2FYUD

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2fyuD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2fyuD02
4U3FD 1CRGA 1BL9A 1A2SA 2C9XB 3L73D 1SQBD 2DGEA 3VYMA 2BGVX 1LC2A 1MG2D 2LITA 4FANA 2N3YA 1CHJA 4UB8V 1LMSA 5TJHA 2QJYB 4AX3A 4RSZA 2C1UA 4J20A 5DJQC 3PTZA 4QAOA 1HZUA 3HQ7A 4WQ9A 1DW0A 3CX5W 4O1WA 1H9YA 5CICB 3H1KD 5IY51 4P4QB 1QKSA 4XXLA 2O3JA 1IZL0 2C2CA 3WU2V 2B10B 1H33A 4EIEA 1FI7A 3ZBMA 3WFCC 1GJQA 1GIWA 2N9IA 2RN0A 1U75B 3CX5D 1N50A 2BH5X 1NIRA 2FRCA 2YIUB 2XTSB 2C8SA 4JCGA 4WQBA 2KNCB 1N9CA 3KHUA 2B4ZA 4KMGA 4EIDA 1C6OA 1CNOA 1N90A 2I8FA 1W2LA 1H1OA 1YFCA 3BCCD 1K3GA 1DVVA 2PCBB 3M97X 3RN0A 1LFMA 1L0ND 2EXVA 3L4OA 3ITKA 2ZOOA 1YIQA 1C52A 5KLVD 1CCRA 2JWAA 4EIFA 1NTMD 3L72D 1C2RA 1CIHA 1CXCA 4UB6V 3MK7B 1CSUA 1YICA 1IRVA 5DF5A 3TYIA 2N3BA 2ORLA 1CSXA 2JQRA 2K9JB 1BCCD 3X39A 3DMIA 3L4MA 3O1YA 3A0HV 1FHBA 4H0KA 3TGUD 2BCNB 1WVEC 1L9BC 3CYTI 1HJ3A 2CA3B 1KB0A 1E8EA 2OZ1B 4D6TD 5KAIV 1EB7A 1H31B 1KV9A 1H32B 4WQ7A 3WC8A 1M6ZA 1BE3D 4WQ8A 4PJ0V 4PW9B 5GTHV 1KYOD 2HV4A 1OCDA 3SLEA 1I54A 3HQ8A 1AOQA 2QJPB 3GG2A 4L1QA 3TDKA 1CC5A 4IL6V 3CWBD 1W5CT 4EICA 1QL3A 2ZXYA 451CA 1HCMA 1CO6A 1GQ1A 2B0ZB 5AURA 3KZIV 3OCDB 3RMZA 3CXHW 1CRCA 1CRYA 4MU8A 5CIFB 2CE0A 3ZOWA 1CTYA 2MTAC 1CXAA 5C0ZA 1A8CA 3A0BV 2C1DA 4WQDA 2Q3EA 2Y0EA 4AAOA 2RMZA 1SQQD 3H1ID 1CRJA 1GU2A 1YNRA 4GEDB 3C2CA 3VNWA 1CRHA 1CYCA 2CA4B 2YCCA 1HZVA 1AKKA 3L70D 4FB1A 1PP9D 1IO3A 1CYIA 1I6EA 3FWLA 2L4DA 1CIGA 1FI3A 3RLMA 1MZ4A 2AIUA 4O1QA 3HQ6A 2V08A 1A56A 1C2NA 3ZOOA 3ORVA 3O20A 4K3IA 1DIQC 1RZ6A 4H0JA 1JDLA 1CCHA 2CE1A 1LS9A 1H32A 4FA9A 5C9MA 5CIHB 2L91A 1S6VB 2ZONG 1C6SA 1DVHA 1AYGA 5DFSA 5KAFV 1I55A 351CA 1J3SA 3PXSA 1K3HA 3PRJA 1L0LD 5EXQA 1M70A 3H1LD 1M60A 4XYDB 1HROA 1FCDC 3SVWA 3PHLA 3VRDA 1CYJA 1CTZA 1ZRTD 5KKZB 2D0SA 1R0QA 2FYNB 1NMIA 3CU4A 1FJ0A 4L3HA 1CRIA 4Q5PA 3WUIA 2C1VA 4V2KA 1QN2A 1RZ5A 2B12B 3WFDC 1BGYD 1B7VA 1NTZD 1IQCA 5E79V 1H33B 1I5TA 2AI5A 1HH7A 1CSVA 3DR0A 4WQCA 1YEAA 5DJQB 4GYDA 2BH4X 1CEDA 4FAVA 1RAPA 1LC1A 2V07A 5KLIB 3L75D 2FYUD 2IBZD 1FOCA 3ZOXA 1N15A 4FA5A 4RJTA 1QYZA 3H1JD 2ZBOA 3OA8B 5TISV 2BPBB 1RAQA 3WFBC 2AXTV 2N9YB 1NNOA 3PH2B 4L3GA 2KS1A 1I8OA 4FA4A 2B11B 2BLFB 2VHDA 3JBTB 2YK3A 1EZVD 4PD4D 3MK7C 3WFEC 1IRWA 1I6DA 3L71D 4AAMA 2N18C 1SQVD 2GC7D 3SJLA 2YQBA 3DP5A 1HJ5A 4NFGB 3NWVA 1DIIC 3CP5A 1CIEA 5CIGB 1YCCA 4PWAA 1DW3A 1C6RA 3SWSA 1GDVA 5H2FV 3CXHD 1F1CA 1KX7A 1KX2A 1YTCA 2GC4D 3NBSA 3TF5A 1CSWA 3VMAA 2GB8B 3NBTA 5CIBB 3HQ9A 3GW6A 3PXWA 2CXBA 1CIFA 1VYDA 1U74B 3A9FA 1CTJA 5CYTR 1MG3D 5B6QA 2QG4A 5B5EV 2DVHA 1NU1D 1ZZHA 2OZ1A 4Y5RA 3L74D 1COTA 1I8PA 2MHMA 1H31A 4LJIA 2JTIB 1GKSA 1KB9D 1PPJD 1CHIA 3OA8A 4AALA 2GIWA 2QJKB 1DW2A 1P84D 1DT1A 3ZCFA 3PLNA 1F1FA 1H9XA 1E2RA 3ZOYA 3OCDA 1NTKD 3ZIYA 4A7PA 1CHHA 2FWLA 3O0RC 1HJ4A 1OAEA 2C1DB 2Y0DA 1WEJF 2PACA 1DW1A 2A06D 1AOFA 1SQXD 3H1HD 4AANA 1CORA 1KIBA 4YE1A 4WQEA 3PXTA 3SXTA 1SQPD 2BCCD 1L9JC 1C7MA 1YEBA 5GTIV 2N18B 4WQAA 2ZZS1 5CIEB 1FI9A 5CIDB 1E29A 4DY9A 2LIRA 1KYOW 1C75A 4EDFA 1HRCA 1NMLA 3O5CA 1ETPA 2PCCB 4N0KA 3RN1A 155CA 4FA1A 5B66V 2D0WA 1S5LV 2N9JA 2Y0CA 1QL4A
chains in the Genus database with same CATH superfamily
1CRGA 3TNUB 3AE1C 1R5SA 1LT9C 4RO0A 4Z1MH 3L73D 3VYMA 2LITA 4BRYA 1PGQA 2N3YA 4JYBA 1N73B 4I7ZB 1E5WA 1KYOI 4UB8V 1LMSA 2ZYDA 2FYUK 4H0LB 2QJYB 3E1IA 1YHQP 3L74J 2N1TC 4H13D 5APWA 3PTZA 2NZ2A 4QAOA 1HZUA 1CI6B 2ZVNB 1H9YA 1SQBG 2AEJA 3H1KD 3V2PA 1QKSA 2M5AB 2O3JA 1IZL0 2C2CA 1SFCC 1K04A 1QVGO 4EIJA 1JCDA 1GIWA 1GMJA 1JY2O 1U75B 3CX5D 1LTIC 3WUVA 3TGUE 1J1DC 1NTKJ 4D6TE 2C8SA 4WQBA 2FXPA 4NPFX 3G71P 1IO4A 3P8MC 3KHUA 2SPZA 3AE8C 4EIDA 2D2CC 3UIAA 1N7SC 3JSVC 4L74A 2KZJA 1NO4A 1X8YA 2E76C 2ZVOB 1SQPJ 1W2LA 4GIFA 4L73A 2JO1A 2B87A 2Z5HA 3NXSA 3RK3E 1VQLP 3CC4P 1NU1K 2MJZA 1GU5A 1NH4A 1LFMA 1L0ND 2EXVA 5CCHC 1YIQA 3QH9A 5H2FH 1XTCC 1FBMA 3KXDA 3C9IA 3TYIA 2QEXP 3BASA 2ORLA 1CSXA 3CXHE 3RL0B 3L73J 4EI2A 1ZN5A 1BCCD 3HD7C 1FZEA 4XE5B 1KZUB 2WQYC 1NYHA 1FHBA 2G8YA 1HJ3A 2N9BA 2E42A 1DEEG 2QJKC 4UB6E 2OZ1B 5KLVG 4WQ7A 1HH0A 1JM0A 1NTMG 1S9KD 4WQ8A 3II6A 1KYOD 4C46A 2OTJP 1FJPA 1DX7A 3L74E 1ZV8A 3GG2A 4W7YA 2ZT9D 3PP5A 3H1KJ 1EXIA 451CA 3TGUG 2XKMA 3A2AA 1CO6A 4D6TG 1A02J 4H44D 4WVZA 2H8PD 3Q5SA 3U1AA 2Y9ZA 4WQDA 4I2LC 3L37A 2Y0EA 4AAOA 1VQ8P 1NTKE 1JUNA 2IDBA 3H25A 1FAVA 1GU2A 1SQBK 1HZVA 3H6PA 3L70D 3P8CE 1IO3A 1M1KQ 1CYIA 1NKNA 3L75E 1X9VA 3G4SP 1L0NJ 3ZOOA 1N73C 3Q3DA 1EDLA 3ORVA 4I7ZC 1FU1A 4H0JA 4H0LC 1JDLA 1CCHA 1H32A 5C9MA 2R5BA 4NPEA 1E79H 2NPSA 1S6VB 2XV5A 4HB1A 3W68A 1HBWA 2P10A 5DFSA 1I55A 1PP9G 3CCSP 1BCCJ 5AVSB 4IFDK 2M0BA 1M60A 1RE4C 1FCDC 3BRTB 3PHLA 3L73E 1BDDA 1VF5D 2BEZF 1N7SD 3LIDA 1FDIA 4LGDE 1T8ZA 1HTLC 4N78D 3TSIA 3S4RA 4V2KA 1LTAC 4OH8B 1NTZD 2GM4A 1L0LG 5CCHD 4WQCA 5DJQB 3H1KE 2BH4X 1OVVA 1JTHB 3D6ZA 3NMDA 2IBZD 1H8AA 4DOJA 3ZOXA 1GD2E 1HJBA 3VMXA 4RJTA 3HD7D 1LJ2A 3CX5E 1NTMK 1KFNA 4OWFA 1NNOA 1KB9E 3HTKA 3JBTB 5AW5B 1EZVD 3IF4A 2Q9IA 3SFEC 1P84E 3L75G 3L70J 1YJNP 3R4YA 2OARA 2YO3A 2N18C 1SQVD 1USEA 3RL0C 3V2RA 3DP5A 3VYIA 4NFGB 5CIGB 2V4HA 1DW3A 5AW0B 3N4XA 3LW5H 1L0NE 1LT9A 2GC4D 2QE7H 1DH3A 4PV1C 3F5HA 5GTIH 4YTPC 2K9JA 2QIWA 1U74B 1W5CE 5H2FE 1JMMA 2YKOA 3VMYA 2M3EA 1BCCE 2N1TA 1IFJA 1COTA 1H31A 4LJIA 1T6AA 3ABVC 2JJLA 2JTIB 1BSNA 4HH2A 1LTBC 2KK7A 1S9KE 5B5EE 2YKQA 2GIWA 1KYOE 5BU5A 1NTZJ 1SFCA 1GDTA 1OMIA 1J2JB 1HF9A 3NTNA 4H0LD 1A02F 1E2RA 1N2DC 4HJGH 3BVHA 1H0TA 3OCDA 3O6QB 1WRGA 1JCCA 1IFDA 3CD6P 4L76A 2J5UA 3O0RC 5CCGC 1OAEA 5APSA 1SS1A 2Y0DA 2CPSA 3HE5A 3A5TA 3VP8A 2A06D 1FC2C 1KN7A 1FE6A 2H7HA 1SQXD 3H1HD 2I1JA 2WPSA 1KIBA 2FFDB 1M1JB 4YE1A 3PXTA 2BCCD 1L9JC 1C7MA 1L0LK 5CIDB 1X22A 3HUSA 1SQVJ 2O01J 1VQ4P 1HRCA 4IOIH 4HYTB 5CCHA 1IFMA 1ZMEC 2PCCB 3PH0A 1JB0J 2WSFH 2D0WA 1S5LV 1JY3N 2N9JA 1QL4A 4U3FD 1ZLLA 2J59M 4H13C 1A2SA 5AW1B 5AVRB 4FANA 4BXLA 3GLMA 2YXQB 3QWOC 3CXHH 1TU3F 3A7OA 3HE4A 1QVFO 2AEMA 4AX3A 5DJQC 1NGMB 5CJ4A 5APTA 4UB6H 1KQLA 4K35A 1OXZA 3CCEP 2V7QJ 1RH5B 3SWYA 3CX5W 4O1WA 4UB8E 1K9MQ 5CICB 1JY3P 3RL0D 4N78E 4XXLA 3H1LJ 4WBAA 2B10B 1NOHA 1YJ9P 1KD1Q 3ZBMA 3WFCC 1ZR2A 1FZCB 3V6IA 2N9IA 4KHXA 3SWKA 3GMAA 1N50A 1NIRA 1GL2A 3A0BE 2FRCA 2YIUB 3C1LA 3K5BA 1MFTA 2WPRA 1GK4A 2KNCB 4JPZB 1YTZT 2C9LY 1SQXJ 3H1HJ 1CNOA 1Q7YQ 1N90A 5AW4B 2I8FA 2BCCJ 3TNUA 1H1OA 1YFCA 1DVVA 3MD0A 1IFIA 1LTJB 3M97X 3TK1A 4AUWA 3M9BA 2H43A 3L4OA 1SQVE 1G1IA 1C52A 1CCRA 4EIFA 3L72D 1C2RA 4U3FJ 1IRVA 4GODA 3I55P 2N3BA 2JWDA 3BCCG 1RF1B 3DMIA 2B9BA 2ZYAA 1URQA 2M5AA 3CCVP 1WVEC 1E8EA 3FX0A 5KAIV 2R44A 1MFZA 3GHGB 1KQFB 1D7MA 4YPCA 1OCDA 2A45H 5E79E 1AOQA 1YQ4C 4L1QA 4IL6V 3AEEC 4H44C 3CWBD 1VQPP 2ZXYA 4ASVA 2KSEA 3IN6A 2W6JH 1GQ1A 2M3BA 1FDOA 1JY2N 1PGJA 5AURA 2KZIA 1IC2A 1LTSC 3H1LE 1AQTA 2AXCA 2FFDC 1HUCA 3RMZA 1BE3G 1LTGC 1CRCA 3CCLP 1ZRTE 4MU8A 5CIFB 4QMAA 1CTYA 2AXTE 1YI2P 1A8CA 3A0BV 2PGDA 1RF0C 2Q3EA 1RE3C 2KI7B 1VL2A 3CX5H 3H32B 3C2CA 1KB9H 2W6AA 3AE4C 2A06E 2P2UA 1I6EA 1OW6A 1KILB 1JY2P 2BCCE 1ZR4A 1P84H 1A56A 3TYYA 1KV4A 1SQQG 2KS1B 2OYOA 1RZ6A 1VF5C 1S5LX 3H1IG 1U7MA 2CE1A 1LS9A 5CIHB 3L72J 2ZONG 1GW3A 1AYGA 1IFNA 2OGUA 2WSCJ 351CA 4BRYB 2GUSA 3PRJA 1GZLA 5EXQA 2FXMA 3M9HA 1HROA 1W2EA 1K73Q 2W6BA 1LWUC 1CYJA 2D0SA 2FYNB 5M1BA 1NMIA 1LTTC 1FZCC 3CU4A 4Q5PA 2C1VA 2YIUC 4HKZH 3CWBJ 1BGYD 1PZQA 5E79V 4TT3H 1I5TA 1USDA 5B5EH 1CSVA 2H88C 1KYOH 3V2QA 4IFFA 2V07A 3MZWB 5EFWB 2FYUD 3JCUE 3AEGC 1IK7A 5CCGA 1QYZA 3H1JD 3OA8B 5TISV 1LTJC 3WFBC 2AXTV 4IFMA 2IBZI 1CW5A 2KSJA 1PPJE 3PH2B 1I8OA 1MV8A 2B11B 1HJ0A 4M3LA 2NRGA 2B87B 3S9OA 1RQVA 1FJKA 1IRWA 3L71D 2XZRA 3SJLA 5AVTB 1PL5A 1RF1C 3CP5A 1EZVI 1YCCA 4GOEA 3WMM0 4PWAA 3SWSA 1GDVA 1HWTC 1F1CA 1EDJA 3IR9A 1KX2A 1L2PA 3TF5A 4DCKA 1N86A 3VMAA 2GB8B 1Q2NA 5CIBB 3L72E 5K5GB 3G9RA 1QL1A 1SQPE 3A9FA 4KT0J 5CYTR 2UWJE 5B6QA 2LXBA 1BSHA 2QM8A 1NU1D 1ZZHA 5KAIH 1YTZI 1I8PA 2VRSA 2QJYC 2I1KA 1KTMA 1SQQK 1LP1B 5AW8B 2Q1KA 3WU2E 3T97A 4IL6X 4AALA 1BGYJ 3L35A 4C7NA 1OX3A 4UB8H 2K1AA 4N6JA 2ZXEB 1JMBA 3CWBE 1H9XA 3L74G 3FXEA 2FYUJ 2WT7A 3ZIYA 4A7PA 1S1CX 2OTLP 3MUDC 1PPJG 3B5ND 2CPBA 4GT1A 3H1JJ 1OZHA 3A0BH 1KILC 1DEBA 2PACA 1EQ7A 4AANA 1WMKA 5AVXB 2YO2A 4YXDC 1E29A 1NTKG 3L71J 2OYHA 1C75A 4EDFA 2JDIH 2WZ7A 3OJAB 1Q82Q 155CA 4FA1A 2WSEJ 3AEFC 2B89A 1ZOYC 2NPSB 1BL9A 5CMZA 2OYIA 2FYNC 2O01H 1SQPG 2Q5UA 2FY8A 3CMEP 1VQNP 3M06A 1SQBD 2DGEA 4AYCA 1LC2A 1MG2D 4U7JA 2HPCB 2KOGA 1S5LE 3IFMA 3M0AA 4PJ0E 5TJHA 2C1UA 4J20A 3BRVB 3CC2P 1KFMA 3MGNA 3V4WA 3HQ7A 1OFCX 4WQ9A 1DW0A 3EFGA 1AQ5A 2ZAEB 1T3UA 1S72P 3L73G 2E75B 5IY51 1PGPA 5E79H 4DT0A 2A45G 3WU2V 3KZIE 3Q5RA 1H33A 2KUBA 1FI7A 2C0XA 4ZKUA 3KPEA 2H89C 1BGYE 1GJQA 3WUUA 2RN0A 1R5LA 4WY4D 2BH5X 2GA1A 2O1KA 2WMMA 1H88A 4JCGA 4I1LA 3AE5C 1RE3A 4Y28J 1FZFA 3H1KG 3AE9C 3B4SA 2AXTH 2B4ZA 3HTKB 2E74D 3N7NA 3H1JE 1C6OA 1GU4A 2IZ1A 1K3GA 3U59A 4R4LA 2PCBB 5DJUB 4LC1A 1L4AD 3D0WA 1U57A 3ITKA 2C9NY 2ZOOA 5KLVD 1N7SA 1JO5A 2JWAA 2QM7A 1NTMD 1LT9B 5APVA 5KAFE 1CSUA 5KJ7D 3SFDC 2YKPA 3V4QA 2W27A 2Q3IA 1SQBJ 2K9JB 1IFPA 1FZAA 1KILD 3L4MA 3O1YA 1LWUA 2HODA 4H0KA 3TGUD 3L70E 2BCNB 1L9BC 1L0NG 2CA3B 2N1TB 1NTKK 4D6TD 1EB7A 1H31B 1KV9A 3CCRP 1FZCA 1M6ZA 1PV3A 3FGAD 3HRNA 2Y9YA 1EXJA 4PJ0V 4PW9B 5GTHV 2HV4A 2HFED 4JF7A 4JQ0D 3CPWO 1VQMP 4RKUJ 3HD7A 1BCCG 1T3JA 1FDMA 1QL3A 1SQPK 5KAIE 4ASWA 3VP9A 3GF7A 2I8DA 1G2CB 2JEEA 2B0ZB 5CBOA 3KZIV 1H0TB 3OCDB 3Q1MA 1K8AQ 4IL6E 1HGZA 2KIKA 2CE0A 3B5NB 3HE5B 2GUVA 1EDKA 3EWKA 2C1DA 3JCUH 3BATA 3KQGA 4PD4I 2D2CB 4OGQD 1YIJP 1CRJA 4GEDB 2E76B 3L4FA 2W90A 3VNWA 1S2EA 1CYCA 1NTZE 2CA4B 1RQUA 2XU6A 5APYA 5AVWB 1IZNB 2FYZA 2P58A 3HUSB 1PP9D 3FWLA 2L4DA 1EDIA 1CIGA 2OTKE 1FI3A 1YQ3C 1MZ4A 1RF1A 2AIUA 4O1QA 3HQ6A 3M0DC 3AE3C 2IBZE 2R32A 5KLVJ 4KJMA 2K9YA 1M56D 1NTMJ 4FA9A 1Q90D 2L91A 5AW2B 2IFNA 1DIPA 1C6SA 3L70G 5KAFV 2WITA 2PRRA 1K3HA 1W2BO 1HVVA 1L0LD 1EZVE 4XYDB 1N73A 3HE4B 3TGUJ 3VRDA 1SQBE 1DD3A 5KKZB 4D6TJ 1FOSF 3CLQA 1IJDB 2WSCH 1YYCA 4L3HA 1FJ0A 5L8RJ 3WUIA 1CI6A 4JBZA 1VQKP 2B12B 1RZ5A 2FXOA 1B7VA 1RE4A 2WSSH 3WU2H 1NWQA 1HH7A 2W8ZA 5AVUB 1SLQA 1CEDA 2R3SA 4WY4B 1RAPA 1QLED 1GL2B 5KLIB 3L75D 3JC22 4DJGA 1L0NK 2WWWA 2YXRB 1FOCA 1N15A 4FA5A 1VPCA 2LKMA 2Q7CA 3F89A 3CCMP 1RAQA 1SVFA 1YJWP 3R2PA 1NTZG 1PIXA 2E74B 2N9YB 2KS1A 2ZYGA 4FA4A 1MZ9A 3MTUE 2YK3A 3I56P 4PD4D 1M1JC 1Y47A 3WFEC 1X79B 2M8RA 5TISE 2IBZG 1PP9J 4AAMA 1LT1A 3E1RA 2GC7D 2YQBA 1L4AB 5B66E 3NWVA 1N7LA 1Z56A 2PFXA 1DIIC 1CIEA 1ZW0A 1C6RA 3WUTA 2KXPB 1YTCA 3NBSA 4W80A 3KDPB 1CSWA 1EZVG 5KLVE 2ZFCA 1PFIA 3NBTA 1SQXE 3H1HE 1JEKA 1NTME 3HQ9A 3GW6A 3C8VA 3CCUP 3D6YA 1SQVG 3NFQA 1URQB 1L0LJ 1VYDA 1CTJA 1MG3D 2QG4A 3CMAP 2OZ1A 1KILE 1OW7A 1S5LH 3AE6C 5CHXA 2NPSD 1RY3A 4PJ0H 5GTHH 1GKSA 1KB9D 1KORA 5AVQB 1AA0A 4U3FE 3OA8A 4GKGA 3B5NC 2K3RA 3GF3A 1FS0E 1DW2A 2C0WA 2E5YA 1P84D 3AEBC 3E7KA 2DW3A 3RK3B 1XTGB 2KB7P 3ZCFA 3KZIH 2Q6QA 2P67A 3ZOYA 4MN4C 3L75J 4O9BA 4WWIA 2E5TA 1YBKA 2FWLA 3VMZA 3HUSC 1HJ4A 2R5DA 1VQOP 1MKMA 2LR2A 1WEJF 4CPGA 2E75D 4OGQB 1SP4A 3H1LG 1DW1A 5AVVB 4WQEA 3SXTA 2HG5D 3G3ZA 5GTIV 2N18B 4WQAA 2ZZS1 5CIEB 1FI9A 3KYQA 3O5CA 3AEDC 4OVNF 3RGUA 4N0KA 1PP9E 2WPVB 3AEAC 5C39A 5B66V 2A06G 4PV1B 1SQXG 3H1HG 1N8RQ 1M57D 5KKZC 1G1JA 2C9XB 1OIPA 3V2NA 1NTZK 2BCCG 3A0HE 3M9QA 1LP1A 5KAFH 2FKWB 2BGVX 1M7LA 1PGOA 2WSEH 3RK2D 1CHJA 4GOFA 3U1CA 1Y9BA 2MKVA 2OQQA 4RSZA 1L0LE 1T2KC 1J1EB 3FXDA 4U3FG 5AW9B 4WY4C 3GHGC 1GL2C 3CI9A 5KLIC 3SSUA 1ZXGA 2BASA 4P4QB 4C7RA 2CK3H 4B86A 3ZDMA 2WVRA 5AW7B 4EIEA 1QX8A 2E74C 2N1TD 5CJ0A 2HR3A 1SQVK 1JTHA 2PP6A 4WB4A 2XTSB 1QGKB 2KLVA 4IL6H 1L4AC 2QSIA 1VQ9P 1SFCD 1N9CA 4KMGA 2W83C 3L36A 2L5GB 2R3CA 1VDFA 3MP7B 1NJIQ 3VN0A 4AQRD 1GK6A 1QEXA 3BCCD 5KJ7C 3AE2C 4K3AA 5CBNA 3B8EB 4GDOA 4R4MA 3M0DA 4PD4E 2HPCA 3RN0A 3MIWA 3Q5PA 1AVOA 2IPPA 1URQC 1FZBA 1YITP 2D2CD 3O8ZA 4H13B 5APQA 2E76D 3RBXA 1CIHA 1CXCA 4UB6V 3MK7B 1YICA 5DF5A 2IX7C 1GTWA 2JQRA 1AJYA 4RESB 2ZJSE 3X39A 1R8EA 3A0HV 1Q81Q 1H89A 3CYTI 1X0TA 1VQ5P 1KB0A 4YXWH 1KQGB 2YNYA 3RK3C 1H32B 3WC8A 2PAJA 3L72G 1BE3D 2P1JA 2E43A 3VOPA 1CSBA 3W67A 3SLEA 1I54A 3HQ8A 3T97B 5KLVK 2WTYA 2QJPB 3TDKA 1CC5A 1AVYA 1SQXK 4C7NB 1W5CT 4EICA 3FWNA 1OVRA 3IAOA 4OGQC 1HCMA 4I6MC 1LGHB 1FZGA 3A3YB 5GTHE 1NU1J 5APXA 2K88A 2WT7B 5AW3B 3CXHW 1CRYA 1NAYA 3O6QA 2WPQA 1UIXA 3ZOWA 2MTAC 1CXAA 5C0ZA 3CWBG 2RMZA 1SQQD 1M8OB 2IYPA 3H1ID 1YNRA 4N3YB 1CRHA 1T2KD 2YCCA 2V7QH 2FFDA 1M1JA 2KP8A 1AFOA 1AKKA 4FB1A 1GL2D 2JKVA 2XNXA 3BCCJ 2OYHB 2YMYA 2FBWC 3CXHI 3RLMA 1U7JA 1RF0A 3V5BA 4EOTA 1NVOA 2V08A 5TISH 2FYUE 1C2NA 1BDCA 3O20A 4JYCA 4K3IA 1DIQC 3CC7P 5B66H 1RHZB 2OYIB 1JOCA 3OW2O 2XNDH 1CZQA 4Y99B 3CCQP 2J58A 1J1EC 2BEQD 1DVHA 2ZT9B 4W7ZA 3M91A 1J3SA 3PXSA 3RK2B 1M70A 3H1LD 4NPDA 3SVWA 2K37A 1OVUA 3L71E 1CTZA 1G2CA 1NKZB 1ZRTD 3P32A 1AV1A 1R0QA 3USSA 1BE3J 5BVZA 2Z5IA 1ZP0C 1CRIA 4H44B 3B5NA 1M90Q 1KC8Q 1QN2A 3WFDC 3RBZA 1IQCA 1URQD 1H33B 2AEFA 2AI5A 3DR0A 1MUUA 3CL3D 1YEAA 3D70A 4GYDA 3S1KA 4FAVA 1LC1A 1S4XA 3G6EP 4XFJA 1NU1E 3PJSK 1FOSE 4ZKPA 2ZBOA 1K05A 1EC5A 2BPBB 1SFCB 2ZXXA 2RH0A 1BGYG 4XA4A 1SQQJ 2KNCA 1KQSO 3H1IJ 4L3GA 3RK3D 2BLFB 2VHDA 4ZNCA 1J1DB 5KTBA 3OAKA 1UIIA 4TLFA 3MK7C 3EQ2A 3LW5J 2FYUG 1I6DA 3VTPC 3AE7C 5APUA 2ITAA 3EFFK 5AVZB 4DZOA 1LTJA 1HJ5A 5AVYB 3CCJP 3H1JG 2HYNA 3BCCE 1HGVA 1VF5B 1N7SB 2G3AA 5H2FV 3CXHD 1KX7A 1JY3O 3D71A 2A45I 3AECC 2NPSC 2JP3A 2KYVA 3B71A 3PXWA 3L71G 2CXBA 1CIFA 1LWUB 2QJPC 1IK9A 2HODB 5DJTB 3A0HH 1QL2A 1Y8AA 5B5EV 1OW8A 1JNMA 1S3JA 3MHVA 2DVHA 2QVAA 4Y5RA 3L74D 5BU8B 2MHMA 2POHA 2LXCB 2YMKA 4WY4A 3GHGA 2JR8A 4PV1D 2IYOA 5AW6B 2XDJA 1PPJD 3HD7B 1CHIA 3OA7A 1BE3E 1OWAA 3CX5I 2E75C 2QJKB 1NHLA 1DT1A 3I5CA 1KMIZ 1KB9I 4LLHA 3LIEA 1NU1G 2IZ0A 2O01N 2RKLA 3PLNA 1F1FA 2QA4P 2O1JA 1WT6A 4BWNA 1NTKD 2P7JA 2Z4EA 1P84I 1CHHA 4ZMDA 2OYHC 2C1DB 1L4AA 3Q2YA 4EYYQ 1NAFA 2IFMA 1AOFA 3P8CD 3H32A 2KLUA 4L75A 1CORA 1SQPD 1SQQE 2B88A 1Q86Q 2OYIC 3P7KA 1YEBA 2WSFJ 5KJ7A 3H1IE 1DD4A 4Y99C 1VQ6P 4DY9A 3MUDA 5CCGD 2LIRA 1KYOW 3SWFA 2ZT9C 1NMLA 1KILA 1GW4A 1VQ7P 3RK2C 1ETPA 3RL0g 2HLOA 3RN1A 4PD4H 5GTIE 1LNQA 2Y0CA 2QRXA
chains in the Genus database with same CATH topology
4U3FD 1CRGA 1BL9A 1A2SA 2C9XB 3L73D 1SQBD 2DGEA 3VYMA 2BGVX 1LC2A 1MG2D 2LITA 4FANA 2N3YA 1CHJA 4UB8V 1LMSA 5TJHA 2QJYB 4AX3A 4RSZA 2C1UA 4J20A 5DJQC 3PTZA 4QAOA 1HZUA 3HQ7A 4WQ9A 1DW0A 3CX5W 4O1WA 1H9YA 5CICB 3H1KD 5IY51 4P4QB 1QKSA 4XXLA 2O3JA 1IZL0 2C2CA 3WU2V 2B10B 1H33A 4EIEA 1FI7A 3ZBMA 3WFCC 1GJQA 1GIWA 2N9IA 2RN0A 1U75B 3CX5D 1N50A 2BH5X 1NIRA 2FRCA 2YIUB 2XTSB 2C8SA 4JCGA 4WQBA 2KNCB 1N9CA 3KHUA 2B4ZA 4KMGA 4EIDA 1C6OA 1CNOA 1N90A 2I8FA 1W2LA 1H1OA 1YFCA 3BCCD 1K3GA 1DVVA 2PCBB 3M97X 3RN0A 1LFMA 1L0ND 2EXVA 3L4OA 3ITKA 2ZOOA 1YIQA 1C52A 5KLVD 1CCRA 2JWAA 4EIFA 1NTMD 3L72D 1C2RA 1CIHA 1CXCA 4UB6V 3MK7B 1CSUA 1YICA 1IRVA 5DF5A 3TYIA 2N3BA 2ORLA 1CSXA 2JQRA 2K9JB 1BCCD 3X39A 3DMIA 3L4MA 3O1YA 3A0HV 1FHBA 4H0KA 3TGUD 2BCNB 1WVEC 1L9BC 3CYTI 1HJ3A 2CA3B 1KB0A 1E8EA 2OZ1B 4D6TD 5KAIV 1EB7A 1H31B 1KV9A 1H32B 4WQ7A 3WC8A 1M6ZA 1BE3D 4WQ8A 4PJ0V 4PW9B 5GTHV 1KYOD 2HV4A 1OCDA 3SLEA 1I54A 3HQ8A 1AOQA 2QJPB 3GG2A 4L1QA 3TDKA 1CC5A 4IL6V 3CWBD 1W5CT 4EICA 1QL3A 2ZXYA 451CA 1HCMA 1CO6A 1GQ1A 2B0ZB 5AURA 3KZIV 3OCDB 3RMZA 3CXHW 1CRCA 1CRYA 4MU8A 5CIFB 2CE0A 3ZOWA 1CTYA 2MTAC 1CXAA 5C0ZA 1A8CA 3A0BV 2C1DA 4WQDA 2Q3EA 2Y0EA 4AAOA 2RMZA 1SQQD 3H1ID 1CRJA 1GU2A 1YNRA 4GEDB 3C2CA 3VNWA 1CRHA 1CYCA 2CA4B 2YCCA 1HZVA 1AKKA 3L70D 4FB1A 1PP9D 1IO3A 1CYIA 1I6EA 3FWLA 2L4DA 1CIGA 1FI3A 3RLMA 1MZ4A 2AIUA 4O1QA 3HQ6A 2V08A 1A56A 1C2NA 3ZOOA 3ORVA 3O20A 4K3IA 1DIQC 1RZ6A 4H0JA 1JDLA 1CCHA 2CE1A 1LS9A 1H32A 4FA9A 5C9MA 5CIHB 2L91A 1S6VB 2ZONG 1C6SA 1DVHA 1AYGA 5DFSA 5KAFV 1I55A 351CA 1J3SA 3PXSA 1K3HA 3PRJA 1L0LD 5EXQA 1M70A 3H1LD 1M60A 4XYDB 1HROA 1FCDC 3SVWA 3PHLA 3VRDA 1CYJA 1CTZA 1ZRTD 5KKZB 2D0SA 1R0QA 2FYNB 1NMIA 3CU4A 1FJ0A 4L3HA 1CRIA 4Q5PA 3WUIA 2C1VA 4V2KA 1QN2A 1RZ5A 2B12B 3WFDC 1BGYD 1B7VA 1NTZD 1IQCA 5E79V 1H33B 1I5TA 2AI5A 1HH7A 1CSVA 3DR0A 4WQCA 1YEAA 5DJQB 4GYDA 2BH4X 1CEDA 4FAVA 1RAPA 1LC1A 2V07A 5KLIB 3L75D 2FYUD 2IBZD 1FOCA 3ZOXA 1N15A 4FA5A 4RJTA 1QYZA 3H1JD 2ZBOA 3OA8B 5TISV 2BPBB 1RAQA 3WFBC 2AXTV 2N9YB 1NNOA 3PH2B 4L3GA 2KS1A 1I8OA 4FA4A 2B11B 2BLFB 2VHDA 3JBTB 2YK3A 1EZVD 4PD4D 3MK7C 3WFEC 1IRWA 1I6DA 3L71D 4AAMA 2N18C 1SQVD 2GC7D 3SJLA 2YQBA 3DP5A 1HJ5A 4NFGB 3NWVA 1DIIC 3CP5A 1CIEA 5CIGB 1YCCA 4PWAA 1DW3A 1C6RA 3SWSA 1GDVA 5H2FV 3CXHD 1F1CA 1KX7A 1KX2A 1YTCA 2GC4D 3NBSA 3TF5A 1CSWA 3VMAA 2GB8B 3NBTA 5CIBB 3HQ9A 3GW6A 3PXWA 2CXBA 1CIFA 1VYDA 1U74B 3A9FA 1CTJA 5CYTR 1MG3D 5B6QA 2QG4A 5B5EV 2DVHA 1NU1D 1ZZHA 2OZ1A 4Y5RA 3L74D 1COTA 1I8PA 2MHMA 1H31A 4LJIA 2JTIB 1GKSA 1KB9D 1PPJD 1CHIA 3OA8A 4AALA 2GIWA 2QJKB 1DW2A 1P84D 1DT1A 3ZCFA 3PLNA 1F1FA 1H9XA 1E2RA 3ZOYA 3OCDA 1NTKD 3ZIYA 4A7PA 1CHHA 2FWLA 3O0RC 1HJ4A 1OAEA 2C1DB 2Y0DA 1WEJF 2PACA 1DW1A 2A06D 1AOFA 1SQXD 3H1HD 4AANA 1CORA 1KIBA 4YE1A 4WQEA 3PXTA 3SXTA 1SQPD 2BCCD 1L9JC 1C7MA 1YEBA 5GTIV 2N18B 4WQAA 2ZZS1 5CIEB 1FI9A 5CIDB 1E29A 4DY9A 2LIRA 1KYOW 1C75A 4EDFA 1HRCA 1NMLA 3O5CA 1ETPA 2PCCB 4N0KA 3RN1A 155CA 4FA1A 5B66V 2D0WA 1S5LV 2N9JA 2Y0CA 1QL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U3F D;  1CRG A;  1BL9 A;  1A2S A;  2C9X B;  3L73 D;  1SQB D;  2DGE A;  3VYM A;  2BGV X;  1LC2 A;  1MG2 D;  2LIT A;  4FAN A;  2N3Y A;  1CHJ A;  4UB8 V;  1LMS A;  5TJH A;  2QJY B;  4AX3 A;  4RSZ A;  2C1U A;  4J20 A;  5DJQ C;  3PTZ A;  4QAO A;  1HZU A;  3HQ7 A;  4WQ9 A;  1DW0 A;  3CX5 W;  4O1W A;  1H9Y A;  5CIC B;  3H1K D;  5IY5 1;  4P4Q B;  1QKS A;  4XXL A;  2O3J A;  1IZL 0;  2C2C A;  3WU2 V;  2B10 B;  1H33 A;  4EIE A;  1FI7 A;  3ZBM A;  3WFC C;  1GJQ A;  1GIW A;  2N9I A;  2RN0 A;  1U75 B;  3CX5 D;  1N50 A;  2BH5 X;  1NIR A;  2FRC A;  2YIU B;  2XTS B;  2C8S A;  4JCG A;  4WQB A;  2KNC B;  1N9C A;  3KHU A;  2B4Z A;  4KMG A;  4EID A;  1C6O A;  1CNO A;  1N90 A;  2I8F A;  1W2L A;  1H1O A;  1YFC A;  3BCC D;  1K3G A;  1DVV A;  2PCB B;  3M97 X;  3RN0 A;  1LFM A;  1L0N D;  2EXV A;  3L4O A;  3ITK A;  2ZOO A;  1YIQ A;  1C52 A;  5KLV D;  1CCR A;  2JWA A;  4EIF A;  1NTM D;  3L72 D;  1C2R A;  1CIH A;  1CXC A;  4UB6 V;  3MK7 B;  1CSU A;  1YIC A;  1IRV A;  5DF5 A;  3TYI A;  2N3B A;  2ORL A;  1CSX A;  2JQR A;  2K9J B;  1BCC D;  3X39 A;  3DMI A;  3L4M A;  3O1Y A;  3A0H V;  1FHB A;  4H0K A;  3TGU D;  2BCN B;  1WVE C;  1L9B C;  3CYT I;  1HJ3 A;  2CA3 B;  1KB0 A;  1E8E A;  2OZ1 B;  4D6T D;  5KAI V;  1EB7 A;  1H31 B;  1KV9 A;  1H32 B;  4WQ7 A;  3WC8 A;  1M6Z A;  1BE3 D;  4WQ8 A;  4PJ0 V;  4PW9 B;  5GTH V;  1KYO D;  2HV4 A;  1OCD A;  3SLE A;  1I54 A;  3HQ8 A;  1AOQ A;  2QJP B;  3GG2 A;  4L1Q A;  3TDK A;  1CC5 A;  4IL6 V;  3CWB D;  1W5C T;  4EIC A;  1QL3 A;  2ZXY A;  451C A;  1HCM A;  1CO6 A;  1GQ1 A;  2B0Z B;  5AUR A;  3KZI V;  3OCD B;  3RMZ A;  3CXH W;  1CRC A;  1CRY A;  4MU8 A;  5CIF B;  2CE0 A;  3ZOW A;  1CTY A;  2MTA C;  1CXA A;  5C0Z A;  1A8C A;  3A0B V;  2C1D A;  4WQD A;  2Q3E A;  2Y0E A;  4AAO A;  2RMZ A;  1SQQ D;  3H1I D;  1CRJ A;  1GU2 A;  1YNR A;  4GED B;  3C2C A;  3VNW A;  1CRH A;  1CYC A;  2CA4 B;  2YCC A;  1HZV A;  1AKK A;  3L70 D;  4FB1 A;  1PP9 D;  1IO3 A;  1CYI A;  1I6E A;  3FWL A;  2L4D A;  1CIG A;  1FI3 A;  3RLM A;  1MZ4 A;  2AIU A;  4O1Q A;  3HQ6 A;  2V08 A;  1A56 A;  1C2N A;  3ZOO A;  3ORV A;  3O20 A;  4K3I A;  1DIQ C;  1RZ6 A;  4H0J A;  1JDL A;  1CCH A;  2CE1 A;  1LS9 A;  1H32 A;  4FA9 A;  5C9M A;  5CIH B;  2L91 A;  1S6V B;  2ZON G;  1C6S A;  1DVH A;  1AYG A;  5DFS A;  5KAF V;  1I55 A;  351C A;  1J3S A;  3PXS A;  1K3H A;  3PRJ A;  1L0L D;  5EXQ A;  1M70 A;  3H1L D;  1M60 A;  4XYD B;  1HRO A;  1FCD C;  3SVW A;  3PHL A;  3VRD A;  1CYJ A;  1CTZ A;  1ZRT D;  5KKZ B;  2D0S A;  1R0Q A;  2FYN B;  1NMI A;  3CU4 A;  1FJ0 A;  4L3H A;  1CRI A;  4Q5P A;  3WUI A;  2C1V A;  4V2K A;  1QN2 A;  1RZ5 A;  2B12 B;  3WFD C;  1BGY D;  1B7V A;  1NTZ D;  1IQC A;  5E79 V;  1H33 B;  1I5T A;  2AI5 A;  1HH7 A;  1CSV A;  3DR0 A;  4WQC A;  1YEA A;  5DJQ B;  4GYD A;  2BH4 X;  1CED A;  4FAV A;  1RAP A;  1LC1 A;  2V07 A;  5KLI B;  3L75 D;  2FYU D;  2IBZ D;  1FOC A;  3ZOX A;  1N15 A;  4FA5 A;  4RJT A;  1QYZ A;  3H1J D;  2ZBO A;  3OA8 B;  5TIS V;  2BPB B;  1RAQ A;  3WFB C;  2AXT V;  2N9Y B;  1NNO A;  3PH2 B;  4L3G A;  2KS1 A;  1I8O A;  4FA4 A;  2B11 B;  2BLF B;  2VHD A;  3JBT B;  2YK3 A;  1EZV D;  4PD4 D;  3MK7 C;  3WFE C;  1IRW A;  1I6D A;  3L71 D;  4AAM A;  2N18 C;  1SQV D;  2GC7 D;  3SJL A;  2YQB A;  3DP5 A;  1HJ5 A;  4NFG B;  3NWV A;  1DII C;  3CP5 A;  1CIE A;  5CIG B;  1YCC A;  4PWA A;  1DW3 A;  1C6R A;  3SWS A;  1GDV A;  5H2F V;  3CXH D;  1F1C A;  1KX7 A;  1KX2 A;  1YTC A;  2GC4 D;  3NBS A;  3TF5 A;  1CSW A;  3VMA A;  2GB8 B;  3NBT A;  5CIB B;  3HQ9 A;  3GW6 A;  3PXW A;  2CXB A;  1CIF A;  1VYD A;  1U74 B;  3A9F A;  1CTJ A;  5CYT R;  1MG3 D;  5B6Q A;  2QG4 A;  5B5E V;  2DVH A;  1NU1 D;  1ZZH A;  2OZ1 A;  4Y5R A;  3L74 D;  1COT A;  1I8P A;  2MHM A;  1H31 A;  4LJI A;  2JTI B;  1GKS A;  1KB9 D;  1PPJ D;  1CHI A;  3OA8 A;  4AAL A;  2GIW A;  2QJK B;  1DW2 A;  1P84 D;  1DT1 A;  3ZCF A;  3PLN A;  1F1F A;  1H9X A;  1E2R A;  3ZOY A;  3OCD A;  1NTK D;  3ZIY A;  4A7P A;  1CHH A;  2FWL A;  3O0R C;  1HJ4 A;  1OAE A;  2C1D B;  2Y0D A;  1WEJ F;  2PAC A;  1DW1 A;  2A06 D;  1AOF A;  1SQX D;  3H1H D;  4AAN A;  1COR A;  1KIB A;  4YE1 A;  4WQE A;  3PXT A;  3SXT A;  1SQP D;  2BCC D;  1L9J C;  1C7M A;  1YEB A;  5GTI V;  2N18 B;  4WQA A;  2ZZS 1;  5CIE B;  1FI9 A;  5CID B;  1E29 A;  4DY9 A;  2LIR A;  1KYO W;  1C75 A;  4EDF A;  1HRC A;  1NML A;  3O5C A;  1ETP A;  2PCC B;  4N0K A;  3RN1 A;  155C A;  4FA1 A;  5B66 V;  2D0W A;  1S5L V;  2N9J A;  2Y0C A;  1QL4 A; 
#chains in the Genus database with same CATH topology
 1CRG A;  3TNU B;  3AE1 C;  1R5S A;  1LT9 C;  4RO0 A;  4Z1M H;  3L73 D;  3VYM A;  2LIT A;  4BRY A;  1PGQ A;  2N3Y A;  4JYB A;  1N73 B;  4I7Z B;  1E5W A;  1KYO I;  4UB8 V;  1LMS A;  2ZYD A;  2FYU K;  4H0L B;  2QJY B;  3E1I A;  1YHQ P;  3L74 J;  2N1T C;  4H13 D;  5APW A;  3PTZ A;  2NZ2 A;  4QAO A;  1HZU A;  1CI6 B;  2ZVN B;  1H9Y A;  1SQB G;  2AEJ A;  3H1K D;  3V2P A;  1QKS A;  2M5A B;  2O3J A;  1IZL 0;  2C2C A;  1SFC C;  1K04 A;  1QVG O;  4EIJ A;  1JCD A;  1GIW A;  1GMJ A;  1JY2 O;  1U75 B;  3CX5 D;  1LTI C;  3WUV A;  3TGU E;  1J1D C;  1NTK J;  4D6T E;  2C8S A;  4WQB A;  2FXP A;  4NPF X;  3G71 P;  1IO4 A;  3P8M C;  3KHU A;  2SPZ A;  3AE8 C;  4EID A;  2D2C C;  3UIA A;  1N7S C;  3JSV C;  4L74 A;  2KZJ A;  1NO4 A;  1X8Y A;  2E76 C;  2ZVO B;  1SQP J;  1W2L A;  4GIF A;  4L73 A;  2JO1 A;  2B87 A;  2Z5H A;  3NXS A;  3RK3 E;  1VQL P;  3CC4 P;  1NU1 K;  2MJZ A;  1GU5 A;  1NH4 A;  1LFM A;  1L0N D;  2EXV A;  5CCH C;  1YIQ A;  3QH9 A;  5H2F H;  1XTC C;  1FBM A;  3KXD A;  3C9I A;  3TYI A;  2QEX P;  3BAS A;  2ORL A;  1CSX A;  3CXH E;  3RL0 B;  3L73 J;  4EI2 A;  1ZN5 A;  1BCC D;  3HD7 C;  1FZE A;  4XE5 B;  1KZU B;  2WQY C;  1NYH A;  1FHB A;  2G8Y A;  1HJ3 A;  2N9B A;  2E42 A;  1DEE G;  2QJK C;  4UB6 E;  2OZ1 B;  5KLV G;  4WQ7 A;  1HH0 A;  1JM0 A;  1NTM G;  1S9K D;  4WQ8 A;  3II6 A;  1KYO D;  4C46 A;  2OTJ P;  1FJP A;  1DX7 A;  3L74 E;  1ZV8 A;  3GG2 A;  4W7Y A;  2ZT9 D;  3PP5 A;  3H1K J;  1EXI A;  451C A;  3TGU G;  2XKM A;  3A2A A;  1CO6 A;  4D6T G;  1A02 J;  4H44 D;  4WVZ A;  2H8P D;  3Q5S A;  3U1A A;  2Y9Z A;  4WQD A;  4I2L C;  3L37 A;  2Y0E A;  4AAO A;  1VQ8 P;  1NTK E;  1JUN A;  2IDB A;  3H25 A;  1FAV A;  1GU2 A;  1SQB K;  1HZV A;  3H6P A;  3L70 D;  3P8C E;  1IO3 A;  1M1K Q;  1CYI A;  1NKN A;  3L75 E;  1X9V A;  3G4S P;  1L0N J;  3ZOO A;  1N73 C;  3Q3D A;  1EDL A;  3ORV A;  4I7Z C;  1FU1 A;  4H0J A;  4H0L C;  1JDL A;  1CCH A;  1H32 A;  5C9M A;  2R5B A;  4NPE A;  1E79 H;  2NPS A;  1S6V B;  2XV5 A;  4HB1 A;  3W68 A;  1HBW A;  2P10 A;  5DFS A;  1I55 A;  1PP9 G;  3CCS P;  1BCC J;  5AVS B;  4IFD K;  2M0B A;  1M60 A;  1RE4 C;  1FCD C;  3BRT B;  3PHL A;  3L73 E;  1BDD A;  1VF5 D;  2BEZ F;  1N7S D;  3LID A;  1FDI A;  4LGD E;  1T8Z A;  1HTL C;  4N78 D;  3TSI A;  3S4R A;  4V2K A;  1LTA C;  4OH8 B;  1NTZ D;  2GM4 A;  1L0L G;  5CCH D;  4WQC A;  5DJQ B;  3H1K E;  2BH4 X;  1OVV A;  1JTH B;  3D6Z A;  3NMD A;  2IBZ D;  1H8A A;  4DOJ A;  3ZOX A;  1GD2 E;  1HJB A;  3VMX A;  4RJT A;  3HD7 D;  1LJ2 A;  3CX5 E;  1NTM K;  1KFN A;  4OWF A;  1NNO A;  1KB9 E;  3HTK A;  3JBT B;  5AW5 B;  1EZV D;  3IF4 A;  2Q9I A;  3SFE C;  1P84 E;  3L75 G;  3L70 J;  1YJN P;  3R4Y A;  2OAR A;  2YO3 A;  2N18 C;  1SQV D;  1USE A;  3RL0 C;  3V2R A;  3DP5 A;  3VYI A;  4NFG B;  5CIG B;  2V4H A;  1DW3 A;  5AW0 B;  3N4X A;  3LW5 H;  1L0N E;  1LT9 A;  2GC4 D;  2QE7 H;  1DH3 A;  4PV1 C;  3F5H A;  5GTI H;  4YTP C;  2K9J A;  2QIW A;  1U74 B;  1W5C E;  5H2F E;  1JMM A;  2YKO A;  3VMY A;  2M3E A;  1BCC E;  2N1T A;  1IFJ A;  1COT A;  1H31 A;  4LJI A;  1T6A A;  3ABV C;  2JJL A;  2JTI B;  1BSN A;  4HH2 A;  1LTB C;  2KK7 A;  1S9K E;  5B5E E;  2YKQ A;  2GIW A;  1KYO E;  5BU5 A;  1NTZ J;  1SFC A;  1GDT A;  1OMI A;  1J2J B;  1HF9 A;  3NTN A;  4H0L D;  1A02 F;  1E2R A;  1N2D C;  4HJG H;  3BVH A;  1H0T A;  3OCD A;  3O6Q B;  1WRG A;  1JCC A;  1IFD A;  3CD6 P;  4L76 A;  2J5U A;  3O0R C;  5CCG C;  1OAE A;  5APS A;  1SS1 A;  2Y0D A;  2CPS A;  3HE5 A;  3A5T A;  3VP8 A;  2A06 D;  1FC2 C;  1KN7 A;  1FE6 A;  2H7H A;  1SQX D;  3H1H D;  2I1J A;  2WPS A;  1KIB A;  2FFD B;  1M1J B;  4YE1 A;  3PXT A;  2BCC D;  1L9J C;  1C7M A;  1L0L K;  5CID B;  1X22 A;  3HUS A;  1SQV J;  2O01 J;  1VQ4 P;  1HRC A;  4IOI H;  4HYT B;  5CCH A;  1IFM A;  1ZME C;  2PCC B;  3PH0 A;  1JB0 J;  2WSF H;  2D0W A;  1S5L V;  1JY3 N;  2N9J A;  1QL4 A;  4U3F D;  1ZLL A;  2J59 M;  4H13 C;  1A2S A;  5AW1 B;  5AVR B;  4FAN A;  4BXL A;  3GLM A;  2YXQ B;  3QWO C;  3CXH H;  1TU3 F;  3A7O A;  3HE4 A;  1QVF O;  2AEM A;  4AX3 A;  5DJQ C;  1NGM B;  5CJ4 A;  5APT A;  4UB6 H;  1KQL A;  4K35 A;  1OXZ A;  3CCE P;  2V7Q J;  1RH5 B;  3SWY A;  3CX5 W;  4O1W A;  4UB8 E;  1K9M Q;  5CIC B;  1JY3 P;  3RL0 D;  4N78 E;  4XXL A;  3H1L J;  4WBA A;  2B10 B;  1NOH A;  1YJ9 P;  1KD1 Q;  3ZBM A;  3WFC C;  1ZR2 A;  1FZC B;  3V6I A;  2N9I A;  4KHX A;  3SWK A;  3GMA A;  1N50 A;  1NIR A;  1GL2 A;  3A0B E;  2FRC A;  2YIU B;  3C1L A;  3K5B A;  1MFT A;  2WPR A;  1GK4 A;  2KNC B;  4JPZ B;  1YTZ T;  2C9L Y;  1SQX J;  3H1H J;  1CNO A;  1Q7Y Q;  1N90 A;  5AW4 B;  2I8F A;  2BCC J;  3TNU A;  1H1O A;  1YFC A;  1DVV A;  3MD0 A;  1IFI A;  1LTJ B;  3M97 X;  3TK1 A;  4AUW A;  3M9B A;  2H43 A;  3L4O A;  1SQV E;  1G1I A;  1C52 A;  1CCR A;  4EIF A;  3L72 D;  1C2R A;  4U3F J;  1IRV A;  4GOD A;  3I55 P;  2N3B A;  2JWD A;  3BCC G;  1RF1 B;  3DMI A;  2B9B A;  2ZYA A;  1URQ A;  2M5A A;  3CCV P;  1WVE C;  1E8E A;  3FX0 A;  5KAI V;  2R44 A;  1MFZ A;  3GHG B;  1KQF B;  1D7M A;  4YPC A;  1OCD A;  2A45 H;  5E79 E;  1AOQ A;  1YQ4 C;  4L1Q A;  4IL6 V;  3AEE C;  4H44 C;  3CWB D;  1VQP P;  2ZXY A;  4ASV A;  2KSE A;  3IN6 A;  2W6J H;  1GQ1 A;  2M3B A;  1FDO A;  1JY2 N;  1PGJ A;  5AUR A;  2KZI A;  1IC2 A;  1LTS C;  3H1L E;  1AQT A;  2AXC A;  2FFD C;  1HUC A;  3RMZ A;  1BE3 G;  1LTG C;  1CRC A;  3CCL P;  1ZRT E;  4MU8 A;  5CIF B;  4QMA A;  1CTY A;  2AXT E;  1YI2 P;  1A8C A;  3A0B V;  2PGD A;  1RF0 C;  2Q3E A;  1RE3 C;  2KI7 B;  1VL2 A;  3CX5 H;  3H32 B;  3C2C A;  1KB9 H;  2W6A A;  3AE4 C;  2A06 E;  2P2U A;  1I6E A;  1OW6 A;  1KIL B;  1JY2 P;  2BCC E;  1ZR4 A;  1P84 H;  1A56 A;  3TYY A;  1KV4 A;  1SQQ G;  2KS1 B;  2OYO A;  1RZ6 A;  1VF5 C;  1S5L X;  3H1I G;  1U7M A;  2CE1 A;  1LS9 A;  5CIH B;  3L72 J;  2ZON G;  1GW3 A;  1AYG A;  1IFN A;  2OGU A;  2WSC J;  351C A;  4BRY B;  2GUS A;  3PRJ A;  1GZL A;  5EXQ A;  2FXM A;  3M9H A;  1HRO A;  1W2E A;  1K73 Q;  2W6B A;  1LWU C;  1CYJ A;  2D0S A;  2FYN B;  5M1B A;  1NMI A;  1LTT C;  1FZC C;  3CU4 A;  4Q5P A;  2C1V A;  2YIU C;  4HKZ H;  3CWB J;  1BGY D;  1PZQ A;  5E79 V;  4TT3 H;  1I5T A;  1USD A;  5B5E H;  1CSV A;  2H88 C;  1KYO H;  3V2Q A;  4IFF A;  2V07 A;  3MZW B;  5EFW B;  2FYU D;  3JCU E;  3AEG C;  1IK7 A;  5CCG A;  1QYZ A;  3H1J D;  3OA8 B;  5TIS V;  1LTJ C;  3WFB C;  2AXT V;  4IFM A;  2IBZ I;  1CW5 A;  2KSJ A;  1PPJ E;  3PH2 B;  1I8O A;  1MV8 A;  2B11 B;  1HJ0 A;  4M3L A;  2NRG A;  2B87 B;  3S9O A;  1RQV A;  1FJK A;  1IRW A;  3L71 D;  2XZR A;  3SJL A;  5AVT B;  1PL5 A;  1RF1 C;  3CP5 A;  1EZV I;  1YCC A;  4GOE A;  3WMM 0;  4PWA A;  3SWS A;  1GDV A;  1HWT C;  1F1C A;  1EDJ A;  3IR9 A;  1KX2 A;  1L2P A;  3TF5 A;  4DCK A;  1N86 A;  3VMA A;  2GB8 B;  1Q2N A;  5CIB B;  3L72 E;  5K5G B;  3G9R A;  1QL1 A;  1SQP E;  3A9F A;  4KT0 J;  5CYT R;  2UWJ E;  5B6Q A;  2LXB A;  1BSH A;  2QM8 A;  1NU1 D;  1ZZH A;  5KAI H;  1YTZ I;  1I8P A;  2VRS A;  2QJY C;  2I1K A;  1KTM A;  1SQQ K;  1LP1 B;  5AW8 B;  2Q1K A;  3WU2 E;  3T97 A;  4IL6 X;  4AAL A;  1BGY J;  3L35 A;  4C7N A;  1OX3 A;  4UB8 H;  2K1A A;  4N6J A;  2ZXE B;  1JMB A;  3CWB E;  1H9X A;  3L74 G;  3FXE A;  2FYU J;  2WT7 A;  3ZIY A;  4A7P A;  1S1C X;  2OTL P;  3MUD C;  1PPJ G;  3B5N D;  2CPB A;  4GT1 A;  3H1J J;  1OZH A;  3A0B H;  1KIL C;  1DEB A;  2PAC A;  1EQ7 A;  4AAN A;  1WMK A;  5AVX B;  2YO2 A;  4YXD C;  1E29 A;  1NTK G;  3L71 J;  2OYH A;  1C75 A;  4EDF A;  2JDI H;  2WZ7 A;  3OJA B;  1Q82 Q;  155C A;  4FA1 A;  2WSE J;  3AEF C;  2B89 A;  1ZOY C;  2NPS B;  1BL9 A;  5CMZ A;  2OYI A;  2FYN C;  2O01 H;  1SQP G;  2Q5U A;  2FY8 A;  3CME P;  1VQN P;  3M06 A;  1SQB D;  2DGE A;  4AYC A;  1LC2 A;  1MG2 D;  4U7J A;  2HPC B;  2KOG A;  1S5L E;  3IFM A;  3M0A A;  4PJ0 E;  5TJH A;  2C1U A;  4J20 A;  3BRV B;  3CC2 P;  1KFM A;  3MGN A;  3V4W A;  3HQ7 A;  1OFC X;  4WQ9 A;  1DW0 A;  3EFG A;  1AQ5 A;  2ZAE B;  1T3U A;  1S72 P;  3L73 G;  2E75 B;  5IY5 1;  1PGP A;  5E79 H;  4DT0 A;  2A45 G;  3WU2 V;  3KZI E;  3Q5R A;  1H33 A;  2KUB A;  1FI7 A;  2C0X A;  4ZKU A;  3KPE A;  2H89 C;  1BGY E;  1GJQ A;  3WUU A;  2RN0 A;  1R5L A;  4WY4 D;  2BH5 X;  2GA1 A;  2O1K A;  2WMM A;  1H88 A;  4JCG A;  4I1L A;  3AE5 C;  1RE3 A;  4Y28 J;  1FZF A;  3H1K G;  3AE9 C;  3B4S A;  2AXT H;  2B4Z A;  3HTK B;  2E74 D;  3N7N A;  3H1J E;  1C6O A;  1GU4 A;  2IZ1 A;  1K3G A;  3U59 A;  4R4L A;  2PCB B;  5DJU B;  4LC1 A;  1L4A D;  3D0W A;  1U57 A;  3ITK A;  2C9N Y;  2ZOO A;  5KLV D;  1N7S A;  1JO5 A;  2JWA A;  2QM7 A;  1NTM D;  1LT9 B;  5APV A;  5KAF E;  1CSU A;  5KJ7 D;  3SFD C;  2YKP A;  3V4Q A;  2W27 A;  2Q3I A;  1SQB J;  2K9J B;  1IFP A;  1FZA A;  1KIL D;  3L4M A;  3O1Y A;  1LWU A;  2HOD A;  4H0K A;  3TGU D;  3L70 E;  2BCN B;  1L9B C;  1L0N G;  2CA3 B;  2N1T B;  1NTK K;  4D6T D;  1EB7 A;  1H31 B;  1KV9 A;  3CCR P;  1FZC A;  1M6Z A;  1PV3 A;  3FGA D;  3HRN A;  2Y9Y A;  1EXJ A;  4PJ0 V;  4PW9 B;  5GTH V;  2HV4 A;  2HFE D;  4JF7 A;  4JQ0 D;  3CPW O;  1VQM P;  4RKU J;  3HD7 A;  1BCC G;  1T3J A;  1FDM A;  1QL3 A;  1SQP K;  5KAI E;  4ASW A;  3VP9 A;  3GF7 A;  2I8D A;  1G2C B;  2JEE A;  2B0Z B;  5CBO A;  3KZI V;  1H0T B;  3OCD B;  3Q1M A;  1K8A Q;  4IL6 E;  1HGZ A;  2KIK A;  2CE0 A;  3B5N B;  3HE5 B;  2GUV A;  1EDK A;  3EWK A;  2C1D A;  3JCU H;  3BAT A;  3KQG A;  4PD4 I;  2D2C B;  4OGQ D;  1YIJ P;  1CRJ A;  4GED B;  2E76 B;  3L4F A;  2W90 A;  3VNW A;  1S2E A;  1CYC A;  1NTZ E;  2CA4 B;  1RQU A;  2XU6 A;  5APY A;  5AVW B;  1IZN B;  2FYZ A;  2P58 A;  3HUS B;  1PP9 D;  3FWL A;  2L4D A;  1EDI A;  1CIG A;  2OTK E;  1FI3 A;  1YQ3 C;  1MZ4 A;  1RF1 A;  2AIU A;  4O1Q A;  3HQ6 A;  3M0D C;  3AE3 C;  2IBZ E;  2R32 A;  5KLV J;  4KJM A;  2K9Y A;  1M56 D;  1NTM J;  4FA9 A;  1Q90 D;  2L91 A;  5AW2 B;  2IFN A;  1DIP A;  1C6S A;  3L70 G;  5KAF V;  2WIT A;  2PRR A;  1K3H A;  1W2B O;  1HVV A;  1L0L D;  1EZV E;  4XYD B;  1N73 A;  3HE4 B;  3TGU J;  3VRD A;  1SQB E;  1DD3 A;  5KKZ B;  4D6T J;  1FOS F;  3CLQ A;  1IJD B;  2WSC H;  1YYC A;  4L3H A;  1FJ0 A;  5L8R J;  3WUI A;  1CI6 A;  4JBZ A;  1VQK P;  2B12 B;  1RZ5 A;  2FXO A;  1B7V A;  1RE4 A;  2WSS H;  3WU2 H;  1NWQ A;  1HH7 A;  2W8Z A;  5AVU B;  1SLQ A;  1CED A;  2R3S A;  4WY4 B;  1RAP A;  1QLE D;  1GL2 B;  5KLI B;  3L75 D;  3JC2 2;  4DJG A;  1L0N K;  2WWW A;  2YXR B;  1FOC A;  1N15 A;  4FA5 A;  1VPC A;  2LKM A;  2Q7C A;  3F89 A;  3CCM P;  1RAQ A;  1SVF A;  1YJW P;  3R2P A;  1NTZ G;  1PIX A;  2E74 B;  2N9Y B;  2KS1 A;  2ZYG A;  4FA4 A;  1MZ9 A;  3MTU E;  2YK3 A;  3I56 P;  4PD4 D;  1M1J C;  1Y47 A;  3WFE C;  1X79 B;  2M8R A;  5TIS E;  2IBZ G;  1PP9 J;  4AAM A;  1LT1 A;  3E1R A;  2GC7 D;  2YQB A;  1L4A B;  5B66 E;  3NWV A;  1N7L A;  1Z56 A;  2PFX A;  1DII C;  1CIE A;  1ZW0 A;  1C6R A;  3WUT A;  2KXP B;  1YTC A;  3NBS A;  4W80 A;  3KDP B;  1CSW A;  1EZV G;  5KLV E;  2ZFC A;  1PFI A;  3NBT A;  1SQX E;  3H1H E;  1JEK A;  1NTM E;  3HQ9 A;  3GW6 A;  3C8V A;  3CCU P;  3D6Y A;  1SQV G;  3NFQ A;  1URQ B;  1L0L J;  1VYD A;  1CTJ A;  1MG3 D;  2QG4 A;  3CMA P;  2OZ1 A;  1KIL E;  1OW7 A;  1S5L H;  3AE6 C;  5CHX A;  2NPS D;  1RY3 A;  4PJ0 H;  5GTH H;  1GKS A;  1KB9 D;  1KOR A;  5AVQ B;  1AA0 A;  4U3F E;  3OA8 A;  4GKG A;  3B5N C;  2K3R A;  3GF3 A;  1FS0 E;  1DW2 A;  2C0W A;  2E5Y A;  1P84 D;  3AEB C;  3E7K A;  2DW3 A;  3RK3 B;  1XTG B;  2KB7 P;  3ZCF A;  3KZI H;  2Q6Q A;  2P67 A;  3ZOY A;  4MN4 C;  3L75 J;  4O9B A;  4WWI A;  2E5T A;  1YBK A;  2FWL A;  3VMZ A;  3HUS C;  1HJ4 A;  2R5D A;  1VQO P;  1MKM A;  2LR2 A;  1WEJ F;  4CPG A;  2E75 D;  4OGQ B;  1SP4 A;  3H1L G;  1DW1 A;  5AVV B;  4WQE A;  3SXT A;  2HG5 D;  3G3Z A;  5GTI V;  2N18 B;  4WQA A;  2ZZS 1;  5CIE B;  1FI9 A;  3KYQ A;  3O5C A;  3AED C;  4OVN F;  3RGU A;  4N0K A;  1PP9 E;  2WPV B;  3AEA C;  5C39 A;  5B66 V;  2A06 G;  4PV1 B;  1SQX G;  3H1H G;  1N8R Q;  1M57 D;  5KKZ C;  1G1J A;  2C9X B;  1OIP A;  3V2N A;  1NTZ K;  2BCC G;  3A0H E;  3M9Q A;  1LP1 A;  5KAF H;  2FKW B;  2BGV X;  1M7L A;  1PGO A;  2WSE H;  3RK2 D;  1CHJ A;  4GOF A;  3U1C A;  1Y9B A;  2MKV A;  2OQQ A;  4RSZ A;  1L0L E;  1T2K C;  1J1E B;  3FXD A;  4U3F G;  5AW9 B;  4WY4 C;  3GHG C;  1GL2 C;  3CI9 A;  5KLI C;  3SSU A;  1ZXG A;  2BAS A;  4P4Q B;  4C7R A;  2CK3 H;  4B86 A;  3ZDM A;  2WVR A;  5AW7 B;  4EIE A;  1QX8 A;  2E74 C;  2N1T D;  5CJ0 A;  2HR3 A;  1SQV K;  1JTH A;  2PP6 A;  4WB4 A;  2XTS B;  1QGK B;  2KLV A;  4IL6 H;  1L4A C;  2QSI A;  1VQ9 P;  1SFC D;  1N9C A;  4KMG A;  2W83 C;  3L36 A;  2L5G B;  2R3C A;  1VDF A;  3MP7 B;  1NJI Q;  3VN0 A;  4AQR D;  1GK6 A;  1QEX A;  3BCC D;  5KJ7 C;  3AE2 C;  4K3A A;  5CBN A;  3B8E B;  4GDO A;  4R4M A;  3M0D A;  4PD4 E;  2HPC A;  3RN0 A;  3MIW A;  3Q5P A;  1AVO A;  2IPP A;  1URQ C;  1FZB A;  1YIT P;  2D2C D;  3O8Z A;  4H13 B;  5APQ A;  2E76 D;  3RBX A;  1CIH A;  1CXC A;  4UB6 V;  3MK7 B;  1YIC A;  5DF5 A;  2IX7 C;  1GTW A;  2JQR A;  1AJY A;  4RES B;  2ZJS E;  3X39 A;  1R8E A;  3A0H V;  1Q81 Q;  1H89 A;  3CYT I;  1X0T A;  1VQ5 P;  1KB0 A;  4YXW H;  1KQG B;  2YNY A;  3RK3 C;  1H32 B;  3WC8 A;  2PAJ A;  3L72 G;  1BE3 D;  2P1J A;  2E43 A;  3VOP A;  1CSB A;  3W67 A;  3SLE A;  1I54 A;  3HQ8 A;  3T97 B;  5KLV K;  2WTY A;  2QJP B;  3TDK A;  1CC5 A;  1AVY A;  1SQX K;  4C7N B;  1W5C T;  4EIC A;  3FWN A;  1OVR A;  3IAO A;  4OGQ C;  1HCM A;  4I6M C;  1LGH B;  1FZG A;  3A3Y B;  5GTH E;  1NU1 J;  5APX A;  2K88 A;  2WT7 B;  5AW3 B;  3CXH W;  1CRY A;  1NAY A;  3O6Q A;  2WPQ A;  1UIX A;  3ZOW A;  2MTA C;  1CXA A;  5C0Z A;  3CWB G;  2RMZ A;  1SQQ D;  1M8O B;  2IYP A;  3H1I D;  1YNR A;  4N3Y B;  1CRH A;  1T2K D;  2YCC A;  2V7Q H;  2FFD A;  1M1J A;  2KP8 A;  1AFO A;  1AKK A;  4FB1 A;  1GL2 D;  2JKV A;  2XNX A;  3BCC J;  2OYH B;  2YMY A;  2FBW C;  3CXH I;  3RLM A;  1U7J A;  1RF0 A;  3V5B A;  4EOT A;  1NVO A;  2V08 A;  5TIS H;  2FYU E;  1C2N A;  1BDC A;  3O20 A;  4JYC A;  4K3I A;  1DIQ C;  3CC7 P;  5B66 H;  1RHZ B;  2OYI B;  1JOC A;  3OW2 O;  2XND H;  1CZQ A;  4Y99 B;  3CCQ P;  2J58 A;  1J1E C;  2BEQ D;  1DVH A;  2ZT9 B;  4W7Z A;  3M91 A;  1J3S A;  3PXS A;  3RK2 B;  1M70 A;  3H1L D;  4NPD A;  3SVW A;  2K37 A;  1OVU A;  3L71 E;  1CTZ A;  1G2C A;  1NKZ B;  1ZRT D;  3P32 A;  1AV1 A;  1R0Q A;  3USS A;  1BE3 J;  5BVZ A;  2Z5I A;  1ZP0 C;  1CRI A;  4H44 B;  3B5N A;  1M90 Q;  1KC8 Q;  1QN2 A;  3WFD C;  3RBZ A;  1IQC A;  1URQ D;  1H33 B;  2AEF A;  2AI5 A;  3DR0 A;  1MUU A;  3CL3 D;  1YEA A;  3D70 A;  4GYD A;  3S1K A;  4FAV A;  1LC1 A;  1S4X A;  3G6E P;  4XFJ A;  1NU1 E;  3PJS K;  1FOS E;  4ZKP A;  2ZBO A;  1K05 A;  1EC5 A;  2BPB B;  1SFC B;  2ZXX A;  2RH0 A;  1BGY G;  4XA4 A;  1SQQ J;  2KNC A;  1KQS O;  3H1I J;  4L3G A;  3RK3 D;  2BLF B;  2VHD A;  4ZNC A;  1J1D B;  5KTB A;  3OAK A;  1UII A;  4TLF A;  3MK7 C;  3EQ2 A;  3LW5 J;  2FYU G;  1I6D A;  3VTP C;  3AE7 C;  5APU A;  2ITA A;  3EFF K;  5AVZ B;  4DZO A;  1LTJ A;  1HJ5 A;  5AVY B;  3CCJ P;  3H1J G;  2HYN A;  3BCC E;  1HGV A;  1VF5 B;  1N7S B;  2G3A A;  5H2F V;  3CXH D;  1KX7 A;  1JY3 O;  3D71 A;  2A45 I;  3AEC C;  2NPS C;  2JP3 A;  2KYV A;  3B71 A;  3PXW A;  3L71 G;  2CXB A;  1CIF A;  1LWU B;  2QJP C;  1IK9 A;  2HOD B;  5DJT B;  3A0H H;  1QL2 A;  1Y8A A;  5B5E V;  1OW8 A;  1JNM A;  1S3J A;  3MHV A;  2DVH A;  2QVA A;  4Y5R A;  3L74 D;  5BU8 B;  2MHM A;  2POH A;  2LXC B;  2YMK A;  4WY4 A;  3GHG A;  2JR8 A;  4PV1 D;  2IYO A;  5AW6 B;  2XDJ A;  1PPJ D;  3HD7 B;  1CHI A;  3OA7 A;  1BE3 E;  1OWA A;  3CX5 I;  2E75 C;  2QJK B;  1NHL A;  1DT1 A;  3I5C A;  1KMI Z;  1KB9 I;  4LLH A;  3LIE A;  1NU1 G;  2IZ0 A;  2O01 N;  2RKL A;  3PLN A;  1F1F A;  2QA4 P;  2O1J A;  1WT6 A;  4BWN A;  1NTK D;  2P7J A;  2Z4E A;  1P84 I;  1CHH A;  4ZMD A;  2OYH C;  2C1D B;  1L4A A;  3Q2Y A;  4EYY Q;  1NAF A;  2IFM A;  1AOF A;  3P8C D;  3H32 A;  2KLU A;  4L75 A;  1COR A;  1SQP D;  1SQQ E;  2B88 A;  1Q86 Q;  2OYI C;  3P7K A;  1YEB A;  2WSF J;  5KJ7 A;  3H1I E;  1DD4 A;  4Y99 C;  1VQ6 P;  4DY9 A;  3MUD A;  5CCG D;  2LIR A;  1KYO W;  3SWF A;  2ZT9 C;  1NML A;  1KIL A;  1GW4 A;  1VQ7 P;  3RK2 C;  1ETP A;  3RL0 g;  2HLO A;  3RN1 A;  4PD4 H;  5GTI E;  1LNQ A;  2Y0C A;  2QRX A; 
#chains in the Genus database with same CATH homology
 4U3F D;  1CRG A;  1BL9 A;  1A2S A;  2C9X B;  3L73 D;  1SQB D;  2DGE A;  3VYM A;  2BGV X;  1LC2 A;  1MG2 D;  2LIT A;  4FAN A;  2N3Y A;  1CHJ A;  4UB8 V;  1LMS A;  5TJH A;  2QJY B;  4AX3 A;  4RSZ A;  2C1U A;  4J20 A;  5DJQ C;  3PTZ A;  4QAO A;  1HZU A;  3HQ7 A;  4WQ9 A;  1DW0 A;  3CX5 W;  4O1W A;  1H9Y A;  5CIC B;  3H1K D;  5IY5 1;  4P4Q B;  1QKS A;  4XXL A;  2O3J A;  1IZL 0;  2C2C A;  3WU2 V;  2B10 B;  1H33 A;  4EIE A;  1FI7 A;  3ZBM A;  3WFC C;  1GJQ A;  1GIW A;  2N9I A;  2RN0 A;  1U75 B;  3CX5 D;  1N50 A;  2BH5 X;  1NIR A;  2FRC A;  2YIU B;  2XTS B;  2C8S A;  4JCG A;  4WQB A;  2KNC B;  1N9C A;  3KHU A;  2B4Z A;  4KMG A;  4EID A;  1C6O A;  1CNO A;  1N90 A;  2I8F A;  1W2L A;  1H1O A;  1YFC A;  3BCC D;  1K3G A;  1DVV A;  2PCB B;  3M97 X;  3RN0 A;  1LFM A;  1L0N D;  2EXV A;  3L4O A;  3ITK A;  2ZOO A;  1YIQ A;  1C52 A;  5KLV D;  1CCR A;  2JWA A;  4EIF A;  1NTM D;  3L72 D;  1C2R A;  1CIH A;  1CXC A;  4UB6 V;  3MK7 B;  1CSU A;  1YIC A;  1IRV A;  5DF5 A;  3TYI A;  2N3B A;  2ORL A;  1CSX A;  2JQR A;  2K9J B;  1BCC D;  3X39 A;  3DMI A;  3L4M A;  3O1Y A;  3A0H V;  1FHB A;  4H0K A;  3TGU D;  2BCN B;  1WVE C;  1L9B C;  3CYT I;  1HJ3 A;  2CA3 B;  1KB0 A;  1E8E A;  2OZ1 B;  4D6T D;  5KAI V;  1EB7 A;  1H31 B;  1KV9 A;  1H32 B;  4WQ7 A;  3WC8 A;  1M6Z A;  1BE3 D;  4WQ8 A;  4PJ0 V;  4PW9 B;  5GTH V;  1KYO D;  2HV4 A;  1OCD A;  3SLE A;  1I54 A;  3HQ8 A;  1AOQ A;  2QJP B;  3GG2 A;  4L1Q A;  3TDK A;  1CC5 A;  4IL6 V;  3CWB D;  1W5C T;  4EIC A;  1QL3 A;  2ZXY A;  451C A;  1HCM A;  1CO6 A;  1GQ1 A;  2B0Z B;  5AUR A;  3KZI V;  3OCD B;  3RMZ A;  3CXH W;  1CRC A;  1CRY A;  4MU8 A;  5CIF B;  2CE0 A;  3ZOW A;  1CTY A;  2MTA C;  1CXA A;  5C0Z A;  1A8C A;  3A0B V;  2C1D A;  4WQD A;  2Q3E A;  2Y0E A;  4AAO A;  2RMZ A;  1SQQ D;  3H1I D;  1CRJ A;  1GU2 A;  1YNR A;  4GED B;  3C2C A;  3VNW A;  1CRH A;  1CYC A;  2CA4 B;  2YCC A;  1HZV A;  1AKK A;  3L70 D;  4FB1 A;  1PP9 D;  1IO3 A;  1CYI A;  1I6E A;  3FWL A;  2L4D A;  1CIG A;  1FI3 A;  3RLM A;  1MZ4 A;  2AIU A;  4O1Q A;  3HQ6 A;  2V08 A;  1A56 A;  1C2N A;  3ZOO A;  3ORV A;  3O20 A;  4K3I A;  1DIQ C;  1RZ6 A;  4H0J A;  1JDL A;  1CCH A;  2CE1 A;  1LS9 A;  1H32 A;  4FA9 A;  5C9M A;  5CIH B;  2L91 A;  1S6V B;  2ZON G;  1C6S A;  1DVH A;  1AYG A;  5DFS A;  5KAF V;  1I55 A;  351C A;  1J3S A;  3PXS A;  1K3H A;  3PRJ A;  1L0L D;  5EXQ A;  1M70 A;  3H1L D;  1M60 A;  4XYD B;  1HRO A;  1FCD C;  3SVW A;  3PHL A;  3VRD A;  1CYJ A;  1CTZ A;  1ZRT D;  5KKZ B;  2D0S A;  1R0Q A;  2FYN B;  1NMI A;  3CU4 A;  1FJ0 A;  4L3H A;  1CRI A;  4Q5P A;  3WUI A;  2C1V A;  4V2K A;  1QN2 A;  1RZ5 A;  2B12 B;  3WFD C;  1BGY D;  1B7V A;  1NTZ D;  1IQC A;  5E79 V;  1H33 B;  1I5T A;  2AI5 A;  1HH7 A;  1CSV A;  3DR0 A;  4WQC A;  1YEA A;  5DJQ B;  4GYD A;  2BH4 X;  1CED A;  4FAV A;  1RAP A;  1LC1 A;  2V07 A;  5KLI B;  3L75 D;  2FYU D;  2IBZ D;  1FOC A;  3ZOX A;  1N15 A;  4FA5 A;  4RJT A;  1QYZ A;  3H1J D;  2ZBO A;  3OA8 B;  5TIS V;  2BPB B;  1RAQ A;  3WFB C;  2AXT V;  2N9Y B;  1NNO A;  3PH2 B;  4L3G A;  2KS1 A;  1I8O A;  4FA4 A;  2B11 B;  2BLF B;  2VHD A;  3JBT B;  2YK3 A;  1EZV D;  4PD4 D;  3MK7 C;  3WFE C;  1IRW A;  1I6D A;  3L71 D;  4AAM A;  2N18 C;  1SQV D;  2GC7 D;  3SJL A;  2YQB A;  3DP5 A;  1HJ5 A;  4NFG B;  3NWV A;  1DII C;  3CP5 A;  1CIE A;  5CIG B;  1YCC A;  4PWA A;  1DW3 A;  1C6R A;  3SWS A;  1GDV A;  5H2F V;  3CXH D;  1F1C A;  1KX7 A;  1KX2 A;  1YTC A;  2GC4 D;  3NBS A;  3TF5 A;  1CSW A;  3VMA A;  2GB8 B;  3NBT A;  5CIB B;  3HQ9 A;  3GW6 A;  3PXW A;  2CXB A;  1CIF A;  1VYD A;  1U74 B;  3A9F A;  1CTJ A;  5CYT R;  1MG3 D;  5B6Q A;  2QG4 A;  5B5E V;  2DVH A;  1NU1 D;  1ZZH A;  2OZ1 A;  4Y5R A;  3L74 D;  1COT A;  1I8P A;  2MHM A;  1H31 A;  4LJI A;  2JTI B;  1GKS A;  1KB9 D;  1PPJ D;  1CHI A;  3OA8 A;  4AAL A;  2GIW A;  2QJK B;  1DW2 A;  1P84 D;  1DT1 A;  3ZCF A;  3PLN A;  1F1F A;  1H9X A;  1E2R A;  3ZOY A;  3OCD A;  1NTK D;  3ZIY A;  4A7P A;  1CHH A;  2FWL A;  3O0R C;  1HJ4 A;  1OAE A;  2C1D B;  2Y0D A;  1WEJ F;  2PAC A;  1DW1 A;  2A06 D;  1AOF A;  1SQX D;  3H1H D;  4AAN A;  1COR A;  1KIB A;  4YE1 A;  4WQE A;  3PXT A;  3SXT A;  1SQP D;  2BCC D;  1L9J C;  1C7M A;  1YEB A;  5GTI V;  2N18 B;  4WQA A;  2ZZS 1;  5CIE B;  1FI9 A;  5CID B;  1E29 A;  4DY9 A;  2LIR A;  1KYO W;  1C75 A;  4EDF A;  1HRC A;  1NML A;  3O5C A;  1ETP A;  2PCC B;  4N0K A;  3RN1 A;  155C A;  4FA1 A;  5B66 V;  2D0W A;  1S5L V;  2N9J A;  2Y0C A;  1QL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...