2FYUD

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 65
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2fyuD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2fyuD02
5IY51 1CC5A 1J3SA 1H31B 3NWVA 5KAFV 5CIEB 2Y0EA 4EIEA 3PH2B 1E8EA 1I5TA 1BL9A 4AALA 1OCDA 1FOCA 4FB1A 2DGEA 1RAQA 3SJLA 4AANA 2LIRA 3HQ9A 1CCRA 1YICA 1DVHA 1MZ4A 4RSZA 3WFCC 1AYGA 3ORVA 2BH4X 1I54A 4WQ9A 5B6QA 2BCCD 2Y0CA 2L4DA 1KX2A 2YCCA 2V07A 1CHIA 2OZ1B 4WQDA 3TDKA 2PACA 1W5CT 5CIHB 1KB0A 4FA4A 1A56A 351CA 2C1DB 4WQ7A 1A8CA 1CNOA 4PWAA 1KIBA 1YFCA 1M60A 1U74B 2JQRA 3SXTA 3WFBC 3FWLA 1CCHA 4FA9A 1YNRA 3CP5A 1YIQA 5EXQA 1NNOA 1CRJA 1I6EA 4YE1A 1CYIA 4O1QA 1NIRA 5DJQC 1CORA 1QL3A 1LFMA 3O0RC 3OCDB 1H1OA 1H31A 2ORLA 3PXWA 1YEBA 2GB8B 3O20A 3PHLA 4L1QA 2PCCB 3OA8B 1L9JC 1CSUA 4WQEA 2IBZD 1CIFA 2ZOOA 1CRYA 1NU1D 2C1UA 1F1CA 2Y0DA 5CYTR 4H0KA 1WEJF 2O3JA 1CO6A 1CRHA 3CYTI 1HJ3A 2OZ1A 3DMIA 3L75D 2C1VA 3MK7B 3L70D 4K3IA 2N3BA 1NMIA 1IQCA 2N9JA 3RN1A 2BPBB 5TISV 1ZRTD 1JDLA 3M97X 3SWSA 2CXBA 3L71D 2VHDA 3A9FA 3VRDA 5KAIV 3VMAA 1K3HA 5KKZB 3H1LD 1BCCD 1DW1A 2FYNB 1AOQA 1CTZA 3ZOXA 2C9XB 2D0WA 5DFSA 1GKSA 2EXVA 1SQXD 1CRIA 3NBSA 1I55A 1H33B 1CXCA 1BE3D 3ZOYA 5CICB 4U3FD 1FJ0A 1M70A 1B7VA 155CA 2CA3B 4L3GA 1IZL0 5C9MA 2V08A 3RLMA 1BGYD 3RN0A 1C6RA 1YEAA 2XTSB 4XYDB 2B11B 1FCDC 3SLEA 3CX5W 1KYOW 1C52A 3L72D 3ZOOA 4PD4D 2ZONG 1FI7A 2B12B 1KV9A 1RAPA 1FI9A 3A0HV 1CRGA 1HRCA 4GEDB 3ZBMA 2GIWA 1HJ5A 3H1KD 2KNCB 1VYDA 1P84D 3DP5A 3MK7C 4EDFA 2AIUA 3KHUA 1M6ZA 1WVEC 1IRWA 4QAOA 1GIWA 2QJKB 1PP9D 3H1HD 2QJYB 4AAMA 3DR0A 5B5EV 1HJ4A 1DW3A 2CE0A 1CRCA 2C8SA 1GU2A 2BLFB 2JTIB 5CIDB 5DJQB 2B4ZA 3OCDA 1U75B 2N3YA 4PW9B 1I8OA 1CSVA 4NFGB 2BGVX 1H9YA 1QYZA 3CXHD 3CWBD 3L4OA 2FWLA 3JBTB 1NTKD 1C7MA 2PCBB 1N50A 4UB6V 2B0ZB 3GG2A 2AI5A 1EB7A 5AURA 2K9JB 3C2CA 2CA4B 1HROA 1NMLA 3O1YA 1W2LA 2BCNB 4H0JA 1SQVD 1L0ND 3VNWA 2JWAA 2YK3A 1MG3D 2I8FA 3HQ6A 3ZIYA 3HQ7A 3SVWA 5CIBB 2RN0A 5KLVD 3WC8A 4MU8A 3PXTA 1N15A 1HH7A 2L91A 1YTCA 1CIEA 3PRJA 1C2RA 4IL6V 1IO3A 3HQ8A 4V2KA 2AXTV 2N18B 2Q3EA 1DIQC 2CE1A 3PTZA 1SQPD 1E2RA 1C2NA 1OAEA 1H9XA 2YQBA 5DF5A 4FA5A 1LC2A 1PPJD 1HCMA 1RZ5A 1LS9A 1H32A 2HV4A 1CSXA 2N9YB 1H33A 2ZBOA 5H2FV 1DVVA 3CX5D 4EIDA 3H1JD 3BCCD 4Q5PA 1ETPA 3H1ID 4L3HA 1FHBA 1N90A 3WFDC 1HZVA 1L0LD 3L74D 1QKSA 1COTA 1C6SA 1MG2D 4EICA 3O5CA 4FANA 1S6VB 1YCCA 2FRCA 1KYOD 3PLNA 1QN2A 4P4QB 1CIGA 3X39A 3CXHW 1CXAA 1AKKA 1DW2A 4J20A 1EZVD 1DT1A 4Y5RA 4WQAA 5CIGB 4FAVA 4WQCA 1K3GA 4EIFA 2N9IA 4FA1A 3CU4A 2MHMA 4O1WA 1H32B 3ITKA 3TF5A 2QJPB 4WQ8A 1KX7A 5C0ZA 4GYDA 3RMZA 5E79V 5GTHV 2QG4A 2GC7D 1SQBD 4RJTA 1CIHA 1E29A 1N9CA 4PJ0V 2KS1A 2RMZA 3KZIV 4XXLA 1AOFA 4JCGA 4D6TD 1CHHA 2ZXYA 3L73D 2YIUB 5CIFB 1LC1A 4A7PA 1ZZHA 3PXSA 1F1FA 1HZUA 1CEDA 3L4MA 1GQ1A 4AX3A 4AAOA 1QL4A 1CYCA 1LMSA 1R0QA 1CSWA 2MTAC 1FI3A 1I6DA 3ZCFA 2FYUD 1L9BC 1I8PA 5KLIB 3WFEC 1A2SA 3NBTA 1C6OA 1NTMD 2ZZS1 2C2CA 2A06D 1CTJA 3WUIA 3GW6A 3A0BV 3VYMA 3TYIA 1DW0A 5GTIV 1CTYA 1SQQD 5B66V 1DIIC 2N18C 2D0SA 1IRVA 2GC4D 451CA 3OA8A 3WU2V 1C75A 5TJHA 1S5LV 4WQBA 1NTZD 4N0KA 4KMGA 1GJQA 2LITA 2DVHA 4LJIA 4UB8V 2BH5X 2B10B 1CHJA 1GDVA 1RZ6A 1CYJA 2C1DA 3ZOWA 3TGUD 1KB9D 4DY9A
chains in the Genus database with same CATH superfamily
3PH0A 5CIEB 1SQVK 4EIEA 1G2CB 1X22A 1IC2A 2BCCJ 3L73G 4IFMA 4DCKA 4L76A 1NTZG 1BCCG 1Q90D 1YBKA 3H32B 2YMKA 2V4HA 1HJBA 5TISE 1OX3A 4AANA 2LIRA 2FFDC 3G3ZA 1LTJC 4H0LB 5CCGA 4WQ9A 2Y0CA 1NTMG 2YCCA 2OZ1B 2IBZE 3V2NA 3II6A 2PACA 4HB1A 4LGDE 2C1DB 1CNOA 1KIBA 5B5EE 2JQRA 3SXTA 3FWLA 4FA9A 5EXQA 3AE9C 2IYOA 1I6EA 1ZLLA 3HE5B 5KKZC 1NIRA 3FWNA 1QL3A 1TU3F 2Q5UA 1H1OA 1L0NJ 2G3AA 2K9YA 3H1JG 3PXWA 1L0NE 1YEBA 2K9JA 5KLVK 4WQEA 2W8ZA 3A0HE 4ZMDA 3QWOC 2IBZD 4U3FJ 4NPEA 2IYPA 1EDLA 3Q5RA 2WPSA 3W68A 3A2AA 3L71G 5AW4B 1F1CA 5KAIE 1JY2P 2O01N 2B89A 3RL0g 1IK9A 1GL2A 1VL2A 1CRHA 1VQMP 2BEZF 1M1KQ 3AEEC 1N7LA 4OGQC 4K3IA 3HE4A 1MV8A 3HUSB 2N9JA 3CCQP 2BPBB 5TISV 3A5TA 2Q7CA 3M97X 3L71D 3RK3C 3A9FA 1D7MA 3MIWA 4GODA 3VRDA 4BXLA 1K3HA 4Y99C 3H32A 4ZNCA 1T2KC 3Q1MA 3L74G 3M9BA 1DD3A 1S5LH 1K05A 1NYHA 1CTZA 3ZOXA 1FDOA 2M3BA 1USEA 1CRIA 2M0BA 1CXCA 3OW2O 1FJ0A 4WY4C 155CA 2JKVA 1WMKA 4EYYQ 5C9MA 1MUUA 2V08A 1L0LE 3O6QA 2OYIC 4XE5B 3P32A 1YEAA 1BGYJ 3M9HA 1AVYA 3L74J 3CX5E 1N73B 1USDA 1FCDC 3SLEA 2P1JA 1C52A 4PD4D 2B12B 1KQSO 1RAPA 2ZT9C 1S5LX 4N78D 1NVOA 2GIWA 3H1JJ 1KB9E 2G8YA 1T8ZA 2AIUA 1M6ZA 1KILE 1HWTC 1GIWA 1X8YA 2QJKB 3RBXA 2JO1A 3NFQA 2W27A 2QJYB 3H1HJ 2IX7C 3VYIA 2FFDA 1ZRTE 3DR0A 1N7SB 3P8MC 1Y8AA 4LC1A 3G71P 2C8SA 1KILD 1GU2A 3CC2P 2BLFB 2JTIB 2OGUA 3AEBC 1U75B 3VN0A 1SQPE 2N3YA 5EFWB 1I8OA 3H1KE 4NFGB 2BGVX 1QYZA 1QL2A 2QIWA 3L4OA 1L4AB 1YIJP 4C7RA 1FZCB 1NTKJ 3HD7C 4ASVA 2PCBB 1KQFB 1LJ2A 5CBNA 2B0ZB 2RKLA 1VPCA 1GD2E 5GTIH 3MUDA 1EB7A 2K9JB 3C2CA 4PV1D 1HROA 1FU1A 2KZJA 1L0LJ 2BCNB 4H0JA 1SQVD 1RE3A 2AEMA 1GL2C 4KT0J 1Q81Q 3VMZA 3ZIYA 4AYCA 3UIAA 1M8OB 3D6YA 1PP9J 1NKZB 5KLVD 2SPZA 3H1LJ 1WRGA 1X0TA 1YTCA 3IR9A 5CHXA 3PRJA 3B5NA 1NTZK 3TGUJ 3PTZA 1BCCE 2M3EA 2A45G 2H43A 5DF5A 4NPDA 1HCMA 1NTZE 1LS9A 1H32A 1KQGB 1CSXA 4KJMA 1NTZJ 3A7OA 1NH4A 1NAFA 1LWUB 1KILC 1GU4A 4EIDA 3H1JD 3CPWO 1DEEG 4Q5PA 5BU8B 4L3HA 1ZW0A 1LT9A 2WQYC 1JCDA 1JY3N 2WTYA 3N4XA 3AEFC 1COTA 1URQB 3IAOA 3O5CA 4U3FE 4FANA 1NTKE 3M0DA 1YCCA 2IDBA 4W7ZA 1KYOD 4C46A 3CXHE 1SQXE 4B86A 1CIGA 2ZXEB 1CXAA 1IFNA 1LT9B 1G1JA 4J20A 2IZ0A 4Y5RA 4WQAA 3HUSA 4PV1C 2LXBA 3Q5PA 1H89A 4WQCA 3NMDA 2Q1KA 2N9IA 4H0LC 2E74C 4O1WA 1H32B 3HD7D 2QJPB 4WQ8A 3OAKA 1PP9E 2WSFH 2QG4A 5GTHV 3RL0C 1L0NG 4DT0A 4RJTA 1N9CA 2YO2A 3BASA 3HTKA 3O8ZA 3L4FA 2CPSA 1J1EB 3KZIV 1EDJA 3L35A 4ZKPA 4D6TD 3E1RA 1HTLC 3L73D 2YIUB 5APVA 3KDPB 2KI7B 1L0NK 3KZIE 1NAYA 1R8EA 1F1FA 1CEDA 3WUUA 3AE6C 4OH8B 1GQ1A 4HJGH 2QM7A 1LMSA 1PPJG 1CSWA 2R5DA 1GK4A 2W6JH 3WU2E 4H44B 2NPSA 3Q3DA 1L9BC 1I8PA 3P7KA 1M90Q 1BE3E 2K3RA 2B87A 3NBTA 3NXSA 2ZZS1 1VQPP 1M1JA 2PAJA 1FZGA 1IFJA 1HF9A 1RF0A 3KXDA 1SQQD 1SS1A 1LTJA 1IRVA 1AA0A 2OYHB 1VQ8P 3OA8A 1QGKB 3CCRP 2FFDB 1L2PA 1LTJB 2KS1B 3A0BH 1LP1B 3H1HE 3T97A 5KAIH 2DVHA 1GDVA 1CYJA 3OA7A 2YKOA 4GOFA 1VQ6P 5AW1B 3HE5A 2FXPA 5IY51 1J3SA 1Q7YQ 5KAFV 2Z4EA 3MTUE 3PH2B 2FYUJ 1HGZA 3V2RA 1I5TA 1FOCA 2DGEA 2HYNA 2FXMA 1RAQA 4IFFA 2UWJE 3WU2H 5AW6B 3HQ9A 3P8CE 3SSUA 1SQQG 4D6TJ 3EQ2A 3U59A 1YICA 1YQ4C 1MZ4A 3MZWB 3H1KG 1AYGA 2Z5IA 3N7NA 1S9KD 4H13D 1ZP0C 1RH5B 1K04A 3LW5J 351CA 1A8CA 4PWAA 1NJIQ 2Y9ZA 3WFBC 1MKMA 5AVQB 1NU1G 3AE1C 1T2KD 5AVVB 1H0TA 2ZYAA 3V4WA 1SFCC 1CRJA 1E5WA 4O1QA 1ZR2A 1LFMA 1JMMA 1BSNA 1KB9H 2OYOA 1H31A 2N1TA 1SQXG 2GB8B 1RQUA 1G2CA 1UIXA 2YO3A 4L1QA 3IF4A 1K73Q 2ZOOA 1CRYA 1VF5D 2C1UA 2R32A 1YQ3C 2B87B 1J1DC 4H0KA 1DIPA 3CYTI 1HJ3A 3L70G 3DMIA 1N73C 1GW4A 3BCCE 3G4SP 1QLED 1N7SA 1IQCA 3RN1A 1ZRTD 1JDLA 3SWSA 4UB8H 1HH0A 2KIKA 5CMZA 3H1LD 4HH2A 1LTSC 3F5HA 4N6JA 1DW1A 1HJ0A 1FBMA 1ZMEC 5DFSA 1GKSA 2NPSD 2EXVA 2J5UA 3NBSA 1VF5C 1I55A 2QJYC 2WZ7A 1H33B 1GMJA 1BE3D 2ZVNB 2OTJP 1LWUC 2CA3B 5AW8B 1P84H 5BVZA 1OXZA 2H7HA 5GTHE 3RLMA 4RO0A 4YPCA 3RN0A 1C6RA 2YNYA 4XYDB 1RF1B 1W2EA 2WSFJ 2H88C 4QMAA 3CX5W 1KYOW 4EIJA 3HD7B 3H1HG 1PZQA 1KYOE 2ZONG 1S72P 1KV9A 3LIEA 1MFTA 1PL5A 5GTIE 1VQ9P 1CRGA 1HRCA 5AW5B 1IFIA 4WWIA 4M3LA 2KNCB 2AXCA 2B88A 1PV3A 3MK7C 3S9OA 4EDFA 1RE4A 4PD4I 2QE7H 2ZJSE 3R4YA 1IRWA 2HODA 2OTLP 1PP9D 1LWUA 3U1AA 2V7QH 1S1CX 3RK3D 3RL0B 1HJ4A 4H13B 1DW3A 2CE0A 3CC7P 2QEXP 4UB6H 1T3UA 5DJQB 1YTZI 2D2CC 1L4AA 2O1KA 2ZVOB 4PW9B 1CSBA 4U3FG 3CXHD 3CWBD 3TYYA 4NPFX 1NTKD 3EFGA 4UB6V 1FOSE 1FZBA 3MGNA 1M57D 3GG2A 4BRYB 2OQQA 2P67A 4O9BA 1LTGC 2CA4B 1LT1A 3VNWA 3BVHA 2YK3A 1UIIA 1FS0E 3H1JE 1URQC 3AEGC 4GIFA 2N9BA 1FC2C 3SVWA 2H89C 3VP9A 5CIBB 3M0AA 4MU8A 3PXTA 1H88A 1HH7A 1G1IA 2L91A 3L75G 3RK2C 1CIEA 2A45I 3L71J 5C39A 1IO3A 1EZVG 1YJ9P 1HUCA 4V2KA 2AXTV 4PV1B 1SQPD 3AECC 3CX5I 1JUNA 3B5NC 4FA5A 1RZ5A 3D70A 4RESB 1S9KE 2N9YB 2ZBOA 5H2FV 2YMYA 1ZOYC 4DOJA 1FAVA 3HE4B 3L72E 3CMEP 3IN6A 1IO4A 1ETPA 1KTMA 3G6EP 2FYNC 2HR3A 1N90A 2KLUA 2XU6A 4TT3H 2HODB 3L74D 4R4LA 4ZKUA 1QKSA 1C6SA 1MG2D 4EICA 4JYBA 4JYCA 4H44C 2WSSH 5CBOA 2FRCA 3LW5H 2FYUE 5H2FE 3RL0D 3BRVB 3CD6P 1R5SA 1SQPG 3X39A 3CXHW 1DD4A 3SFEC 1NGMB 1EZVD 3H1IJ 1RF1A 1W5CE 5CIGB 3CX5H 1SQBJ 1K3GA 1YTZT 5CCHC 1DEBA 4R4MA 2MHMA 2QSIA 1HVVA 1RY3A 2BASA 3LIDA 1X79B 4GYDA 5E79V 1PPJE 1AJYA 2GC7D 1SQBD 3NTNA 1CIHA 2KS1A 2IBZG 2RMZA 1PIXA 4OGQD 3M91A 4XXLA 1AQTA 1CHHA 2ZXYA 1NTKG 1SFCB 5CIFB 4A7PA 3CWBG 1ZZHA 3U1CA 2WPRA 4PD4E 1N2DC 1AV1A 2HPCB 4BWNA 3TGUG 4AAOA 1QL4A 5APQA 5APYA 1FJKA 2MTAC 1P84E 3GLMA 1Z56A 3ZCFA 1PGQA 2FYUD 3WFEC 1PP9G 1ZXGA 4BRYA 4C7NA 1FJPA 2IFMA 3FGAD 1NTMD 2E75C 1JMBA 3L74E 3D6ZA 2C2CA 2A06D 3MUDC 3GW6A 4D6TE 1KN7A 2HLOA 5APWA 2O1JA 5APXA 1DIIC 1M1JB 2YKQA 3WU2V 1C75A 5TJHA 1S5LV 2XKMA 1KB9I 4WQBA 1VQNP 3CMAP 1NTZD 1GJQA 1BCCJ 4LJIA 4HKZH 3FXEA 3CCLP 2B10B 2C1DA 3ZOWA 1T6AA 3RK2D 1GW3A 3AEDC 3S4RA 1H31B 2Y0EA 2E42A 1E8EA 3AE3C 4I7ZB 1RQVA 4AALA 1OCDA 1U7MA 4FB1A 1IZNB 3L70E 1GDTA 1RF1C 3JCUE 4GOEA 1OVRA 1LTBC 3QH9A 1Y47A 5KLVJ 2H8PD 2CK3H 4H0LD 4RSZA 1S3JA 1JM0A 3ORVA 1I54A 1YYCA 2WMMA 5B6QA 2BCCD 1J1DB 1ZN5A 5BU5A 4MN4C 2ZT9D 4WQDA 1W5CT 5CIHB 1IFPA 3L72G 5CCHA 3R2PA 2WSCJ 4FA4A 1A56A 4WQ7A 2FKWB 4TLFA 1YFCA 1OW8A 4I1LA 1CCHA 1L4AC 3C9IA 1YNRA 3CP5A 1NNOA 5CCHD 3L37A 1PGJA 5DJQC 1S5LE 1GTWA 3O0RC 3OCDB 1LP1A 3CCMP 2ORLA 1NU1K 3ZDMA 3O20A 3PHLA 4JQ0D 1SP4A 1L9JC 2ZYGA 4N78E 3VTPC 1CIFA 1NU1D 1W2BO 1VQOP 5KLIC 5CYTR 1WEJF 2LXCB 2M5AB 1KB9D 2GUSA 2OARA 2P7JA 1SQQK 2C1VA 3MK7B 1SQBE 2E5YA 2W83C 3B5ND 1NMIA 2VRSA 1JOCA 1ZR4A 2WPQA 3CL3D 3RK2B 2J59M 2CXBA 2VHDA 2P58A 2E43A 3FX0A 1M56D 4LLHA 3B5NB 1N86A 1AOQA 2XNDH 1L0LG 2D2CB 2D0WA 1FOSF 3AE7C 5AVYB 3CCUP 1YJWP 3BCCG 1SQVJ 5CICB 1X9VA 1LTIC 1M70A 4H13C 1B7VA 2ZXXA 3L72J 1MZ9A 2FYZA 1RE4C 3OJAB 2N1TC 2E76B 3HD7A 1BGYE 2B11B 3AE2C 1JY2O 1DH3A 5KJ7D 2XV5A 1JB0J 3L72D 3ZOOA 2DW3A 1VQ4P 2QJPC 2BCCG 2E76D 1QVFO 1GL2D 1HJ5A 2Q6QA 1KFMA 1VYDA 2OYIA 3A0BE 1WVEC 1OMIA 2FY8A 4QAOA 4WY4A 4Y28J 2K1AA 3L71E 4AAMA 1IFDA 4PD4H 1KORA 3V2PA 1NTMJ 1CRCA 1NWQA 3IFMA 1SQPJ 2WVRA 3T97B 5CIDB 3OCDA 1OVVA 1PGPA 2KSJA 1PFIA 1H9YA 1JY3O 2FWLA 3JBTB 2R3SA 5KLVE 2WSEJ 1PGOA 4IL6E 3AE5C 5E79E 4IOIH 5AURA 4K35A 2WWWA 1AQ5A 5CCGC 3O1YA 1W2LA 1L0ND 4JBZA 1JNMA 3HQ6A 2NPSC 1EDIA 3HQ7A 2RN0A 4AQRD 1SQBK 3KPEA 3MHVA 1A02F 1C2RA 2KYVA 1OFCX 1IJDB 3B71A 5CJ4A 4CPGA 1M1JC 2FBWC 1JO5A 5APTA 1KMIZ 1EC5A 1LC2A 5DJTB 2FXOA 1KYOH 1FZAA 2P10A 1BDDA 4XFJA 1CW5A 3HTKB 4PJ0E 1J2JB 4JPZB 5GTHH 3BATA 3WFDC 4DZOA 1S2EA 1M7LA 3S1KA 1L0LK 2JP3A 1Y9BA 2PP6A 2WSCH 1S6VB 3PLNA 3VMYA 4P4QB 2POHA 2OYIB 2E75B 3SWFA 1DT1A 5CCGD 3G9RA 4FAVA 3CC4P 4OWFA 4EIFA 1URQA 5KLVG 1SQPK 4EI2A 3ITKA 3TF5A 3Q5SA 1KX7A 1KC8Q 3H6PA 2XNXA 4PJ0V 4H44D 4WVZA 2O01J 5KJ7A 5B66E 2HPCA 2O01H 3JSVC 1OWAA 5M1BA 1LC1A 2B9BA 2E74D 3PXSA 1HZUA 1A02J 3L4MA 1CYCA 4I7ZC 2MJZA 1BSHA 1R0QA 3M0DC 2D2CD 3L36A 5KAFH 4JF7A 3E7KA 3W67A 1I6DA 1FZCC 1QEXA 2MKVA 5KLIB 2KSEA 3ABVC 2IFNA 1EDKA 1JY2N 3MP7B 2YXQB 2JWDA 4GT1A 3CCEP 1R5LA 1CTJA 3A0BV 1DW0A 5GTIV 2A06G 3GF7A 1YJNP 3CCVP 3WMM0 2N18C 3SWYA 2D0SA 2KNCA 3SFDC 2GC4D 451CA 4YXWH 1K8AQ 1OW6A 1VF5B 2FYUG 3H25A 3TNUA 2QM8A 4N0KA 1VQKP 4KMGA 5AVSB 1S4XA 5KTBA 4UB8V 2Z5HA 1CHJA 2K88A 1SQQE 2KLVA 2KXPB 2E5TA 3TGUD 1SQQJ 1JY3P 5APUA 3V6IA 4DY9A 2QA4P 3L70J 3F89A 1CC5A 1VQ7P 3NWVA 1T3JA 1CZQA 5AW3B 4AUWA 1EXIA 1KZUB 1BL9A 1GU5A 5AW2B 2ITAA 2E76C 3JC22 2PGDA 1MFZA 2YXRB 2I1JA 4YTPC 3SJLA 1SQBG 3MD0A 2AEFA 1CCRA 2FYUK 1NU1J 1DVHA 2NZ2A 4WBAA 3KZIH 3WFCC 3RBZA 2BH4X 2R5BA 2L4DA 1KV4A 1KX2A 2V07A 1CHIA 1Q2NA 3PP5A 3D0WA 3TDKA 3L73E 5AVTB 1KB0A 1HBWA 1FZFA 2KOGA 3GMAA 3TGUE 2PFXA 4IFDK 2A06E 2WT7B 2WSEH 1M60A 1U74B 3O6QB 1L4AD 1YIQA 4YE1A 1VQ5P 1CYIA 1BE3G 1CORA 2LR2A 3AE8C 1YITP 1J1EC 1Q86Q 3GHGC 1KQLA 4KHXA 2N1TB 2PCCB 5TISH 3OA8B 1H8AA 1CSUA 2CPBA 3H1LG 1U7JA 2Y0DA 2LKMA 4L74A 1AVOA 2O3JA 3CI9A 1CO6A 1N73A 2OYHA 2OZ1A 4U7JA 3B8EB 3L75D 2NPSB 3L70D 2N3BA 1WT6A 3RGUA 4W80A 3VMXA 2K37A 1RHZB 5KAIV 3VMAA 2W90A 4N3YB 3L75J 5KKZB 2A45H 3WUTA 3C8VA 1BCCD 2C9LY 3CLQA 2WT7A 2HG5D 1KFNA 1DX7A 2FYNB 2J58A 2C9XB 2OYHC 3TK1A 1SQXD 4I6MC 2BCCE 1FZEA 1YHQP 3ZOYA 4U3FD 4L3GA 5KAFE 4RKUJ 1IZL0 1FZCA 1LTTC 1BGYD 3Q2YA 1SQVE 2XTSB 3HRNA 1BDCA 4OGQB 4EOTA 5AVWB 1GK6A 3AE4C 1JTHB 1FI7A 4YXDC 1RF0C 4IL6H 1FI9A 4WY4D 3A0HV 3ZBMA 4GEDB 2QRXA 1SQXJ 3H1KD 2OTKE 1P84D 1QX8A 2R3CA 3DP5A 5DJUB 3KYQA 1KD1Q 3KHUA 1QL1A 4IL6X 3I5CA 4L75A 3D71A 3CWBJ 2WITA 3H1HD 1OZHA 2KB7P 2KP8A 4UB6E 1IK7A 3H1KJ 4WB4A 1EZVI 5B5EV 1P84I 2AXTH 2C0XA 2B4ZA 3KQGA 2RH0A 2AXTE 5AVZB 1CSVA 3I55P 5AW9B 2BEQD 3SWKA 1H0TB 1JTHA 1C7MA 5B66H 1N50A 3PJSK 1GZLA 1NU1E 3A3YB 3V2QA 3FXDA 2M8RA 2AI5A 2KUBA 3I56P 1NMLA 2IZ1A 3B4SA 2ZAEB 3CCJP 2YKPA 2JEEA 2JWAA 1MG3D 2I8FA 1E79H 2KK7A 2XZRA 4XA4A 3AEAC 1U57A 1URQD 1NKNA 2QJKC 4C7NB 2ZT9B 3HUSC 1N8RQ 3GF3A 3CXHH 3WC8A 5CJ0A 1OVUA 2ZYDA 1IFMA 1N15A 1OIPA 5AVXB 1N7SC 5AVRB 1Q82Q 4IL6V 3RK3B 3HQ8A 4K3AA 4Y99B 2N18B 2Q3EA 5B5EH 1DIQC 2CE1A 3BRTB 1E2RA 1C2NA 1AFOA 1OAEA 2IPPA 3H1LE 1H9XA 2YQBA 2V7QJ 3TNUB 4ASWA 2GUVA 2AEJA 1PPJD 2HV4A 1LTAC 2GA1A 2KZIA 3K5BA 1H33A 1SLQA 1SFCA 4Z1MH 3V5BA 4WY4B 1DVVA 1KILA 5APSA 3CX5D 2HFED 2JJLA 3H1IG 3BCCD 3H1ID 3A0HH 1FHBA 1SQXK 5E79H 1EZVE 4D6TG 2W6BA 1HZVA 3EFFK 1L0LD 1FDIA 1N7SD 2IBZI 3VP8A 1EXJA 3BCCJ 1ZV8A 5L8RJ 2JR8A 1QN2A 1AKKA 1SVFA 3VOPA 1DW2A 2P2UA 1EQ7A 3M9QA 1FDMA 3EWKA 1LGHB 5AW0B 2R44A 1JCCA 1GL2B 3WUVA 4FA1A 3CU4A 2Q9IA 5C0ZA 3RMZA 3CXHI 3USSA 4L73A 1E29A 1K9MQ 1KILB 3CCSP 2I1KA 1VDFA 5H2FH 1AOFA 1CI6B 4JCGA 1NHLA 1VQLP 1NTKK 1OW7A 2W6AA 1NTME 1SFCD 3M06A 2E75D 2Q3IA 4AX3A 4OVNF 4GDOA 1BE3J 1NO4A 2NRGA 4GKGA 2C9NY 1LT9C 2L5GB 1NTMK 4I2LC 1FI3A 1HGVA 3C1LA 3TSIA 4DJGA 2Y9YA 1A2SA 5AVUB 1C6OA 3CWBE 4UB8E 3JCUH 2JDIH 4PJ0H 3WUIA 2XDJA 2M5AA 3VYMA 3TYIA 1XTCC 2I8DA 1CTYA 3H1IE 1XTGB 5AW7B 2QVAA 5B66V 3GHGA 1YI2P 2E74B 1CI6A 1SQVG 1JEKA 1KYOI 2WPVB 1QVGO 3RK3E 3L73J 2GM4A 1NOHA 5K5GB 5KJ7C 2LITA 1FE6A 1BGYG 1RE3C 2PRRA 3P8CD 2C0WA 3L75E 2BH5X 4HYTB 3E1IA 1RZ6A 2ZFCA 2N1TD 3GHGB 3V4QA 4W7YA 1LNQA 2YIUC
chains in the Genus database with same CATH topology
5IY51 1CC5A 1J3SA 1H31B 3NWVA 5KAFV 5CIEB 2Y0EA 4EIEA 3PH2B 1E8EA 1I5TA 1BL9A 4AALA 1OCDA 1FOCA 4FB1A 2DGEA 1RAQA 3SJLA 4AANA 2LIRA 3HQ9A 1CCRA 1YICA 1DVHA 1MZ4A 4RSZA 3WFCC 1AYGA 3ORVA 2BH4X 1I54A 4WQ9A 5B6QA 2BCCD 2Y0CA 2L4DA 1KX2A 2YCCA 2V07A 1CHIA 2OZ1B 4WQDA 3TDKA 2PACA 1W5CT 5CIHB 1KB0A 4FA4A 1A56A 351CA 2C1DB 4WQ7A 1A8CA 1CNOA 4PWAA 1KIBA 1YFCA 1M60A 1U74B 2JQRA 3SXTA 3WFBC 3FWLA 1CCHA 4FA9A 1YNRA 3CP5A 1YIQA 5EXQA 1NNOA 1CRJA 1I6EA 4YE1A 1CYIA 4O1QA 1NIRA 5DJQC 1CORA 1QL3A 1LFMA 3O0RC 3OCDB 1H1OA 1H31A 2ORLA 3PXWA 1YEBA 2GB8B 3O20A 3PHLA 4L1QA 2PCCB 3OA8B 1L9JC 1CSUA 4WQEA 2IBZD 1CIFA 2ZOOA 1CRYA 1NU1D 2C1UA 1F1CA 2Y0DA 5CYTR 4H0KA 1WEJF 2O3JA 1CO6A 1CRHA 3CYTI 1HJ3A 2OZ1A 3DMIA 3L75D 2C1VA 3MK7B 3L70D 4K3IA 2N3BA 1NMIA 1IQCA 2N9JA 3RN1A 2BPBB 5TISV 1ZRTD 1JDLA 3M97X 3SWSA 2CXBA 3L71D 2VHDA 3A9FA 3VRDA 5KAIV 3VMAA 1K3HA 5KKZB 3H1LD 1BCCD 1DW1A 2FYNB 1AOQA 1CTZA 3ZOXA 2C9XB 2D0WA 5DFSA 1GKSA 2EXVA 1SQXD 1CRIA 3NBSA 1I55A 1H33B 1CXCA 1BE3D 3ZOYA 5CICB 4U3FD 1FJ0A 1M70A 1B7VA 155CA 2CA3B 4L3GA 1IZL0 5C9MA 2V08A 3RLMA 1BGYD 3RN0A 1C6RA 1YEAA 2XTSB 4XYDB 2B11B 1FCDC 3SLEA 3CX5W 1KYOW 1C52A 3L72D 3ZOOA 4PD4D 2ZONG 1FI7A 2B12B 1KV9A 1RAPA 1FI9A 3A0HV 1CRGA 1HRCA 4GEDB 3ZBMA 2GIWA 1HJ5A 3H1KD 2KNCB 1VYDA 1P84D 3DP5A 3MK7C 4EDFA 2AIUA 3KHUA 1M6ZA 1WVEC 1IRWA 4QAOA 1GIWA 2QJKB 1PP9D 3H1HD 2QJYB 4AAMA 3DR0A 5B5EV 1HJ4A 1DW3A 2CE0A 1CRCA 2C8SA 1GU2A 2BLFB 2JTIB 5CIDB 5DJQB 2B4ZA 3OCDA 1U75B 2N3YA 4PW9B 1I8OA 1CSVA 4NFGB 2BGVX 1H9YA 1QYZA 3CXHD 3CWBD 3L4OA 2FWLA 3JBTB 1NTKD 1C7MA 2PCBB 1N50A 4UB6V 2B0ZB 3GG2A 2AI5A 1EB7A 5AURA 2K9JB 3C2CA 2CA4B 1HROA 1NMLA 3O1YA 1W2LA 2BCNB 4H0JA 1SQVD 1L0ND 3VNWA 2JWAA 2YK3A 1MG3D 2I8FA 3HQ6A 3ZIYA 3HQ7A 3SVWA 5CIBB 2RN0A 5KLVD 3WC8A 4MU8A 3PXTA 1N15A 1HH7A 2L91A 1YTCA 1CIEA 3PRJA 1C2RA 4IL6V 1IO3A 3HQ8A 4V2KA 2AXTV 2N18B 2Q3EA 1DIQC 2CE1A 3PTZA 1SQPD 1E2RA 1C2NA 1OAEA 1H9XA 2YQBA 5DF5A 4FA5A 1LC2A 1PPJD 1HCMA 1RZ5A 1LS9A 1H32A 2HV4A 1CSXA 2N9YB 1H33A 2ZBOA 5H2FV 1DVVA 3CX5D 4EIDA 3H1JD 3BCCD 4Q5PA 1ETPA 3H1ID 4L3HA 1FHBA 1N90A 3WFDC 1HZVA 1L0LD 3L74D 1QKSA 1COTA 1C6SA 1MG2D 4EICA 3O5CA 4FANA 1S6VB 1YCCA 2FRCA 1KYOD 3PLNA 1QN2A 4P4QB 1CIGA 3X39A 3CXHW 1CXAA 1AKKA 1DW2A 4J20A 1EZVD 1DT1A 4Y5RA 4WQAA 5CIGB 4FAVA 4WQCA 1K3GA 4EIFA 2N9IA 4FA1A 3CU4A 2MHMA 4O1WA 1H32B 3ITKA 3TF5A 2QJPB 4WQ8A 1KX7A 5C0ZA 4GYDA 3RMZA 5E79V 5GTHV 2QG4A 2GC7D 1SQBD 4RJTA 1CIHA 1E29A 1N9CA 4PJ0V 2KS1A 2RMZA 3KZIV 4XXLA 1AOFA 4JCGA 4D6TD 1CHHA 2ZXYA 3L73D 2YIUB 5CIFB 1LC1A 4A7PA 1ZZHA 3PXSA 1F1FA 1HZUA 1CEDA 3L4MA 1GQ1A 4AX3A 4AAOA 1QL4A 1CYCA 1LMSA 1R0QA 1CSWA 2MTAC 1FI3A 1I6DA 3ZCFA 2FYUD 1L9BC 1I8PA 5KLIB 3WFEC 1A2SA 3NBTA 1C6OA 1NTMD 2ZZS1 2C2CA 2A06D 1CTJA 3WUIA 3GW6A 3A0BV 3VYMA 3TYIA 1DW0A 5GTIV 1CTYA 1SQQD 5B66V 1DIIC 2N18C 2D0SA 1IRVA 2GC4D 451CA 3OA8A 3WU2V 1C75A 5TJHA 1S5LV 4WQBA 1NTZD 4N0KA 4KMGA 1GJQA 2LITA 2DVHA 4LJIA 4UB8V 2BH5X 2B10B 1CHJA 1GDVA 1RZ6A 1CYJA 2C1DA 3ZOWA 3TGUD 1KB9D 4DY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IY5 1;  1CC5 A;  1J3S A;  1H31 B;  3NWV A;  5KAF V;  5CIE B;  2Y0E A;  4EIE A;  3PH2 B;  1E8E A;  1I5T A;  1BL9 A;  4AAL A;  1OCD A;  1FOC A;  4FB1 A;  2DGE A;  1RAQ A;  3SJL A;  4AAN A;  2LIR A;  3HQ9 A;  1CCR A;  1YIC A;  1DVH A;  1MZ4 A;  4RSZ A;  3WFC C;  1AYG A;  3ORV A;  2BH4 X;  1I54 A;  4WQ9 A;  5B6Q A;  2BCC D;  2Y0C A;  2L4D A;  1KX2 A;  2YCC A;  2V07 A;  1CHI A;  2OZ1 B;  4WQD A;  3TDK A;  2PAC A;  1W5C T;  5CIH B;  1KB0 A;  4FA4 A;  1A56 A;  351C A;  2C1D B;  4WQ7 A;  1A8C A;  1CNO A;  4PWA A;  1KIB A;  1YFC A;  1M60 A;  1U74 B;  2JQR A;  3SXT A;  3WFB C;  3FWL A;  1CCH A;  4FA9 A;  1YNR A;  3CP5 A;  1YIQ A;  5EXQ A;  1NNO A;  1CRJ A;  1I6E A;  4YE1 A;  1CYI A;  4O1Q A;  1NIR A;  5DJQ C;  1COR A;  1QL3 A;  1LFM A;  3O0R C;  3OCD B;  1H1O A;  1H31 A;  2ORL A;  3PXW A;  1YEB A;  2GB8 B;  3O20 A;  3PHL A;  4L1Q A;  2PCC B;  3OA8 B;  1L9J C;  1CSU A;  4WQE A;  2IBZ D;  1CIF A;  2ZOO A;  1CRY A;  1NU1 D;  2C1U A;  1F1C A;  2Y0D A;  5CYT R;  4H0K A;  1WEJ F;  2O3J A;  1CO6 A;  1CRH A;  3CYT I;  1HJ3 A;  2OZ1 A;  3DMI A;  3L75 D;  2C1V A;  3MK7 B;  3L70 D;  4K3I A;  2N3B A;  1NMI A;  1IQC A;  2N9J A;  3RN1 A;  2BPB B;  5TIS V;  1ZRT D;  1JDL A;  3M97 X;  3SWS A;  2CXB A;  3L71 D;  2VHD A;  3A9F A;  3VRD A;  5KAI V;  3VMA A;  1K3H A;  5KKZ B;  3H1L D;  1BCC D;  1DW1 A;  2FYN B;  1AOQ A;  1CTZ A;  3ZOX A;  2C9X B;  2D0W A;  5DFS A;  1GKS A;  2EXV A;  1SQX D;  1CRI A;  3NBS A;  1I55 A;  1H33 B;  1CXC A;  1BE3 D;  3ZOY A;  5CIC B;  4U3F D;  1FJ0 A;  1M70 A;  1B7V A;  155C A;  2CA3 B;  4L3G A;  1IZL 0;  5C9M A;  2V08 A;  3RLM A;  1BGY D;  3RN0 A;  1C6R A;  1YEA A;  2XTS B;  4XYD B;  2B11 B;  1FCD C;  3SLE A;  3CX5 W;  1KYO W;  1C52 A;  3L72 D;  3ZOO A;  4PD4 D;  2ZON G;  1FI7 A;  2B12 B;  1KV9 A;  1RAP A;  1FI9 A;  3A0H V;  1CRG A;  1HRC A;  4GED B;  3ZBM A;  2GIW A;  1HJ5 A;  3H1K D;  2KNC B;  1VYD A;  1P84 D;  3DP5 A;  3MK7 C;  4EDF A;  2AIU A;  3KHU A;  1M6Z A;  1WVE C;  1IRW A;  4QAO A;  1GIW A;  2QJK B;  1PP9 D;  3H1H D;  2QJY B;  4AAM A;  3DR0 A;  5B5E V;  1HJ4 A;  1DW3 A;  2CE0 A;  1CRC A;  2C8S A;  1GU2 A;  2BLF B;  2JTI B;  5CID B;  5DJQ B;  2B4Z A;  3OCD A;  1U75 B;  2N3Y A;  4PW9 B;  1I8O A;  1CSV A;  4NFG B;  2BGV X;  1H9Y A;  1QYZ A;  3CXH D;  3CWB D;  3L4O A;  2FWL A;  3JBT B;  1NTK D;  1C7M A;  2PCB B;  1N50 A;  4UB6 V;  2B0Z B;  3GG2 A;  2AI5 A;  1EB7 A;  5AUR A;  2K9J B;  3C2C A;  2CA4 B;  1HRO A;  1NML A;  3O1Y A;  1W2L A;  2BCN B;  4H0J A;  1SQV D;  1L0N D;  3VNW A;  2JWA A;  2YK3 A;  1MG3 D;  2I8F A;  3HQ6 A;  3ZIY A;  3HQ7 A;  3SVW A;  5CIB B;  2RN0 A;  5KLV D;  3WC8 A;  4MU8 A;  3PXT A;  1N15 A;  1HH7 A;  2L91 A;  1YTC A;  1CIE A;  3PRJ A;  1C2R A;  4IL6 V;  1IO3 A;  3HQ8 A;  4V2K A;  2AXT V;  2N18 B;  2Q3E A;  1DIQ C;  2CE1 A;  3PTZ A;  1SQP D;  1E2R A;  1C2N A;  1OAE A;  1H9X A;  2YQB A;  5DF5 A;  4FA5 A;  1LC2 A;  1PPJ D;  1HCM A;  1RZ5 A;  1LS9 A;  1H32 A;  2HV4 A;  1CSX A;  2N9Y B;  1H33 A;  2ZBO A;  5H2F V;  1DVV A;  3CX5 D;  4EID A;  3H1J D;  3BCC D;  4Q5P A;  1ETP A;  3H1I D;  4L3H A;  1FHB A;  1N90 A;  3WFD C;  1HZV A;  1L0L D;  3L74 D;  1QKS A;  1COT A;  1C6S A;  1MG2 D;  4EIC A;  3O5C A;  4FAN A;  1S6V B;  1YCC A;  2FRC A;  1KYO D;  3PLN A;  1QN2 A;  4P4Q B;  1CIG A;  3X39 A;  3CXH W;  1CXA A;  1AKK A;  1DW2 A;  4J20 A;  1EZV D;  1DT1 A;  4Y5R A;  4WQA A;  5CIG B;  4FAV A;  4WQC A;  1K3G A;  4EIF A;  2N9I A;  4FA1 A;  3CU4 A;  2MHM A;  4O1W A;  1H32 B;  3ITK A;  3TF5 A;  2QJP B;  4WQ8 A;  1KX7 A;  5C0Z A;  4GYD A;  3RMZ A;  5E79 V;  5GTH V;  2QG4 A;  2GC7 D;  1SQB D;  4RJT A;  1CIH A;  1E29 A;  1N9C A;  4PJ0 V;  2KS1 A;  2RMZ A;  3KZI V;  4XXL A;  1AOF A;  4JCG A;  4D6T D;  1CHH A;  2ZXY A;  3L73 D;  2YIU B;  5CIF B;  1LC1 A;  4A7P A;  1ZZH A;  3PXS A;  1F1F A;  1HZU A;  1CED A;  3L4M A;  1GQ1 A;  4AX3 A;  4AAO A;  1QL4 A;  1CYC A;  1LMS A;  1R0Q A;  1CSW A;  2MTA C;  1FI3 A;  1I6D A;  3ZCF A;  2FYU D;  1L9B C;  1I8P A;  5KLI B;  3WFE C;  1A2S A;  3NBT A;  1C6O A;  1NTM D;  2ZZS 1;  2C2C A;  2A06 D;  1CTJ A;  3WUI A;  3GW6 A;  3A0B V;  3VYM A;  3TYI A;  1DW0 A;  5GTI V;  1CTY A;  1SQQ D;  5B66 V;  1DII C;  2N18 C;  2D0S A;  1IRV A;  2GC4 D;  451C A;  3OA8 A;  3WU2 V;  1C75 A;  5TJH A;  1S5L V;  4WQB A;  1NTZ D;  4N0K A;  4KMG A;  1GJQ A;  2LIT A;  2DVH A;  4LJI A;  4UB8 V;  2BH5 X;  2B10 B;  1CHJ A;  1GDV A;  1RZ6 A;  1CYJ A;  2C1D A;  3ZOW A;  3TGU D;  1KB9 D;  4DY9 A; 
#chains in the Genus database with same CATH topology
 3PH0 A;  5CIE B;  1SQV K;  4EIE A;  1G2C B;  1X22 A;  1IC2 A;  2BCC J;  3L73 G;  4IFM A;  4DCK A;  4L76 A;  1NTZ G;  1BCC G;  1Q90 D;  1YBK A;  3H32 B;  2YMK A;  2V4H A;  1HJB A;  5TIS E;  1OX3 A;  4AAN A;  2LIR A;  2FFD C;  3G3Z A;  1LTJ C;  4H0L B;  5CCG A;  4WQ9 A;  2Y0C A;  1NTM G;  2YCC A;  2OZ1 B;  2IBZ E;  3V2N A;  3II6 A;  2PAC A;  4HB1 A;  4LGD E;  2C1D B;  1CNO A;  1KIB A;  5B5E E;  2JQR A;  3SXT A;  3FWL A;  4FA9 A;  5EXQ A;  3AE9 C;  2IYO A;  1I6E A;  1ZLL A;  3HE5 B;  5KKZ C;  1NIR A;  3FWN A;  1QL3 A;  1TU3 F;  2Q5U A;  1H1O A;  1L0N J;  2G3A A;  2K9Y A;  3H1J G;  3PXW A;  1L0N E;  1YEB A;  2K9J A;  5KLV K;  4WQE A;  2W8Z A;  3A0H E;  4ZMD A;  3QWO C;  2IBZ D;  4U3F J;  4NPE A;  2IYP A;  1EDL A;  3Q5R A;  2WPS A;  3W68 A;  3A2A A;  3L71 G;  5AW4 B;  1F1C A;  5KAI E;  1JY2 P;  2O01 N;  2B89 A;  3RL0 g;  1IK9 A;  1GL2 A;  1VL2 A;  1CRH A;  1VQM P;  2BEZ F;  1M1K Q;  3AEE C;  1N7L A;  4OGQ C;  4K3I A;  3HE4 A;  1MV8 A;  3HUS B;  2N9J A;  3CCQ P;  2BPB B;  5TIS V;  3A5T A;  2Q7C A;  3M97 X;  3L71 D;  3RK3 C;  3A9F A;  1D7M A;  3MIW A;  4GOD A;  3VRD A;  4BXL A;  1K3H A;  4Y99 C;  3H32 A;  4ZNC A;  1T2K C;  3Q1M A;  3L74 G;  3M9B A;  1DD3 A;  1S5L H;  1K05 A;  1NYH A;  1CTZ A;  3ZOX A;  1FDO A;  2M3B A;  1USE A;  1CRI A;  2M0B A;  1CXC A;  3OW2 O;  1FJ0 A;  4WY4 C;  155C A;  2JKV A;  1WMK A;  4EYY Q;  5C9M A;  1MUU A;  2V08 A;  1L0L E;  3O6Q A;  2OYI C;  4XE5 B;  3P32 A;  1YEA A;  1BGY J;  3M9H A;  1AVY A;  3L74 J;  3CX5 E;  1N73 B;  1USD A;  1FCD C;  3SLE A;  2P1J A;  1C52 A;  4PD4 D;  2B12 B;  1KQS O;  1RAP A;  2ZT9 C;  1S5L X;  4N78 D;  1NVO A;  2GIW A;  3H1J J;  1KB9 E;  2G8Y A;  1T8Z A;  2AIU A;  1M6Z A;  1KIL E;  1HWT C;  1GIW A;  1X8Y A;  2QJK B;  3RBX A;  2JO1 A;  3NFQ A;  2W27 A;  2QJY B;  3H1H J;  2IX7 C;  3VYI A;  2FFD A;  1ZRT E;  3DR0 A;  1N7S B;  3P8M C;  1Y8A A;  4LC1 A;  3G71 P;  2C8S A;  1KIL D;  1GU2 A;  3CC2 P;  2BLF B;  2JTI B;  2OGU A;  3AEB C;  1U75 B;  3VN0 A;  1SQP E;  2N3Y A;  5EFW B;  1I8O A;  3H1K E;  4NFG B;  2BGV X;  1QYZ A;  1QL2 A;  2QIW A;  3L4O A;  1L4A B;  1YIJ P;  4C7R A;  1FZC B;  1NTK J;  3HD7 C;  4ASV A;  2PCB B;  1KQF B;  1LJ2 A;  5CBN A;  2B0Z B;  2RKL A;  1VPC A;  1GD2 E;  5GTI H;  3MUD A;  1EB7 A;  2K9J B;  3C2C A;  4PV1 D;  1HRO A;  1FU1 A;  2KZJ A;  1L0L J;  2BCN B;  4H0J A;  1SQV D;  1RE3 A;  2AEM A;  1GL2 C;  4KT0 J;  1Q81 Q;  3VMZ A;  3ZIY A;  4AYC A;  3UIA A;  1M8O B;  3D6Y A;  1PP9 J;  1NKZ B;  5KLV D;  2SPZ A;  3H1L J;  1WRG A;  1X0T A;  1YTC A;  3IR9 A;  5CHX A;  3PRJ A;  3B5N A;  1NTZ K;  3TGU J;  3PTZ A;  1BCC E;  2M3E A;  2A45 G;  2H43 A;  5DF5 A;  4NPD A;  1HCM A;  1NTZ E;  1LS9 A;  1H32 A;  1KQG B;  1CSX A;  4KJM A;  1NTZ J;  3A7O A;  1NH4 A;  1NAF A;  1LWU B;  1KIL C;  1GU4 A;  4EID A;  3H1J D;  3CPW O;  1DEE G;  4Q5P A;  5BU8 B;  4L3H A;  1ZW0 A;  1LT9 A;  2WQY C;  1JCD A;  1JY3 N;  2WTY A;  3N4X A;  3AEF C;  1COT A;  1URQ B;  3IAO A;  3O5C A;  4U3F E;  4FAN A;  1NTK E;  3M0D A;  1YCC A;  2IDB A;  4W7Z A;  1KYO D;  4C46 A;  3CXH E;  1SQX E;  4B86 A;  1CIG A;  2ZXE B;  1CXA A;  1IFN A;  1LT9 B;  1G1J A;  4J20 A;  2IZ0 A;  4Y5R A;  4WQA A;  3HUS A;  4PV1 C;  2LXB A;  3Q5P A;  1H89 A;  4WQC A;  3NMD A;  2Q1K A;  2N9I A;  4H0L C;  2E74 C;  4O1W A;  1H32 B;  3HD7 D;  2QJP B;  4WQ8 A;  3OAK A;  1PP9 E;  2WSF H;  2QG4 A;  5GTH V;  3RL0 C;  1L0N G;  4DT0 A;  4RJT A;  1N9C A;  2YO2 A;  3BAS A;  3HTK A;  3O8Z A;  3L4F A;  2CPS A;  1J1E B;  3KZI V;  1EDJ A;  3L35 A;  4ZKP A;  4D6T D;  3E1R A;  1HTL C;  3L73 D;  2YIU B;  5APV A;  3KDP B;  2KI7 B;  1L0N K;  3KZI E;  1NAY A;  1R8E A;  1F1F A;  1CED A;  3WUU A;  3AE6 C;  4OH8 B;  1GQ1 A;  4HJG H;  2QM7 A;  1LMS A;  1PPJ G;  1CSW A;  2R5D A;  1GK4 A;  2W6J H;  3WU2 E;  4H44 B;  2NPS A;  3Q3D A;  1L9B C;  1I8P A;  3P7K A;  1M90 Q;  1BE3 E;  2K3R A;  2B87 A;  3NBT A;  3NXS A;  2ZZS 1;  1VQP P;  1M1J A;  2PAJ A;  1FZG A;  1IFJ A;  1HF9 A;  1RF0 A;  3KXD A;  1SQQ D;  1SS1 A;  1LTJ A;  1IRV A;  1AA0 A;  2OYH B;  1VQ8 P;  3OA8 A;  1QGK B;  3CCR P;  2FFD B;  1L2P A;  1LTJ B;  2KS1 B;  3A0B H;  1LP1 B;  3H1H E;  3T97 A;  5KAI H;  2DVH A;  1GDV A;  1CYJ A;  3OA7 A;  2YKO A;  4GOF A;  1VQ6 P;  5AW1 B;  3HE5 A;  2FXP A;  5IY5 1;  1J3S A;  1Q7Y Q;  5KAF V;  2Z4E A;  3MTU E;  3PH2 B;  2FYU J;  1HGZ A;  3V2R A;  1I5T A;  1FOC A;  2DGE A;  2HYN A;  2FXM A;  1RAQ A;  4IFF A;  2UWJ E;  3WU2 H;  5AW6 B;  3HQ9 A;  3P8C E;  3SSU A;  1SQQ G;  4D6T J;  3EQ2 A;  3U59 A;  1YIC A;  1YQ4 C;  1MZ4 A;  3MZW B;  3H1K G;  1AYG A;  2Z5I A;  3N7N A;  1S9K D;  4H13 D;  1ZP0 C;  1RH5 B;  1K04 A;  3LW5 J;  351C A;  1A8C A;  4PWA A;  1NJI Q;  2Y9Z A;  3WFB C;  1MKM A;  5AVQ B;  1NU1 G;  3AE1 C;  1T2K D;  5AVV B;  1H0T A;  2ZYA A;  3V4W A;  1SFC C;  1CRJ A;  1E5W A;  4O1Q A;  1ZR2 A;  1LFM A;  1JMM A;  1BSN A;  1KB9 H;  2OYO A;  1H31 A;  2N1T A;  1SQX G;  2GB8 B;  1RQU A;  1G2C A;  1UIX A;  2YO3 A;  4L1Q A;  3IF4 A;  1K73 Q;  2ZOO A;  1CRY A;  1VF5 D;  2C1U A;  2R32 A;  1YQ3 C;  2B87 B;  1J1D C;  4H0K A;  1DIP A;  3CYT I;  1HJ3 A;  3L70 G;  3DMI A;  1N73 C;  1GW4 A;  3BCC E;  3G4S P;  1QLE D;  1N7S A;  1IQC A;  3RN1 A;  1ZRT D;  1JDL A;  3SWS A;  4UB8 H;  1HH0 A;  2KIK A;  5CMZ A;  3H1L D;  4HH2 A;  1LTS C;  3F5H A;  4N6J A;  1DW1 A;  1HJ0 A;  1FBM A;  1ZME C;  5DFS A;  1GKS A;  2NPS D;  2EXV A;  2J5U A;  3NBS A;  1VF5 C;  1I55 A;  2QJY C;  2WZ7 A;  1H33 B;  1GMJ A;  1BE3 D;  2ZVN B;  2OTJ P;  1LWU C;  2CA3 B;  5AW8 B;  1P84 H;  5BVZ A;  1OXZ A;  2H7H A;  5GTH E;  3RLM A;  4RO0 A;  4YPC A;  3RN0 A;  1C6R A;  2YNY A;  4XYD B;  1RF1 B;  1W2E A;  2WSF J;  2H88 C;  4QMA A;  3CX5 W;  1KYO W;  4EIJ A;  3HD7 B;  3H1H G;  1PZQ A;  1KYO E;  2ZON G;  1S72 P;  1KV9 A;  3LIE A;  1MFT A;  1PL5 A;  5GTI E;  1VQ9 P;  1CRG A;  1HRC A;  5AW5 B;  1IFI A;  4WWI A;  4M3L A;  2KNC B;  2AXC A;  2B88 A;  1PV3 A;  3MK7 C;  3S9O A;  4EDF A;  1RE4 A;  4PD4 I;  2QE7 H;  2ZJS E;  3R4Y A;  1IRW A;  2HOD A;  2OTL P;  1PP9 D;  1LWU A;  3U1A A;  2V7Q H;  1S1C X;  3RK3 D;  3RL0 B;  1HJ4 A;  4H13 B;  1DW3 A;  2CE0 A;  3CC7 P;  2QEX P;  4UB6 H;  1T3U A;  5DJQ B;  1YTZ I;  2D2C C;  1L4A A;  2O1K A;  2ZVO B;  4PW9 B;  1CSB A;  4U3F G;  3CXH D;  3CWB D;  3TYY A;  4NPF X;  1NTK D;  3EFG A;  4UB6 V;  1FOS E;  1FZB A;  3MGN A;  1M57 D;  3GG2 A;  4BRY B;  2OQQ A;  2P67 A;  4O9B A;  1LTG C;  2CA4 B;  1LT1 A;  3VNW A;  3BVH A;  2YK3 A;  1UII A;  1FS0 E;  3H1J E;  1URQ C;  3AEG C;  4GIF A;  2N9B A;  1FC2 C;  3SVW A;  2H89 C;  3VP9 A;  5CIB B;  3M0A A;  4MU8 A;  3PXT A;  1H88 A;  1HH7 A;  1G1I A;  2L91 A;  3L75 G;  3RK2 C;  1CIE A;  2A45 I;  3L71 J;  5C39 A;  1IO3 A;  1EZV G;  1YJ9 P;  1HUC A;  4V2K A;  2AXT V;  4PV1 B;  1SQP D;  3AEC C;  3CX5 I;  1JUN A;  3B5N C;  4FA5 A;  1RZ5 A;  3D70 A;  4RES B;  1S9K E;  2N9Y B;  2ZBO A;  5H2F V;  2YMY A;  1ZOY C;  4DOJ A;  1FAV A;  3HE4 B;  3L72 E;  3CME P;  3IN6 A;  1IO4 A;  1ETP A;  1KTM A;  3G6E P;  2FYN C;  2HR3 A;  1N90 A;  2KLU A;  2XU6 A;  4TT3 H;  2HOD B;  3L74 D;  4R4L A;  4ZKU A;  1QKS A;  1C6S A;  1MG2 D;  4EIC A;  4JYB A;  4JYC A;  4H44 C;  2WSS H;  5CBO A;  2FRC A;  3LW5 H;  2FYU E;  5H2F E;  3RL0 D;  3BRV B;  3CD6 P;  1R5S A;  1SQP G;  3X39 A;  3CXH W;  1DD4 A;  3SFE C;  1NGM B;  1EZV D;  3H1I J;  1RF1 A;  1W5C E;  5CIG B;  3CX5 H;  1SQB J;  1K3G A;  1YTZ T;  5CCH C;  1DEB A;  4R4M A;  2MHM A;  2QSI A;  1HVV A;  1RY3 A;  2BAS A;  3LID A;  1X79 B;  4GYD A;  5E79 V;  1PPJ E;  1AJY A;  2GC7 D;  1SQB D;  3NTN A;  1CIH A;  2KS1 A;  2IBZ G;  2RMZ A;  1PIX A;  4OGQ D;  3M91 A;  4XXL A;  1AQT A;  1CHH A;  2ZXY A;  1NTK G;  1SFC B;  5CIF B;  4A7P A;  3CWB G;  1ZZH A;  3U1C A;  2WPR A;  4PD4 E;  1N2D C;  1AV1 A;  2HPC B;  4BWN A;  3TGU G;  4AAO A;  1QL4 A;  5APQ A;  5APY A;  1FJK A;  2MTA C;  1P84 E;  3GLM A;  1Z56 A;  3ZCF A;  1PGQ A;  2FYU D;  3WFE C;  1PP9 G;  1ZXG A;  4BRY A;  4C7N A;  1FJP A;  2IFM A;  3FGA D;  1NTM D;  2E75 C;  1JMB A;  3L74 E;  3D6Z A;  2C2C A;  2A06 D;  3MUD C;  3GW6 A;  4D6T E;  1KN7 A;  2HLO A;  5APW A;  2O1J A;  5APX A;  1DII C;  1M1J B;  2YKQ A;  3WU2 V;  1C75 A;  5TJH A;  1S5L V;  2XKM A;  1KB9 I;  4WQB A;  1VQN P;  3CMA P;  1NTZ D;  1GJQ A;  1BCC J;  4LJI A;  4HKZ H;  3FXE A;  3CCL P;  2B10 B;  2C1D A;  3ZOW A;  1T6A A;  3RK2 D;  1GW3 A;  3AED C;  3S4R A;  1H31 B;  2Y0E A;  2E42 A;  1E8E A;  3AE3 C;  4I7Z B;  1RQV A;  4AAL A;  1OCD A;  1U7M A;  4FB1 A;  1IZN B;  3L70 E;  1GDT A;  1RF1 C;  3JCU E;  4GOE A;  1OVR A;  1LTB C;  3QH9 A;  1Y47 A;  5KLV J;  2H8P D;  2CK3 H;  4H0L D;  4RSZ A;  1S3J A;  1JM0 A;  3ORV A;  1I54 A;  1YYC A;  2WMM A;  5B6Q A;  2BCC D;  1J1D B;  1ZN5 A;  5BU5 A;  4MN4 C;  2ZT9 D;  4WQD A;  1W5C T;  5CIH B;  1IFP A;  3L72 G;  5CCH A;  3R2P A;  2WSC J;  4FA4 A;  1A56 A;  4WQ7 A;  2FKW B;  4TLF A;  1YFC A;  1OW8 A;  4I1L A;  1CCH A;  1L4A C;  3C9I A;  1YNR A;  3CP5 A;  1NNO A;  5CCH D;  3L37 A;  1PGJ A;  5DJQ C;  1S5L E;  1GTW A;  3O0R C;  3OCD B;  1LP1 A;  3CCM P;  2ORL A;  1NU1 K;  3ZDM A;  3O20 A;  3PHL A;  4JQ0 D;  1SP4 A;  1L9J C;  2ZYG A;  4N78 E;  3VTP C;  1CIF A;  1NU1 D;  1W2B O;  1VQO P;  5KLI C;  5CYT R;  1WEJ F;  2LXC B;  2M5A B;  1KB9 D;  2GUS A;  2OAR A;  2P7J A;  1SQQ K;  2C1V A;  3MK7 B;  1SQB E;  2E5Y A;  2W83 C;  3B5N D;  1NMI A;  2VRS A;  1JOC A;  1ZR4 A;  2WPQ A;  3CL3 D;  3RK2 B;  2J59 M;  2CXB A;  2VHD A;  2P58 A;  2E43 A;  3FX0 A;  1M56 D;  4LLH A;  3B5N B;  1N86 A;  1AOQ A;  2XND H;  1L0L G;  2D2C B;  2D0W A;  1FOS F;  3AE7 C;  5AVY B;  3CCU P;  1YJW P;  3BCC G;  1SQV J;  5CIC B;  1X9V A;  1LTI C;  1M70 A;  4H13 C;  1B7V A;  2ZXX A;  3L72 J;  1MZ9 A;  2FYZ A;  1RE4 C;  3OJA B;  2N1T C;  2E76 B;  3HD7 A;  1BGY E;  2B11 B;  3AE2 C;  1JY2 O;  1DH3 A;  5KJ7 D;  2XV5 A;  1JB0 J;  3L72 D;  3ZOO A;  2DW3 A;  1VQ4 P;  2QJP C;  2BCC G;  2E76 D;  1QVF O;  1GL2 D;  1HJ5 A;  2Q6Q A;  1KFM A;  1VYD A;  2OYI A;  3A0B E;  1WVE C;  1OMI A;  2FY8 A;  4QAO A;  4WY4 A;  4Y28 J;  2K1A A;  3L71 E;  4AAM A;  1IFD A;  4PD4 H;  1KOR A;  3V2P A;  1NTM J;  1CRC A;  1NWQ A;  3IFM A;  1SQP J;  2WVR A;  3T97 B;  5CID B;  3OCD A;  1OVV A;  1PGP A;  2KSJ A;  1PFI A;  1H9Y A;  1JY3 O;  2FWL A;  3JBT B;  2R3S A;  5KLV E;  2WSE J;  1PGO A;  4IL6 E;  3AE5 C;  5E79 E;  4IOI H;  5AUR A;  4K35 A;  2WWW A;  1AQ5 A;  5CCG C;  3O1Y A;  1W2L A;  1L0N D;  4JBZ A;  1JNM A;  3HQ6 A;  2NPS C;  1EDI A;  3HQ7 A;  2RN0 A;  4AQR D;  1SQB K;  3KPE A;  3MHV A;  1A02 F;  1C2R A;  2KYV A;  1OFC X;  1IJD B;  3B71 A;  5CJ4 A;  4CPG A;  1M1J C;  2FBW C;  1JO5 A;  5APT A;  1KMI Z;  1EC5 A;  1LC2 A;  5DJT B;  2FXO A;  1KYO H;  1FZA A;  2P10 A;  1BDD A;  4XFJ A;  1CW5 A;  3HTK B;  4PJ0 E;  1J2J B;  4JPZ B;  5GTH H;  3BAT A;  3WFD C;  4DZO A;  1S2E A;  1M7L A;  3S1K A;  1L0L K;  2JP3 A;  1Y9B A;  2PP6 A;  2WSC H;  1S6V B;  3PLN A;  3VMY A;  4P4Q B;  2POH A;  2OYI B;  2E75 B;  3SWF A;  1DT1 A;  5CCG D;  3G9R A;  4FAV A;  3CC4 P;  4OWF A;  4EIF A;  1URQ A;  5KLV G;  1SQP K;  4EI2 A;  3ITK A;  3TF5 A;  3Q5S A;  1KX7 A;  1KC8 Q;  3H6P A;  2XNX A;  4PJ0 V;  4H44 D;  4WVZ A;  2O01 J;  5KJ7 A;  5B66 E;  2HPC A;  2O01 H;  3JSV C;  1OWA A;  5M1B A;  1LC1 A;  2B9B A;  2E74 D;  3PXS A;  1HZU A;  1A02 J;  3L4M A;  1CYC A;  4I7Z C;  2MJZ A;  1BSH A;  1R0Q A;  3M0D C;  2D2C D;  3L36 A;  5KAF H;  4JF7 A;  3E7K A;  3W67 A;  1I6D A;  1FZC C;  1QEX A;  2MKV A;  5KLI B;  2KSE A;  3ABV C;  2IFN A;  1EDK A;  1JY2 N;  3MP7 B;  2YXQ B;  2JWD A;  4GT1 A;  3CCE P;  1R5L A;  1CTJ A;  3A0B V;  1DW0 A;  5GTI V;  2A06 G;  3GF7 A;  1YJN P;  3CCV P;  3WMM 0;  2N18 C;  3SWY A;  2D0S A;  2KNC A;  3SFD C;  2GC4 D;  451C A;  4YXW H;  1K8A Q;  1OW6 A;  1VF5 B;  2FYU G;  3H25 A;  3TNU A;  2QM8 A;  4N0K A;  1VQK P;  4KMG A;  5AVS B;  1S4X A;  5KTB A;  4UB8 V;  2Z5H A;  1CHJ A;  2K88 A;  1SQQ E;  2KLV A;  2KXP B;  2E5T A;  3TGU D;  1SQQ J;  1JY3 P;  5APU A;  3V6I A;  4DY9 A;  2QA4 P;  3L70 J;  3F89 A;  1CC5 A;  1VQ7 P;  3NWV A;  1T3J A;  1CZQ A;  5AW3 B;  4AUW A;  1EXI A;  1KZU B;  1BL9 A;  1GU5 A;  5AW2 B;  2ITA A;  2E76 C;  3JC2 2;  2PGD A;  1MFZ A;  2YXR B;  2I1J A;  4YTP C;  3SJL A;  1SQB G;  3MD0 A;  2AEF A;  1CCR A;  2FYU K;  1NU1 J;  1DVH A;  2NZ2 A;  4WBA A;  3KZI H;  3WFC C;  3RBZ A;  2BH4 X;  2R5B A;  2L4D A;  1KV4 A;  1KX2 A;  2V07 A;  1CHI A;  1Q2N A;  3PP5 A;  3D0W A;  3TDK A;  3L73 E;  5AVT B;  1KB0 A;  1HBW A;  1FZF A;  2KOG A;  3GMA A;  3TGU E;  2PFX A;  4IFD K;  2A06 E;  2WT7 B;  2WSE H;  1M60 A;  1U74 B;  3O6Q B;  1L4A D;  1YIQ A;  4YE1 A;  1VQ5 P;  1CYI A;  1BE3 G;  1COR A;  2LR2 A;  3AE8 C;  1YIT P;  1J1E C;  1Q86 Q;  3GHG C;  1KQL A;  4KHX A;  2N1T B;  2PCC B;  5TIS H;  3OA8 B;  1H8A A;  1CSU A;  2CPB A;  3H1L G;  1U7J A;  2Y0D A;  2LKM A;  4L74 A;  1AVO A;  2O3J A;  3CI9 A;  1CO6 A;  1N73 A;  2OYH A;  2OZ1 A;  4U7J A;  3B8E B;  3L75 D;  2NPS B;  3L70 D;  2N3B A;  1WT6 A;  3RGU A;  4W80 A;  3VMX A;  2K37 A;  1RHZ B;  5KAI V;  3VMA A;  2W90 A;  4N3Y B;  3L75 J;  5KKZ B;  2A45 H;  3WUT A;  3C8V A;  1BCC D;  2C9L Y;  3CLQ A;  2WT7 A;  2HG5 D;  1KFN A;  1DX7 A;  2FYN B;  2J58 A;  2C9X B;  2OYH C;  3TK1 A;  1SQX D;  4I6M C;  2BCC E;  1FZE A;  1YHQ P;  3ZOY A;  4U3F D;  4L3G A;  5KAF E;  4RKU J;  1IZL 0;  1FZC A;  1LTT C;  1BGY D;  3Q2Y A;  1SQV E;  2XTS B;  3HRN A;  1BDC A;  4OGQ B;  4EOT A;  5AVW B;  1GK6 A;  3AE4 C;  1JTH B;  1FI7 A;  4YXD C;  1RF0 C;  4IL6 H;  1FI9 A;  4WY4 D;  3A0H V;  3ZBM A;  4GED B;  2QRX A;  1SQX J;  3H1K D;  2OTK E;  1P84 D;  1QX8 A;  2R3C A;  3DP5 A;  5DJU B;  3KYQ A;  1KD1 Q;  3KHU A;  1QL1 A;  4IL6 X;  3I5C A;  4L75 A;  3D71 A;  3CWB J;  2WIT A;  3H1H D;  1OZH A;  2KB7 P;  2KP8 A;  4UB6 E;  1IK7 A;  3H1K J;  4WB4 A;  1EZV I;  5B5E V;  1P84 I;  2AXT H;  2C0X A;  2B4Z A;  3KQG A;  2RH0 A;  2AXT E;  5AVZ B;  1CSV A;  3I55 P;  5AW9 B;  2BEQ D;  3SWK A;  1H0T B;  1JTH A;  1C7M A;  5B66 H;  1N50 A;  3PJS K;  1GZL A;  1NU1 E;  3A3Y B;  3V2Q A;  3FXD A;  2M8R A;  2AI5 A;  2KUB A;  3I56 P;  1NML A;  2IZ1 A;  3B4S A;  2ZAE B;  3CCJ P;  2YKP A;  2JEE A;  2JWA A;  1MG3 D;  2I8F A;  1E79 H;  2KK7 A;  2XZR A;  4XA4 A;  3AEA C;  1U57 A;  1URQ D;  1NKN A;  2QJK C;  4C7N B;  2ZT9 B;  3HUS C;  1N8R Q;  3GF3 A;  3CXH H;  3WC8 A;  5CJ0 A;  1OVU A;  2ZYD A;  1IFM A;  1N15 A;  1OIP A;  5AVX B;  1N7S C;  5AVR B;  1Q82 Q;  4IL6 V;  3RK3 B;  3HQ8 A;  4K3A A;  4Y99 B;  2N18 B;  2Q3E A;  5B5E H;  1DIQ C;  2CE1 A;  3BRT B;  1E2R A;  1C2N A;  1AFO A;  1OAE A;  2IPP A;  3H1L E;  1H9X A;  2YQB A;  2V7Q J;  3TNU B;  4ASW A;  2GUV A;  2AEJ A;  1PPJ D;  2HV4 A;  1LTA C;  2GA1 A;  2KZI A;  3K5B A;  1H33 A;  1SLQ A;  1SFC A;  4Z1M H;  3V5B A;  4WY4 B;  1DVV A;  1KIL A;  5APS A;  3CX5 D;  2HFE D;  2JJL A;  3H1I G;  3BCC D;  3H1I D;  3A0H H;  1FHB A;  1SQX K;  5E79 H;  1EZV E;  4D6T G;  2W6B A;  1HZV A;  3EFF K;  1L0L D;  1FDI A;  1N7S D;  2IBZ I;  3VP8 A;  1EXJ A;  3BCC J;  1ZV8 A;  5L8R J;  2JR8 A;  1QN2 A;  1AKK A;  1SVF A;  3VOP A;  1DW2 A;  2P2U A;  1EQ7 A;  3M9Q A;  1FDM A;  3EWK A;  1LGH B;  5AW0 B;  2R44 A;  1JCC A;  1GL2 B;  3WUV A;  4FA1 A;  3CU4 A;  2Q9I A;  5C0Z A;  3RMZ A;  3CXH I;  3USS A;  4L73 A;  1E29 A;  1K9M Q;  1KIL B;  3CCS P;  2I1K A;  1VDF A;  5H2F H;  1AOF A;  1CI6 B;  4JCG A;  1NHL A;  1VQL P;  1NTK K;  1OW7 A;  2W6A A;  1NTM E;  1SFC D;  3M06 A;  2E75 D;  2Q3I A;  4AX3 A;  4OVN F;  4GDO A;  1BE3 J;  1NO4 A;  2NRG A;  4GKG A;  2C9N Y;  1LT9 C;  2L5G B;  1NTM K;  4I2L C;  1FI3 A;  1HGV A;  3C1L A;  3TSI A;  4DJG A;  2Y9Y A;  1A2S A;  5AVU B;  1C6O A;  3CWB E;  4UB8 E;  3JCU H;  2JDI H;  4PJ0 H;  3WUI A;  2XDJ A;  2M5A A;  3VYM A;  3TYI A;  1XTC C;  2I8D A;  1CTY A;  3H1I E;  1XTG B;  5AW7 B;  2QVA A;  5B66 V;  3GHG A;  1YI2 P;  2E74 B;  1CI6 A;  1SQV G;  1JEK A;  1KYO I;  2WPV B;  1QVG O;  3RK3 E;  3L73 J;  2GM4 A;  1NOH A;  5K5G B;  5KJ7 C;  2LIT A;  1FE6 A;  1BGY G;  1RE3 C;  2PRR A;  3P8C D;  2C0W A;  3L75 E;  2BH5 X;  4HYT B;  3E1I A;  1RZ6 A;  2ZFC A;  2N1T D;  3GHG B;  3V4Q A;  4W7Y A;  1LNQ A;  2YIU C; 
#chains in the Genus database with same CATH homology
 5IY5 1;  1CC5 A;  1J3S A;  1H31 B;  3NWV A;  5KAF V;  5CIE B;  2Y0E A;  4EIE A;  3PH2 B;  1E8E A;  1I5T A;  1BL9 A;  4AAL A;  1OCD A;  1FOC A;  4FB1 A;  2DGE A;  1RAQ A;  3SJL A;  4AAN A;  2LIR A;  3HQ9 A;  1CCR A;  1YIC A;  1DVH A;  1MZ4 A;  4RSZ A;  3WFC C;  1AYG A;  3ORV A;  2BH4 X;  1I54 A;  4WQ9 A;  5B6Q A;  2BCC D;  2Y0C A;  2L4D A;  1KX2 A;  2YCC A;  2V07 A;  1CHI A;  2OZ1 B;  4WQD A;  3TDK A;  2PAC A;  1W5C T;  5CIH B;  1KB0 A;  4FA4 A;  1A56 A;  351C A;  2C1D B;  4WQ7 A;  1A8C A;  1CNO A;  4PWA A;  1KIB A;  1YFC A;  1M60 A;  1U74 B;  2JQR A;  3SXT A;  3WFB C;  3FWL A;  1CCH A;  4FA9 A;  1YNR A;  3CP5 A;  1YIQ A;  5EXQ A;  1NNO A;  1CRJ A;  1I6E A;  4YE1 A;  1CYI A;  4O1Q A;  1NIR A;  5DJQ C;  1COR A;  1QL3 A;  1LFM A;  3O0R C;  3OCD B;  1H1O A;  1H31 A;  2ORL A;  3PXW A;  1YEB A;  2GB8 B;  3O20 A;  3PHL A;  4L1Q A;  2PCC B;  3OA8 B;  1L9J C;  1CSU A;  4WQE A;  2IBZ D;  1CIF A;  2ZOO A;  1CRY A;  1NU1 D;  2C1U A;  1F1C A;  2Y0D A;  5CYT R;  4H0K A;  1WEJ F;  2O3J A;  1CO6 A;  1CRH A;  3CYT I;  1HJ3 A;  2OZ1 A;  3DMI A;  3L75 D;  2C1V A;  3MK7 B;  3L70 D;  4K3I A;  2N3B A;  1NMI A;  1IQC A;  2N9J A;  3RN1 A;  2BPB B;  5TIS V;  1ZRT D;  1JDL A;  3M97 X;  3SWS A;  2CXB A;  3L71 D;  2VHD A;  3A9F A;  3VRD A;  5KAI V;  3VMA A;  1K3H A;  5KKZ B;  3H1L D;  1BCC D;  1DW1 A;  2FYN B;  1AOQ A;  1CTZ A;  3ZOX A;  2C9X B;  2D0W A;  5DFS A;  1GKS A;  2EXV A;  1SQX D;  1CRI A;  3NBS A;  1I55 A;  1H33 B;  1CXC A;  1BE3 D;  3ZOY A;  5CIC B;  4U3F D;  1FJ0 A;  1M70 A;  1B7V A;  155C A;  2CA3 B;  4L3G A;  1IZL 0;  5C9M A;  2V08 A;  3RLM A;  1BGY D;  3RN0 A;  1C6R A;  1YEA A;  2XTS B;  4XYD B;  2B11 B;  1FCD C;  3SLE A;  3CX5 W;  1KYO W;  1C52 A;  3L72 D;  3ZOO A;  4PD4 D;  2ZON G;  1FI7 A;  2B12 B;  1KV9 A;  1RAP A;  1FI9 A;  3A0H V;  1CRG A;  1HRC A;  4GED B;  3ZBM A;  2GIW A;  1HJ5 A;  3H1K D;  2KNC B;  1VYD A;  1P84 D;  3DP5 A;  3MK7 C;  4EDF A;  2AIU A;  3KHU A;  1M6Z A;  1WVE C;  1IRW A;  4QAO A;  1GIW A;  2QJK B;  1PP9 D;  3H1H D;  2QJY B;  4AAM A;  3DR0 A;  5B5E V;  1HJ4 A;  1DW3 A;  2CE0 A;  1CRC A;  2C8S A;  1GU2 A;  2BLF B;  2JTI B;  5CID B;  5DJQ B;  2B4Z A;  3OCD A;  1U75 B;  2N3Y A;  4PW9 B;  1I8O A;  1CSV A;  4NFG B;  2BGV X;  1H9Y A;  1QYZ A;  3CXH D;  3CWB D;  3L4O A;  2FWL A;  3JBT B;  1NTK D;  1C7M A;  2PCB B;  1N50 A;  4UB6 V;  2B0Z B;  3GG2 A;  2AI5 A;  1EB7 A;  5AUR A;  2K9J B;  3C2C A;  2CA4 B;  1HRO A;  1NML A;  3O1Y A;  1W2L A;  2BCN B;  4H0J A;  1SQV D;  1L0N D;  3VNW A;  2JWA A;  2YK3 A;  1MG3 D;  2I8F A;  3HQ6 A;  3ZIY A;  3HQ7 A;  3SVW A;  5CIB B;  2RN0 A;  5KLV D;  3WC8 A;  4MU8 A;  3PXT A;  1N15 A;  1HH7 A;  2L91 A;  1YTC A;  1CIE A;  3PRJ A;  1C2R A;  4IL6 V;  1IO3 A;  3HQ8 A;  4V2K A;  2AXT V;  2N18 B;  2Q3E A;  1DIQ C;  2CE1 A;  3PTZ A;  1SQP D;  1E2R A;  1C2N A;  1OAE A;  1H9X A;  2YQB A;  5DF5 A;  4FA5 A;  1LC2 A;  1PPJ D;  1HCM A;  1RZ5 A;  1LS9 A;  1H32 A;  2HV4 A;  1CSX A;  2N9Y B;  1H33 A;  2ZBO A;  5H2F V;  1DVV A;  3CX5 D;  4EID A;  3H1J D;  3BCC D;  4Q5P A;  1ETP A;  3H1I D;  4L3H A;  1FHB A;  1N90 A;  3WFD C;  1HZV A;  1L0L D;  3L74 D;  1QKS A;  1COT A;  1C6S A;  1MG2 D;  4EIC A;  3O5C A;  4FAN A;  1S6V B;  1YCC A;  2FRC A;  1KYO D;  3PLN A;  1QN2 A;  4P4Q B;  1CIG A;  3X39 A;  3CXH W;  1CXA A;  1AKK A;  1DW2 A;  4J20 A;  1EZV D;  1DT1 A;  4Y5R A;  4WQA A;  5CIG B;  4FAV A;  4WQC A;  1K3G A;  4EIF A;  2N9I A;  4FA1 A;  3CU4 A;  2MHM A;  4O1W A;  1H32 B;  3ITK A;  3TF5 A;  2QJP B;  4WQ8 A;  1KX7 A;  5C0Z A;  4GYD A;  3RMZ A;  5E79 V;  5GTH V;  2QG4 A;  2GC7 D;  1SQB D;  4RJT A;  1CIH A;  1E29 A;  1N9C A;  4PJ0 V;  2KS1 A;  2RMZ A;  3KZI V;  4XXL A;  1AOF A;  4JCG A;  4D6T D;  1CHH A;  2ZXY A;  3L73 D;  2YIU B;  5CIF B;  1LC1 A;  4A7P A;  1ZZH A;  3PXS A;  1F1F A;  1HZU A;  1CED A;  3L4M A;  1GQ1 A;  4AX3 A;  4AAO A;  1QL4 A;  1CYC A;  1LMS A;  1R0Q A;  1CSW A;  2MTA C;  1FI3 A;  1I6D A;  3ZCF A;  2FYU D;  1L9B C;  1I8P A;  5KLI B;  3WFE C;  1A2S A;  3NBT A;  1C6O A;  1NTM D;  2ZZS 1;  2C2C A;  2A06 D;  1CTJ A;  3WUI A;  3GW6 A;  3A0B V;  3VYM A;  3TYI A;  1DW0 A;  5GTI V;  1CTY A;  1SQQ D;  5B66 V;  1DII C;  2N18 C;  2D0S A;  1IRV A;  2GC4 D;  451C A;  3OA8 A;  3WU2 V;  1C75 A;  5TJH A;  1S5L V;  4WQB A;  1NTZ D;  4N0K A;  4KMG A;  1GJQ A;  2LIT A;  2DVH A;  4LJI A;  4UB8 V;  2BH5 X;  2B10 B;  1CHJ A;  1GDV A;  1RZ6 A;  1CYJ A;  2C1D A;  3ZOW A;  3TGU D;  1KB9 D;  4DY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...