2FYUD

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 2fyuD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2fyuD02
2N18C 3SXTA 1H9YA 1KYOW 3ZOWA 1DIIC 3CP5A 3CXHD 4UB8V 4O1QA 3DMIA 1AOFA 1FI9A 4H0KA 1IZL0 155CA 1I5TA 3NWVA 5CIHB 3H1KD 4FA9A 2ZXYA 2BH5X 5B66V 3PXSA 3A0BV 3L73D 2YQBA 3L70D 3GG2A 1I55A 4NFGB 2CA3B 1CSXA 2GC4D 2N18B 1ETPA 1HROA 4RSZA 3ZOYA 1C7MA 1M60A 1CHJA 4FA5A 3ITKA 5KKZB 1A56A 5CICB 1N15A 2BGVX 1CYCA 3ZBMA 2C8SA 3TDKA 2CXBA 4O1WA 1KYOD 4PJ0V 2AI5A 2FYNB 1W2LA 2AXTV 1KX7A 1GJQA 3X39A 1B7VA 3VRDA 1K3GA 2JWAA 2PCCB 5CIEB 3H1HD 1U74B 1CSVA 1WEJF 5EXQA 1CYIA 4WQ9A 1IQCA 1QL4A 4EICA 1IO3A 4PD4D 4V2KA 4YE1A 3H1LD 3HQ7A 2GC7D 4P4QB 4PWAA 1MG3D 2EXVA 4WQCA 3MK7C 4QAOA 5H2FV 2HV4A 2Y0EA 1CXAA 3CXHW 1AYGA 3BCCD 2ZBOA 4FAVA 4A7PA 3CU4A 3OCDA 1NTKD 3OCDB 3JBTB 2O3JA 1DW2A 2N3BA 2LITA 4WQDA 1YFCA 1C6SA 5CYTR 1PPJD 1CTZA 1AOQA 5TISV 3A9FA 1QYZA 1CTYA 3ZOXA 3VYMA 1SQQD 1MZ4A 3RN0A 1DT1A 5GTHV 2Y0DA 3VMAA 1H9XA 3O5CA 1SQBD 4K3IA 3PRJA 1NMIA 1C2RA 2B10B 1CCRA 1C75A 2BH4X 1KIBA 2FYUD 1BE3D 3WFEC 5KLIB 3CX5W 1RZ6A 5DJQC 3OA8A 3OA8B 1CCHA 1SQVD 2BLFB 2OZ1A 4UB6V 1I6DA 5IY51 2OZ1B 1GKSA 2L91A 2QG4A 2IBZD 5DFSA 3TGUD 1SQPD 1F1FA 2VHDA 1FHBA 1KX2A 1HRCA 1MG2D 5CIDB 1CSWA 3WFCC 4AX3A 1NTZD 2N3YA 1E2RA 1KV9A 3PTZA 3CYTI 1JDLA 1R0QA 1N9CA 1I8OA 1HZUA 4DY9A 1ZRTD 4U3FD 4AANA 1DW0A 4H0JA 3M97X 1AKKA 2B4ZA 3CX5D 3WUIA 1CSUA 5KAFV 3L74D 2BPBB 2JTIB 2C9XB 5TJHA 4D6TD 4EIDA 1QN2A 1KB0A 1CEDA 2KNCB 3O20A 4GYDA 5E79V 1DVVA 2BCNB 3H1JD 3L4OA 2ORLA 2RN0A 2MHMA 1IRWA 2AIUA 1CRYA 1HCMA 3NBSA 1CIGA 3FWLA 1ZZHA 3WFDC 2LIRA 2ZOOA 5CIBB 2D0WA 3O1YA 1HH7A 1QKSA 1C6OA 1A2SA 1KB9D 2QJYB 4WQBA 1N90A 4Y5RA 5DF5A 3PLNA 4RJTA 2PCBB 2V08A 4JCGA 1YIQA 1E29A 3SJLA 1F1CA 2YCCA 1DW3A 4J20A 3SWSA 3RN1A 1H1OA 1NIRA 2L4DA 2ZONG 3L75D 4AAOA 1FCDC 1I54A 1LFMA 1LMSA 1CO6A 1H31A 1OAEA 3MK7B 1C2NA 4LJIA 1RAQA 1NTMD 1HZVA 3A0HV 1IRVA 1L0LD 4L1QA 1FI7A 1YTCA 2N9YB 2ZZS1 1LS9A 4FANA 3HQ9A 1W5CT 3ZOOA 1L9JC 5AURA 3DP5A 351CA 5KLVD 1GQ1A 1CRIA 1BL9A 1CRCA 1DIQC 2BCCD 1CTJA 4PW9B 4FB1A 1BCCD 3SVWA 4EIEA 1SQXD 1NU1D 4KMGA 1FI3A 2Q3EA 1EZVD 1EB7A 2QJKB 3KZIV 4L3GA 3DR0A 3KHUA 1DW1A 4Q5PA 1QL3A 5KAIV 2I8FA 1CRGA 1YICA 1C52A 2MTAC 3PXWA 5C0ZA 1CORA 1M70A 3RLMA 3PHLA 1OCDA 1GIWA 2A06D 4WQ7A 1L0ND 3C2CA 3ORVA 5DJQB 4XYDB 1I8PA 3L72D 1U75B 1H32A 2GIWA 1H32B 1CRJA 3ZCFA 4EDFA 2N9JA 2B0ZB 3VNWA 1DVHA 1P84D 3RMZA 1LC1A 3GW6A 2QJPB 3SLEA 1CC5A 4WQAA 2GB8B 1FOCA 2YIUB 5B5EV 1HJ3A 4N0KA 1E8EA 4AAMA 1LC2A 1YEBA 3TYIA 4GEDB 1S6VB 3PXTA 4XXLA 2FWLA 3WU2V 1COTA 1CYJA 1VYDA 2B12B 3CWBD 4WQEA 2RMZA 2YK3A 4FA1A 3ZIYA 5CIFB 1CIEA 1L9BC 1CIFA 2CE0A 1C6RA 1CHHA 1CHIA 2C1UA 1NNOA 1YCCA 2V07A 1RAPA 1H33A 1S5LV 2JQRA 1N50A 1H33B 3WC8A 1HJ5A 1CIHA 2D0SA 4FA4A 1GU2A 2Y0CA 5C9MA 1YNRA 3NBTA 2DVHA 1NMLA 1CRHA 2XTSB 1I6EA 2C2CA 4EIFA 5CIGB 4WQ8A 3O0RC 1CXCA 1M6ZA 2FRCA 3TF5A 3H1ID 3PH2B 1BGYD 4IL6V 1J3SA 3L71D 1H31B 2DGEA 4L3HA 1HJ4A 1RZ5A 3HQ8A 1PP9D 1YEAA 3WFBC 2CA4B 2C1VA 5B6QA 2N9IA 1CNOA 3HQ6A 2K9JB 5GTIV 2C1DA 2PACA 3L4MA 1A8CA 2C1DB 1WVEC 2CE1A 2B11B 1FJ0A 4MU8A 1GDVA 1K3HA 2KS1A 451CA 4AALA
chains in the Genus database with same CATH superfamily
1MZ9A 1FJPA 3SXTA 1SQXE 1KYOW 2WVRA 1DIIC 1IFDA 1EZVE 3CXHD 4UB8V 2IBZE 2PFXA 1G2CB 1GL2D 5CHXA 4H0KA 2YXQB 2HPCB 2ZXYA 2MKVA 2W27A 4NPFX 3QH9A 1M56D 2YMKA 1T6AA 3GMAA 2A06E 1RE3A 2M5AB 1HJBA 3GG2A 1I55A 1RF1A 1N2DC 2BCCG 1CSXA 3L72E 2JDIH 1HROA 1JCDA 1PGJA 1CHJA 1GL2B 2E74C 2PGDA 2WSCH 2RKLA 2NRGA 4FA5A 2AXTH 3BRVB 3H1JJ 3CC4P 1GW4A 2BGVX 5AVZB 4PJ0V 4DZOA 4PV1D 3E1RA 4GIFA 1VQKP 5KAFE 1GJQA 4DT0A 1EDLA 3X39A 1YI2P 1K3GA 2PCCB 5CIEB 5E79E 3H1HD 4N78E 1CSVA 1SFCC 2IZ0A 2B88A 2LKMA 5AW2B 4IOIH 3PH0A 3H1LD 4PV1B 1S1CX 2PAJA 5AVRB 4L76A 3L75J 1JO5A 2JKVA 1U57A 5H2FV 1K04A 5KJ7D 3VN0A 1H8AA 1AYGA 3P7KA 4FAVA 1SFCA 5AVXB 3JBTB 2O3JA 3GLMA 1N73B 5GTHH 1CTZA 3RK2D 2BCCJ 3VMAA 1H9XA 1J1DB 3MUDC 1VQPP 4IL6X 4C46A 1JTHB 1NMIA 1C2RA 2WITA 2Z5IA 1KIBA 4UB6H 1NJIQ 3BCCG 3I5CA 5KLIB 2A45I 3RK2B 3VMXA 3AECC 3OA8A 2NPSD 1EDKA 2OZ1B 1VDFA 2QG4A 2LXCB 2K9YA 2G8YA 1KQGB 2M8RA 3KZIE 3N7NA 3O8ZA 4HJGH 1F1FA 4HYTB 1KX2A 1SQQK 1JEKA 2XNDH 3L70E 1HGVA 2N3YA 2K88A 2M0BA 3PTZA 2KZJA 2LR2A 1IFJA 1LTIC 3FXEA 2B89A 2R5BA 1DW0A 3HE4B 3CX5D 1CSUA 1LTTC 3L74D 2JTIB 1IZNB 2FKWB 2WMMA 2WSEJ 4D6TD 2ZVNB 1QN2A 3B4SA 3D70A 1CEDA 2KNCB 1DVVA 3TGUG 2ORLA 2MHMA 1L4AC 2J58A 3WU2E 1JY2O 1FC2C 1KORA 4HKZH 3FWLA 5AVTB 1VF5C 2W6JH 3WFDC 2J5UA 2ZOOA 3KYQA 2D2CD 1FAVA 1MV8A 1K8AQ 1S4XA 1C6OA 1W5CE 4R4LA 2JEEA 1KB9D 4WQBA 1R8EA 2OTLP 4WY4C 4KHXA 1BGYJ 5DF5A 1VL2A 3GHGA 4JCGA 3BCCJ 1YIQA 2YCCA 2WPSA 4J20A 1AV1A 1L4AA 1IFIA 3SWSA 3D71A 3TK1A 4L74A 4XFJA 2L4DA 1M7LA 3CCRP 4AAOA 2D2CB 3H32A 4YXDC 1YJNP 1VQ8P 1RE4C 1H31A 1URQD 4WY4A 2GM4A 1S9KD 1HZVA 4N6JA 1YTCA 3RK3E 3SFDC 2ZZS1 2W8ZA 3USSA 4I1LA 1W5CT 3L36A 4K3AA 351CA 1SQBE 2I1KA 3VOPA 1CTJA 4PW9B 3IR9A 1BCCD 1RE4A 1URQB 1NU1D 1FI3A 2Q3EA 4GODA 2Q6QA 3P8MC 2QJKB 4L3GA 1W2EA 3KHUA 3MHVA 1VQ9P 1GL2C 5KAIV 1G2CA 2MTAC 3PXWA 1NTMG 1NHLA 1TU3F 4WQ7A 2M3EA 1N8RQ 3G71P 1KFNA 5B66E 1KYOH 2M3BA 1HVVA 5L8RJ 3A0BE 1H32A 1MFTA 3ZCFA 3AE5C 5B5EH 1YYCA 1AVYA 3F5HA 3VNWA 1JNMA 1FJKA 1P84D 2L5GB 3SLEA 4U3FE 1GL2A 1ZW0A 1CC5A 3V2RA 2WSCJ 4N0KA 2JWDA 1YHQP 4GEDB 4PV1C 3PXTA 4XXLA 1CYJA 1VYDA 2YK3A 3C1LA 3H1LJ 3H1JE 3CCMP 4GKGA 3ZIYA 1CIEA 1J1EB 3IFMA 2IZ1A 1CHIA 2OARA 5CBNA 1YCCA 2QM7A 1FU1A 1L0NK 1H33A 1S5LV 2OQQA 1CIHA 2H7HA 3L74G 1YNRA 1BSNA 3BASA 2OYIC 3CMEP 5APWA 3V2PA 5CIGB 3O0RC 5KJ7C 4GOEA 1M6ZA 1KILD 3TF5A 3TNUA 4IFDK 1J3SA 1IK9A 1NTMJ 2W6AA 3L75E 1FDMA 1RZ5A 2QRXA 5GTIH 1IK7A 1L0LE 2OYIA 1JY3N 1S3JA 3RK2C 5B6QA 2N9IA 1CNOA 2AEJA 2K9JA 3HQ6A 3L4MA 5KJ7A 1KILB 4H44C 1FJ0A 1LP1B 4GDOA 5AVVB 1LTBC 1VQOP 3C8VA 2FXPA 1XTCC 1LT9B 4O1QA 1AOFA 3L71G 1FI9A 1GK6A 2FXOA 1JY2P 2N1TD 3NWVA 2ZJSE 4FA9A 2BH5X 2ZYGA 3HD7D 1PP9G 1VQ4P 4MN4C 2IPPA 1L0NE 2WPVB 2I1JA 2YQBA 2KXPB 4NFGB 2CA3B 5EFWB 3L74J 2N18B 1BCCG 1ETPA 2P7JA 4RSZA 3ZOYA 1C7MA 4D6TJ 1GTWA 3ITKA 3CXHI 3BVHA 1A56A 5CICB 3ZBMA 2C8SA 3TDKA 4O1WA 3HD7B 1IO4A 2AI5A 1K05A 1D7MA 2AXTV 1KX7A 1OX3A 3AEFC 3H1KG 1B7VA 3CWBE 2DW3A 2FFDB 1EQ7A 2QE7H 2KYVA 3NFQA 3L73G 3M9HA 4ZMDA 4DOJA 1IQCA 4PD4D 4V2KA 4YE1A 3W68A 1KQFB 2C0XA 4C7NB 4K35A 3II6A 2D2CC 5CCGC 3MIWA 3WUTA 1Q86Q 1NKNA 3MP7B 2EXVA 2QVAA 5APXA 2C9NY 3L4FA 1USEA 3L71J 3BCCD 4HH2A 2ZBOA 5TISH 3OCDA 3FGAD 1BGYE 2H43A 3D0WA 1C6SA 4I2LC 1UIIA 5CCGA 1MFZA 4Y28J 4GT1A 1VQ7P 3ZOXA 1A02F 3SFEC 1BCCJ 1MZ4A 3A0HE 5GTHV 1WRGA 2Y0DA 3HTKB 1NU1J 1GD2E 1OVVA 3O5CA 4WBAA 1QLED 1LTJC 2H8PD 2WQYC 5AW0B 1CCRA 4TT3H 1NAFA 2LXBA 1KQSO 2QIWA 1RZ6A 1JM0A 1H88A 1NTKG 3H1KJ 1CCHA 1IJDB 3CXHE 1FZCC 4UB6V 1FDOA 4OGQD 1VQMP 2L91A 3AE3C 1KD1Q 1PPJG 2GUVA 1LTAC 2IBZD 2V7QJ 1GW3A 5DFSA 3TGUD 1M1JC 1OIPA 1SQPD 5DJUB 1LTJA 1OW8A 1M90Q 1FHBA 1RY3A 5CIDB 1HRCA 1CSWA 1NTZD 1NTMK 3SSUA 2ZYAA 3S1KA 1FZGA 1FS0E 3CCSP 3U1AA 5KAFH 1N9CA 3V5BA 1FZCA 1SS1A 4OGQB 1HJ0A 1J1EC 3I56P 5E79H 2E76D 1AKKA 2B4ZA 1NKZB 1M1JA 2K37A 2BPBB 5AVWB 1SQVG 5TJHA 4IFFA 4EIDA 2P10A 1KB0A 1SVFA 4GYDA 1PGOA 1G1IA 5AW5B 1Y47A 2B87B 4ASVA 3NXSA 3L4OA 1S72P 1CRYA 4ZKPA 1LGHB 3H1HE 1CIGA 1ZZHA 3AEBC 1Y9BA 2LIRA 2E76B 2IX7C 4JBZA 5K5GB 3O1YA 5AW4B 1MKMA 1QKSA 3H1LE 1PGPA 1KTMA 3CX5I 2WSSH 1N90A 4Y5RA 2OGUA 2PCBB 2V08A 1F1CA 1QGKB 1XTGB 3PP5A 1NTKJ 1DW3A 1BDCA 5APTA 5BU8B 4OH8B 3RN1A 1H1OA 1JMMA 4U7JA 2P58A 3E1IA 5DJTB 1KILC 1GZLA 4BXLA 1LMSA 1EC5A 4W7YA 3VMZA 4IL6E 1CO6A 1OAEA 3MK7B 3VP9A 1NTMD 4AALA 1KB9I 5CCHC 1AA0A 1LT9C 4EI2A 3ZOOA 5AURA 2HFED 4L73A 5KLVD 3Q5SA 1BL9A 3KZIH 1YTZI 1GDTA 4EIEA 1EDIA 3B71A 1JY3O 2E75D 2H89C 1EB7A 2YO2A 3MUDA 2OYOA 1QX8A 3V4WA 5CCHA 1DW1A 4Q5PA 1QL3A 4UB8E 3CMAP 1C52A 1U7MA 3PHLA 3HD7C 1GIWA 2JJLA 3C2CA 2NPSB 1OMIA 3OAKA 1H0TB 1U75B 2GIWA 2N9JA 2FFDC 2HR3A 1FE6A 3LW5H 1LTSC 4W80A 2QJPB 3B5NC 2WSFJ 1SQXG 3AEAC 3WU2H 2ZXEB 5B5EV 1EZVG 3CX5E 2IBZG 1NU1K 3L37A 3L74E 1ZR4A 4JPZB 1SQPG 4PJ0E 4D6TE 1S6VB 3VYIA 2FWLA 2RMZA 2KK7A 3RL0D 3PJSK 4CPGA 4FA1A 1L9BC 4RO0A 1CIFA 1NTZG 2CPBA 2A06G 2FFDA 1CHHA 2GA1A 3MZWB 1WT6A 2R3CA 2Y9ZA 3QWOC 4DJGA 1AFOA 3B5NA 5CBOA 3L72G 2Z4EA 1P84I 1Q7YQ 2YKQA 1ZXGA 2E42A 1KB9E 4C7NA 3S9OA 1DEEG 5C9MA 5AW3B 3TYYA 3D6YA 2A45H 3RL0B 5AW8B 5APUA 4EIFA 4BRYB 4HB1A 5H2FE 5C39A 3H1ID 1RF0C 2Q9IA 1NOHA 1HGZA 2AXCA 2KB7P 1NAYA 3L71D 2DGEA 1OWAA 3T97A 3HQ8A 1SQQE 1S9KE 1PP9D 1FOSE 2O01H 5GTIV 3RK3D 1T2KD 2C1DB 1Q81Q 2WT7A 1WVEC 1CI6A 1RF0A 2YO3A 2XZRA 3CI9A 1GDVA 451CA 2KS1B 3TGUJ 1BCCE 1SQPJ 4Y99B 1NU1E 2KUBA 3ZOWA 1N7SD 3CCVP 2FYZA 1YTZT 1CW5A 5B66H 3DMIA 1HTLC 3A0BH 1IZL0 1NTZJ 2HPCA 1I5TA 3H1KD 4I6MC 2H88C 2O01N 3K5BA 3L72J 3PXSA 2M5AA 5KLVG 4YPCA 1W2BO 3L73D 1RF1B 2GC4D 5APSA 1N7SB 3RL0g 2IFNA 3HUSB 3MD0A 2E74D 1P84E 1HH0A 2Q5UA 4Z1MH 3CCEP 1DD4A 2E43A 1CYCA 4GOFA 1KYOD 4XE5B 2FYNB 1W2LA 3VP8A 2Q3IA 1LNQA 1ZV8A 3FX0A 1KC8Q 3Q1MA 5AW9B 3VRDA 1QEXA 2JWAA 1U74B 1WEJF 2VRSA 2E74B 1AQTA 5EXQA 1Y8AA 1CYIA 4WQ9A 1SFCD 3MGNA 3SWYA 1QL4A 1T3JA 1N73C 3AE2C 2XDJA 1QVGO 2GC7D 4P4QB 4PWAA 1LT1A 4RESB 4ZNCA 3M0AA 4WQCA 3MK7C 1OW6A 3BATA 4QAOA 1IC2A 2Y0EA 1J1DC 3A7OA 1KQLA 1LWUB 1KILE 1SFCB 1NTKD 1DW2A 3IN6A 4WQDA 1N73A 1AVOA 1NWQA 3CL3D 5CYTR 3Q5RA 1PPJD 5TISV 5KLIC 5KLVJ 4PD4I 1VPCA 2AEFA 1YBKA 1CTYA 3FWNA 2V4HA 3VYMA 3U59A 1E79H 4LLHA 1U7JA 2R5DA 1KMIZ 3TSIA 4LGDE 3AE6C 4K3IA 2BCCE 2SPZA 1JTHA 3PRJA 2WPRA 1T3UA 1Q90D 3BRTB 3H1IG 1C75A 2BH4X 2FBWC 4YXWH 2FYUD 1BE3D 2NPSC 3WFEC 3CX5W 2CK3H 3CLQA 3OA8B 4IFMA 1KZUB 5APVA 1UIXA 1SQVD 2OZ1A 3WUVA 2A45G 3W67A 5IY51 1GKSA 1KV4A 1NVOA 1GMJA 2WZ7A 5KAIE 3CC7P 2KI7B 3V4QA 3FXDA 1MG2D 3WFCC 1JMBA 4AX3A 1EDJA 1SQBG 2NPSA 1E2RA 1KV9A 2N1TB 1H0TA 2G3AA 1JDLA 1R0QA 1K73Q 3EQ2A 1ZRTD 2RH0A 4H0JA 3E7KA 3HE4A 3HE5B 3LW5J 3WUIA 1A02J 5KAFV 1JY2N 3I55P 2WSEH 2C9XB 5AVSB 2J59M 2KNCA 2E5TA 2KZIA 4R4MA 5E79V 3NTNA 2BCNB 1ZP0C 3JSVC 2RN0A 1IRWA 2AIUA 1PGQA 1L4AD 1SQPK 2QM8A 2MJZA 4NPDA 3NBSA 5CIBB 1VF5D 2D0WA 3A5TA 3LIEA 3AEGC 4PD4E 1HH7A 2XU6A 1NTZK 3P8CE 3G3ZA 1A2SA 3H1IJ 3JCUE 2QJYB 2KOGA 1S5LE 4JYBA 3PLNA 4U3FG 2W6BA 3SJLA 3GF7A 1N86A 3GHGB 4KT0J 1DH3A 3M91A 1RH5B 1L4AB 3H25A 4WWIA 3RBXA 3BCCE 1PP9J 4BRYA 1X9VA 3A0HH 4C7RA 3H32B 1LFMA 1URQC 3G6EP 1C2NA 3NMDA 4LJIA 1RAQA 5AW1B 2QJKC 1SQBJ 2PRRA 4EYYQ 4FANA 3HQ9A 1RQUA 1L9JC 2QSIA 3CXHH 5APYA 1S2EA 1T2KC 1GQ1A 1DIPA 5AW7B 2XV5A 1MUUA 2YMYA 3M9BA 1JCCA 2C0WA 1URQA 3OA7A 2W90A 1SQXD 2XKMA 4DCKA 1RE3C 2JR8A 1EZVD 1AJYA 3A2AA 1RF1C 3KZIV 1N7SC 1IFPA 3L73J 3HUSC 3M06A 2HODB 3GF3A 1PZQA 1YICA 5C0ZA 3TGUE 1CORA 1M70A 1L0LG 1LJ2A 1SQPE 5AVUB 2A06D 2FYNC 1FZBA 5DJQB 4XYDB 3L72D 4U3FJ 1NTZE 1H32B 1OFCX 3AE8C 4EDFA 1FOSF 2FYUG 2W83C 1BE3G 5KLVK 1DVHA 1N7SA 3SWKA 3HUSA 3RMZA 3GW6A 3AE1C 5CJ0A 4H0LD 1FOCA 2YIUB 1HJ3A 1E8EA 4H13D 1ZR2A 2Z5HA 1YEBA 1E5WA 3TYIA 1R5LA 3WU2V 1COTA 2B12B 2AXTE 3VTPC 4N78D 2CE0A 1Z56A 1L0NG 1ZN5A 2JO1A 2C1UA 3AE7C 1NNOA 3IF4A 2ZT9D 1RAPA 1LWUC 4H0LB 1KN7A 4H13B 1H33B 3WC8A 3O6QB 1R5SA 2XNXA 1Q2NA 1NH4A 1NMLA 3V2NA 1CRHA 4IL6H 2XTSB 4QMAA 2I8DA 4JF7A 4WQ8A 2OYHB 3CCUP 1H89A 2UWJE 3R2PA 3PH2B 2ZT9B 2KLUA 3CWBG 4N3YB 3TNUB 3B8EB 2NZ2A 1LWUA 1IFNA 1L0LJ 4M3LA 4L3HA 5M1BA 1HJ4A 3S4RA 2ZAEB 1NTME 1YITP 1YJ9P 1YEAA 3G9RA 3WFBC 2CA4B 1BDDA 2OYIB 3EFGA 1VQNP 4I7ZB 2FYUJ 1BE3J 5AW6B 2K9JB 1KILA 2Q7CA 1AQ5A 1A8CA 2AEMA 2BASA 2Y9YA 1LTGC 5GTHE 5KLVE 4H44D 1SQVJ 2CE1A 2B11B 4KJMA 1M1KQ 4UB8H 1X22A 3EFFK 1LP1A 2N18C 2IDBA 1SP4A 1H9YA 1BGYG 1LT9A 3CP5A 4AYCA 2N1TC 1L2PA 3CCQP 155CA 2HYNA 5CIHB 1L0NJ 1G1JA 4UB6E 3RBZA 1HF9A 2BEQD 4H44B 2P2UA 5B66V 3A0BV 3G4SP 2E75B 3L70D 3CX5H 3V6IA 1DEBA 1M8OB 4PJ0H 1M60A 3MTUE 1OXZA 2N1TA 2FXMA 2YKOA 2JP3A 4RKUJ 5KKZB 1SQBK 1N15A 3HD7A 2CXBA 3CWBJ 3HE5A 1RQVA 5CMZA 4B86A 2QJYC 3A3YB 3GHGC 1KB9H 2HLOA 5CJ4A 3P32A 2R3SA 3ZDMA 2Q1KA 4EICA 3CCLP 1IO3A 5H2FH 3Q5PA 3HQ7A 4YTPC 2PP6A 1FBMA 1MG3D 1KYOI 1Q82Q 1NYHA 5CCGD 4TLFA 3N4XA 1EXIA 2HV4A 1CXAA 2YKPA 3CXHW 3KXDA 4A7PA 3H1IE 3CU4A 3OCDB 2N3BA 2LITA 3L71E 1YFCA 1VQ5P 2HG5D 1AOQA 3H1HG 4JQ0D 2R32A 3A9FA 1YQ3C 1QYZA 2QEXP 3ABVC 4L75A 1VQ6P 1PP9E 3LIDA 1SQQD 3HTKA 3H1LG 3RN0A 3AE9C 1DT1A 1SQXJ 1T8ZA 1YJWP 3UIAA 1SQBD 2WPQA 1DD3A 3VMYA 3C9IA 2B9BA 3SWFA 2BEZF 4LC1A 2B10B 1M57D 3V2QA 1PV3A 3M0DC 3D6ZA 1X0TA 5DJQC 3RK3B 5KTBA 4OGQC 1GK4A 2BLFB 1I6DA 3CCJP 1NTKK 2KIKA 1HUCA 3H6PA 5APQA 2V7QH 3U1CA 1WMKA 3H1KE 3OJAB 2HODA 1HWTC 1FZEA 1P84H 2C9LY 1LTJB 2YIUC 1IFMA 3OW2O 2O1KA 2VHDA 2FY8A 1OW7A 3M0DA 3L73E 2OTJP 2KSJA 3CC2P 1L0LK 3CYTI 2P67A 1X79B 2N9BA 2GUSA 1I8OA 1HZUA 1FZCB 4DY9A 1OVRA 4U3FD 4AANA 2E76C 3M97X 1KYOE 1M1JB 2K1AA 2FYUK 4H0LC 4H13C 5B5EE 1K9MQ 2B87A 3O20A 3H1HJ 2CPSA 1BSHA 1SQVK 3Q3DA 1PFIA 3H1JD 4OVNF 1N7LA 1JB0J 1DX7A 1FZAA 3L70G 1HCMA 2KSEA 3IAOA 3WUUA 2OYHC 2R44A 2ZT9C 2K3RA 1JY3P 1VQLP 1NGMB 3JC22 3O6QA 5AVQB 4RJTA 1E29A 2O1JA 1KFMA 1PL5A 3AEEC 3KDPB 4ASWA 1X8YA 4D6TG 1YQ4C 1QL2A 1NIRA 4I7ZC 5AVYB 1GU4A 2OYHA 2ZONG 3L75D 1NTKE 2OTKE 1FCDC 1I54A 1QL1A 1PPJE 1FZFA 2ZFCA 1FDIA 3A0HV 1IRVA 1L0LD 3CD6P 4L1QA 1FI7A 2N9YB 4OWFA 4ZKUA 1LS9A 5CCHD 2ZVOB 3DP5A 1ZMEC 3RGUA 5BVZA 4W7ZA 1CRIA 1NO4A 5GTIE 3WMM0 1CRCA 1RHZB 5BU5A 1DIQC 2KP8A 4AUWA 2BCCD 2WWWA 4FB1A 3L35A 3EWKA 3SVWA 2E75C 5KAIH 4KMGA 2FYUE 1BE3E 2E5YA 1QVFO 4EOTA 3DR0A 1SQVE 2QJPC 3L70J 4EIJA 2KLVA 2I8FA 1SQQG 1CRGA 3F89A 4WVZA 3R4YA 5KKZC 3RLMA 1OCDA 2IFMA 1L0ND 3ORVA 1I8PA 3KQGA 1CRJA 3KPEA 2B0ZB 4JYCA 1EZVI 1LC1A 2IBZI 1ZRTE 2WSFH 1NU1G 4WQAA 3B5ND 2GB8B 1JOCA 4AAMA 1LC2A 2POHA 1SQXK 1GU5A 3RL0C 4PD4H 3CWBD 4WQEA 3JCUH 2YNYA 5CIFB 1S5LH 3CPWO 2ZYDA 1C6RA 1OZHA 2V07A 3B5NB 2JQRA 1ZLLA 3HRNA 1N50A 4O9BA 1HJ5A 2ZXXA 4WY4D 2IYPA 2D0SA 2WTYA 4BWNA 4FA4A 1J2JB 1GU2A 2Y0CA 3P8CD 1YIJP 3NBTA 2DVHA 3AE4C 4NPEA 3AEDC 1I6EA 2C2CA 1OVUA 4AQRD 1VF5B 3H1JG 1CXCA 2FRCA 1SQQJ 1BGYD 4IL6V 1H31B 2QA4P 3Q2YA 4WY4B 4Y99C 1CSBA 1S5LX 3T97B 1SLQA 5TISE 2C1VA 2O01J 3RK3C 1HBWA 1JUNA 2C1DA 2PACA 2YXRB 3M9QA 1ZOYC 2WT7B 1PIXA 1CI6B 4MU8A 2P1JA 2IYOA 1USDA 4WB4A 2ITAA 1EXJA 1K3HA 2KS1A 1CZQA 4XA4A 3L75G
chains in the Genus database with same CATH topology
2N18C 3SXTA 1H9YA 1KYOW 3ZOWA 1DIIC 3CP5A 3CXHD 4UB8V 4O1QA 3DMIA 1AOFA 1FI9A 4H0KA 1IZL0 155CA 1I5TA 3NWVA 5CIHB 3H1KD 4FA9A 2ZXYA 2BH5X 5B66V 3PXSA 3A0BV 3L73D 2YQBA 3L70D 3GG2A 1I55A 4NFGB 2CA3B 1CSXA 2GC4D 2N18B 1ETPA 1HROA 4RSZA 3ZOYA 1C7MA 1M60A 1CHJA 4FA5A 3ITKA 5KKZB 1A56A 5CICB 1N15A 2BGVX 1CYCA 3ZBMA 2C8SA 3TDKA 2CXBA 4O1WA 1KYOD 4PJ0V 2AI5A 2FYNB 1W2LA 2AXTV 1KX7A 1GJQA 3X39A 1B7VA 3VRDA 1K3GA 2JWAA 2PCCB 5CIEB 3H1HD 1U74B 1CSVA 1WEJF 5EXQA 1CYIA 4WQ9A 1IQCA 1QL4A 4EICA 1IO3A 4PD4D 4V2KA 4YE1A 3H1LD 3HQ7A 2GC7D 4P4QB 4PWAA 1MG3D 2EXVA 4WQCA 3MK7C 4QAOA 5H2FV 2HV4A 2Y0EA 1CXAA 3CXHW 1AYGA 3BCCD 2ZBOA 4FAVA 4A7PA 3CU4A 3OCDA 1NTKD 3OCDB 3JBTB 2O3JA 1DW2A 2N3BA 2LITA 4WQDA 1YFCA 1C6SA 5CYTR 1PPJD 1CTZA 1AOQA 5TISV 3A9FA 1QYZA 1CTYA 3ZOXA 3VYMA 1SQQD 1MZ4A 3RN0A 1DT1A 5GTHV 2Y0DA 3VMAA 1H9XA 3O5CA 1SQBD 4K3IA 3PRJA 1NMIA 1C2RA 2B10B 1CCRA 1C75A 2BH4X 1KIBA 2FYUD 1BE3D 3WFEC 5KLIB 3CX5W 1RZ6A 5DJQC 3OA8A 3OA8B 1CCHA 1SQVD 2BLFB 2OZ1A 4UB6V 1I6DA 5IY51 2OZ1B 1GKSA 2L91A 2QG4A 2IBZD 5DFSA 3TGUD 1SQPD 1F1FA 2VHDA 1FHBA 1KX2A 1HRCA 1MG2D 5CIDB 1CSWA 3WFCC 4AX3A 1NTZD 2N3YA 1E2RA 1KV9A 3PTZA 3CYTI 1JDLA 1R0QA 1N9CA 1I8OA 1HZUA 4DY9A 1ZRTD 4U3FD 4AANA 1DW0A 4H0JA 3M97X 1AKKA 2B4ZA 3CX5D 3WUIA 1CSUA 5KAFV 3L74D 2BPBB 2JTIB 2C9XB 5TJHA 4D6TD 4EIDA 1QN2A 1KB0A 1CEDA 2KNCB 3O20A 4GYDA 5E79V 1DVVA 2BCNB 3H1JD 3L4OA 2ORLA 2RN0A 2MHMA 1IRWA 2AIUA 1CRYA 1HCMA 3NBSA 1CIGA 3FWLA 1ZZHA 3WFDC 2LIRA 2ZOOA 5CIBB 2D0WA 3O1YA 1HH7A 1QKSA 1C6OA 1A2SA 1KB9D 2QJYB 4WQBA 1N90A 4Y5RA 5DF5A 3PLNA 4RJTA 2PCBB 2V08A 4JCGA 1YIQA 1E29A 3SJLA 1F1CA 2YCCA 1DW3A 4J20A 3SWSA 3RN1A 1H1OA 1NIRA 2L4DA 2ZONG 3L75D 4AAOA 1FCDC 1I54A 1LFMA 1LMSA 1CO6A 1H31A 1OAEA 3MK7B 1C2NA 4LJIA 1RAQA 1NTMD 1HZVA 3A0HV 1IRVA 1L0LD 4L1QA 1FI7A 1YTCA 2N9YB 2ZZS1 1LS9A 4FANA 3HQ9A 1W5CT 3ZOOA 1L9JC 5AURA 3DP5A 351CA 5KLVD 1GQ1A 1CRIA 1BL9A 1CRCA 1DIQC 2BCCD 1CTJA 4PW9B 4FB1A 1BCCD 3SVWA 4EIEA 1SQXD 1NU1D 4KMGA 1FI3A 2Q3EA 1EZVD 1EB7A 2QJKB 3KZIV 4L3GA 3DR0A 3KHUA 1DW1A 4Q5PA 1QL3A 5KAIV 2I8FA 1CRGA 1YICA 1C52A 2MTAC 3PXWA 5C0ZA 1CORA 1M70A 3RLMA 3PHLA 1OCDA 1GIWA 2A06D 4WQ7A 1L0ND 3C2CA 3ORVA 5DJQB 4XYDB 1I8PA 3L72D 1U75B 1H32A 2GIWA 1H32B 1CRJA 3ZCFA 4EDFA 2N9JA 2B0ZB 3VNWA 1DVHA 1P84D 3RMZA 1LC1A 3GW6A 2QJPB 3SLEA 1CC5A 4WQAA 2GB8B 1FOCA 2YIUB 5B5EV 1HJ3A 4N0KA 1E8EA 4AAMA 1LC2A 1YEBA 3TYIA 4GEDB 1S6VB 3PXTA 4XXLA 2FWLA 3WU2V 1COTA 1CYJA 1VYDA 2B12B 3CWBD 4WQEA 2RMZA 2YK3A 4FA1A 3ZIYA 5CIFB 1CIEA 1L9BC 1CIFA 2CE0A 1C6RA 1CHHA 1CHIA 2C1UA 1NNOA 1YCCA 2V07A 1RAPA 1H33A 1S5LV 2JQRA 1N50A 1H33B 3WC8A 1HJ5A 1CIHA 2D0SA 4FA4A 1GU2A 2Y0CA 5C9MA 1YNRA 3NBTA 2DVHA 1NMLA 1CRHA 2XTSB 1I6EA 2C2CA 4EIFA 5CIGB 4WQ8A 3O0RC 1CXCA 1M6ZA 2FRCA 3TF5A 3H1ID 3PH2B 1BGYD 4IL6V 1J3SA 3L71D 1H31B 2DGEA 4L3HA 1HJ4A 1RZ5A 3HQ8A 1PP9D 1YEAA 3WFBC 2CA4B 2C1VA 5B6QA 2N9IA 1CNOA 3HQ6A 2K9JB 5GTIV 2C1DA 2PACA 3L4MA 1A8CA 2C1DB 1WVEC 2CE1A 2B11B 1FJ0A 4MU8A 1GDVA 1K3HA 2KS1A 451CA 4AALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N18 C;  3SXT A;  1H9Y A;  1KYO W;  3ZOW A;  1DII C;  3CP5 A;  3CXH D;  4UB8 V;  4O1Q A;  3DMI A;  1AOF A;  1FI9 A;  4H0K A;  1IZL 0;  155C A;  1I5T A;  3NWV A;  5CIH B;  3H1K D;  4FA9 A;  2ZXY A;  2BH5 X;  5B66 V;  3PXS A;  3A0B V;  3L73 D;  2YQB A;  3L70 D;  3GG2 A;  1I55 A;  4NFG B;  2CA3 B;  1CSX A;  2GC4 D;  2N18 B;  1ETP A;  1HRO A;  4RSZ A;  3ZOY A;  1C7M A;  1M60 A;  1CHJ A;  4FA5 A;  3ITK A;  5KKZ B;  1A56 A;  5CIC B;  1N15 A;  2BGV X;  1CYC A;  3ZBM A;  2C8S A;  3TDK A;  2CXB A;  4O1W A;  1KYO D;  4PJ0 V;  2AI5 A;  2FYN B;  1W2L A;  2AXT V;  1KX7 A;  1GJQ A;  3X39 A;  1B7V A;  3VRD A;  1K3G A;  2JWA A;  2PCC B;  5CIE B;  3H1H D;  1U74 B;  1CSV A;  1WEJ F;  5EXQ A;  1CYI A;  4WQ9 A;  1IQC A;  1QL4 A;  4EIC A;  1IO3 A;  4PD4 D;  4V2K A;  4YE1 A;  3H1L D;  3HQ7 A;  2GC7 D;  4P4Q B;  4PWA A;  1MG3 D;  2EXV A;  4WQC A;  3MK7 C;  4QAO A;  5H2F V;  2HV4 A;  2Y0E A;  1CXA A;  3CXH W;  1AYG A;  3BCC D;  2ZBO A;  4FAV A;  4A7P A;  3CU4 A;  3OCD A;  1NTK D;  3OCD B;  3JBT B;  2O3J A;  1DW2 A;  2N3B A;  2LIT A;  4WQD A;  1YFC A;  1C6S A;  5CYT R;  1PPJ D;  1CTZ A;  1AOQ A;  5TIS V;  3A9F A;  1QYZ A;  1CTY A;  3ZOX A;  3VYM A;  1SQQ D;  1MZ4 A;  3RN0 A;  1DT1 A;  5GTH V;  2Y0D A;  3VMA A;  1H9X A;  3O5C A;  1SQB D;  4K3I A;  3PRJ A;  1NMI A;  1C2R A;  2B10 B;  1CCR A;  1C75 A;  2BH4 X;  1KIB A;  2FYU D;  1BE3 D;  3WFE C;  5KLI B;  3CX5 W;  1RZ6 A;  5DJQ C;  3OA8 A;  3OA8 B;  1CCH A;  1SQV D;  2BLF B;  2OZ1 A;  4UB6 V;  1I6D A;  5IY5 1;  2OZ1 B;  1GKS A;  2L91 A;  2QG4 A;  2IBZ D;  5DFS A;  3TGU D;  1SQP D;  1F1F A;  2VHD A;  1FHB A;  1KX2 A;  1HRC A;  1MG2 D;  5CID B;  1CSW A;  3WFC C;  4AX3 A;  1NTZ D;  2N3Y A;  1E2R A;  1KV9 A;  3PTZ A;  3CYT I;  1JDL A;  1R0Q A;  1N9C A;  1I8O A;  1HZU A;  4DY9 A;  1ZRT D;  4U3F D;  4AAN A;  1DW0 A;  4H0J A;  3M97 X;  1AKK A;  2B4Z A;  3CX5 D;  3WUI A;  1CSU A;  5KAF V;  3L74 D;  2BPB B;  2JTI B;  2C9X B;  5TJH A;  4D6T D;  4EID A;  1QN2 A;  1KB0 A;  1CED A;  2KNC B;  3O20 A;  4GYD A;  5E79 V;  1DVV A;  2BCN B;  3H1J D;  3L4O A;  2ORL A;  2RN0 A;  2MHM A;  1IRW A;  2AIU A;  1CRY A;  1HCM A;  3NBS A;  1CIG A;  3FWL A;  1ZZH A;  3WFD C;  2LIR A;  2ZOO A;  5CIB B;  2D0W A;  3O1Y A;  1HH7 A;  1QKS A;  1C6O A;  1A2S A;  1KB9 D;  2QJY B;  4WQB A;  1N90 A;  4Y5R A;  5DF5 A;  3PLN A;  4RJT A;  2PCB B;  2V08 A;  4JCG A;  1YIQ A;  1E29 A;  3SJL A;  1F1C A;  2YCC A;  1DW3 A;  4J20 A;  3SWS A;  3RN1 A;  1H1O A;  1NIR A;  2L4D A;  2ZON G;  3L75 D;  4AAO A;  1FCD C;  1I54 A;  1LFM A;  1LMS A;  1CO6 A;  1H31 A;  1OAE A;  3MK7 B;  1C2N A;  4LJI A;  1RAQ A;  1NTM D;  1HZV A;  3A0H V;  1IRV A;  1L0L D;  4L1Q A;  1FI7 A;  1YTC A;  2N9Y B;  2ZZS 1;  1LS9 A;  4FAN A;  3HQ9 A;  1W5C T;  3ZOO A;  1L9J C;  5AUR A;  3DP5 A;  351C A;  5KLV D;  1GQ1 A;  1CRI A;  1BL9 A;  1CRC A;  1DIQ C;  2BCC D;  1CTJ A;  4PW9 B;  4FB1 A;  1BCC D;  3SVW A;  4EIE A;  1SQX D;  1NU1 D;  4KMG A;  1FI3 A;  2Q3E A;  1EZV D;  1EB7 A;  2QJK B;  3KZI V;  4L3G A;  3DR0 A;  3KHU A;  1DW1 A;  4Q5P A;  1QL3 A;  5KAI V;  2I8F A;  1CRG A;  1YIC A;  1C52 A;  2MTA C;  3PXW A;  5C0Z A;  1COR A;  1M70 A;  3RLM A;  3PHL A;  1OCD A;  1GIW A;  2A06 D;  4WQ7 A;  1L0N D;  3C2C A;  3ORV A;  5DJQ B;  4XYD B;  1I8P A;  3L72 D;  1U75 B;  1H32 A;  2GIW A;  1H32 B;  1CRJ A;  3ZCF A;  4EDF A;  2N9J A;  2B0Z B;  3VNW A;  1DVH A;  1P84 D;  3RMZ A;  1LC1 A;  3GW6 A;  2QJP B;  3SLE A;  1CC5 A;  4WQA A;  2GB8 B;  1FOC A;  2YIU B;  5B5E V;  1HJ3 A;  4N0K A;  1E8E A;  4AAM A;  1LC2 A;  1YEB A;  3TYI A;  4GED B;  1S6V B;  3PXT A;  4XXL A;  2FWL A;  3WU2 V;  1COT A;  1CYJ A;  1VYD A;  2B12 B;  3CWB D;  4WQE A;  2RMZ A;  2YK3 A;  4FA1 A;  3ZIY A;  5CIF B;  1CIE A;  1L9B C;  1CIF A;  2CE0 A;  1C6R A;  1CHH A;  1CHI A;  2C1U A;  1NNO A;  1YCC A;  2V07 A;  1RAP A;  1H33 A;  1S5L V;  2JQR A;  1N50 A;  1H33 B;  3WC8 A;  1HJ5 A;  1CIH A;  2D0S A;  4FA4 A;  1GU2 A;  2Y0C A;  5C9M A;  1YNR A;  3NBT A;  2DVH A;  1NML A;  1CRH A;  2XTS B;  1I6E A;  2C2C A;  4EIF A;  5CIG B;  4WQ8 A;  3O0R C;  1CXC A;  1M6Z A;  2FRC A;  3TF5 A;  3H1I D;  3PH2 B;  1BGY D;  4IL6 V;  1J3S A;  3L71 D;  1H31 B;  2DGE A;  4L3H A;  1HJ4 A;  1RZ5 A;  3HQ8 A;  1PP9 D;  1YEA A;  3WFB C;  2CA4 B;  2C1V A;  5B6Q A;  2N9I A;  1CNO A;  3HQ6 A;  2K9J B;  5GTI V;  2C1D A;  2PAC A;  3L4M A;  1A8C A;  2C1D B;  1WVE C;  2CE1 A;  2B11 B;  1FJ0 A;  4MU8 A;  1GDV A;  1K3H A;  2KS1 A;  451C A;  4AAL A; 
#chains in the Genus database with same CATH topology
 1MZ9 A;  1FJP A;  3SXT A;  1SQX E;  1KYO W;  2WVR A;  1DII C;  1IFD A;  1EZV E;  3CXH D;  4UB8 V;  2IBZ E;  2PFX A;  1G2C B;  1GL2 D;  5CHX A;  4H0K A;  2YXQ B;  2HPC B;  2ZXY A;  2MKV A;  2W27 A;  4NPF X;  3QH9 A;  1M56 D;  2YMK A;  1T6A A;  3GMA A;  2A06 E;  1RE3 A;  2M5A B;  1HJB A;  3GG2 A;  1I55 A;  1RF1 A;  1N2D C;  2BCC G;  1CSX A;  3L72 E;  2JDI H;  1HRO A;  1JCD A;  1PGJ A;  1CHJ A;  1GL2 B;  2E74 C;  2PGD A;  2WSC H;  2RKL A;  2NRG A;  4FA5 A;  2AXT H;  3BRV B;  3H1J J;  3CC4 P;  1GW4 A;  2BGV X;  5AVZ B;  4PJ0 V;  4DZO A;  4PV1 D;  3E1R A;  4GIF A;  1VQK P;  5KAF E;  1GJQ A;  4DT0 A;  1EDL A;  3X39 A;  1YI2 P;  1K3G A;  2PCC B;  5CIE B;  5E79 E;  3H1H D;  4N78 E;  1CSV A;  1SFC C;  2IZ0 A;  2B88 A;  2LKM A;  5AW2 B;  4IOI H;  3PH0 A;  3H1L D;  4PV1 B;  1S1C X;  2PAJ A;  5AVR B;  4L76 A;  3L75 J;  1JO5 A;  2JKV A;  1U57 A;  5H2F V;  1K04 A;  5KJ7 D;  3VN0 A;  1H8A A;  1AYG A;  3P7K A;  4FAV A;  1SFC A;  5AVX B;  3JBT B;  2O3J A;  3GLM A;  1N73 B;  5GTH H;  1CTZ A;  3RK2 D;  2BCC J;  3VMA A;  1H9X A;  1J1D B;  3MUD C;  1VQP P;  4IL6 X;  4C46 A;  1JTH B;  1NMI A;  1C2R A;  2WIT A;  2Z5I A;  1KIB A;  4UB6 H;  1NJI Q;  3BCC G;  3I5C A;  5KLI B;  2A45 I;  3RK2 B;  3VMX A;  3AEC C;  3OA8 A;  2NPS D;  1EDK A;  2OZ1 B;  1VDF A;  2QG4 A;  2LXC B;  2K9Y A;  2G8Y A;  1KQG B;  2M8R A;  3KZI E;  3N7N A;  3O8Z A;  4HJG H;  1F1F A;  4HYT B;  1KX2 A;  1SQQ K;  1JEK A;  2XND H;  3L70 E;  1HGV A;  2N3Y A;  2K88 A;  2M0B A;  3PTZ A;  2KZJ A;  2LR2 A;  1IFJ A;  1LTI C;  3FXE A;  2B89 A;  2R5B A;  1DW0 A;  3HE4 B;  3CX5 D;  1CSU A;  1LTT C;  3L74 D;  2JTI B;  1IZN B;  2FKW B;  2WMM A;  2WSE J;  4D6T D;  2ZVN B;  1QN2 A;  3B4S A;  3D70 A;  1CED A;  2KNC B;  1DVV A;  3TGU G;  2ORL A;  2MHM A;  1L4A C;  2J58 A;  3WU2 E;  1JY2 O;  1FC2 C;  1KOR A;  4HKZ H;  3FWL A;  5AVT B;  1VF5 C;  2W6J H;  3WFD C;  2J5U A;  2ZOO A;  3KYQ A;  2D2C D;  1FAV A;  1MV8 A;  1K8A Q;  1S4X A;  1C6O A;  1W5C E;  4R4L A;  2JEE A;  1KB9 D;  4WQB A;  1R8E A;  2OTL P;  4WY4 C;  4KHX A;  1BGY J;  5DF5 A;  1VL2 A;  3GHG A;  4JCG A;  3BCC J;  1YIQ A;  2YCC A;  2WPS A;  4J20 A;  1AV1 A;  1L4A A;  1IFI A;  3SWS A;  3D71 A;  3TK1 A;  4L74 A;  4XFJ A;  2L4D A;  1M7L A;  3CCR P;  4AAO A;  2D2C B;  3H32 A;  4YXD C;  1YJN P;  1VQ8 P;  1RE4 C;  1H31 A;  1URQ D;  4WY4 A;  2GM4 A;  1S9K D;  1HZV A;  4N6J A;  1YTC A;  3RK3 E;  3SFD C;  2ZZS 1;  2W8Z A;  3USS A;  4I1L A;  1W5C T;  3L36 A;  4K3A A;  351C A;  1SQB E;  2I1K A;  3VOP A;  1CTJ A;  4PW9 B;  3IR9 A;  1BCC D;  1RE4 A;  1URQ B;  1NU1 D;  1FI3 A;  2Q3E A;  4GOD A;  2Q6Q A;  3P8M C;  2QJK B;  4L3G A;  1W2E A;  3KHU A;  3MHV A;  1VQ9 P;  1GL2 C;  5KAI V;  1G2C A;  2MTA C;  3PXW A;  1NTM G;  1NHL A;  1TU3 F;  4WQ7 A;  2M3E A;  1N8R Q;  3G71 P;  1KFN A;  5B66 E;  1KYO H;  2M3B A;  1HVV A;  5L8R J;  3A0B E;  1H32 A;  1MFT A;  3ZCF A;  3AE5 C;  5B5E H;  1YYC A;  1AVY A;  3F5H A;  3VNW A;  1JNM A;  1FJK A;  1P84 D;  2L5G B;  3SLE A;  4U3F E;  1GL2 A;  1ZW0 A;  1CC5 A;  3V2R A;  2WSC J;  4N0K A;  2JWD A;  1YHQ P;  4GED B;  4PV1 C;  3PXT A;  4XXL A;  1CYJ A;  1VYD A;  2YK3 A;  3C1L A;  3H1L J;  3H1J E;  3CCM P;  4GKG A;  3ZIY A;  1CIE A;  1J1E B;  3IFM A;  2IZ1 A;  1CHI A;  2OAR A;  5CBN A;  1YCC A;  2QM7 A;  1FU1 A;  1L0N K;  1H33 A;  1S5L V;  2OQQ A;  1CIH A;  2H7H A;  3L74 G;  1YNR A;  1BSN A;  3BAS A;  2OYI C;  3CME P;  5APW A;  3V2P A;  5CIG B;  3O0R C;  5KJ7 C;  4GOE A;  1M6Z A;  1KIL D;  3TF5 A;  3TNU A;  4IFD K;  1J3S A;  1IK9 A;  1NTM J;  2W6A A;  3L75 E;  1FDM A;  1RZ5 A;  2QRX A;  5GTI H;  1IK7 A;  1L0L E;  2OYI A;  1JY3 N;  1S3J A;  3RK2 C;  5B6Q A;  2N9I A;  1CNO A;  2AEJ A;  2K9J A;  3HQ6 A;  3L4M A;  5KJ7 A;  1KIL B;  4H44 C;  1FJ0 A;  1LP1 B;  4GDO A;  5AVV B;  1LTB C;  1VQO P;  3C8V A;  2FXP A;  1XTC C;  1LT9 B;  4O1Q A;  1AOF A;  3L71 G;  1FI9 A;  1GK6 A;  2FXO A;  1JY2 P;  2N1T D;  3NWV A;  2ZJS E;  4FA9 A;  2BH5 X;  2ZYG A;  3HD7 D;  1PP9 G;  1VQ4 P;  4MN4 C;  2IPP A;  1L0N E;  2WPV B;  2I1J A;  2YQB A;  2KXP B;  4NFG B;  2CA3 B;  5EFW B;  3L74 J;  2N18 B;  1BCC G;  1ETP A;  2P7J A;  4RSZ A;  3ZOY A;  1C7M A;  4D6T J;  1GTW A;  3ITK A;  3CXH I;  3BVH A;  1A56 A;  5CIC B;  3ZBM A;  2C8S A;  3TDK A;  4O1W A;  3HD7 B;  1IO4 A;  2AI5 A;  1K05 A;  1D7M A;  2AXT V;  1KX7 A;  1OX3 A;  3AEF C;  3H1K G;  1B7V A;  3CWB E;  2DW3 A;  2FFD B;  1EQ7 A;  2QE7 H;  2KYV A;  3NFQ A;  3L73 G;  3M9H A;  4ZMD A;  4DOJ A;  1IQC A;  4PD4 D;  4V2K A;  4YE1 A;  3W68 A;  1KQF B;  2C0X A;  4C7N B;  4K35 A;  3II6 A;  2D2C C;  5CCG C;  3MIW A;  3WUT A;  1Q86 Q;  1NKN A;  3MP7 B;  2EXV A;  2QVA A;  5APX A;  2C9N Y;  3L4F A;  1USE A;  3L71 J;  3BCC D;  4HH2 A;  2ZBO A;  5TIS H;  3OCD A;  3FGA D;  1BGY E;  2H43 A;  3D0W A;  1C6S A;  4I2L C;  1UII A;  5CCG A;  1MFZ A;  4Y28 J;  4GT1 A;  1VQ7 P;  3ZOX A;  1A02 F;  3SFE C;  1BCC J;  1MZ4 A;  3A0H E;  5GTH V;  1WRG A;  2Y0D A;  3HTK B;  1NU1 J;  1GD2 E;  1OVV A;  3O5C A;  4WBA A;  1QLE D;  1LTJ C;  2H8P D;  2WQY C;  5AW0 B;  1CCR A;  4TT3 H;  1NAF A;  2LXB A;  1KQS O;  2QIW A;  1RZ6 A;  1JM0 A;  1H88 A;  1NTK G;  3H1K J;  1CCH A;  1IJD B;  3CXH E;  1FZC C;  4UB6 V;  1FDO A;  4OGQ D;  1VQM P;  2L91 A;  3AE3 C;  1KD1 Q;  1PPJ G;  2GUV A;  1LTA C;  2IBZ D;  2V7Q J;  1GW3 A;  5DFS A;  3TGU D;  1M1J C;  1OIP A;  1SQP D;  5DJU B;  1LTJ A;  1OW8 A;  1M90 Q;  1FHB A;  1RY3 A;  5CID B;  1HRC A;  1CSW A;  1NTZ D;  1NTM K;  3SSU A;  2ZYA A;  3S1K A;  1FZG A;  1FS0 E;  3CCS P;  3U1A A;  5KAF H;  1N9C A;  3V5B A;  1FZC A;  1SS1 A;  4OGQ B;  1HJ0 A;  1J1E C;  3I56 P;  5E79 H;  2E76 D;  1AKK A;  2B4Z A;  1NKZ B;  1M1J A;  2K37 A;  2BPB B;  5AVW B;  1SQV G;  5TJH A;  4IFF A;  4EID A;  2P10 A;  1KB0 A;  1SVF A;  4GYD A;  1PGO A;  1G1I A;  5AW5 B;  1Y47 A;  2B87 B;  4ASV A;  3NXS A;  3L4O A;  1S72 P;  1CRY A;  4ZKP A;  1LGH B;  3H1H E;  1CIG A;  1ZZH A;  3AEB C;  1Y9B A;  2LIR A;  2E76 B;  2IX7 C;  4JBZ A;  5K5G B;  3O1Y A;  5AW4 B;  1MKM A;  1QKS A;  3H1L E;  1PGP A;  1KTM A;  3CX5 I;  2WSS H;  1N90 A;  4Y5R A;  2OGU A;  2PCB B;  2V08 A;  1F1C A;  1QGK B;  1XTG B;  3PP5 A;  1NTK J;  1DW3 A;  1BDC A;  5APT A;  5BU8 B;  4OH8 B;  3RN1 A;  1H1O A;  1JMM A;  4U7J A;  2P58 A;  3E1I A;  5DJT B;  1KIL C;  1GZL A;  4BXL A;  1LMS A;  1EC5 A;  4W7Y A;  3VMZ A;  4IL6 E;  1CO6 A;  1OAE A;  3MK7 B;  3VP9 A;  1NTM D;  4AAL A;  1KB9 I;  5CCH C;  1AA0 A;  1LT9 C;  4EI2 A;  3ZOO A;  5AUR A;  2HFE D;  4L73 A;  5KLV D;  3Q5S A;  1BL9 A;  3KZI H;  1YTZ I;  1GDT A;  4EIE A;  1EDI A;  3B71 A;  1JY3 O;  2E75 D;  2H89 C;  1EB7 A;  2YO2 A;  3MUD A;  2OYO A;  1QX8 A;  3V4W A;  5CCH A;  1DW1 A;  4Q5P A;  1QL3 A;  4UB8 E;  3CMA P;  1C52 A;  1U7M A;  3PHL A;  3HD7 C;  1GIW A;  2JJL A;  3C2C A;  2NPS B;  1OMI A;  3OAK A;  1H0T B;  1U75 B;  2GIW A;  2N9J A;  2FFD C;  2HR3 A;  1FE6 A;  3LW5 H;  1LTS C;  4W80 A;  2QJP B;  3B5N C;  2WSF J;  1SQX G;  3AEA C;  3WU2 H;  2ZXE B;  5B5E V;  1EZV G;  3CX5 E;  2IBZ G;  1NU1 K;  3L37 A;  3L74 E;  1ZR4 A;  4JPZ B;  1SQP G;  4PJ0 E;  4D6T E;  1S6V B;  3VYI A;  2FWL A;  2RMZ A;  2KK7 A;  3RL0 D;  3PJS K;  4CPG A;  4FA1 A;  1L9B C;  4RO0 A;  1CIF A;  1NTZ G;  2CPB A;  2A06 G;  2FFD A;  1CHH A;  2GA1 A;  3MZW B;  1WT6 A;  2R3C A;  2Y9Z A;  3QWO C;  4DJG A;  1AFO A;  3B5N A;  5CBO A;  3L72 G;  2Z4E A;  1P84 I;  1Q7Y Q;  2YKQ A;  1ZXG A;  2E42 A;  1KB9 E;  4C7N A;  3S9O A;  1DEE G;  5C9M A;  5AW3 B;  3TYY A;  3D6Y A;  2A45 H;  3RL0 B;  5AW8 B;  5APU A;  4EIF A;  4BRY B;  4HB1 A;  5H2F E;  5C39 A;  3H1I D;  1RF0 C;  2Q9I A;  1NOH A;  1HGZ A;  2AXC A;  2KB7 P;  1NAY A;  3L71 D;  2DGE A;  1OWA A;  3T97 A;  3HQ8 A;  1SQQ E;  1S9K E;  1PP9 D;  1FOS E;  2O01 H;  5GTI V;  3RK3 D;  1T2K D;  2C1D B;  1Q81 Q;  2WT7 A;  1WVE C;  1CI6 A;  1RF0 A;  2YO3 A;  2XZR A;  3CI9 A;  1GDV A;  451C A;  2KS1 B;  3TGU J;  1BCC E;  1SQP J;  4Y99 B;  1NU1 E;  2KUB A;  3ZOW A;  1N7S D;  3CCV P;  2FYZ A;  1YTZ T;  1CW5 A;  5B66 H;  3DMI A;  1HTL C;  3A0B H;  1IZL 0;  1NTZ J;  2HPC A;  1I5T A;  3H1K D;  4I6M C;  2H88 C;  2O01 N;  3K5B A;  3L72 J;  3PXS A;  2M5A A;  5KLV G;  4YPC A;  1W2B O;  3L73 D;  1RF1 B;  2GC4 D;  5APS A;  1N7S B;  3RL0 g;  2IFN A;  3HUS B;  3MD0 A;  2E74 D;  1P84 E;  1HH0 A;  2Q5U A;  4Z1M H;  3CCE P;  1DD4 A;  2E43 A;  1CYC A;  4GOF A;  1KYO D;  4XE5 B;  2FYN B;  1W2L A;  3VP8 A;  2Q3I A;  1LNQ A;  1ZV8 A;  3FX0 A;  1KC8 Q;  3Q1M A;  5AW9 B;  3VRD A;  1QEX A;  2JWA A;  1U74 B;  1WEJ F;  2VRS A;  2E74 B;  1AQT A;  5EXQ A;  1Y8A A;  1CYI A;  4WQ9 A;  1SFC D;  3MGN A;  3SWY A;  1QL4 A;  1T3J A;  1N73 C;  3AE2 C;  2XDJ A;  1QVG O;  2GC7 D;  4P4Q B;  4PWA A;  1LT1 A;  4RES B;  4ZNC A;  3M0A A;  4WQC A;  3MK7 C;  1OW6 A;  3BAT A;  4QAO A;  1IC2 A;  2Y0E A;  1J1D C;  3A7O A;  1KQL A;  1LWU B;  1KIL E;  1SFC B;  1NTK D;  1DW2 A;  3IN6 A;  4WQD A;  1N73 A;  1AVO A;  1NWQ A;  3CL3 D;  5CYT R;  3Q5R A;  1PPJ D;  5TIS V;  5KLI C;  5KLV J;  4PD4 I;  1VPC A;  2AEF A;  1YBK A;  1CTY A;  3FWN A;  2V4H A;  3VYM A;  3U59 A;  1E79 H;  4LLH A;  1U7J A;  2R5D A;  1KMI Z;  3TSI A;  4LGD E;  3AE6 C;  4K3I A;  2BCC E;  2SPZ A;  1JTH A;  3PRJ A;  2WPR A;  1T3U A;  1Q90 D;  3BRT B;  3H1I G;  1C75 A;  2BH4 X;  2FBW C;  4YXW H;  2FYU D;  1BE3 D;  2NPS C;  3WFE C;  3CX5 W;  2CK3 H;  3CLQ A;  3OA8 B;  4IFM A;  1KZU B;  5APV A;  1UIX A;  1SQV D;  2OZ1 A;  3WUV A;  2A45 G;  3W67 A;  5IY5 1;  1GKS A;  1KV4 A;  1NVO A;  1GMJ A;  2WZ7 A;  5KAI E;  3CC7 P;  2KI7 B;  3V4Q A;  3FXD A;  1MG2 D;  3WFC C;  1JMB A;  4AX3 A;  1EDJ A;  1SQB G;  2NPS A;  1E2R A;  1KV9 A;  2N1T B;  1H0T A;  2G3A A;  1JDL A;  1R0Q A;  1K73 Q;  3EQ2 A;  1ZRT D;  2RH0 A;  4H0J A;  3E7K A;  3HE4 A;  3HE5 B;  3LW5 J;  3WUI A;  1A02 J;  5KAF V;  1JY2 N;  3I55 P;  2WSE H;  2C9X B;  5AVS B;  2J59 M;  2KNC A;  2E5T A;  2KZI A;  4R4M A;  5E79 V;  3NTN A;  2BCN B;  1ZP0 C;  3JSV C;  2RN0 A;  1IRW A;  2AIU A;  1PGQ A;  1L4A D;  1SQP K;  2QM8 A;  2MJZ A;  4NPD A;  3NBS A;  5CIB B;  1VF5 D;  2D0W A;  3A5T A;  3LIE A;  3AEG C;  4PD4 E;  1HH7 A;  2XU6 A;  1NTZ K;  3P8C E;  3G3Z A;  1A2S A;  3H1I J;  3JCU E;  2QJY B;  2KOG A;  1S5L E;  4JYB A;  3PLN A;  4U3F G;  2W6B A;  3SJL A;  3GF7 A;  1N86 A;  3GHG B;  4KT0 J;  1DH3 A;  3M91 A;  1RH5 B;  1L4A B;  3H25 A;  4WWI A;  3RBX A;  3BCC E;  1PP9 J;  4BRY A;  1X9V A;  3A0H H;  4C7R A;  3H32 B;  1LFM A;  1URQ C;  3G6E P;  1C2N A;  3NMD A;  4LJI A;  1RAQ A;  5AW1 B;  2QJK C;  1SQB J;  2PRR A;  4EYY Q;  4FAN A;  3HQ9 A;  1RQU A;  1L9J C;  2QSI A;  3CXH H;  5APY A;  1S2E A;  1T2K C;  1GQ1 A;  1DIP A;  5AW7 B;  2XV5 A;  1MUU A;  2YMY A;  3M9B A;  1JCC A;  2C0W A;  1URQ A;  3OA7 A;  2W90 A;  1SQX D;  2XKM A;  4DCK A;  1RE3 C;  2JR8 A;  1EZV D;  1AJY A;  3A2A A;  1RF1 C;  3KZI V;  1N7S C;  1IFP A;  3L73 J;  3HUS C;  3M06 A;  2HOD B;  3GF3 A;  1PZQ A;  1YIC A;  5C0Z A;  3TGU E;  1COR A;  1M70 A;  1L0L G;  1LJ2 A;  1SQP E;  5AVU B;  2A06 D;  2FYN C;  1FZB A;  5DJQ B;  4XYD B;  3L72 D;  4U3F J;  1NTZ E;  1H32 B;  1OFC X;  3AE8 C;  4EDF A;  1FOS F;  2FYU G;  2W83 C;  1BE3 G;  5KLV K;  1DVH A;  1N7S A;  3SWK A;  3HUS A;  3RMZ A;  3GW6 A;  3AE1 C;  5CJ0 A;  4H0L D;  1FOC A;  2YIU B;  1HJ3 A;  1E8E A;  4H13 D;  1ZR2 A;  2Z5H A;  1YEB A;  1E5W A;  3TYI A;  1R5L A;  3WU2 V;  1COT A;  2B12 B;  2AXT E;  3VTP C;  4N78 D;  2CE0 A;  1Z56 A;  1L0N G;  1ZN5 A;  2JO1 A;  2C1U A;  3AE7 C;  1NNO A;  3IF4 A;  2ZT9 D;  1RAP A;  1LWU C;  4H0L B;  1KN7 A;  4H13 B;  1H33 B;  3WC8 A;  3O6Q B;  1R5S A;  2XNX A;  1Q2N A;  1NH4 A;  1NML A;  3V2N A;  1CRH A;  4IL6 H;  2XTS B;  4QMA A;  2I8D A;  4JF7 A;  4WQ8 A;  2OYH B;  3CCU P;  1H89 A;  2UWJ E;  3R2P A;  3PH2 B;  2ZT9 B;  2KLU A;  3CWB G;  4N3Y B;  3TNU B;  3B8E B;  2NZ2 A;  1LWU A;  1IFN A;  1L0L J;  4M3L A;  4L3H A;  5M1B A;  1HJ4 A;  3S4R A;  2ZAE B;  1NTM E;  1YIT P;  1YJ9 P;  1YEA A;  3G9R A;  3WFB C;  2CA4 B;  1BDD A;  2OYI B;  3EFG A;  1VQN P;  4I7Z B;  2FYU J;  1BE3 J;  5AW6 B;  2K9J B;  1KIL A;  2Q7C A;  1AQ5 A;  1A8C A;  2AEM A;  2BAS A;  2Y9Y A;  1LTG C;  5GTH E;  5KLV E;  4H44 D;  1SQV J;  2CE1 A;  2B11 B;  4KJM A;  1M1K Q;  4UB8 H;  1X22 A;  3EFF K;  1LP1 A;  2N18 C;  2IDB A;  1SP4 A;  1H9Y A;  1BGY G;  1LT9 A;  3CP5 A;  4AYC A;  2N1T C;  1L2P A;  3CCQ P;  155C A;  2HYN A;  5CIH B;  1L0N J;  1G1J A;  4UB6 E;  3RBZ A;  1HF9 A;  2BEQ D;  4H44 B;  2P2U A;  5B66 V;  3A0B V;  3G4S P;  2E75 B;  3L70 D;  3CX5 H;  3V6I A;  1DEB A;  1M8O B;  4PJ0 H;  1M60 A;  3MTU E;  1OXZ A;  2N1T A;  2FXM A;  2YKO A;  2JP3 A;  4RKU J;  5KKZ B;  1SQB K;  1N15 A;  3HD7 A;  2CXB A;  3CWB J;  3HE5 A;  1RQV A;  5CMZ A;  4B86 A;  2QJY C;  3A3Y B;  3GHG C;  1KB9 H;  2HLO A;  5CJ4 A;  3P32 A;  2R3S A;  3ZDM A;  2Q1K A;  4EIC A;  3CCL P;  1IO3 A;  5H2F H;  3Q5P A;  3HQ7 A;  4YTP C;  2PP6 A;  1FBM A;  1MG3 D;  1KYO I;  1Q82 Q;  1NYH A;  5CCG D;  4TLF A;  3N4X A;  1EXI A;  2HV4 A;  1CXA A;  2YKP A;  3CXH W;  3KXD A;  4A7P A;  3H1I E;  3CU4 A;  3OCD B;  2N3B A;  2LIT A;  3L71 E;  1YFC A;  1VQ5 P;  2HG5 D;  1AOQ A;  3H1H G;  4JQ0 D;  2R32 A;  3A9F A;  1YQ3 C;  1QYZ A;  2QEX P;  3ABV C;  4L75 A;  1VQ6 P;  1PP9 E;  3LID A;  1SQQ D;  3HTK A;  3H1L G;  3RN0 A;  3AE9 C;  1DT1 A;  1SQX J;  1T8Z A;  1YJW P;  3UIA A;  1SQB D;  2WPQ A;  1DD3 A;  3VMY A;  3C9I A;  2B9B A;  3SWF A;  2BEZ F;  4LC1 A;  2B10 B;  1M57 D;  3V2Q A;  1PV3 A;  3M0D C;  3D6Z A;  1X0T A;  5DJQ C;  3RK3 B;  5KTB A;  4OGQ C;  1GK4 A;  2BLF B;  1I6D A;  3CCJ P;  1NTK K;  2KIK A;  1HUC A;  3H6P A;  5APQ A;  2V7Q H;  3U1C A;  1WMK A;  3H1K E;  3OJA B;  2HOD A;  1HWT C;  1FZE A;  1P84 H;  2C9L Y;  1LTJ B;  2YIU C;  1IFM A;  3OW2 O;  2O1K A;  2VHD A;  2FY8 A;  1OW7 A;  3M0D A;  3L73 E;  2OTJ P;  2KSJ A;  3CC2 P;  1L0L K;  3CYT I;  2P67 A;  1X79 B;  2N9B A;  2GUS A;  1I8O A;  1HZU A;  1FZC B;  4DY9 A;  1OVR A;  4U3F D;  4AAN A;  2E76 C;  3M97 X;  1KYO E;  1M1J B;  2K1A A;  2FYU K;  4H0L C;  4H13 C;  5B5E E;  1K9M Q;  2B87 A;  3O20 A;  3H1H J;  2CPS A;  1BSH A;  1SQV K;  3Q3D A;  1PFI A;  3H1J D;  4OVN F;  1N7L A;  1JB0 J;  1DX7 A;  1FZA A;  3L70 G;  1HCM A;  2KSE A;  3IAO A;  3WUU A;  2OYH C;  2R44 A;  2ZT9 C;  2K3R A;  1JY3 P;  1VQL P;  1NGM B;  3JC2 2;  3O6Q A;  5AVQ B;  4RJT A;  1E29 A;  2O1J A;  1KFM A;  1PL5 A;  3AEE C;  3KDP B;  4ASW A;  1X8Y A;  4D6T G;  1YQ4 C;  1QL2 A;  1NIR A;  4I7Z C;  5AVY B;  1GU4 A;  2OYH A;  2ZON G;  3L75 D;  1NTK E;  2OTK E;  1FCD C;  1I54 A;  1QL1 A;  1PPJ E;  1FZF A;  2ZFC A;  1FDI A;  3A0H V;  1IRV A;  1L0L D;  3CD6 P;  4L1Q A;  1FI7 A;  2N9Y B;  4OWF A;  4ZKU A;  1LS9 A;  5CCH D;  2ZVO B;  3DP5 A;  1ZME C;  3RGU A;  5BVZ A;  4W7Z A;  1CRI A;  1NO4 A;  5GTI E;  3WMM 0;  1CRC A;  1RHZ B;  5BU5 A;  1DIQ C;  2KP8 A;  4AUW A;  2BCC D;  2WWW A;  4FB1 A;  3L35 A;  3EWK A;  3SVW A;  2E75 C;  5KAI H;  4KMG A;  2FYU E;  1BE3 E;  2E5Y A;  1QVF O;  4EOT A;  3DR0 A;  1SQV E;  2QJP C;  3L70 J;  4EIJ A;  2KLV A;  2I8F A;  1SQQ G;  1CRG A;  3F89 A;  4WVZ A;  3R4Y A;  5KKZ C;  3RLM A;  1OCD A;  2IFM A;  1L0N D;  3ORV A;  1I8P A;  3KQG A;  1CRJ A;  3KPE A;  2B0Z B;  4JYC A;  1EZV I;  1LC1 A;  2IBZ I;  1ZRT E;  2WSF H;  1NU1 G;  4WQA A;  3B5N D;  2GB8 B;  1JOC A;  4AAM A;  1LC2 A;  2POH A;  1SQX K;  1GU5 A;  3RL0 C;  4PD4 H;  3CWB D;  4WQE A;  3JCU H;  2YNY A;  5CIF B;  1S5L H;  3CPW O;  2ZYD A;  1C6R A;  1OZH A;  2V07 A;  3B5N B;  2JQR A;  1ZLL A;  3HRN A;  1N50 A;  4O9B A;  1HJ5 A;  2ZXX A;  4WY4 D;  2IYP A;  2D0S A;  2WTY A;  4BWN A;  4FA4 A;  1J2J B;  1GU2 A;  2Y0C A;  3P8C D;  1YIJ P;  3NBT A;  2DVH A;  3AE4 C;  4NPE A;  3AED C;  1I6E A;  2C2C A;  1OVU A;  4AQR D;  1VF5 B;  3H1J G;  1CXC A;  2FRC A;  1SQQ J;  1BGY D;  4IL6 V;  1H31 B;  2QA4 P;  3Q2Y A;  4WY4 B;  4Y99 C;  1CSB A;  1S5L X;  3T97 B;  1SLQ A;  5TIS E;  2C1V A;  2O01 J;  3RK3 C;  1HBW A;  1JUN A;  2C1D A;  2PAC A;  2YXR B;  3M9Q A;  1ZOY C;  2WT7 B;  1PIX A;  1CI6 B;  4MU8 A;  2P1J A;  2IYO A;  1USD A;  4WB4 A;  2ITA A;  1EXJ A;  1K3H A;  2KS1 A;  1CZQ A;  4XA4 A;  3L75 G; 
#chains in the Genus database with same CATH homology
 2N18 C;  3SXT A;  1H9Y A;  1KYO W;  3ZOW A;  1DII C;  3CP5 A;  3CXH D;  4UB8 V;  4O1Q A;  3DMI A;  1AOF A;  1FI9 A;  4H0K A;  1IZL 0;  155C A;  1I5T A;  3NWV A;  5CIH B;  3H1K D;  4FA9 A;  2ZXY A;  2BH5 X;  5B66 V;  3PXS A;  3A0B V;  3L73 D;  2YQB A;  3L70 D;  3GG2 A;  1I55 A;  4NFG B;  2CA3 B;  1CSX A;  2GC4 D;  2N18 B;  1ETP A;  1HRO A;  4RSZ A;  3ZOY A;  1C7M A;  1M60 A;  1CHJ A;  4FA5 A;  3ITK A;  5KKZ B;  1A56 A;  5CIC B;  1N15 A;  2BGV X;  1CYC A;  3ZBM A;  2C8S A;  3TDK A;  2CXB A;  4O1W A;  1KYO D;  4PJ0 V;  2AI5 A;  2FYN B;  1W2L A;  2AXT V;  1KX7 A;  1GJQ A;  3X39 A;  1B7V A;  3VRD A;  1K3G A;  2JWA A;  2PCC B;  5CIE B;  3H1H D;  1U74 B;  1CSV A;  1WEJ F;  5EXQ A;  1CYI A;  4WQ9 A;  1IQC A;  1QL4 A;  4EIC A;  1IO3 A;  4PD4 D;  4V2K A;  4YE1 A;  3H1L D;  3HQ7 A;  2GC7 D;  4P4Q B;  4PWA A;  1MG3 D;  2EXV A;  4WQC A;  3MK7 C;  4QAO A;  5H2F V;  2HV4 A;  2Y0E A;  1CXA A;  3CXH W;  1AYG A;  3BCC D;  2ZBO A;  4FAV A;  4A7P A;  3CU4 A;  3OCD A;  1NTK D;  3OCD B;  3JBT B;  2O3J A;  1DW2 A;  2N3B A;  2LIT A;  4WQD A;  1YFC A;  1C6S A;  5CYT R;  1PPJ D;  1CTZ A;  1AOQ A;  5TIS V;  3A9F A;  1QYZ A;  1CTY A;  3ZOX A;  3VYM A;  1SQQ D;  1MZ4 A;  3RN0 A;  1DT1 A;  5GTH V;  2Y0D A;  3VMA A;  1H9X A;  3O5C A;  1SQB D;  4K3I A;  3PRJ A;  1NMI A;  1C2R A;  2B10 B;  1CCR A;  1C75 A;  2BH4 X;  1KIB A;  2FYU D;  1BE3 D;  3WFE C;  5KLI B;  3CX5 W;  1RZ6 A;  5DJQ C;  3OA8 A;  3OA8 B;  1CCH A;  1SQV D;  2BLF B;  2OZ1 A;  4UB6 V;  1I6D A;  5IY5 1;  2OZ1 B;  1GKS A;  2L91 A;  2QG4 A;  2IBZ D;  5DFS A;  3TGU D;  1SQP D;  1F1F A;  2VHD A;  1FHB A;  1KX2 A;  1HRC A;  1MG2 D;  5CID B;  1CSW A;  3WFC C;  4AX3 A;  1NTZ D;  2N3Y A;  1E2R A;  1KV9 A;  3PTZ A;  3CYT I;  1JDL A;  1R0Q A;  1N9C A;  1I8O A;  1HZU A;  4DY9 A;  1ZRT D;  4U3F D;  4AAN A;  1DW0 A;  4H0J A;  3M97 X;  1AKK A;  2B4Z A;  3CX5 D;  3WUI A;  1CSU A;  5KAF V;  3L74 D;  2BPB B;  2JTI B;  2C9X B;  5TJH A;  4D6T D;  4EID A;  1QN2 A;  1KB0 A;  1CED A;  2KNC B;  3O20 A;  4GYD A;  5E79 V;  1DVV A;  2BCN B;  3H1J D;  3L4O A;  2ORL A;  2RN0 A;  2MHM A;  1IRW A;  2AIU A;  1CRY A;  1HCM A;  3NBS A;  1CIG A;  3FWL A;  1ZZH A;  3WFD C;  2LIR A;  2ZOO A;  5CIB B;  2D0W A;  3O1Y A;  1HH7 A;  1QKS A;  1C6O A;  1A2S A;  1KB9 D;  2QJY B;  4WQB A;  1N90 A;  4Y5R A;  5DF5 A;  3PLN A;  4RJT A;  2PCB B;  2V08 A;  4JCG A;  1YIQ A;  1E29 A;  3SJL A;  1F1C A;  2YCC A;  1DW3 A;  4J20 A;  3SWS A;  3RN1 A;  1H1O A;  1NIR A;  2L4D A;  2ZON G;  3L75 D;  4AAO A;  1FCD C;  1I54 A;  1LFM A;  1LMS A;  1CO6 A;  1H31 A;  1OAE A;  3MK7 B;  1C2N A;  4LJI A;  1RAQ A;  1NTM D;  1HZV A;  3A0H V;  1IRV A;  1L0L D;  4L1Q A;  1FI7 A;  1YTC A;  2N9Y B;  2ZZS 1;  1LS9 A;  4FAN A;  3HQ9 A;  1W5C T;  3ZOO A;  1L9J C;  5AUR A;  3DP5 A;  351C A;  5KLV D;  1GQ1 A;  1CRI A;  1BL9 A;  1CRC A;  1DIQ C;  2BCC D;  1CTJ A;  4PW9 B;  4FB1 A;  1BCC D;  3SVW A;  4EIE A;  1SQX D;  1NU1 D;  4KMG A;  1FI3 A;  2Q3E A;  1EZV D;  1EB7 A;  2QJK B;  3KZI V;  4L3G A;  3DR0 A;  3KHU A;  1DW1 A;  4Q5P A;  1QL3 A;  5KAI V;  2I8F A;  1CRG A;  1YIC A;  1C52 A;  2MTA C;  3PXW A;  5C0Z A;  1COR A;  1M70 A;  3RLM A;  3PHL A;  1OCD A;  1GIW A;  2A06 D;  4WQ7 A;  1L0N D;  3C2C A;  3ORV A;  5DJQ B;  4XYD B;  1I8P A;  3L72 D;  1U75 B;  1H32 A;  2GIW A;  1H32 B;  1CRJ A;  3ZCF A;  4EDF A;  2N9J A;  2B0Z B;  3VNW A;  1DVH A;  1P84 D;  3RMZ A;  1LC1 A;  3GW6 A;  2QJP B;  3SLE A;  1CC5 A;  4WQA A;  2GB8 B;  1FOC A;  2YIU B;  5B5E V;  1HJ3 A;  4N0K A;  1E8E A;  4AAM A;  1LC2 A;  1YEB A;  3TYI A;  4GED B;  1S6V B;  3PXT A;  4XXL A;  2FWL A;  3WU2 V;  1COT A;  1CYJ A;  1VYD A;  2B12 B;  3CWB D;  4WQE A;  2RMZ A;  2YK3 A;  4FA1 A;  3ZIY A;  5CIF B;  1CIE A;  1L9B C;  1CIF A;  2CE0 A;  1C6R A;  1CHH A;  1CHI A;  2C1U A;  1NNO A;  1YCC A;  2V07 A;  1RAP A;  1H33 A;  1S5L V;  2JQR A;  1N50 A;  1H33 B;  3WC8 A;  1HJ5 A;  1CIH A;  2D0S A;  4FA4 A;  1GU2 A;  2Y0C A;  5C9M A;  1YNR A;  3NBT A;  2DVH A;  1NML A;  1CRH A;  2XTS B;  1I6E A;  2C2C A;  4EIF A;  5CIG B;  4WQ8 A;  3O0R C;  1CXC A;  1M6Z A;  2FRC A;  3TF5 A;  3H1I D;  3PH2 B;  1BGY D;  4IL6 V;  1J3S A;  3L71 D;  1H31 B;  2DGE A;  4L3H A;  1HJ4 A;  1RZ5 A;  3HQ8 A;  1PP9 D;  1YEA A;  3WFB C;  2CA4 B;  2C1V A;  5B6Q A;  2N9I A;  1CNO A;  3HQ6 A;  2K9J B;  5GTI V;  2C1D A;  2PAC A;  3L4M A;  1A8C A;  2C1D B;  1WVE C;  2CE1 A;  2B11 B;  1FJ0 A;  4MU8 A;  1GDV A;  1K3H A;  2KS1 A;  451C A;  4AAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...