2FYUE

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 44
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 2fyuE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2fyuE02
2GBXA 3BCCE 4HM2A 2XSHA 2HMOA 1PPJE 2B24A 4QUQA 4NBFD 4AIVA 1SQVE 5KLVE 2YFJA 1O7MA 2XRXA 5KKZC 1G8JB 1VM9A 3GOBA 1BE3E 1O7PA 2HMNA 4NBHD 1L0NE 4NBCD 4QDCA 4D6TE 1SQXE 3VCPA 4NB8D 1BGYE 3GTEA 2CKFA 2E75D 1NU1E 3H1JE 4OGQD 2B1XA 4PD4E 2NUMA 1RFSA 2QJPC 3VMHD 1G8KB 5BOKA 2D2CD 4H13D 1JM1A 2YVJB 2XSOA 3EQQA 3GTSA 4HKVA 3GL2A 2HMJA 1RIEA 1NTKE 3N0QA 4NBED 1KYOE 1O7GA 4HM5A 4NB9D 1O7HA 4HM0A 2JZAA 4HM8A 2Q3WA 3GZXA 2NWFA 2YFLA 4P1CH 3VMID 1ULJA 4PV1D 3GCEA 4P1BH 1ULIA 5AEWA 3DQYA 3H1LE 3CWBE 1NDOA 3GKEA 2BMOA 2NVEA 2IBZE 1ZRTE 3GL0A 2NUKA 2QJYC 1EZVE 3C0DA 3H1IE 3H1KE 4NBAD 2I7FA 4HM6A 4HJLA 4NBBD 2YIUC 5AEUA 3GZYA 2ZT9D 3CX5E 1BCCE 1SJGA 2YFIA 1FQTA 5CXMA 1PP9E 1KB9E 3EN1A 4QDDA 2FYUE 2NVFA 2DE7D 2E74D 3VCAA 2BCCE 3L75E 2HMKA 2E4QA 2A06E 1O7WA 1UUVA 3H1HE 3CXHE 3D89A 2FYNC 4H44D 4AAYB 3GB4A 4HM4A 1O7NA 4HM1A 2E76D 2GBWA 2HMMA 2QJKC 2E4PA 1NTZE 2DE5D 1SQBE 5HL4A 4H0LD 3TGUE 4NBDD 1L0LE 4QURA 1SQQE 2BMQA 5KLIC 1NYKA 4HM3A 4NBGD 3L71E 4QUPA 1Q90C 3L72E 2DE6D 2JO6A 4EMJB 2NVGA 1SQPE 4QDFB 1P84E 3VMGD 1NTME 4HM7A 1VF5D 3L73E 4U3FE 2QPZA 1UUWA 4QDFA 3L70E 2ZYLA 3L74E 2XR8A 3AZCA 1VCKA 1EG9A 2BMRA 1WQLA 2HMLA 4QCKA 3FOUA
chains in the Genus database with same CATH superfamily
4PJ0E 4IFDK 1BGYD 1SQXJ 3CCRP 4NBFD 1TU3F 1KB9H 1X8YA 2K37A 5KLVD 1WMKA 2IYPA 1L4AA 1GU4A 1OW6A 1VQNP 2R5DA 3W67A 4OGQD 3CCVP 1VQ5P 2B1XA 2XNXA 1LTIC 2FYUG 2R5BA 2FBWC 1YI2P 5AVXB 2C0WA 1N73A 5APUA 2M3EA 5GTIE 3OJAB 3LW5H 5CMZA 2NWFA 3A3YB 1HUCA 2IBZD 2QM7A 2XV5A 2POHA 1GL2C 1NTKJ 2OYOA 2OQQA 4ASWA 3U1AA 1CI6A 1NKNA 5AVSB 1D7MA 1T3UA 3P8MC 2FYUE 3E7KA 4WY4C 4WY4A 1MZ9A 1SQQJ 2W6AA 3P7KA 4DCKA 3BASA 4HM4A 3L36A 4NBDD 1YHQP 1RE4A 2HYNA 2KNCB 2BMQA 5KLIC 3VMAA 3BCCJ 2FKWB 1G2CA 4I1LA 3MIWA 3HUSC 1T6AA 3VP8A 2E76B 2M5AA 4QCKA 3L35A 4JPZB 5CJ0A 4DT0A 5B66H 1J1DC 2HPCA 1VQKP 2N1TA 1L0NJ 3AEEC 1KFMA 1Q86Q 3NMDA 4UB8H 4NBHD 4W80A 3U59A 4JYBA 4D6TD 4D6TG 3WU2E 5M1BA 2A45I 4QMAA 3HE5A 1Y8AA 3V4WA 2OYIC 2ZXXA 2WT7A 5AW8B 1HH0A 1O7GA 2JWAA 3D6YA 3H1LG 2KLUA 1LWUA 1ULJA 1SQPK 1GL2D 1ULIA 1YIJP 2OYHA 2ZT9C 4IL6H 2KNCA 2YIUC 2GA1A 1VF5C 1RE3C 1SQBG 1G2CB 3AE1C 2AXTH 1GK4A 1NTMK 1X9VA 2PAJA 5APQA 1FZGA 1HVVA 1L0NK 2KK7A 1GK6A 3L75E 2G8YA 3CCQP 5K5GB 3MGNA 1QGKB 4ZKPA 3CXHI 3L4FA 1NU1D 1GD2E 1J1DB 3IAOA 3TGUE 2B89A 4NPFX 1LTSC 2NVGA 1NTME 2YNYA 3FXEA 2W27A 1RH5B 1Q2NA 3RL0D 4PD4I 3TK1A 3FGAD 4R4LA 1O7MA 1QVGO 4EYYQ 1VM9A 4ZMDA 1BE3E 3T97B 4GOEA 2WPQA 4I2LC 3IN6A 4GOFA 1RF1C 3L70D 1BSHA 1EDKA 2WPSA 3E1IA 2KP8A 1KB9D 3CMAP 4BRYA 2E76C 4HM0A 2JZAA 1YTZT 1KTMA 3G71P 1QVFO 4M3LA 4WY4B 5AVUB 4P1CH 2HG5D 1USDA 1J1EB 2IZ0A 3H1LE 4ZKUA 1UIIA 1RF1A 3FXDA 3H1JJ 4HM6A 3TGUD 5AEUA 2WPVB 1RHZB 3TGUG 1SJGA 3TYYA 3H25A 5CXMA 3H1KJ 3CXHH 3VP9A 2C9LY 5B66E 1NGMB 2E4QA 3HD7C 2FYNC 1NVOA 1M90Q 1QL2A 3A5TA 3GLMA 4NBGD 3E1RA 3L71E 4AUWA 5E79H 1FZCC 3R2PA 2WSCJ 3IF4A 2JO6A 2Y0DA 1FOSF 1W5CE 4QDFB 1MFZA 3P8CD 3GG2A 1JY3P 2QPZA 1AQTA 1IFJA 1USEA 1EG9A 3I55P 3GF7A 5AVRB 1AFOA 1KORA 1YBKA 2MJZA 4W7ZA 3VN0A 2O01N 1KFNA 2FFDA 5APTA 4QDCA 3D70A 4H13C 2Q9IA 1RFSA 1IK9A 2O01H 1QEXA 3RK2C 2KUBA 2GM4A 3OW2O 1PGJA 4EI2A 3LIEA 1SQVG 4NB9D 1VL2A 2JWDA 1ZW0A 1JO5A 2IBZG 2A06D 1FBMA 3M91A 1VDFA 1NTZJ 3JSVC 3AE4C 1JY2O 3V2QA 1NU1J 3GHGC 2JR8A 3GZYA 2WSSH 1BCCE 3Q2YA 3KQGA 1NH4A 1PP9E 2BEZF 5TISH 2LKMA 1AQ5A 1X22A 5HL4A 4XE5B 1SQPJ 4KJMA 2R44A 3HTKB 1NYKA 2ITAA 1K8AQ 1IFPA 1NTZG 4IL6X 1P84E 3SSUA 1LTTC 4HYTB 2W8ZA 2KB7P 2AXCA 2HLOA 2Y9YA 3L70E 1KN7A 3BRTB 1WQLA 2HMLA 3CPWO 5KAFH 2Q7CA 3H1JG 1KYOH 1PPJE 4OGQB 5AVZB 1AVYA 3H1HJ 5AW6B 4D6TJ 3AE5C 2KZJA 1EDJA 3WUVA 3H1KG 1ZMEC 3HUSB 3L74G 3OAKA 1MUUA 2N9YB 2CKFA 5CCHA 4CPGA 2K1AA 1WRGA 3P8CE 2QJPC 1JB0J 1PZQA 3MUDC 2BEQD 1LT9A 3GTSA 3KXDA 2SPZA 3PJSK 4GKGA 2NPSB 4HJGH 2IX7C 1DEBA 1QL1A 3AEAC 3CXHD 1ZRTD 3PTZA 3VMXA 3I56P 2IBZE 2Y0EA 2FYUJ 2NUKA 3AE9C 3H1IE 3CX5D 4NBBD 3CCJP 3H1KD 2WPRA 4H44C 2KI7B 2QG4A 3H32A 3CC2P 3HRNA 2KZIA 2HMKA 1PP9D 3Q5PA 3L37A 4C46A 3GB4A 1LJ2A 4OGQC 1Q82Q 4QUPA 1UIXA 1L2PA 3NXSA 4N78E 3H1HG 4L75A 2NRGA 1RE3A 1ZLLA 4N3YB 1M1KQ 1KMIZ 2QJPB 1OVUA 1RY3A 3FX0A 1SLQA 3MP7B 3H1IG 4DJGA 1JOCA 1S5LX 3G4SP 1YJ9P 4NBCD 2J58A 1SQVJ 4IL6E 2D2CD 5GTIH 1RF0A 3N0QA 1NYHA 2GUVA 2J5UA 1HTLC 3HD7D 2YKPA 1DEEG 1N7SB 2V7QH 3L75D 3GCEA 4P1BH 2HODA 1AV1A 3RBZA 2AEMA 3GL0A 1R8EA 5KTBA 4EOTA 4TT3H 3AEBC 1SQQK 5APWA 1FS0E 1ZXGA 1S4XA 1EDIA 1LT1A 3L74J 3H1ID 1ZN5A 4W7YA 3EN1A 1SS1A 3TF5A 2BCCE 2B87A 1M8OB 4RESB 2ZYAA 1PL5A 4I7ZB 2RN0A 1BCCJ 4BWNA 1L0LK 2E76D 2K9YA 3Q3DA 3L70J 5AW4B 3V5BA 2Q1KA 1Q90C 4XA4A 4UB6H 1UUWA 4GT1A 1EC5A 2BMRA 4N6JA 3LIDA 1BGYJ 3EFFK 5KLVE 2LR2A 4UB6E 3GOBA 3HTKA 1CSBA 3WU2H 2I1KA 3EWKA 3M9HA 2D2CC 2OYHB 1HJBA 3SWKA 2KYVA 1ZOYC 1S9KE 1OXZA 3GL2A 5APVA 2WTYA 1RIEA 1L4AD 2K3RA 3M0DC 2Q3WA 2YMKA 4JYCA 3H32B 3RBXA 4ASVA 1AVOA 4A7PA 1JMBA 2CK3H 1H88A 3L73D 3BCCG 3GKEA 1JNMA 3L70G 1FZEA 1K73Q 2I7FA 4DOJA 2ZYDA 1LT9B 2QVAA 1MKMA 2ZT9D 3CX5E 5CCGA 3I5CA 3P32A 3GMAA 3FWLA 1KB9E 2KSJA 1KILA 2QJYB 3EQ2A 3A7OA 1UUVA 1BGYG 4H0LB 4H44D 3CX5H 2QA4P 1IZNB 4YTPC 4QURA 2YKOA 1YJNP 2FXPA 5KLVG 3U1CA 2YXRB 2MKVA 2FYUK 5CCGC 4IFMA 3RK3E 1SQBJ 2P2UA 2KLVA 1IFMA 1M57D 3TDKA 1NJIQ 1FJKA 4WWIA 1BE3J 4Y99C 3EFGA 2ZXEB 1KC8Q 5APSA 2K9JA 1RF0C 3HE4B 5B5EE 1EZVG 2P58A 1GTWA 1JCCA 2JEEA 2H8PD 3VMHD 2P10A 2JP3A 4WY4D 5CBNA 4NBED 4I7ZC 4HH2A 1KILB 1Q81Q 2WVRA 2P7JA 4N78D 5AW9B 2J59M 1J2JB 1NTKG 3C0DA 4YXDC 1R5LA 3CD6P 2OYIB 2WSCH 3AEGC 5AVYB 5CBOA 5CCHD 5H2FE 2G3AA 1FQTA 2WQYC 3MD0A 2B9BA 2KS1B 1NWQA 2KXPB 3F89A 2IDBA 2ZJSE 2FFDC 3RL0g 3ABVC 2HODB 1SQXG 1O7NA 5H2FH 2E4PA 1NTZE 1AJYA 1PPJG 3S9OA 1NAYA 1CW5A 3CI9A 2Z5HA 3N4XA 5E79E 5AVVB 2IZ1A 3TSIA 3RK2B 2GBXA 2WSFJ 1M56D 4GIFA 1NU1G 1OIPA 2R3CA 5KLIB 3L72G 1NO4A 2XU6A 3CCSP 3L72D 1LTJA 3V6IA 1LTJC 5BU8B 1L0LG 5DJTB 1OW7A 4H0LC 1JY2N 2I8DA 1PIXA 1L0LD 1L0NE 1SQXE 1FDIA 3GTEA 1S3JA 1S72P 3MZWB 1PGOA 1K04A 3JC22 3RL0C 4NPDA 4H13D 1HBWA 2YVJB 3GHGB 1SFCB 4Z1MH 1KYOI 1NTZK 1NTKE 2UWJE 1LWUB 1FDMA 3CLQA 5KKZB 1SQBD 3B4SA 1PGPA 1OVVA 2WSEH 1MV8A 3L75G 2I1JA 1OX3A 4PV1D 3R4YA 2Z5IA 1LNQA 2N1TD 5GTHE 2BCCD 3SWYA 3V2PA 2IFNA 3G9RA 2M5AB 1ZRTE 2NPSC 1OZHA 2XNDH 2C0XA 3B5NB 1EDLA 3L75J 2LXCB 1CZQA 1T8ZA 1LTGC 3H1LD 2H89C 2E74D 1BDDA 3VOPA 1HGVA 1PGQA 2PRRA 1BCCG 1KQGB 3HE5B 3O6QB 1IJDB 2WT7B 1S9KD 3L72E 5AW3B 3Q1MA 1U7JA 3CWBG 4U3FE 3CCUP 3CCMP 3AZCA 4RKUJ 1QX8A 1BE3D 1CI6B 1YTZI 1SQVE 2OGUA 2YXQB 5L8RJ 2M0BA 5KKZC 1LWUC 3MTUE 1VQ4P 2QE7H 4JF7A 3KZIE 3PRJA 1EXIA 3KYQA 3HUSA 3V4QA 1U57A 1KZUB 3H1HD 1L0NG 1NTMD 5BOKA 2KOGA 2AEJA 2QIWA 2OYIA 4MN4C 1KV4A 1EZVI 1M1JB 1SQVK 3M0AA 1DIPA 1URQD 1A02J 4HM8A 4YXWH 3K5BA 1DD4A 3M06A 2FXMA 5AEWA 1FZCB 3IR9A 1SQPD 4HKZH 2FYUD 4L76A 3H1KE 1BE3G 4HJLA 2XDJA 1LTBC 3O8ZA 1KILD 2DE7D 3M9QA 3A2AA 4HM1A 2XKMA 2PFXA 5KJ7D 3VTPC 3VMGD 1VQ7P 4HM7A 1VF5D 1NOHA 3L71J 2CPSA 5AW1B 4GDOA 2ZYLA 2AEFA 3FOUA 2IFMA 2HMOA 2JJLA 1GW4A 2WSEJ 1SQVD 2E75C 1N7LA 2N1TB 1Q90D 5KAFE 3NFQA 1R5SA 1YQ4C 1X0TA 3B5ND 3H1JE 2NUMA 2PP6A 3B8EB 3A0HE 4HKVA 4OH8B 3NTNA 1RE4C 1DD3A 4OWFA 1GL2A 1MFTA 1JTHB 1LTJB 2OTLP 3L74D 3Q5RA 1LP1A 3CMEP 1HF9A 1FJPA 2XZRA 3DQYA 2CPBA 4WBAA 5AW2B 3O6QA 5APXA 1K9MQ 1AA0A 4AQRD 1LGHB 4BXLA 2E5YA 1ZR4A 5CCHC 2RH0A 3G6EP 1HGZA 1OVRA 3VCAA 2HFED 3TGUJ 1IO4A 1VPCA 2LXBA 4U7JA 3H1JD 2QJKC 4BRYB 1BSNA 3B5NA 2WWWA 4LGDE 1SQPE 2E43A 3ZDMA 2JDIH 4HB1A 3A0BE 4LC1A 2XR8A 1VCKA 3AECC 2XSHA 1S2EA 1M1JA 2L5GB 2XRXA 3CX5I 4PV1C 1M7LA 4C7NB 1VQOP 1WT6A 2HMNA 1OW8A 3VCPA 1VQ9P 2E75D 2WZ7A 2KSEA 1SFCD 4DZOA 2PGDA 2WMMA 1ZV8A 1H89A 2XSOA 3LW5J 4O9BA 2HMJA 2NPSA 1PP9J 1KILE 1XTGB 2BASA 3TNUB 4KHXA 2ZVNB 1SQXK 2L91A 3PHLA 5DJUB 1L4AB 5AVWB 4U3FD 1XTCC 5AVQB 3CWBE 4U3FG 3WUUA 2HR3A 3VMZA 1ZP0C 3H6PA 2QJKB 1JY3N 4NBAD 5BVZA 4IOIH 2FFDB 1NTKK 2ZFCA 1OMIA 3D6ZA 1URQA 4K3AA 2KIKA 4LLHA 2YO3A 4YPCA 2A06E 3D89A 2R3SA 1N73B 1EXJA 2V4HA 1SQQE 4U3FJ 4C7NA 3USSA 1GMJA 4L73A 1JM0A 3MUDA 4QDFA 4H13B 2ZYGA 1SQPG 2ZAEB 2E5TA 4HM2A 4WB4A 3CCEP 5TISE 3KPEA 5B5EH 2B24A 1X79B 4QUQA 3KDPB 3RK3B 4UB8E 1KQFB 3WUTA 2E74B 3TNUA 2FYNB 5KAIE 2W83C 3PP5A 2A06G 3IFMA 1LP1B 2K9JB 4KT0J 4ZNCA 4NB8D 3RK3C 3F5HA 2YKQA 1L0ND 1NTMG 1T2KC 1Q7YQ 1GZLA 1YQ3C 1S1CX 2Q3EA 1KYOE 4HM5A 3AE2C 3GZXA 1KQSO 4JQ0D 4GODA 3A0HH 2FY8A 1P84H 5BU5A 1YITP 4L74A 2IPPA 1NDOA 2WSFH 2H7HA 1EZVE 1M1JC 3AE7C 2HPCB 4PJ0H 1NTZD 3OA7A 2RMZA 1SVFA 2YFIA 1N7SC 2B87B 1GL2B 2O01J 2NPSD 1VQ8P 4B86A 2QEXP 2JO1A 2KS1A 1VQPP 2N1TC 2BCCG 2HMMA 1P84I 1PFIA 1SFCA 1NTMJ 2O1JA 5TJHA 2DE5D 4H0LD 1L0LE 2Y9ZA 2WITA 1VF5B 2YMYA 2YIUB 5APYA 3CC7P 3CC4P 2OARA 1JEKA 1N7SA 3KHUA 2GUSA 2A45H 4RO0A 1KB9I 3W68A 3GW6A 1A02F 3GHGA 2M8RA 2FYZA 1FOSE 3RK2D 2YFJA 2W90A 1P84D 3QH9A 4RJTA 3UIAA 2B88A 3QWOC 1E79H 1YJWP 3SFDC 4I6MC 1H8AA 2W6JH 1W2EA 3L73G 1H0TB 4PD4E 4C7RA 1HWTC 1G1IA 3HD7B 4PV1B 1VQLP 1URQB 2M3BA 1N8RQ 3S1KA 2N9BA 1E5WA 1RF1B 1N73C 5AW0B 4XFJA 3C9IA 3SWFA 1OFCX 1FZFA 2BCCJ 2P67A 3VMYA 2OTJP 4OVNF 2NZ2A 2IBZI 3RL0B 3CWBJ 3PH0A 3GF3A 2QRXA 1YYCA 1J1EC 1JUNA 2ZT9B 3CXHE 2H88C 1DH3A 3N7NA 3B71A 2C9NY 3M9BA 5KLVK 1FE6A 5KAIH 2RKLA 4HM3A 2P1JA 4EMJB 1FZBA 1L0LJ 1FZAA 3L73E 1NHLA 5KLVJ 3B5NC 1FDOA 1NKZB 3S4RA 3L74E 3FWNA 1U7MA 1RQVA 1T2KD 2H43A 1SQXD 2YO2A 3HE4A 4H44B 3RK3D 1T3JA 2E42A 1KD1Q 1G8JB 2IYOA 3L71D 1GU5A 2QSIA 2W6BA 1BGYE 3AEFC 1GDTA 1W2BO 3KZIH 4Y99B 1JMMA 1G8KB 1GW3A 3BVHA 1IK7A 1N86A 1HJ0A 1JY2P 4IFFA 2O1KA 3M0DA 2YFLA 3C1LA 5KJ7C 1PP9G 3RGUA 3V2NA 2BMOA 2NVEA 2QJYC 1FZCA 1N2DC 1Z56A 1PV3A 1SFCC 3H1LJ 3L71G 2Z4EA 1NU1K 1L4AC 4QDDA 2NVFA 1KILC 3WMM0 1O7WA 2JKVA 3G3ZA 1ZR2A 2GBWA 2O3JA 1DX7A 3C8VA 1QLED 1SQBE 1KYOD 1NTKD 2V7QJ 1IFIA 1N7SD 3JCUH 3AEDC 3AE8C 1NAFA 2E75B 4PD4H 2Y0CA 5AW5B 1H0TA 1KQLA 1JY3O 3V2RA 2D2CB 1SP4A 1IFDA 3BCCE 1VQ6P 1FC2C 1IC2A 1Y47A 3D71A 3Q5SA 3JCUE 2OTKE 4AIVA 1SQBK 1URQC 1O7PA 1PPJD 4PD4D 4Y28J 4D6TE 5CJ4A 1OWAA 3CCLP 1IFNA 3BCCD 1EQ7A 1NU1E 3CL3D 1JM1A 3EQQA 3AE6C 1LT9C 2AXTE 3AE3C 4JBZA 1SQQD 1Y9BA 2E74C 1FAVA 2ZVOB 4NPEA 4EIJA 1O7HA 2R32A 1G1JA 1BDCA 2Q5UA 3VMID 1K05A 5EFWB 2DW3A 1JTHA 5C39A 3BRVB 2Q3IA 2VRSA 5AVTB 1VQMP 1BCCD 3MHVA 2Q6QA 4WVZA 3L73J 3II6A 3VYIA 1S5LE 2OYHC 1JCDA 3HD7A 3H1IJ 3CWBD 5KJ7A 4EDFA 1RQUA 4TLFA 2QM8A 2FXOA 3PLNA 3H1HE 4AYCA 1LTAC 1FU1A 4AAYB 4K35A 1S5LH 3ITKA 2A45G 2K88A 3T97A 1EZVD 1SQQG 3A0BH 3SFEC 5CHXA 2DE6D 5GTHH 5AW7B 5CCGD 3BATA 3L72J 4R4MA
chains in the Genus database with same CATH topology
2GBXA 3BCCE 4HM2A 2XSHA 2HMOA 1PPJE 2B24A 4QUQA 4NBFD 4AIVA 1SQVE 5KLVE 2YFJA 1O7MA 2XRXA 5KKZC 1G8JB 1VM9A 3GOBA 1BE3E 1O7PA 2HMNA 4NBHD 1L0NE 4NBCD 4QDCA 4D6TE 1SQXE 3VCPA 4NB8D 1BGYE 3GTEA 2CKFA 2E75D 1NU1E 3H1JE 4OGQD 2B1XA 4PD4E 2NUMA 1RFSA 2QJPC 3VMHD 1G8KB 5BOKA 2D2CD 4H13D 1JM1A 2YVJB 2XSOA 3EQQA 3GTSA 4HKVA 3GL2A 2HMJA 1RIEA 1NTKE 3N0QA 4NBED 1KYOE 1O7GA 4HM5A 4NB9D 1O7HA 4HM0A 2JZAA 4HM8A 2Q3WA 3GZXA 2NWFA 2YFLA 4P1CH 3VMID 1ULJA 4PV1D 3GCEA 4P1BH 1ULIA 5AEWA 3DQYA 3H1LE 3CWBE 1NDOA 3GKEA 2BMOA 2NVEA 2IBZE 1ZRTE 3GL0A 2NUKA 2QJYC 1EZVE 3C0DA 3H1IE 3H1KE 4NBAD 2I7FA 4HM6A 4HJLA 4NBBD 2YIUC 5AEUA 3GZYA 2ZT9D 3CX5E 1BCCE 1SJGA 2YFIA 1FQTA 5CXMA 1PP9E 1KB9E 3EN1A 4QDDA 2FYUE 2NVFA 2DE7D 2E74D 3VCAA 2BCCE 3L75E 2HMKA 2E4QA 2A06E 1O7WA 1UUVA 3H1HE 3CXHE 3D89A 2FYNC 4H44D 4AAYB 3GB4A 4HM4A 1O7NA 4HM1A 2E76D 2GBWA 2HMMA 2QJKC 2E4PA 1NTZE 2DE5D 1SQBE 5HL4A 4H0LD 3TGUE 4NBDD 1L0LE 4QURA 1SQQE 2BMQA 5KLIC 1NYKA 4HM3A 4NBGD 3L71E 4QUPA 1Q90C 3L72E 2DE6D 2JO6A 4EMJB 2NVGA 1SQPE 4QDFB 1P84E 3VMGD 1NTME 4HM7A 1VF5D 3L73E 4U3FE 2QPZA 1UUWA 4QDFA 3L70E 2ZYLA 3L74E 2XR8A 3AZCA 1VCKA 1EG9A 2BMRA 1WQLA 2HMLA 4QCKA 3FOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBX A;  3BCC E;  4HM2 A;  2XSH A;  2HMO A;  1PPJ E;  2B24 A;  4QUQ A;  4NBF D;  4AIV A;  1SQV E;  5KLV E;  2YFJ A;  1O7M A;  2XRX A;  5KKZ C;  1G8J B;  1VM9 A;  3GOB A;  1BE3 E;  1O7P A;  2HMN A;  4NBH D;  1L0N E;  4NBC D;  4QDC A;  4D6T E;  1SQX E;  3VCP A;  4NB8 D;  1BGY E;  3GTE A;  2CKF A;  2E75 D;  1NU1 E;  3H1J E;  4OGQ D;  2B1X A;  4PD4 E;  2NUM A;  1RFS A;  2QJP C;  3VMH D;  1G8K B;  5BOK A;  2D2C D;  4H13 D;  1JM1 A;  2YVJ B;  2XSO A;  3EQQ A;  3GTS A;  4HKV A;  3GL2 A;  2HMJ A;  1RIE A;  1NTK E;  3N0Q A;  4NBE D;  1KYO E;  1O7G A;  4HM5 A;  4NB9 D;  1O7H A;  4HM0 A;  2JZA A;  4HM8 A;  2Q3W A;  3GZX A;  2NWF A;  2YFL A;  4P1C H;  3VMI D;  1ULJ A;  4PV1 D;  3GCE A;  4P1B H;  1ULI A;  5AEW A;  3DQY A;  3H1L E;  3CWB E;  1NDO A;  3GKE A;  2BMO A;  2NVE A;  2IBZ E;  1ZRT E;  3GL0 A;  2NUK A;  2QJY C;  1EZV E;  3C0D A;  3H1I E;  3H1K E;  4NBA D;  2I7F A;  4HM6 A;  4HJL A;  4NBB D;  2YIU C;  5AEU A;  3GZY A;  2ZT9 D;  3CX5 E;  1BCC E;  1SJG A;  2YFI A;  1FQT A;  5CXM A;  1PP9 E;  1KB9 E;  3EN1 A;  4QDD A;  2FYU E;  2NVF A;  2DE7 D;  2E74 D;  3VCA A;  2BCC E;  3L75 E;  2HMK A;  2E4Q A;  2A06 E;  1O7W A;  1UUV A;  3H1H E;  3CXH E;  3D89 A;  2FYN C;  4H44 D;  4AAY B;  3GB4 A;  4HM4 A;  1O7N A;  4HM1 A;  2E76 D;  2GBW A;  2HMM A;  2QJK C;  2E4P A;  1NTZ E;  2DE5 D;  1SQB E;  5HL4 A;  4H0L D;  3TGU E;  4NBD D;  1L0L E;  4QUR A;  1SQQ E;  2BMQ A;  5KLI C;  1NYK A;  4HM3 A;  4NBG D;  3L71 E;  4QUP A;  1Q90 C;  3L72 E;  2DE6 D;  2JO6 A;  4EMJ B;  2NVG A;  1SQP E;  4QDF B;  1P84 E;  3VMG D;  1NTM E;  4HM7 A;  1VF5 D;  3L73 E;  4U3F E;  2QPZ A;  1UUW A;  4QDF A;  3L70 E;  2ZYL A;  3L74 E;  2XR8 A;  3AZC A;  1VCK A;  1EG9 A;  2BMR A;  1WQL A;  2HML A;  4QCK A;  3FOU A; 
#chains in the Genus database with same CATH topology
 4PJ0 E;  4IFD K;  1BGY D;  1SQX J;  3CCR P;  4NBF D;  1TU3 F;  1KB9 H;  1X8Y A;  2K37 A;  5KLV D;  1WMK A;  2IYP A;  1L4A A;  1GU4 A;  1OW6 A;  1VQN P;  2R5D A;  3W67 A;  4OGQ D;  3CCV P;  1VQ5 P;  2B1X A;  2XNX A;  1LTI C;  2FYU G;  2R5B A;  2FBW C;  1YI2 P;  5AVX B;  2C0W A;  1N73 A;  5APU A;  2M3E A;  5GTI E;  3OJA B;  3LW5 H;  5CMZ A;  2NWF A;  3A3Y B;  1HUC A;  2IBZ D;  2QM7 A;  2XV5 A;  2POH A;  1GL2 C;  1NTK J;  2OYO A;  2OQQ A;  4ASW A;  3U1A A;  1CI6 A;  1NKN A;  5AVS B;  1D7M A;  1T3U A;  3P8M C;  2FYU E;  3E7K A;  4WY4 C;  4WY4 A;  1MZ9 A;  1SQQ J;  2W6A A;  3P7K A;  4DCK A;  3BAS A;  4HM4 A;  3L36 A;  4NBD D;  1YHQ P;  1RE4 A;  2HYN A;  2KNC B;  2BMQ A;  5KLI C;  3VMA A;  3BCC J;  2FKW B;  1G2C A;  4I1L A;  3MIW A;  3HUS C;  1T6A A;  3VP8 A;  2E76 B;  2M5A A;  4QCK A;  3L35 A;  4JPZ B;  5CJ0 A;  4DT0 A;  5B66 H;  1J1D C;  2HPC A;  1VQK P;  2N1T A;  1L0N J;  3AEE C;  1KFM A;  1Q86 Q;  3NMD A;  4UB8 H;  4NBH D;  4W80 A;  3U59 A;  4JYB A;  4D6T D;  4D6T G;  3WU2 E;  5M1B A;  2A45 I;  4QMA A;  3HE5 A;  1Y8A A;  3V4W A;  2OYI C;  2ZXX A;  2WT7 A;  5AW8 B;  1HH0 A;  1O7G A;  2JWA A;  3D6Y A;  3H1L G;  2KLU A;  1LWU A;  1ULJ A;  1SQP K;  1GL2 D;  1ULI A;  1YIJ P;  2OYH A;  2ZT9 C;  4IL6 H;  2KNC A;  2YIU C;  2GA1 A;  1VF5 C;  1RE3 C;  1SQB G;  1G2C B;  3AE1 C;  2AXT H;  1GK4 A;  1NTM K;  1X9V A;  2PAJ A;  5APQ A;  1FZG A;  1HVV A;  1L0N K;  2KK7 A;  1GK6 A;  3L75 E;  2G8Y A;  3CCQ P;  5K5G B;  3MGN A;  1QGK B;  4ZKP A;  3CXH I;  3L4F A;  1NU1 D;  1GD2 E;  1J1D B;  3IAO A;  3TGU E;  2B89 A;  4NPF X;  1LTS C;  2NVG A;  1NTM E;  2YNY A;  3FXE A;  2W27 A;  1RH5 B;  1Q2N A;  3RL0 D;  4PD4 I;  3TK1 A;  3FGA D;  4R4L A;  1O7M A;  1QVG O;  4EYY Q;  1VM9 A;  4ZMD A;  1BE3 E;  3T97 B;  4GOE A;  2WPQ A;  4I2L C;  3IN6 A;  4GOF A;  1RF1 C;  3L70 D;  1BSH A;  1EDK A;  2WPS A;  3E1I A;  2KP8 A;  1KB9 D;  3CMA P;  4BRY A;  2E76 C;  4HM0 A;  2JZA A;  1YTZ T;  1KTM A;  3G71 P;  1QVF O;  4M3L A;  4WY4 B;  5AVU B;  4P1C H;  2HG5 D;  1USD A;  1J1E B;  2IZ0 A;  3H1L E;  4ZKU A;  1UII A;  1RF1 A;  3FXD A;  3H1J J;  4HM6 A;  3TGU D;  5AEU A;  2WPV B;  1RHZ B;  3TGU G;  1SJG A;  3TYY A;  3H25 A;  5CXM A;  3H1K J;  3CXH H;  3VP9 A;  2C9L Y;  5B66 E;  1NGM B;  2E4Q A;  3HD7 C;  2FYN C;  1NVO A;  1M90 Q;  1QL2 A;  3A5T A;  3GLM A;  4NBG D;  3E1R A;  3L71 E;  4AUW A;  5E79 H;  1FZC C;  3R2P A;  2WSC J;  3IF4 A;  2JO6 A;  2Y0D A;  1FOS F;  1W5C E;  4QDF B;  1MFZ A;  3P8C D;  3GG2 A;  1JY3 P;  2QPZ A;  1AQT A;  1IFJ A;  1USE A;  1EG9 A;  3I55 P;  3GF7 A;  5AVR B;  1AFO A;  1KOR A;  1YBK A;  2MJZ A;  4W7Z A;  3VN0 A;  2O01 N;  1KFN A;  2FFD A;  5APT A;  4QDC A;  3D70 A;  4H13 C;  2Q9I A;  1RFS A;  1IK9 A;  2O01 H;  1QEX A;  3RK2 C;  2KUB A;  2GM4 A;  3OW2 O;  1PGJ A;  4EI2 A;  3LIE A;  1SQV G;  4NB9 D;  1VL2 A;  2JWD A;  1ZW0 A;  1JO5 A;  2IBZ G;  2A06 D;  1FBM A;  3M91 A;  1VDF A;  1NTZ J;  3JSV C;  3AE4 C;  1JY2 O;  3V2Q A;  1NU1 J;  3GHG C;  2JR8 A;  3GZY A;  2WSS H;  1BCC E;  3Q2Y A;  3KQG A;  1NH4 A;  1PP9 E;  2BEZ F;  5TIS H;  2LKM A;  1AQ5 A;  1X22 A;  5HL4 A;  4XE5 B;  1SQP J;  4KJM A;  2R44 A;  3HTK B;  1NYK A;  2ITA A;  1K8A Q;  1IFP A;  1NTZ G;  4IL6 X;  1P84 E;  3SSU A;  1LTT C;  4HYT B;  2W8Z A;  2KB7 P;  2AXC A;  2HLO A;  2Y9Y A;  3L70 E;  1KN7 A;  3BRT B;  1WQL A;  2HML A;  3CPW O;  5KAF H;  2Q7C A;  3H1J G;  1KYO H;  1PPJ E;  4OGQ B;  5AVZ B;  1AVY A;  3H1H J;  5AW6 B;  4D6T J;  3AE5 C;  2KZJ A;  1EDJ A;  3WUV A;  3H1K G;  1ZME C;  3HUS B;  3L74 G;  3OAK A;  1MUU A;  2N9Y B;  2CKF A;  5CCH A;  4CPG A;  2K1A A;  1WRG A;  3P8C E;  2QJP C;  1JB0 J;  1PZQ A;  3MUD C;  2BEQ D;  1LT9 A;  3GTS A;  3KXD A;  2SPZ A;  3PJS K;  4GKG A;  2NPS B;  4HJG H;  2IX7 C;  1DEB A;  1QL1 A;  3AEA C;  3CXH D;  1ZRT D;  3PTZ A;  3VMX A;  3I56 P;  2IBZ E;  2Y0E A;  2FYU J;  2NUK A;  3AE9 C;  3H1I E;  3CX5 D;  4NBB D;  3CCJ P;  3H1K D;  2WPR A;  4H44 C;  2KI7 B;  2QG4 A;  3H32 A;  3CC2 P;  3HRN A;  2KZI A;  2HMK A;  1PP9 D;  3Q5P A;  3L37 A;  4C46 A;  3GB4 A;  1LJ2 A;  4OGQ C;  1Q82 Q;  4QUP A;  1UIX A;  1L2P A;  3NXS A;  4N78 E;  3H1H G;  4L75 A;  2NRG A;  1RE3 A;  1ZLL A;  4N3Y B;  1M1K Q;  1KMI Z;  2QJP B;  1OVU A;  1RY3 A;  3FX0 A;  1SLQ A;  3MP7 B;  3H1I G;  4DJG A;  1JOC A;  1S5L X;  3G4S P;  1YJ9 P;  4NBC D;  2J58 A;  1SQV J;  4IL6 E;  2D2C D;  5GTI H;  1RF0 A;  3N0Q A;  1NYH A;  2GUV A;  2J5U A;  1HTL C;  3HD7 D;  2YKP A;  1DEE G;  1N7S B;  2V7Q H;  3L75 D;  3GCE A;  4P1B H;  2HOD A;  1AV1 A;  3RBZ A;  2AEM A;  3GL0 A;  1R8E A;  5KTB A;  4EOT A;  4TT3 H;  3AEB C;  1SQQ K;  5APW A;  1FS0 E;  1ZXG A;  1S4X A;  1EDI A;  1LT1 A;  3L74 J;  3H1I D;  1ZN5 A;  4W7Y A;  3EN1 A;  1SS1 A;  3TF5 A;  2BCC E;  2B87 A;  1M8O B;  4RES B;  2ZYA A;  1PL5 A;  4I7Z B;  2RN0 A;  1BCC J;  4BWN A;  1L0L K;  2E76 D;  2K9Y A;  3Q3D A;  3L70 J;  5AW4 B;  3V5B A;  2Q1K A;  1Q90 C;  4XA4 A;  4UB6 H;  1UUW A;  4GT1 A;  1EC5 A;  2BMR A;  4N6J A;  3LID A;  1BGY J;  3EFF K;  5KLV E;  2LR2 A;  4UB6 E;  3GOB A;  3HTK A;  1CSB A;  3WU2 H;  2I1K A;  3EWK A;  3M9H A;  2D2C C;  2OYH B;  1HJB A;  3SWK A;  2KYV A;  1ZOY C;  1S9K E;  1OXZ A;  3GL2 A;  5APV A;  2WTY A;  1RIE A;  1L4A D;  2K3R A;  3M0D C;  2Q3W A;  2YMK A;  4JYC A;  3H32 B;  3RBX A;  4ASV A;  1AVO A;  4A7P A;  1JMB A;  2CK3 H;  1H88 A;  3L73 D;  3BCC G;  3GKE A;  1JNM A;  3L70 G;  1FZE A;  1K73 Q;  2I7F A;  4DOJ A;  2ZYD A;  1LT9 B;  2QVA A;  1MKM A;  2ZT9 D;  3CX5 E;  5CCG A;  3I5C A;  3P32 A;  3GMA A;  3FWL A;  1KB9 E;  2KSJ A;  1KIL A;  2QJY B;  3EQ2 A;  3A7O A;  1UUV A;  1BGY G;  4H0L B;  4H44 D;  3CX5 H;  2QA4 P;  1IZN B;  4YTP C;  4QUR A;  2YKO A;  1YJN P;  2FXP A;  5KLV G;  3U1C A;  2YXR B;  2MKV A;  2FYU K;  5CCG C;  4IFM A;  3RK3 E;  1SQB J;  2P2U A;  2KLV A;  1IFM A;  1M57 D;  3TDK A;  1NJI Q;  1FJK A;  4WWI A;  1BE3 J;  4Y99 C;  3EFG A;  2ZXE B;  1KC8 Q;  5APS A;  2K9J A;  1RF0 C;  3HE4 B;  5B5E E;  1EZV G;  2P58 A;  1GTW A;  1JCC A;  2JEE A;  2H8P D;  3VMH D;  2P10 A;  2JP3 A;  4WY4 D;  5CBN A;  4NBE D;  4I7Z C;  4HH2 A;  1KIL B;  1Q81 Q;  2WVR A;  2P7J A;  4N78 D;  5AW9 B;  2J59 M;  1J2J B;  1NTK G;  3C0D A;  4YXD C;  1R5L A;  3CD6 P;  2OYI B;  2WSC H;  3AEG C;  5AVY B;  5CBO A;  5CCH D;  5H2F E;  2G3A A;  1FQT A;  2WQY C;  3MD0 A;  2B9B A;  2KS1 B;  1NWQ A;  2KXP B;  3F89 A;  2IDB A;  2ZJS E;  2FFD C;  3RL0 g;  3ABV C;  2HOD B;  1SQX G;  1O7N A;  5H2F H;  2E4P A;  1NTZ E;  1AJY A;  1PPJ G;  3S9O A;  1NAY A;  1CW5 A;  3CI9 A;  2Z5H A;  3N4X A;  5E79 E;  5AVV B;  2IZ1 A;  3TSI A;  3RK2 B;  2GBX A;  2WSF J;  1M56 D;  4GIF A;  1NU1 G;  1OIP A;  2R3C A;  5KLI B;  3L72 G;  1NO4 A;  2XU6 A;  3CCS P;  3L72 D;  1LTJ A;  3V6I A;  1LTJ C;  5BU8 B;  1L0L G;  5DJT B;  1OW7 A;  4H0L C;  1JY2 N;  2I8D A;  1PIX A;  1L0L D;  1L0N E;  1SQX E;  1FDI A;  3GTE A;  1S3J A;  1S72 P;  3MZW B;  1PGO A;  1K04 A;  3JC2 2;  3RL0 C;  4NPD A;  4H13 D;  1HBW A;  2YVJ B;  3GHG B;  1SFC B;  4Z1M H;  1KYO I;  1NTZ K;  1NTK E;  2UWJ E;  1LWU B;  1FDM A;  3CLQ A;  5KKZ B;  1SQB D;  3B4S A;  1PGP A;  1OVV A;  2WSE H;  1MV8 A;  3L75 G;  2I1J A;  1OX3 A;  4PV1 D;  3R4Y A;  2Z5I A;  1LNQ A;  2N1T D;  5GTH E;  2BCC D;  3SWY A;  3V2P A;  2IFN A;  3G9R A;  2M5A B;  1ZRT E;  2NPS C;  1OZH A;  2XND H;  2C0X A;  3B5N B;  1EDL A;  3L75 J;  2LXC B;  1CZQ A;  1T8Z A;  1LTG C;  3H1L D;  2H89 C;  2E74 D;  1BDD A;  3VOP A;  1HGV A;  1PGQ A;  2PRR A;  1BCC G;  1KQG B;  3HE5 B;  3O6Q B;  1IJD B;  2WT7 B;  1S9K D;  3L72 E;  5AW3 B;  3Q1M A;  1U7J A;  3CWB G;  4U3F E;  3CCU P;  3CCM P;  3AZC A;  4RKU J;  1QX8 A;  1BE3 D;  1CI6 B;  1YTZ I;  1SQV E;  2OGU A;  2YXQ B;  5L8R J;  2M0B A;  5KKZ C;  1LWU C;  3MTU E;  1VQ4 P;  2QE7 H;  4JF7 A;  3KZI E;  3PRJ A;  1EXI A;  3KYQ A;  3HUS A;  3V4Q A;  1U57 A;  1KZU B;  3H1H D;  1L0N G;  1NTM D;  5BOK A;  2KOG A;  2AEJ A;  2QIW A;  2OYI A;  4MN4 C;  1KV4 A;  1EZV I;  1M1J B;  1SQV K;  3M0A A;  1DIP A;  1URQ D;  1A02 J;  4HM8 A;  4YXW H;  3K5B A;  1DD4 A;  3M06 A;  2FXM A;  5AEW A;  1FZC B;  3IR9 A;  1SQP D;  4HKZ H;  2FYU D;  4L76 A;  3H1K E;  1BE3 G;  4HJL A;  2XDJ A;  1LTB C;  3O8Z A;  1KIL D;  2DE7 D;  3M9Q A;  3A2A A;  4HM1 A;  2XKM A;  2PFX A;  5KJ7 D;  3VTP C;  3VMG D;  1VQ7 P;  4HM7 A;  1VF5 D;  1NOH A;  3L71 J;  2CPS A;  5AW1 B;  4GDO A;  2ZYL A;  2AEF A;  3FOU A;  2IFM A;  2HMO A;  2JJL A;  1GW4 A;  2WSE J;  1SQV D;  2E75 C;  1N7L A;  2N1T B;  1Q90 D;  5KAF E;  3NFQ A;  1R5S A;  1YQ4 C;  1X0T A;  3B5N D;  3H1J E;  2NUM A;  2PP6 A;  3B8E B;  3A0H E;  4HKV A;  4OH8 B;  3NTN A;  1RE4 C;  1DD3 A;  4OWF A;  1GL2 A;  1MFT A;  1JTH B;  1LTJ B;  2OTL P;  3L74 D;  3Q5R A;  1LP1 A;  3CME P;  1HF9 A;  1FJP A;  2XZR A;  3DQY A;  2CPB A;  4WBA A;  5AW2 B;  3O6Q A;  5APX A;  1K9M Q;  1AA0 A;  4AQR D;  1LGH B;  4BXL A;  2E5Y A;  1ZR4 A;  5CCH C;  2RH0 A;  3G6E P;  1HGZ A;  1OVR A;  3VCA A;  2HFE D;  3TGU J;  1IO4 A;  1VPC A;  2LXB A;  4U7J A;  3H1J D;  2QJK C;  4BRY B;  1BSN A;  3B5N A;  2WWW A;  4LGD E;  1SQP E;  2E43 A;  3ZDM A;  2JDI H;  4HB1 A;  3A0B E;  4LC1 A;  2XR8 A;  1VCK A;  3AEC C;  2XSH A;  1S2E A;  1M1J A;  2L5G B;  2XRX A;  3CX5 I;  4PV1 C;  1M7L A;  4C7N B;  1VQO P;  1WT6 A;  2HMN A;  1OW8 A;  3VCP A;  1VQ9 P;  2E75 D;  2WZ7 A;  2KSE A;  1SFC D;  4DZO A;  2PGD A;  2WMM A;  1ZV8 A;  1H89 A;  2XSO A;  3LW5 J;  4O9B A;  2HMJ A;  2NPS A;  1PP9 J;  1KIL E;  1XTG B;  2BAS A;  3TNU B;  4KHX A;  2ZVN B;  1SQX K;  2L91 A;  3PHL A;  5DJU B;  1L4A B;  5AVW B;  4U3F D;  1XTC C;  5AVQ B;  3CWB E;  4U3F G;  3WUU A;  2HR3 A;  3VMZ A;  1ZP0 C;  3H6P A;  2QJK B;  1JY3 N;  4NBA D;  5BVZ A;  4IOI H;  2FFD B;  1NTK K;  2ZFC A;  1OMI A;  3D6Z A;  1URQ A;  4K3A A;  2KIK A;  4LLH A;  2YO3 A;  4YPC A;  2A06 E;  3D89 A;  2R3S A;  1N73 B;  1EXJ A;  2V4H A;  1SQQ E;  4U3F J;  4C7N A;  3USS A;  1GMJ A;  4L73 A;  1JM0 A;  3MUD A;  4QDF A;  4H13 B;  2ZYG A;  1SQP G;  2ZAE B;  2E5T A;  4HM2 A;  4WB4 A;  3CCE P;  5TIS E;  3KPE A;  5B5E H;  2B24 A;  1X79 B;  4QUQ A;  3KDP B;  3RK3 B;  4UB8 E;  1KQF B;  3WUT A;  2E74 B;  3TNU A;  2FYN B;  5KAI E;  2W83 C;  3PP5 A;  2A06 G;  3IFM A;  1LP1 B;  2K9J B;  4KT0 J;  4ZNC A;  4NB8 D;  3RK3 C;  3F5H A;  2YKQ A;  1L0N D;  1NTM G;  1T2K C;  1Q7Y Q;  1GZL A;  1YQ3 C;  1S1C X;  2Q3E A;  1KYO E;  4HM5 A;  3AE2 C;  3GZX A;  1KQS O;  4JQ0 D;  4GOD A;  3A0H H;  2FY8 A;  1P84 H;  5BU5 A;  1YIT P;  4L74 A;  2IPP A;  1NDO A;  2WSF H;  2H7H A;  1EZV E;  1M1J C;  3AE7 C;  2HPC B;  4PJ0 H;  1NTZ D;  3OA7 A;  2RMZ A;  1SVF A;  2YFI A;  1N7S C;  2B87 B;  1GL2 B;  2O01 J;  2NPS D;  1VQ8 P;  4B86 A;  2QEX P;  2JO1 A;  2KS1 A;  1VQP P;  2N1T C;  2BCC G;  2HMM A;  1P84 I;  1PFI A;  1SFC A;  1NTM J;  2O1J A;  5TJH A;  2DE5 D;  4H0L D;  1L0L E;  2Y9Z A;  2WIT A;  1VF5 B;  2YMY A;  2YIU B;  5APY A;  3CC7 P;  3CC4 P;  2OAR A;  1JEK A;  1N7S A;  3KHU A;  2GUS A;  2A45 H;  4RO0 A;  1KB9 I;  3W68 A;  3GW6 A;  1A02 F;  3GHG A;  2M8R A;  2FYZ A;  1FOS E;  3RK2 D;  2YFJ A;  2W90 A;  1P84 D;  3QH9 A;  4RJT A;  3UIA A;  2B88 A;  3QWO C;  1E79 H;  1YJW P;  3SFD C;  4I6M C;  1H8A A;  2W6J H;  1W2E A;  3L73 G;  1H0T B;  4PD4 E;  4C7R A;  1HWT C;  1G1I A;  3HD7 B;  4PV1 B;  1VQL P;  1URQ B;  2M3B A;  1N8R Q;  3S1K A;  2N9B A;  1E5W A;  1RF1 B;  1N73 C;  5AW0 B;  4XFJ A;  3C9I A;  3SWF A;  1OFC X;  1FZF A;  2BCC J;  2P67 A;  3VMY A;  2OTJ P;  4OVN F;  2NZ2 A;  2IBZ I;  3RL0 B;  3CWB J;  3PH0 A;  3GF3 A;  2QRX A;  1YYC A;  1J1E C;  1JUN A;  2ZT9 B;  3CXH E;  2H88 C;  1DH3 A;  3N7N A;  3B71 A;  2C9N Y;  3M9B A;  5KLV K;  1FE6 A;  5KAI H;  2RKL A;  4HM3 A;  2P1J A;  4EMJ B;  1FZB A;  1L0L J;  1FZA A;  3L73 E;  1NHL A;  5KLV J;  3B5N C;  1FDO A;  1NKZ B;  3S4R A;  3L74 E;  3FWN A;  1U7M A;  1RQV A;  1T2K D;  2H43 A;  1SQX D;  2YO2 A;  3HE4 A;  4H44 B;  3RK3 D;  1T3J A;  2E42 A;  1KD1 Q;  1G8J B;  2IYO A;  3L71 D;  1GU5 A;  2QSI A;  2W6B A;  1BGY E;  3AEF C;  1GDT A;  1W2B O;  3KZI H;  4Y99 B;  1JMM A;  1G8K B;  1GW3 A;  3BVH A;  1IK7 A;  1N86 A;  1HJ0 A;  1JY2 P;  4IFF A;  2O1K A;  3M0D A;  2YFL A;  3C1L A;  5KJ7 C;  1PP9 G;  3RGU A;  3V2N A;  2BMO A;  2NVE A;  2QJY C;  1FZC A;  1N2D C;  1Z56 A;  1PV3 A;  1SFC C;  3H1L J;  3L71 G;  2Z4E A;  1NU1 K;  1L4A C;  4QDD A;  2NVF A;  1KIL C;  3WMM 0;  1O7W A;  2JKV A;  3G3Z A;  1ZR2 A;  2GBW A;  2O3J A;  1DX7 A;  3C8V A;  1QLE D;  1SQB E;  1KYO D;  1NTK D;  2V7Q J;  1IFI A;  1N7S D;  3JCU H;  3AED C;  3AE8 C;  1NAF A;  2E75 B;  4PD4 H;  2Y0C A;  5AW5 B;  1H0T A;  1KQL A;  1JY3 O;  3V2R A;  2D2C B;  1SP4 A;  1IFD A;  3BCC E;  1VQ6 P;  1FC2 C;  1IC2 A;  1Y47 A;  3D71 A;  3Q5S A;  3JCU E;  2OTK E;  4AIV A;  1SQB K;  1URQ C;  1O7P A;  1PPJ D;  4PD4 D;  4Y28 J;  4D6T E;  5CJ4 A;  1OWA A;  3CCL P;  1IFN A;  3BCC D;  1EQ7 A;  1NU1 E;  3CL3 D;  1JM1 A;  3EQQ A;  3AE6 C;  1LT9 C;  2AXT E;  3AE3 C;  4JBZ A;  1SQQ D;  1Y9B A;  2E74 C;  1FAV A;  2ZVO B;  4NPE A;  4EIJ A;  1O7H A;  2R32 A;  1G1J A;  1BDC A;  2Q5U A;  3VMI D;  1K05 A;  5EFW B;  2DW3 A;  1JTH A;  5C39 A;  3BRV B;  2Q3I A;  2VRS A;  5AVT B;  1VQM P;  1BCC D;  3MHV A;  2Q6Q A;  4WVZ A;  3L73 J;  3II6 A;  3VYI A;  1S5L E;  2OYH C;  1JCD A;  3HD7 A;  3H1I J;  3CWB D;  5KJ7 A;  4EDF A;  1RQU A;  4TLF A;  2QM8 A;  2FXO A;  3PLN A;  3H1H E;  4AYC A;  1LTA C;  1FU1 A;  4AAY B;  4K35 A;  1S5L H;  3ITK A;  2A45 G;  2K88 A;  3T97 A;  1EZV D;  1SQQ G;  3A0B H;  3SFE C;  5CHX A;  2DE6 D;  5GTH H;  5AW7 B;  5CCG D;  3BAT A;  3L72 J;  4R4M A; 
#chains in the Genus database with same CATH homology
 2GBX A;  3BCC E;  4HM2 A;  2XSH A;  2HMO A;  1PPJ E;  2B24 A;  4QUQ A;  4NBF D;  4AIV A;  1SQV E;  5KLV E;  2YFJ A;  1O7M A;  2XRX A;  5KKZ C;  1G8J B;  1VM9 A;  3GOB A;  1BE3 E;  1O7P A;  2HMN A;  4NBH D;  1L0N E;  4NBC D;  4QDC A;  4D6T E;  1SQX E;  3VCP A;  4NB8 D;  1BGY E;  3GTE A;  2CKF A;  2E75 D;  1NU1 E;  3H1J E;  4OGQ D;  2B1X A;  4PD4 E;  2NUM A;  1RFS A;  2QJP C;  3VMH D;  1G8K B;  5BOK A;  2D2C D;  4H13 D;  1JM1 A;  2YVJ B;  2XSO A;  3EQQ A;  3GTS A;  4HKV A;  3GL2 A;  2HMJ A;  1RIE A;  1NTK E;  3N0Q A;  4NBE D;  1KYO E;  1O7G A;  4HM5 A;  4NB9 D;  1O7H A;  4HM0 A;  2JZA A;  4HM8 A;  2Q3W A;  3GZX A;  2NWF A;  2YFL A;  4P1C H;  3VMI D;  1ULJ A;  4PV1 D;  3GCE A;  4P1B H;  1ULI A;  5AEW A;  3DQY A;  3H1L E;  3CWB E;  1NDO A;  3GKE A;  2BMO A;  2NVE A;  2IBZ E;  1ZRT E;  3GL0 A;  2NUK A;  2QJY C;  1EZV E;  3C0D A;  3H1I E;  3H1K E;  4NBA D;  2I7F A;  4HM6 A;  4HJL A;  4NBB D;  2YIU C;  5AEU A;  3GZY A;  2ZT9 D;  3CX5 E;  1BCC E;  1SJG A;  2YFI A;  1FQT A;  5CXM A;  1PP9 E;  1KB9 E;  3EN1 A;  4QDD A;  2FYU E;  2NVF A;  2DE7 D;  2E74 D;  3VCA A;  2BCC E;  3L75 E;  2HMK A;  2E4Q A;  2A06 E;  1O7W A;  1UUV A;  3H1H E;  3CXH E;  3D89 A;  2FYN C;  4H44 D;  4AAY B;  3GB4 A;  4HM4 A;  1O7N A;  4HM1 A;  2E76 D;  2GBW A;  2HMM A;  2QJK C;  2E4P A;  1NTZ E;  2DE5 D;  1SQB E;  5HL4 A;  4H0L D;  3TGU E;  4NBD D;  1L0L E;  4QUR A;  1SQQ E;  2BMQ A;  5KLI C;  1NYK A;  4HM3 A;  4NBG D;  3L71 E;  4QUP A;  1Q90 C;  3L72 E;  2DE6 D;  2JO6 A;  4EMJ B;  2NVG A;  1SQP E;  4QDF B;  1P84 E;  3VMG D;  1NTM E;  4HM7 A;  1VF5 D;  3L73 E;  4U3F E;  2QPZ A;  1UUW A;  4QDF A;  3L70 E;  2ZYL A;  3L74 E;  2XR8 A;  3AZC A;  1VCK A;  1EG9 A;  2BMR A;  1WQL A;  2HML A;  4QCK A;  3FOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...