHA 1HZVA 2C8SA 2IFMA 2FYUG 3G71P 3GHGA 3EWKA 3WC8A 4EIJA 4ZMDA 1CXCA 5KAIH 2HPCB 1PIXA 1E29A 1I6EA 1YTZI 1N90A 3C2CA 1LWUC 2ZXXA 4WQ8A 1W2LA 3FGAD 3HQ8A 2JQRA 1MZ4A 1BE3E 5EXQA 2QJYC 3H1LE 1A8CA 2OYOA 1H88A 2FYZA 1HROA 1CZQA 1ZP0C 4L74A 4W80A 2BH5X 1SQBG 2XU6A 4C7RA 1IO3A 2R5DA 2V07A 4K3AA 4WQ7A 5DJQC 2RN0A 1B7VA 3L75J 4K3IA 4U3FG 1RF1A 3TSIA 2KUBA 1LWUB 2JO1A 3AE2C 1SQVJ 1UIIA 2FBWC 2CPSA 1C2RA 4PWAA 3FWLA 2QJYB 3HQ9A 3ORVA 5AVVB 1HGZA 2HFED 5CCHC 2IBZG 1QL4A 3I55P 2IFNA 3L71J 1H0TB 3GHGC 2LIRA 1SFCB 1G2CA 1GDVA 2N18C 5DJQB 1USEA 4WWIA 1NTKJ 3RMZA 5CCHD 4IFDK 1YIQA 3KHUA 2P1JA 3CCEP 1DVHA 5AVTB 1EC5A 1KFNA 1LT9A 1M7LA 2E42A 1YITP 1EDKA 3JCUH 4XYDB 1CXAA 1K05A 1GMJA 2IBZI 3A7OA 3GHGB 4Y99C 3VP8A 2KNCA 2N18B 3H25A 3CXHI 2FWLA 4FA1A 1L4AA 2N9YB 4GKGA 1NU1D 1QL3A 1CRYA 2P10A 1QKSA 1RF1C 3E1IA 3OA8A 3KPEA 2WSCJ 2DGEA 3EFFK 2E76B 2H88C 2FXOA 1R0QA 4Y99B 3A0HH 1DW0A 3RN1A 2C9NY 3CWBJ 1URQA 3IN6A 3U59A 4HH2A 1AOQA 1EZVD 3IF4A 3K5BA 2KI7B 4AALA 2Q3IA 5DF5A 1KILA 1NTZK 3BCCE 1RF1B 1I5TA 4M3LA 1DD3A 1WVEC 2Q7CA 1CSVA 5AW9B 1LT9C 3V6IA 4J20A 2G3AA 2BASA 3AEBC 1LC1A 1SQXD 2YMYA 3VMZA 2FY8A 4FANA 1G2CB 1RZ6A 3IFMA 1CIFA 4I1LA 3RK3C 2ZAEB 1E79H 1L4AC 2P7JA 3HE5A 5KTBA 5H2FH 2RH0A 3WFBC 2PAJA 3L70G 3JBTB 3CXHH 4HYTB 5KLVJ 2W6AA 1GTWA 1LT9B 3RK3D 5GTHH 1L4AD 1IZNB 2WVRA 1GK6A 3G4SP 2YNYA 1NMIA 1LTTC 3CCSP 2KNCB 4H44C 1URQC 3L73J 3RK3B 3CC4P 1L4AB 2H43A 1NTMK 1NYHA 1KILC 4PJ0E 1NU1E 4H44D 1NO4A 1URQD 1CORA 3OA8B 3B71A 2Q9IA 2CE0A 3KQGA 4NPDA 4YXDC 5C9MA 2JR8A 2WPSA 1R8EA 2AI5A 3ZOXA 4H44B 1DEBA 2B88A 1LJ2A 1URQB 3GF3A 1FZGA 2HYNA 1CIGA 1AA0A 5E79H 3C1LA 3MK7B 1CCRA 3Q5PA 1YFCA 1EZVE 1KILB 2WSFH 2OYHA 3S4RA 1Q2NA 3PTZA 1A56A 3CX5D 3HTKA 1NH4A 2CK3H 1KQLA 4Y28J 2C1VA 3GLMA 2WSSH 3ZDMA 2QJKC 1OCDA 1L0NG 1LNQA 1KN7A 2O1KA 1YEAA 1FS0E 1SQXE 2KSEA 4NFGB 2FYUD 2I8FA 3HQ7A 3HE5B 3KYQA 4I2LC 5KAIE 4FA9A 1QLED 3RK3E 1PP9G 2MTAC 2HODA 2Y9ZA 4DCKA 2HG5D 2YKQA 1T6AA 4LC1A 2QJKB 3SWFA 5CICB 1KQSO 1R5LA 1Y8AA 1VQ6P 1SQPG 4IOIH 2A45G 1H8AA 2JEEA 1OMIA 3MGNA 3CXHW 3D70A 1SQBD 2OYHC 1KFMA 1LGHB 1ZV8A 3Q3DA 3C9IA 4HB1A 3WUIA 1AVYA 2BCCG 5AURA 2GA1A 1KILE 1YBKA 1JMMA 2MKVA 2R3SA 1DVVA 5TISH 1SQVG 1Q82Q 2A45I 3MD0A 3Q5RA 3WMM0 1Z56A 1XTCC 3V2NA 4AX3A 5DFSA 5CMZA 4XA4A 2OYHB 4JF7A 3H1HJ 3ZOYA 1LT1A 5KKZC 1PPJE 4N3YB 4GODA 4DY9A 1HJ5A 2Y0DA 2IYPA 5GTIE 2CPBA 1NTKG 3GG2A 2QA4P 3O1YA 3HTKB 5KLIC 2IYOA 5KJ7D 3OA7A 5AVWB 2FXMA 2D0SA 1FJPA 2MHMA 3JCUE 1FZBA 3MUDA 4JYBA 3A2AA 1FOCA 3T97A 1CC5A 3NBSA 4WQAA 4PW9B 2FXPA 2O1JA 1MG2D 1E8EA 2FYUE 3L36A 3H1KJ 4AQRD 2FKWB 3NMDA 4RSZA 1BDDA 1VQ5P 2OQQA 3AECC 2HODB 1KORA 1BSHA 5CJ4A 5KLIB 4QAOA 4P4QB 3KZIE 1S1CX 1L2PA 3PXWA 2POHA 3IR9A 1DT1A 2R5BA 3PXSA 1I8PA 2K88A 2A45H 2GIWA 1CYJA 1RQVA 2XDJA 3H6PA 3L72G 1C2NA 1EQ7A 1YNRA 1SQBE 3H1IJ 5AW0B 3I56P 2FFDA 2PACA 1YJWP 2M3EA 1EDLA 4U3FE 4FA5A 3L74G 1BCCD 3CC7P 2XNXA 1GZLA 3GW6A 4NPFX 1I54A 1HUCA 1EXJA 2Q6QA 3AE6C 2V7QJ 1SQXK 3A0HV 3WUVA 3C8VA 1M57D 3A0BE 2JDIH 2XNDH 5EFWB 1KB9I 2IBZE 1JY3P 5H2FE 3E7KA 1DD4A 3D0WA 2O3JA 4LLHA 3P8CD 5AW6B 1DW3A 3M0AA 2KLUA 3MIWA 3WFCC 3VOPA 3H1JJ 1KMIZ 3FX0A 3Q2YA 4QMAA 1FZCA 4KMGA 3TNUA 3AEGC 5KLVG 1NTZJ 3F5HA 3T97B 1JTHA 3P8MC 4LJIA 1U74B 2BH4X 1QVFO 3ZOWA 3L73G 1Y9BA 2FFDC 1DIQC 3V2QA 4OGQC 4EIEA 1LTSC 3ABVC 2B10B 5AVQB 3DP5A 2W6BA 1H33A 2ORLA 1VQ9P 2YK3A 4OGQD 2JJLA 5AVZB 4HKZH 3TK1A 1TU3F 5E79E 3MZWB 1N8RQ 1WRGA 1ZW0A 2WSCH 4PV1B 1VQ7P 1BE3J 3BRVB 1F1CA 2GUVA 1KB9H 2FFDB 2RMZA 1JDLA 3H1LJ 2PP6A 4JQ0D 3P32A 4OGQB 3WFEC 1CYIA 2R32A 5CCGA 1CEDA 1FZCC 4MU8A 2VHDA 1NTMJ 1YQ3C 5AW2B 1NNOA 1PPJG 4D6TG 2I8DA 1A02J 2ZT9B 1CRCA 1HTLC 2FYUK 2GUSA 3L37A 3WUUA 3A5TA 2GC4D 3DR0A
chains in the Genus database with same CATH topology
1C6SA 5CIDB 3TGUD 4GYDA 2C9XB 2DGEA 1KIBA 3OCDA 1R0QA 2C1DB 2D0WA 3SVWA 4AAMA 1DW0A 4UB6V 3RN1A 1HH7A 1C6OA 1PP9D 4EICA 1AOQA 1EZVD 4AALA 5DF5A 2HV4A 1HJ3A 4Y5RA 1H31A 3VNWA 1I5TA 5IY51 5B66V 1WVEC 2LITA 3X39A 1CSVA 1KYOD 1SQPD 4L3HA 4EIDA 1M6ZA 1SQQD 1LFMA 1ETPA 1F1FA 4J20A 3L70D 2Y0CA 2FYNB 1E2RA 4EIFA 3KZIV 1LC1A 1SQXD 3PRJA 1NMLA 1FI3A 4FANA 1DW1A 3CU4A 1RZ6A 4FB1A 1FHBA 4A7PA 2A06D 1CIFA 1I6DA 1CNOA 2BCCD 1H33B 3BCCD 1N15A 4O1WA 3WFBC 5KAIV 1AKKA 3JBTB 4GEDB 3H1HD 1AOFA 3TDKA 4H0JA 1LS9A 3PHLA 2N9IA 1BGYD 2EXVA 3PH2B 3O20A 1NMIA 1KV9A 1CTZA 1EB7A 2KNCB 3SLEA 3A0BV 2BLFB 155CA 1C6RA 5B5EV 2CA3B 4N0KA 3PLNA 1CCHA 5TISV 1FI7A 3A9FA 3H1KD 1CORA 3OA8B 4L1QA 1VYDA 5CIEB 2CE0A 2B11B 5C9MA 1L9JC 3OCDB 2AI5A 1IZL0 4AANA 3WFDC 3O0RC 3ZOXA 1CIGA 1S5LV 3VYMA 2C2CA 3MK7B 1CCRA 1YFCA 1FJ0A 3ZCFA 5KKZB 1H31B 2ZOOA 3O5CA 2AXTV 1L0ND 4WQCA 3PTZA 2ZBOA 3H1ID 1A56A 3CX5D 5GTIV 1MG3D 4PD4D 1CSWA 1L9BC 1OAEA 2C1VA 3L72D 1OCDA 2CXBA 1CYCA 1YEAA 2Q3EA 4NFGB 2GB8B 2FYUD 2Y0EA 2I8FA 3HQ7A 3L74D 4XXLA 1P84D 2B0ZB 4IL6V 2B4ZA 4FA9A 3HQ6A 1NIRA 4UB8V 1LMSA 2MTAC 1KX2A 1ZZHA 1HRCA 1QN2A 4V2KA 2XTSB 4JCGA 3H1JD 3WU2V 3ZBMA 2QJKB 1H32A 5CIFB 5CICB 2PCCB 1NTZD 4WQ9A 1DW2A 1CHJA 2YCCA 3VMAA 3L75D 4AAOA 1GJQA 4EDFA 1HJ4A 2FRCA 3CXHW 1SQBD 1SQVD 2QJPB 2BCNB 1RAPA 1IQCA 2B12B 1K3HA 3WUIA 4RJTA 4YE1A 5AURA 451CA 1CSUA 1K3GA 1QYZA 3L71D 1IRWA 1DVVA 1CTJA 1CTYA 3RN0A 1NTKD 4AX3A 351CA 1CIHA 1M60A 5C0ZA 5DFSA 1H9XA 1AYGA 4WQBA 1YICA 5H2FV 3NWVA 3MK7C 1CRHA 3ZOYA 1COTA 3CYTI 5TJHA 1BE3D 2JWAA 1CIEA 4DY9A 1IRVA 1HJ5A 3H1LD 2Y0DA 1FI9A 5GTHV 1KX7A 2L91A 3GG2A 4FA4A 1YCCA 3O1YA 1YEBA 2D0SA 2AIUA 2V08A 1RAQA 2MHMA 1NTMD 1YTCA 1FOCA 1CC5A 3NBSA 2YQBA 4PW9B 4WQAA 2KS1A 1WEJF 1MG2D 3NBTA 1E8EA 3CX5W 2PCBB 3M97X 2BGVX 3RLMA 2JTIB 1J3SA 1PPJD 4D6TD 4RSZA 1DIIC 2K9JB 2OZ1A 5KLIB 3TYIA 1KB9D 1HCMA 4O1QA 3DMIA 4QAOA 4P4QB 1H32B 3ZOOA 3CWBD 1CRJA 4WQEA 1U75B 5CIBB 1GQ1A 5CIHB 1CRIA 3PXWA 4PJ0V 1I55A 1DT1A 3PXSA 1I8PA 1H9YA 1KYOW 5E79V 2BPBB 3ITKA 1GKSA 2GIWA 1W5CT 2ZXYA 5B6QA 1CYJA 2N9JA 1ZRTD 1C2NA 5CYTR 1YNRA 2YIUB 2PACA 3SJLA 1HZVA 2C8SA 4FA5A 1BCCD 3WC8A 3GW6A 3SXTA 1I54A 2ZZS1 1CXCA 4FAVA 3A0HV 1M70A 3VRDA 1C75A 1E29A 2CE1A 3TF5A 1I6EA 1N90A 3C2CA 5KLVD 2ZONG 2O3JA 4WQ8A 1W2LA 3HQ8A 1DW3A 1N50A 2JQRA 1MZ4A 4U3FD 2C1DA 3WFCC 2N3YA 5EXQA 1A8CA 1CHHA 4KMGA 2C1UA 1HROA 1A2SA 1I8OA 2BH5X 3L73D 1IO3A 2V07A 4WQ7A 5DJQC 2RN0A 1CO6A 1B7VA 1CRGA 4K3IA 2IBZD 4LJIA 3CP5A 1U74B 2BH4X 1BL9A 3ZOWA 5KAFV 2DVHA 3CXHD 2N3BA 1C2RA 4PWAA 1DIQC 2OZ1B 3FWLA 2QJYB 2L4DA 3HQ9A 3ORVA 1QL4A 4EIEA 4L3GA 4H0KA 1C52A 2B10B 2LIRA 1N9CA 1CHIA 1GDVA 3DP5A 2N18C 5DJQB 1H33A 1HZUA 2ORLA 3RMZA 2YK3A 1YIQA 3KHUA 2GC7D 1DVHA 1L0LD 1S6VB 1F1CA 2RMZA 1JDLA 2QG4A 3PXTA 4XYDB 1CXAA 1CSXA 4WQDA 3WFEC 3SWSA 1CYIA 1GU2A 5CIGB 1LC2A 1CEDA 1FCDC 3L4MA 2N18B 1RZ5A 2VHDA 1H1OA 4MU8A 2CA4B 2FWLA 4FA1A 1NNOA 1GIWA 1KB0A 3ZIYA 2N9YB 1NU1D 1QL3A 1CRCA 1C7MA 1CRYA 4Q5PA 1QKSA 3OA8A 2GC4D 3L4OA 3DR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C6S A;  5CID B;  3TGU D;  4GYD A;  2C9X B;  2DGE A;  1KIB A;  3OCD A;  1R0Q A;  2C1D B;  2D0W A;  3SVW A;  4AAM A;  1DW0 A;  4UB6 V;  3RN1 A;  1HH7 A;  1C6O A;  1PP9 D;  4EIC A;  1AOQ A;  1EZV D;  4AAL A;  5DF5 A;  2HV4 A;  1HJ3 A;  4Y5R A;  1H31 A;  3VNW A;  1I5T A;  5IY5 1;  5B66 V;  1WVE C;  2LIT A;  3X39 A;  1CSV A;  1KYO D;  1SQP D;  4L3H A;  4EID A;  1M6Z A;  1SQQ D;  1LFM A;  1ETP A;  1F1F A;  4J20 A;  3L70 D;  2Y0C A;  2FYN B;  1E2R A;  4EIF A;  3KZI V;  1LC1 A;  1SQX D;  3PRJ A;  1NML A;  1FI3 A;  4FAN A;  1DW1 A;  3CU4 A;  1RZ6 A;  4FB1 A;  1FHB A;  4A7P A;  2A06 D;  1CIF A;  1I6D A;  1CNO A;  2BCC D;  1H33 B;  3BCC D;  1N15 A;  4O1W A;  3WFB C;  5KAI V;  1AKK A;  3JBT B;  4GED B;  3H1H D;  1AOF A;  3TDK A;  4H0J A;  1LS9 A;  3PHL A;  2N9I A;  1BGY D;  2EXV A;  3PH2 B;  3O20 A;  1NMI A;  1KV9 A;  1CTZ A;  1EB7 A;  2KNC B;  3SLE A;  3A0B V;  2BLF B;  155C A;  1C6R A;  5B5E V;  2CA3 B;  4N0K A;  3PLN A;  1CCH A;  5TIS V;  1FI7 A;  3A9F A;  3H1K D;  1COR A;  3OA8 B;  4L1Q A;  1VYD A;  5CIE B;  2CE0 A;  2B11 B;  5C9M A;  1L9J C;  3OCD B;  2AI5 A;  1IZL 0;  4AAN A;  3WFD C;  3O0R C;  3ZOX A;  1CIG A;  1S5L V;  3VYM A;  2C2C A;  3MK7 B;  1CCR A;  1YFC A;  1FJ0 A;  3ZCF A;  5KKZ B;  1H31 B;  2ZOO A;  3O5C A;  2AXT V;  1L0N D;  4WQC A;  3PTZ A;  2ZBO A;  3H1I D;  1A56 A;  3CX5 D;  5GTI V;  1MG3 D;  4PD4 D;  1CSW A;  1L9B C;  1OAE A;  2C1V A;  3L72 D;  1OCD A;  2CXB A;  1CYC A;  1YEA A;  2Q3E A;  4NFG B;  2GB8 B;  2FYU D;  2Y0E A;  2I8F A;  3HQ7 A;  3L74 D;  4XXL A;  1P84 D;  2B0Z B;  4IL6 V;  2B4Z A;  4FA9 A;  3HQ6 A;  1NIR A;  4UB8 V;  1LMS A;  2MTA C;  1KX2 A;  1ZZH A;  1HRC A;  1QN2 A;  4V2K A;  2XTS B;  4JCG A;  3H1J D;  3WU2 V;  3ZBM A;  2QJK B;  1H32 A;  5CIF B;  5CIC B;  2PCC B;  1NTZ D;  4WQ9 A;  1DW2 A;  1CHJ A;  2YCC A;  3VMA A;  3L75 D;  4AAO A;  1GJQ A;  4EDF A;  1HJ4 A;  2FRC A;  3CXH W;  1SQB D;  1SQV D;  2QJP B;  2BCN B;  1RAP A;  1IQC A;  2B12 B;  1K3H A;  3WUI A;  4RJT A;  4YE1 A;  5AUR A;  451C A;  1CSU A;  1K3G A;  1QYZ A;  3L71 D;  1IRW A;  1DVV A;  1CTJ A;  1CTY A;  3RN0 A;  1NTK D;  4AX3 A;  351C A;  1CIH A;  1M60 A;  5C0Z A;  5DFS A;  1H9X A;  1AYG A;  4WQB A;  1YIC A;  5H2F V;  3NWV A;  3MK7 C;  1CRH A;  3ZOY A;  1COT A;  3CYT I;  5TJH A;  1BE3 D;  2JWA A;  1CIE A;  4DY9 A;  1IRV A;  1HJ5 A;  3H1L D;  2Y0D A;  1FI9 A;  5GTH V;  1KX7 A;  2L91 A;  3GG2 A;  4FA4 A;  1YCC A;  3O1Y A;  1YEB A;  2D0S A;  2AIU A;  2V08 A;  1RAQ A;  2MHM A;  1NTM D;  1YTC A;  1FOC A;  1CC5 A;  3NBS A;  2YQB A;  4PW9 B;  4WQA A;  2KS1 A;  1WEJ F;  1MG2 D;  3NBT A;  1E8E A;  3CX5 W;  2PCB B;  3M97 X;  2BGV X;  3RLM A;  2JTI B;  1J3S A;  1PPJ D;  4D6T D;  4RSZ A;  1DII C;  2K9J B;  2OZ1 A;  5KLI B;  3TYI A;  1KB9 D;  1HCM A;  4O1Q A;  3DMI A;  4QAO A;  4P4Q B;  1H32 B;  3ZOO A;  3CWB D;  1CRJ A;  4WQE A;  1U75 B;  5CIB B;  1GQ1 A;  5CIH B;  1CRI A;  3PXW A;  4PJ0 V;  1I55 A;  1DT1 A;  3PXS A;  1I8P A;  1H9Y A;  1KYO W;  5E79 V;  2BPB B;  3ITK A;  1GKS A;  2GIW A;  1W5C T;  2ZXY A;  5B6Q A;  1CYJ A;  2N9J A;  1ZRT D;  1C2N A;  5CYT R;  1YNR A;  2YIU B;  2PAC A;  3SJL A;  1HZV A;  2C8S A;  4FA5 A;  1BCC D;  3WC8 A;  3GW6 A;  3SXT A;  1I54 A;  2ZZS 1;  1CXC A;  4FAV A;  3A0H V;  1M70 A;  3VRD A;  1C75 A;  1E29 A;  2CE1 A;  3TF5 A;  1I6E A;  1N90 A;  3C2C A;  5KLV D;  2ZON G;  2O3J A;  4WQ8 A;  1W2L A;  3HQ8 A;  1DW3 A;  1N50 A;  2JQR A;  1MZ4 A;  4U3F D;  2C1D A;  3WFC C;  2N3Y A;  5EXQ A;  1A8C A;  1CHH A;  4KMG A;  2C1U A;  1HRO A;  1A2S A;  1I8O A;  2BH5 X;  3L73 D;  1IO3 A;  2V07 A;  4WQ7 A;  5DJQ C;  2RN0 A;  1CO6 A;  1B7V A;  1CRG A;  4K3I A;  2IBZ D;  4LJI A;  3CP5 A;  1U74 B;  2BH4 X;  1BL9 A;  3ZOW A;  5KAF V;  2DVH A;  3CXH D;  2N3B A;  1C2R A;  4PWA A;  1DIQ C;  2OZ1 B;  3FWL A;  2QJY B;  2L4D A;  3HQ9 A;  3ORV A;  1QL4 A;  4EIE A;  4L3G A;  4H0K A;  1C52 A;  2B10 B;  2LIR A;  1N9C A;  1CHI A;  1GDV A;  3DP5 A;  2N18 C;  5DJQ B;  1H33 A;  1HZU A;  2ORL A;  3RMZ A;  2YK3 A;  1YIQ A;  3KHU A;  2GC7 D;  1DVH A;  1L0L D;  1S6V B;  1F1C A;  2RMZ A;  1JDL A;  2QG4 A;  3PXT A;  4XYD B;  1CXA A;  1CSX A;  4WQD A;  3WFE C;  3SWS A;  1CYI A;  1GU2 A;  5CIG B;  1LC2 A;  1CED A;  1FCD C;  3L4M A;  2N18 B;  1RZ5 A;  2VHD A;  1H1O A;  4MU8 A;  2CA4 B;  2FWL A;  4FA1 A;  1NNO A;  1GIW A;  1KB0 A;  3ZIY A;  2N9Y B;  1NU1 D;  1QL3 A;  1CRC A;  1C7M A;  1CRY A;  4Q5P A;  1QKS A;  3OA8 A;  2GC4 D;  3L4O A;  3DR0 A; 
#chains in the Genus database with same CATH topology
 4YTP C;  1JY2 O;  2PRR A;  1IFI A;  2C9X B;  3R4Y A;  3P8C E;  3SVW A;  3L70 E;  4AAM A;  1SQQ K;  4UB6 V;  4H13 C;  1CW5 A;  1FZC B;  1HH7 A;  3CI9 A;  5AVU B;  3TNU B;  1PP9 D;  5APT A;  1JCC A;  2NPS A;  1JTH B;  3FWN A;  3CD6 P;  3N7N A;  3CCJ P;  1FZF A;  1HJ3 A;  4Y5R A;  4H13 D;  5APW A;  3MTU E;  2M0B A;  3FXD A;  5B66 V;  1EDI A;  4OH8 B;  4L3H A;  1SQP D;  4EID A;  2QEX P;  1SVF A;  2PFX A;  1SQB K;  3VMY A;  4KT0 J;  2Y0C A;  3W67 A;  2K1A A;  4H13 B;  4EIF A;  1S3J A;  1SS1 A;  3BAS A;  3E1R A;  1FI3 A;  4KHX A;  3CU4 A;  5CCG C;  1CNO A;  2BCC D;  1H33 B;  1JY2 P;  1SFC C;  4GIF A;  3BCC D;  5KAF H;  1AKK A;  1IO4 A;  1BSN A;  1KTM A;  5CCG D;  3GF7 A;  1VQO P;  1AOF A;  1QVG O;  1AFO A;  1SFC D;  4H0J A;  1FZE A;  1OW7 A;  3RBZ A;  1IK7 A;  2EXV A;  3PH2 B;  3O20 A;  1KV9 A;  1CTZ A;  1KYO I;  3H1H G;  3VN0 A;  3H32 A;  3SLE A;  2H8P D;  2CA3 B;  3MP7 B;  2NPS C;  1NAF A;  1JO5 A;  1VQP P;  5TIS V;  4KJM A;  4R4M A;  2WPV B;  1L0N E;  1K73 Q;  2NPS D;  3GMA A;  3FXE A;  1U7M A;  1G1J A;  2E76 C;  3O0R C;  3II6 A;  4LGD E;  1L0L G;  1K04 A;  3U1C A;  2NPS B;  1PP9 E;  2C2C A;  2PGD A;  1FJ0 A;  2E76 D;  1VQN P;  1QEX A;  3O5C A;  3O6Q A;  3M9H A;  4WQC A;  3VTP C;  1N73 B;  1SP4 A;  2ZBO A;  4XFJ A;  1SQP E;  1OFC X;  2K9Y A;  3MHV A;  1FU1 A;  1L9B C;  3L72 D;  2CXB A;  2KZJ A;  1CYC A;  1NHL A;  2ZVO B;  2AXC A;  3AEA C;  4U7J A;  3L74 D;  1NU1 J;  3TGU G;  1KYO H;  1N7S A;  2BCC E;  4IL6 V;  2B4Z A;  1VQL P;  2KB7 P;  4UB8 V;  1SQV E;  4MN4 C;  5AW7 B;  1PGQ A;  2I1K A;  2SPZ A;  1KX2 A;  1HRC A;  3M0D A;  3SFE C;  1IFJ A;  2YKO A;  1H32 A;  3SWY A;  3H32 B;  1OVV A;  1CHJ A;  2L5G B;  3VMA A;  1NTK E;  4RES B;  3AE1 C;  4AAO A;  4PD4 I;  4EDF A;  1HJ4 A;  1YI2 P;  2FRC A;  3CCR P;  1T8Z A;  1U7J A;  2M5A A;  3P7K A;  1VPC A;  1LP1 A;  5M1B A;  1K3H A;  2A06 G;  1P84 I;  4RJT A;  5B5E H;  3RL0 g;  451C A;  4WVZ A;  1SQX J;  1K3G A;  3CC2 P;  4BRY A;  2C9L Y;  2N1T A;  1T2K C;  4DOJ A;  1CTJ A;  1FJK A;  5APV A;  1CIH A;  1FOS E;  4GOF A;  4K35 A;  1H9X A;  4WQB A;  2YXR B;  1N7S C;  3O6Q B;  3MK7 C;  1GW3 A;  1T2K D;  1BGY G;  2QIW A;  1COT A;  3EQ2 A;  3CCU P;  3G9R A;  5BU5 A;  1N7S D;  1RE3 A;  1S5L H;  3M0D C;  1KIL D;  1Y47 A;  3NXS A;  4I6M C;  4L73 A;  3L72 E;  1YTC A;  1OIP A;  1PGJ A;  3RK2 C;  1S2E A;  3D6Y A;  2YQB A;  2KS1 A;  5BVZ A;  1WEJ F;  1N7S B;  3CX5 W;  2W8Z A;  3L74 E;  2Q5U A;  3RLM A;  1JM0 A;  1PPJ D;  4D6T D;  3RK2 D;  3AE4 C;  4PD4 H;  4WBA A;  1YIJ P;  4UB6 H;  2OZ1 A;  3PP5 A;  4O1Q A;  3DMI A;  1QGK B;  2V7Q H;  1H32 B;  3ZOO A;  5CIB B;  1GQ1 A;  1HF9 A;  1P84 H;  2N1T C;  3RK2 B;  1HH0 A;  2D2C C;  4PJ0 V;  1I55 A;  4ASV A;  5B66 H;  1H9Y A;  1KYO W;  2W6J H;  1J2J B;  1AJY A;  3M06 A;  5B6Q A;  2N1T D;  5KLV E;  2M5A B;  3AE7 C;  2D2C D;  2IPP A;  3WU2 H;  2YIU B;  3CCV P;  2IZ0 A;  1LP1 B;  2LKM A;  3SJL A;  1OW8 A;  1RE3 C;  1K9M Q;  3TYY A;  1DX7 A;  5AVX B;  2AEF A;  3KXD A;  4BRY B;  2N1T B;  4FAV A;  2D2C B;  1NKN A;  3L73 E;  2FYU J;  1PGP A;  2QE7 H;  1VDF A;  5K5G B;  2N9B A;  3VRD A;  1C75 A;  3CMA P;  1OW6 A;  4GT1 A;  2DW3 A;  5AW1 B;  2ZON G;  5CHX A;  1SQQ J;  1NVO A;  4U3F D;  5CBO A;  2N3Y A;  3L75 G;  3VMX A;  2C1U A;  1A2S A;  3HUS A;  1N2D C;  1IC2 A;  3B5N A;  3VP9 A;  2KS1 B;  1CRG A;  3LIE A;  2QVA A;  3V5B A;  2IBZ D;  1WT6 A;  1Q7Y Q;  1SQB J;  3USS A;  2I1J A;  1BL9 A;  1MKM A;  1GD2 E;  3S9O A;  5KAF V;  2DVH A;  3CXH D;  3L71 G;  1YJN P;  4D6T E;  2K3R A;  2OZ1 B;  2L4D A;  4YPC A;  3NTN A;  4L75 A;  4L3G A;  4H0K A;  4DT0 A;  1C52 A;  4TT3 H;  3S1K A;  2P67 A;  1Q81 Q;  1RQU A;  1L0L D;  1S6V B;  1NU1 K;  5AW4 B;  3V4W A;  1VQM P;  3PXT A;  1CSX A;  3CCQ P;  3SWS A;  1GU2 A;  5CIG B;  1LC2 A;  1JY3 O;  3L4M A;  1H1O A;  1GIW A;  1KB0 A;  3HUS C;  3ZIY A;  4IL6 H;  3A0H E;  3CPW O;  2WQY C;  3B5N C;  1C7M A;  4UB8 H;  1Q86 Q;  5APQ A;  1CI6 A;  1C6S A;  3TGU D;  3CWB G;  2E74 C;  3B5N D;  1KIB A;  3OCD A;  2D0W A;  1LTI C;  2J5U A;  3L35 A;  1YQ4 C;  1N86 A;  4EIC A;  2IDB A;  1H89 A;  3HUS B;  3B5N B;  3MUD C;  1T3U A;  3VNW A;  1VF5 B;  5IY5 1;  2LIT A;  3AED C;  2W83 C;  4ZNC A;  3H1H E;  1M6Z A;  1E5W A;  2E74 B;  2YXQ B;  3JSV C;  1X79 B;  1F1F A;  3CXH E;  3L70 D;  4W7Z A;  1BCC J;  3KZI V;  1YTZ T;  3OJA B;  1FOS F;  5GTH E;  3PRJ A;  1NML A;  2Z5H A;  4FB1 A;  4A7P A;  3N4X A;  2A06 D;  1RY3 A;  1AQ5 A;  1N15 A;  4O1W A;  4L76 A;  3B4S A;  4GED B;  3Q1M A;  3H1K E;  4ASW A;  1ZOY C;  1NWQ A;  1L0L E;  1EZV I;  1QX8 A;  1M56 D;  1LS9 A;  4PV1 C;  2QM8 A;  2ZFC A;  1BGY D;  2KYV A;  3CCL P;  2XZR A;  1EB7 A;  2E75 C;  4NPE A;  2K37 A;  3A0B V;  4PV1 D;  1X0T A;  2BLF B;  1C6R A;  5B5E V;  4N0K A;  3V4Q A;  2JP3 A;  1CCH A;  1FDO A;  2P58 A;  2E75 D;  2ZT9 C;  4IL6 X;  2WZ7 A;  1VYD A;  4C46 A;  5CIE B;  1CI6 B;  1NJI Q;  2B11 B;  3OCD B;  2ZT9 D;  3TGU E;  5DJT B;  2WSE J;  2NZ2 A;  1IZL 0;  4PD4 E;  3WFD C;  2E75 B;  4UB6 E;  1VQ4 P;  2QM7 A;  4PJ0 H;  3PJS K;  1MFZ A;  4OWF A;  1S5L V;  2W27 A;  1RHZ B;  3QWO C;  2P2U A;  1OWA A;  1KQG B;  4BWN A;  1P84 E;  3D71 A;  2ZOO A;  3HE4 A;  4JBZ A;  2AXT V;  1L0N D;  5B66 E;  2QSI A;  1IFD A;  1OAE A;  5AW3 B;  1ZLL A;  1FAV A;  4DJG A;  1LTG C;  2GB8 B;  2Y0E A;  3G6E P;  2RKL A;  3BVH A;  2A06 E;  5AW8 B;  3G3Z A;  4IFM A;  3HQ6 A;  1HGV A;  1NIR A;  2KXP B;  2QJP C;  1N73 A;  1LMS A;  2K9J A;  3U1A A;  1QN2 A;  1NAY A;  1PZQ A;  4WB4 A;  4JCG A;  3WU2 V;  3ZBM A;  1BGY E;  2XV5 A;  5CIF B;  1PP9 J;  1FE6 A;  5APU A;  3CX5 I;  1DW2 A;  1JB0 J;  2KZI A;  1SQQ G;  2YCC A;  2HR3 A;  3M91 A;  3L75 D;  1GJQ A;  2LXC B;  2M8R A;  5TIS E;  1GK4 A;  1SQP J;  1SQV D;  5CBN A;  2QJP B;  2YO3 A;  3AE5 C;  1W5C E;  1RAP A;  2E5T A;  2LXB A;  3SSU A;  2E5Y A;  2B12 B;  4YE1 A;  1KC8 Q;  3L4F A;  1CSU A;  1QYZ A;  3L71 D;  1AV1 A;  3RBX A;  2AEJ A;  4B86 A;  1NTM E;  1CTY A;  3RN0 A;  2BCC J;  3BCC J;  1NTK D;  1M60 A;  5C0Z A;  3IAO A;  1AYG A;  2OAR A;  3HE4 B;  3CYT I;  3F89 A;  4GDO A;  1L0L K;  4TLF A;  2XKM A;  1N73 C;  2WPQ A;  1OXZ A;  3RL0 C;  2AIU A;  1RAQ A;  3R2P A;  3H1K G;  2WWW A;  4O9B A;  1VQK P;  2OGU A;  3RL0 D;  3A3Y B;  3NBT A;  4DZO A;  5AVR B;  5GTI H;  2PCB B;  3M97 X;  4IL6 E;  2BGV X;  3CX5 H;  1J3S A;  2O01 J;  1DII C;  4CPG A;  2GM4 A;  4UB8 E;  3LID A;  4RKU J;  2K9J B;  3RL0 B;  3RGU A;  3I5C A;  3TYI A;  5AVY B;  1KB9 D;  1HCM A;  2Q1K A;  3CWB D;  1R5S A;  1PV3 A;  2ZYD A;  3Q5S A;  3SWK A;  1CRI A;  2IZ1 A;  2B87 A;  1W2B O;  3H1I G;  5AW5 B;  4AUW A;  1EDJ A;  3BAT A;  5APY A;  3L75 E;  1W5C T;  2N9J A;  1ZRT D;  2Y9Y A;  3KZI H;  1D7M A;  3HRN A;  1J1D C;  3LW5 J;  3L72 J;  3M9B A;  3SXT A;  2ZZS 1;  2YO2 A;  1HJ0 A;  2IX7 C;  2OYI A;  3L71 E;  1JNM A;  1XTG B;  3L74 J;  1M70 A;  2ITA A;  2CE1 A;  3WUT A;  3TF5 A;  1BCC G;  5KLV D;  3H1J G;  4IFF A;  1MZ9 A;  2LR2 A;  1N50 A;  1OX3 A;  4Z1M H;  1NTZ G;  1J1D B;  2C1D A;  1X8Y A;  1M1K Q;  5C39 A;  1CHH A;  3A0B H;  1HWT C;  1OZH A;  1I8O A;  3L73 D;  1CO6 A;  3CP5 A;  1PFI A;  4N6J A;  2N3B A;  1GW4 A;  2NRG A;  2WPR A;  1LTB C;  1G1I A;  4W7Y A;  2UWJ E;  3AE3 C;  2AEM A;  1FZA A;  1KB9 E;  1N9C A;  1CHI A;  3CWB E;  1S9K D;  1HZU A;  1JMB A;  2B87 B;  5DJU B;  2OYI C;  1IFM A;  4YXW H;  1BE3 G;  2AXT H;  1QL2 A;  3H1L G;  2GC7 D;  1NKZ B;  1WMK A;  2C0X A;  2MJZ A;  1GL2 A;  1L0N K;  2QG4 A;  1NTM G;  1ZRT E;  2YIU C;  1FC2 C;  1M90 Q;  1GU4 A;  4WQD A;  4N78 D;  1IFN A;  1FCD C;  1RZ5 A;  1NGM B;  1LTA C;  2CA4 B;  2OYI B;  2KIK A;  2G8Y A;  2H89 C;  4EOT A;  5APX A;  4Q5P A;  2KSJ A;  3AEE C;  5BU8 B;  1M1J A;  4D6T J;  3L4O A;  1IK9 A;  3VYI A;  1ZR2 A;  5CID B;  4XE5 B;  4GYD A;  1X22 A;  2C1D B;  1SQP K;  3QH9 A;  2FYN C;  3V2P A;  1C6O A;  2Z5I A;  3EFG A;  5APS A;  5KJ7 A;  2HV4 A;  1H31 A;  3B8E B;  3X39 A;  2VRS A;  1YHQ P;  1KYO D;  1SQQ D;  3D6Z A;  1LFM A;  2OTJ P;  1ETP A;  1GL2 C;  5KAF E;  1KZU B;  1SQV K;  2KLV A;  1KQF B;  4GOE A;  2FYN B;  2O01 N;  1E2R A;  4C7N A;  1A02 F;  1JY3 N;  1GL2 D;  1DW1 A;  2BEZ F;  2ZXE B;  2ZJS E;  1FHB A;  1S5L X;  4H0L C;  1I6D A;  2ZVN B;  5KAI V;  1S9K E;  5AVS B;  3AEF C;  3CCM P;  1NTK K;  3H1H D;  3AE9 C;  3BRT B;  2YKP A;  5CJ0 A;  4H0L D;  1GL2 B;  1M1J C;  1UIX A;  3TDK A;  2WSE H;  1DEE G;  1MV8 A;  4U3F J;  1IJD B;  3PHL A;  3BCC G;  2N9I A;  4HJG H;  1QL1 A;  2WMM A;  3HD7 A;  1OVR A;  4N78 E;  4H0L B;  155C A;  1PL5 A;  1U57 A;  3PLN A;  3SFD C;  3V2R A;  5KJ7 C;  1FI7 A;  3A9F A;  3H1K D;  4ZKU A;  4ZKP A;  1M1J B;  4L1Q A;  1FBM A;  4EYY Q;  2WT7 A;  3CX5 E;  4OVN F;  1L9J C;  1JCD A;  2R44 A;  3OW2 O;  4AAN A;  2WIT A;  1YYC A;  1RH5 B;  3VYM A;  2OTK E;  3ZCF A;  5KKZ B;  1H31 B;  1JEK A;  4RO0 A;  1L0L J;  4WY4 A;  1J1E C;  1RE4 A;  1VF5 C;  1MFT A;  1X9V A;  3H1I D;  5GTI V;  1KYO E;  1MG3 D;  1SQQ E;  3NFQ A;  4PD4 D;  1CSW A;  4C7N B;  1NU1 G;  1VF5 D;  1PGO A;  3HD7 C;  2Q3E A;  2E74 D;  2JWD A;  4XXL A;  1Q90 D;  1P84 D;  2B0Z B;  1HVV A;  2BEQ D;  1J1E B;  1HJB A;  3HD7 D;  2OTL P;  2WSF J;  3JC2 2;  2KK7 A;  1JUN A;  3TGU J;  5KLV K;  1FDM A;  2WTY A;  1ZZH A;  1EZV G;  4V2K A;  3KDP B;  2XTS B;  4AYC A;  3H1J D;  4R4L A;  3M9Q A;  1M8O B;  2QRX A;  3HD7 B;  1ZME C;  2PCC B;  1NTZ D;  2Z4E A;  4WQ9 A;  5B5E E;  1ZN5 A;  2JKV A;  3AE8 C;  1AQT A;  1KV4 A;  1LTJ A;  1RF0 A;  2H7H A;  4WY4 C;  1RE4 C;  1SQX G;  2KOG A;  2BCN B;  2J59 M;  1IQC A;  1IFP A;  2WT7 B;  1JY2 N;  3UIA A;  3L70 J;  4BXL A;  1OVU A;  4WY4 D;  1VL2 A;  1S4X A;  1IRW A;  1S5L E;  4JPZ B;  2HPC A;  4EI2 A;  351C A;  2O01 H;  1S72 P;  1YIC A;  3O8Z A;  5H2F V;  3NWV A;  2E43 A;  4WY4 B;  1CRH A;  1VQ8 P;  1GDT A;  2AXT E;  2YMK A;  1ZXG A;  5TJH A;  3CL3 D;  1BE3 D;  2JWA A;  1EXI A;  1CIE A;  1K8A Q;  1IRV A;  3H1L D;  4JYC A;  3OAK A;  1FI9 A;  5GTH V;  1KX7 A;  1FDI A;  4I7Z C;  2L91 A;  3H1I E;  1BGY J;  4FA4 A;  1YCC A;  1YEB A;  3CME P;  2W90 A;  2V08 A;  2ZYA A;  1MUU A;  2M3B A;  1AVO A;  1GU5 A;  1HBW A;  1NTM D;  1N7L A;  2B89 A;  2KP8 A;  2V4H A;  2HLO A;  2ZYG A;  1BDC A;  1LTJ C;  3W68 A;  1RF0 C;  1LWU A;  2JTI B;  1ZR4 A;  1CSB A;  1SLQ A;  4I7Z B;  5L8R J;  1T3J A;  3LW5 H;  2C0W A;  1KD1 Q;  1DIP A;  2R3C A;  1H0T A;  1BCC E;  3WU2 E;  1CRJ A;  4WQE A;  1SFC A;  1U75 B;  3H1J E;  5CIH B;  3PH0 A;  1USD A;  1NTZ E;  2B9B A;  1JOC A;  1LTJ B;  5E79 V;  2BPB B;  3ITK A;  1GKS A;  1L0N J;  1NOH A;  2ZXY A;  5CYT R;  1DH3 A;  1W2E A;  2J58 A;  3CLQ A;  1YJ9 P;  5CCH A;  1HZV A;  2C8S A;  2IFM A;  2FYU G;  3G71 P;  3GHG A;  3EWK A;  3WC8 A;  4EIJ A;  4ZMD A;  1CXC A;  5KAI H;  2HPC B;  1PIX A;  1E29 A;  1I6E A;  1YTZ I;  1N90 A;  3C2C A;  1LWU C;  2ZXX A;  4WQ8 A;  1W2L A;  3FGA D;  3HQ8 A;  2JQR A;  1MZ4 A;  1BE3 E;  5EXQ A;  2QJY C;  3H1L E;  1A8C A;  2OYO A;  1H88 A;  2FYZ A;  1HRO A;  1CZQ A;  1ZP0 C;  4L74 A;  4W80 A;  2BH5 X;  1SQB G;  2XU6 A;  4C7R A;  1IO3 A;  2R5D A;  2V07 A;  4K3A A;  4WQ7 A;  5DJQ C;  2RN0 A;  1B7V A;  3L75 J;  4K3I A;  4U3F G;  1RF1 A;  3TSI A;  2KUB A;  1LWU B;  2JO1 A;  3AE2 C;  1SQV J;  1UII A;  2FBW C;  2CPS A;  1C2R A;  4PWA A;  3FWL A;  2QJY B;  3HQ9 A;  3ORV A;  5AVV B;  1HGZ A;  2HFE D;  5CCH C;  2IBZ G;  1QL4 A;  3I55 P;  2IFN A;  3L71 J;  1H0T B;  3GHG C;  2LIR A;  1SFC B;  1G2C A;  1GDV A;  2N18 C;  5DJQ B;  1USE A;  4WWI A;  1NTK J;  3RMZ A;  5CCH D;  4IFD K;  1YIQ A;  3KHU A;  2P1J A;  3CCE P;  1DVH A;  5AVT B;  1EC5 A;  1KFN A;  1LT9 A;  1M7L A;  2E42 A;  1YIT P;  1EDK A;  3JCU H;  4XYD B;  1CXA A;  1K05 A;  1GMJ A;  2IBZ I;  3A7O A;  3GHG B;  4Y99 C;  3VP8 A;  2KNC A;  2N18 B;  3H25 A;  3CXH I;  2FWL A;  4FA1 A;  1L4A A;  2N9Y B;  4GKG A;  1NU1 D;  1QL3 A;  1CRY A;  2P10 A;  1QKS A;  1RF1 C;  3E1I A;  3OA8 A;  3KPE A;  2WSC J;  2DGE A;  3EFF K;  2E76 B;  2H88 C;  2FXO A;  1R0Q A;  4Y99 B;  3A0H H;  1DW0 A;  3RN1 A;  2C9N Y;  3CWB J;  1URQ A;  3IN6 A;  3U59 A;  4HH2 A;  1AOQ A;  1EZV D;  3IF4 A;  3K5B A;  2KI7 B;  4AAL A;  2Q3I A;  5DF5 A;  1KIL A;  1NTZ K;  3BCC E;  1RF1 B;  1I5T A;  4M3L A;  1DD3 A;  1WVE C;  2Q7C A;  1CSV A;  5AW9 B;  1LT9 C;  3V6I A;  4J20 A;  2G3A A;  2BAS A;  3AEB C;  1LC1 A;  1SQX D;  2YMY A;  3VMZ A;  2FY8 A;  4FAN A;  1G2C B;  1RZ6 A;  3IFM A;  1CIF A;  4I1L A;  3RK3 C;  2ZAE B;  1E79 H;  1L4A C;  2P7J A;  3HE5 A;  5KTB A;  5H2F H;  2RH0 A;  3WFB C;  2PAJ A;  3L70 G;  3JBT B;  3CXH H;  4HYT B;  5KLV J;  2W6A A;  1GTW A;  1LT9 B;  3RK3 D;  5GTH H;  1L4A D;  1IZN B;  2WVR A;  1GK6 A;  3G4S P;  2YNY A;  1NMI A;  1LTT C;  3CCS P;  2KNC B;  4H44 C;  1URQ C;  3L73 J;  3RK3 B;  3CC4 P;  1L4A B;  2H43 A;  1NTM K;  1NYH A;  1KIL C;  4PJ0 E;  1NU1 E;  4H44 D;  1NO4 A;  1URQ D;  1COR A;  3OA8 B;  3B71 A;  2Q9I A;  2CE0 A;  3KQG A;  4NPD A;  4YXD C;  5C9M A;  2JR8 A;  2WPS A;  1R8E A;  2AI5 A;  3ZOX A;  4H44 B;  1DEB A;  2B88 A;  1LJ2 A;  1URQ B;  3GF3 A;  1FZG A;  2HYN A;  1CIG A;  1AA0 A;  5E79 H;  3C1L A;  3MK7 B;  1CCR A;  3Q5P A;  1YFC A;  1EZV E;  1KIL B;  2WSF H;  2OYH A;  3S4R A;  1Q2N A;  3PTZ A;  1A56 A;  3CX5 D;  3HTK A;  1NH4 A;  2CK3 H;  1KQL A;  4Y28 J;  2C1V A;  3GLM A;  2WSS H;  3ZDM A;  2QJK C;  1OCD A;  1L0N G;  1LNQ A;  1KN7 A;  2O1K A;  1YEA A;  1FS0 E;  1SQX E;  2KSE A;  4NFG B;  2FYU D;  2I8F A;  3HQ7 A;  3HE5 B;  3KYQ A;  4I2L C;  5KAI E;  4FA9 A;  1QLE D;  3RK3 E;  1PP9 G;  2MTA C;  2HOD A;  2Y9Z A;  4DCK A;  2HG5 D;  2YKQ A;  1T6A A;  4LC1 A;  2QJK B;  3SWF A;  5CIC B;  1KQS O;  1R5L A;  1Y8A A;  1VQ6 P;  1SQP G;  4IOI H;  2A45 G;  1H8A A;  2JEE A;  1OMI A;  3MGN A;  3CXH W;  3D70 A;  1SQB D;  2OYH C;  1KFM A;  1LGH B;  1ZV8 A;  3Q3D A;  3C9I A;  4HB1 A;  3WUI A;  1AVY A;  2BCC G;  5AUR A;  2GA1 A;  1KIL E;  1YBK A;  1JMM A;  2MKV A;  2R3S A;  1DVV A;  5TIS H;  1SQV G;  1Q82 Q;  2A45 I;  3MD0 A;  3Q5R A;  3WMM 0;  1Z56 A;  1XTC C;  3V2N A;  4AX3 A;  5DFS A;  5CMZ A;  4XA4 A;  2OYH B;  4JF7 A;  3H1H J;  3ZOY A;  1LT1 A;  5KKZ C;  1PPJ E;  4N3Y B;  4GOD A;  4DY9 A;  1HJ5 A;  2Y0D A;  2IYP A;  5GTI E;  2CPB A;  1NTK G;  3GG2 A;  2QA4 P;  3O1Y A;  3HTK B;  5KLI C;  2IYO A;  5KJ7 D;  3OA7 A;  5AVW B;  2FXM A;  2D0S A;  1FJP A;  2MHM A;  3JCU E;  1FZB A;  3MUD A;  4JYB A;  3A2A A;  1FOC A;  3T97 A;  1CC5 A;  3NBS A;  4WQA A;  4PW9 B;  2FXP A;  2O1J A;  1MG2 D;  1E8E A;  2FYU E;  3L36 A;  3H1K J;  4AQR D;  2FKW B;  3NMD A;  4RSZ A;  1BDD A;  1VQ5 P;  2OQQ A;  3AEC C;  2HOD B;  1KOR A;  1BSH A;  5CJ4 A;  5KLI B;  4QAO A;  4P4Q B;  3KZI E;  1S1C X;  1L2P A;  3PXW A;  2POH A;  3IR9 A;  1DT1 A;  2R5B A;  3PXS A;  1I8P A;  2K88 A;  2A45 H;  2GIW A;  1CYJ A;  1RQV A;  2XDJ A;  3H6P A;  3L72 G;  1C2N A;  1EQ7 A;  1YNR A;  1SQB E;  3H1I J;  5AW0 B;  3I56 P;  2FFD A;  2PAC A;  1YJW P;  2M3E A;  1EDL A;  4U3F E;  4FA5 A;  3L74 G;  1BCC D;  3CC7 P;  2XNX A;  1GZL A;  3GW6 A;  4NPF X;  1I54 A;  1HUC A;  1EXJ A;  2Q6Q A;  3AE6 C;  2V7Q J;  1SQX K;  3A0H V;  3WUV A;  3C8V A;  1M57 D;  3A0B E;  2JDI H;  2XND H;  5EFW B;  1KB9 I;  2IBZ E;  1JY3 P;  5H2F E;  3E7K A;  1DD4 A;  3D0W A;  2O3J A;  4LLH A;  3P8C D;  5AW6 B;  1DW3 A;  3M0A A;  2KLU A;  3MIW A;  3WFC C;  3VOP A;  3H1J J;  1KMI Z;  3FX0 A;  3Q2Y A;  4QMA A;  1FZC A;  4KMG A;  3TNU A;  3AEG C;  5KLV G;  1NTZ J;  3F5H A;  3T97 B;  1JTH A;  3P8M C;  4LJI A;  1U74 B;  2BH4 X;  1QVF O;  3ZOW A;  3L73 G;  1Y9B A;  2FFD C;  1DIQ C;  3V2Q A;  4OGQ C;  4EIE A;  1LTS C;  3ABV C;  2B10 B;  5AVQ B;  3DP5 A;  2W6B A;  1H33 A;  2ORL A;  1VQ9 P;  2YK3 A;  4OGQ D;  2JJL A;  5AVZ B;  4HKZ H;  3TK1 A;  1TU3 F;  5E79 E;  3MZW B;  1N8R Q;  1WRG A;  1ZW0 A;  2WSC H;  4PV1 B;  1VQ7 P;  1BE3 J;  3BRV B;  1F1C A;  2GUV A;  1KB9 H;  2FFD B;  2RMZ A;  1JDL A;  3H1L J;  2PP6 A;  4JQ0 D;  3P32 A;  4OGQ B;  3WFE C;  1CYI A;  2R32 A;  5CCG A;  1CED A;  1FZC C;  4MU8 A;  2VHD A;  1NTM J;  1YQ3 C;  5AW2 B;  1NNO A;  1PPJ G;  4D6T G;  2I8D A;  1A02 J;  2ZT9 B;  1CRC A;  1HTL C;  2FYU K;  2GUS A;  3L37 A;  3WUU A;  3A5T A;  2GC4 D;  3DR0 A; 
#chains in the Genus database with same CATH homology
 1C6S A;  5CID B;  3TGU D;  4GYD A;  2C9X B;  2DGE A;  1KIB A;  3OCD A;  1R0Q A;  2C1D B;  2D0W A;  3SVW A;  4AAM A;  1DW0 A;  4UB6 V;  3RN1 A;  1HH7 A;  1C6O A;  1PP9 D;  4EIC A;  1AOQ A;  1EZV D;  4AAL A;  5DF5 A;  2HV4 A;  1HJ3 A;  4Y5R A;  1H31 A;  3VNW A;  1I5T A;  5IY5 1;  5B66 V;  1WVE C;  2LIT A;  3X39 A;  1CSV A;  1KYO D;  1SQP D;  4L3H A;  4EID A;  1M6Z A;  1SQQ D;  1LFM A;  1ETP A;  1F1F A;  4J20 A;  3L70 D;  2Y0C A;  2FYN B;  1E2R A;  4EIF A;  3KZI V;  1LC1 A;  1SQX D;  3PRJ A;  1NML A;  1FI3 A;  4FAN A;  1DW1 A;  3CU4 A;  1RZ6 A;  4FB1 A;  1FHB A;  4A7P A;  2A06 D;  1CIF A;  1I6D A;  1CNO A;  2BCC D;  1H33 B;  3BCC D;  1N15 A;  4O1W A;  3WFB C;  5KAI V;  1AKK A;  3JBT B;  4GED B;  3H1H D;  1AOF A;  3TDK A;  4H0J A;  1LS9 A;  3PHL A;  2N9I A;  1BGY D;  2EXV A;  3PH2 B;  3O20 A;  1NMI A;  1KV9 A;  1CTZ A;  1EB7 A;  2KNC B;  3SLE A;  3A0B V;  2BLF B;  155C A;  1C6R A;  5B5E V;  2CA3 B;  4N0K A;  3PLN A;  1CCH A;  5TIS V;  1FI7 A;  3A9F A;  3H1K D;  1COR A;  3OA8 B;  4L1Q A;  1VYD A;  5CIE B;  2CE0 A;  2B11 B;  5C9M A;  1L9J C;  3OCD B;  2AI5 A;  1IZL 0;  4AAN A;  3WFD C;  3O0R C;  3ZOX A;  1CIG A;  1S5L V;  3VYM A;  2C2C A;  3MK7 B;  1CCR A;  1YFC A;  1FJ0 A;  3ZCF A;  5KKZ B;  1H31 B;  2ZOO A;  3O5C A;  2AXT V;  1L0N D;  4WQC A;  3PTZ A;  2ZBO A;  3H1I D;  1A56 A;  3CX5 D;  5GTI V;  1MG3 D;  4PD4 D;  1CSW A;  1L9B C;  1OAE A;  2C1V A;  3L72 D;  1OCD A;  2CXB A;  1CYC A;  1YEA A;  2Q3E A;  4NFG B;  2GB8 B;  2FYU D;  2Y0E A;  2I8F A;  3HQ7 A;  3L74 D;  4XXL A;  1P84 D;  2B0Z B;  4IL6 V;  2B4Z A;  4FA9 A;  3HQ6 A;  1NIR A;  4UB8 V;  1LMS A;  2MTA C;  1KX2 A;  1ZZH A;  1HRC A;  1QN2 A;  4V2K A;  2XTS B;  4JCG A;  3H1J D;  3WU2 V;  3ZBM A;  2QJK B;  1H32 A;  5CIF B;  5CIC B;  2PCC B;  1NTZ D;  4WQ9 A;  1DW2 A;  1CHJ A;  2YCC A;  3VMA A;  3L75 D;  4AAO A;  1GJQ A;  4EDF A;  1HJ4 A;  2FRC A;  3CXH W;  1SQB D;  1SQV D;  2QJP B;  2BCN B;  1RAP A;  1IQC A;  2B12 B;  1K3H A;  3WUI A;  4RJT A;  4YE1 A;  5AUR A;  451C A;  1CSU A;  1K3G A;  1QYZ A;  3L71 D;  1IRW A;  1DVV A;  1CTJ A;  1CTY A;  3RN0 A;  1NTK D;  4AX3 A;  351C A;  1CIH A;  1M60 A;  5C0Z A;  5DFS A;  1H9X A;  1AYG A;  4WQB A;  1YIC A;  5H2F V;  3NWV A;  3MK7 C;  1CRH A;  3ZOY A;  1COT A;  3CYT I;  5TJH A;  1BE3 D;  2JWA A;  1CIE A;  4DY9 A;  1IRV A;  1HJ5 A;  3H1L D;  2Y0D A;  1FI9 A;  5GTH V;  1KX7 A;  2L91 A;  3GG2 A;  4FA4 A;  1YCC A;  3O1Y A;  1YEB A;  2D0S A;  2AIU A;  2V08 A;  1RAQ A;  2MHM A;  1NTM D;  1YTC A;  1FOC A;  1CC5 A;  3NBS A;  2YQB A;  4PW9 B;  4WQA A;  2KS1 A;  1WEJ F;  1MG2 D;  3NBT A;  1E8E A;  3CX5 W;  2PCB B;  3M97 X;  2BGV X;  3RLM A;  2JTI B;  1J3S A;  1PPJ D;  4D6T D;  4RSZ A;  1DII C;  2K9J B;  2OZ1 A;  5KLI B;  3TYI A;  1KB9 D;  1HCM A;  4O1Q A;  3DMI A;  4QAO A;  4P4Q B;  1H32 B;  3ZOO A;  3CWB D;  1CRJ A;  4WQE A;  1U75 B;  5CIB B;  1GQ1 A;  5CIH B;  1CRI A;  3PXW A;  4PJ0 V;  1I55 A;  1DT1 A;  3PXS A;  1I8P A;  1H9Y A;  1KYO W;  5E79 V;  2BPB B;  3ITK A;  1GKS A;  2GIW A;  1W5C T;  2ZXY A;  5B6Q A;  1CYJ A;  2N9J A;  1ZRT D;  1C2N A;  5CYT R;  1YNR A;  2YIU B;  2PAC A;  3SJL A;  1HZV A;  2C8S A;  4FA5 A;  1BCC D;  3WC8 A;  3GW6 A;  3SXT A;  1I54 A;  2ZZS 1;  1CXC A;  4FAV A;  3A0H V;  1M70 A;  3VRD A;  1C75 A;  1E29 A;  2CE1 A;  3TF5 A;  1I6E A;  1N90 A;  3C2C A;  5KLV D;  2ZON G;  2O3J A;  4WQ8 A;  1W2L A;  3HQ8 A;  1DW3 A;  1N50 A;  2JQR A;  1MZ4 A;  4U3F D;  2C1D A;  3WFC C;  2N3Y A;  5EXQ A;  1A8C A;  1CHH A;  4KMG A;  2C1U A;  1HRO A;  1A2S A;  1I8O A;  2BH5 X;  3L73 D;  1IO3 A;  2V07 A;  4WQ7 A;  5DJQ C;  2RN0 A;  1CO6 A;  1B7V A;  1CRG A;  4K3I A;  2IBZ D;  4LJI A;  3CP5 A;  1U74 B;  2BH4 X;  1BL9 A;  3ZOW A;  5KAF V;  2DVH A;  3CXH D;  2N3B A;  1C2R A;  4PWA A;  1DIQ C;  2OZ1 B;  3FWL A;  2QJY B;  2L4D A;  3HQ9 A;  3ORV A;  1QL4 A;  4EIE A;  4L3G A;  4H0K A;  1C52 A;  2B10 B;  2LIR A;  1N9C A;  1CHI A;  1GDV A;  3DP5 A;  2N18 C;  5DJQ B;  1H33 A;  1HZU A;  2ORL A;  3RMZ A;  2YK3 A;  1YIQ A;  3KHU A;  2GC7 D;  1DVH A;  1L0L D;  1S6V B;  1F1C A;  2RMZ A;  1JDL A;  2QG4 A;  3PXT A;  4XYD B;  1CXA A;  1CSX A;  4WQD A;  3WFE C;  3SWS A;  1CYI A;  1GU2 A;  5CIG B;  1LC2 A;  1CED A;  1FCD C;  3L4M A;  2N18 B;  1RZ5 A;  2VHD A;  1H1O A;  4MU8 A;  2CA4 B;  2FWL A;  4FA1 A;  1NNO A;  1GIW A;  1KB0 A;  3ZIY A;  2N9Y B;  1NU1 D;  1QL3 A;  1CRC A;  1C7M A;  1CRY A;  4Q5P A;  1QKS A;  3OA8 A;  2GC4 D;  3L4O A;  3DR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...