2FYUE

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
molecule tags Oxidoreductase
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
total genus 44
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 2fyuE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2fyuE02
2BMOA 4P1BH 2BCCE 2E75D 1L0NE 1KYOE 2NVEA 4H44D 4HM7A 1JM1A 2DE7D 1EZVE 1ZRTE 4QCKA 1BE3E 3GTEA 1UUVA 2NUKA 1BCCE 2JZAA 3L72E 2XR8A 4QUPA 2IBZE 2XSOA 1NYKA 2YIUC 1SQBE 3D89A 3L75E 1RIEA 2QPZA 4QDFB 4AIVA 4H0LD 3VMGD 5BOKA 2NVGA 2E76D 5KKZC 1L0LE 2E4PA 2YVJB 3L74E 4NBCD 3H1JE 4PD4E 1NTKE 2E4QA 4HKVA 3VCPA 2QJYC 2QJPC 1PP9E 2FYUE 3CX5E 3TGUE 3GKEA 4PV1D 4AAYB 4HM3A 2XSHA 4NBAD 1Q90C 4NB9D 1O7PA 2HMOA 1VM9A 3CWBE 2HMKA 1VF5D 1O7WA 1SQQE 4U3FE 1NTME 2YFIA 4HM1A 2D2CD 2XRXA 4NBHD 3FOUA 1VCKA 4P1CH 2HMLA 1NDOA 1SQVE 3VCAA 4NBFD 2B1XA 3L71E 2HMNA 4QDFA 1O7NA 1SJGA 3GL0A 2NVFA 4D6TE 1ULJA 1SQXE 1SQPE 2NUMA 4QURA 2QJKC 4EMJB 1O7GA 3CXHE 1RFSA 3BCCE 1NTZE 2JO6A 2ZYLA 1BGYE 3GCEA 2B24A 2E74D 3GB4A 3C0DA 3N0QA 1FQTA 2I7FA 4NBBD 4HM2A 4NB8D 3L70E 5AEWA 2GBXA 2YFJA 1KB9E 2NWFA 4NBGD 2FYNC 4QDDA 4HM4A 2HMMA 3H1LE 2GBWA 4NBDD 3AZCA 2BMRA 2CKFA 5KLVE 4HM8A 1NU1E 3GZYA 1O7HA 2DE6D 3H1HE 1UUWA 3VMHD 4HM5A 5AEUA 5HL4A 1O7MA 2YFLA 4H13D 1P84E 3DQYA 4HJLA 4NBED 1G8JB 5KLIC 3H1IE 2BMQA 1EG9A 3EQQA 1PPJE 2ZT9D 2HMJA 3GL2A 3GTSA 2Q3WA 3L73E 2DE5D 3GOBA 4HM6A 4OGQD 3VMID 3GZXA 1ULIA 5CXMA 3H1KE 2A06E 3EN1A 1WQLA 4HM0A 4QUQA 1G8KB 4QDCA
chains in the Genus database with same CATH superfamily
3CMAP 2IX7C 1MV8A 2NVEA 1NU1K 2KZJA 1DEEG 3M9QA 1JM1A 2WSCH 2NUKA 1NU1D 2Q1KA 2XSOA 1HVVA 2QPZA 3MD0A 1K73Q 5CCGD 2ZVOB 5KKZC 2O3JA 4D6TD 3HE5B 2NPSC 2V7QH 1SP4A 4HB1A 1JMBA 3NMDA 4I7ZC 1RQVA 1R5SA 2XSHA 2FXPA 1H0TB 4IFDK 2P67A 1YJ9P 1PP9J 3RGUA 5KKZB 2FY8A 1MFZA 1ZP0C 3H1KJ 1TU3F 2Q7CA 1YI2P 4RO0A 3GL0A 3P8MC 1RE3C 1SQXE 1S2EA 3BCCD 5CJ0A 2KSEA 1RF1B 1BGYE 2KK7A 2B24A 2CK3H 4XE5B 1FZFA 2WQYC 3C9IA 3S9OA 3ITKA 2BCCD 1LWUB 5AEWA 4QDDA 4HM4A 1OVRA 4DCKA 1LT9B 3PLNA 1PV3A 3GZYA 1LT1A 2IBZD 5GTIH 1ZLLA 2E75B 3CCSP 4NBED 1LWUA 3CXHI 3NFQA 2L5GB 3OAKA 2KSJA 2Q3WA 3HD7D 3L73E 5GTIE 1AA0A 2FFDC 4ASWA 4PD4D 1NWQA 2BMOA 2POHA 1YITP 1S3JA 2QM7A 4H44D 3L71J 3R4YA 1ZRTE 1OW7A 1BCCE 2H88C 1GL2A 3L72E 1HGZA 2OYHA 1YYCA 3L75E 2KB7P 4H0LD 1L0LE 1A02F 4AYCA 2IBZI 1SQPJ 5CCGA 3AE2C 4Y28J 1PP9D 2NZ2A 1MFTA 3KXDA 1LTIC 1NTKJ 3GF7A 3Q5RA 4AAYB 5AW4B 1SFCB 2YIUB 1SQBJ 4TLFA 1NTME 2HPCA 1BE3G 1NOHA 1KD1Q 4H13C 1K9MQ 1VQLP 5CHXA 2B1XA 3L75D 3Q5PA 1HJBA 4EDFA 1ZMEC 3VMYA 4WB4A 1FZGA 2MKVA 1S4XA 1IFMA 2NWFA 1URQA 1NJIQ 3H1LE 2GBWA 1IK9A 3ZDMA 3NTNA 2R32A 3TGUD 3L72G 4BWNA 2BMQA 3TSIA 1AQTA 1PPJE 1FZAA 5CXMA 4QDCA 1VPCA 5APYA 3KZIE 2BCCE 2E43A 1VQ6P 4OGQC 3AE4C 2XR8A 3L72D 2QIWA 2ZYAA 5CBNA 2IBZE 2P1JA 1PZQA 3O6QA 1HWTC 2AEJA 2B87A 2E4PA 1EZVD 2WSFJ 3RK2C 1FZBA 4PD4E 1LP1B 1NTKD 1JUNA 5AW3B 1FE6A 3K5BA 4PD4H 1K05A 3II6A 3TGUJ 1GTWA 4EI2A 4NB9D 1O7PA 1BE3J 3HD7A 1H88A 5AW1B 1O7WA 2FFDB 2Y9YA 1EC5A 1L0NJ 1KQFB 5AVXB 4HM1A 2XRXA 3G4SP 2N1TC 2AEFA 2E42A 1O7NA 2O01J 1CI6B 1O7GA 2JWAA 1HJ0A 4JYCA 3M0DA 3IN6A 2J59M 3GB4A 2YKQA 1KORA 1VQ7P 1U7JA 1HUCA 5KTBA 1RY3A 1N73B 2C9NY 3H1HE 1H8AA 1JM0A 1L4AA 4IFMA 5KLIC 1NTKG 2HPCB 2DE5D 4H44C 2M3BA 1Q7YQ 1KTMA 2BEZF 2KYVA 2RN0A 4KT0J 4C7NA 1KV4A 3WUVA 4KHXA 3SWKA 3H25A 2K37A 2GUSA 3WU2H 2CPBA 3PJSK 1UUVA 2NPSD 3T97A 3RL0C 2XNXA 3D71A 3L71G 2WPQA 2MJZA 3HUSC 2OYHC 1J2JB 2E76D 1NTKK 1SQVJ 1JCDA 2LKMA 5EFWB 3H1IG 2B88A 4AUWA 2A45G 2KXPB 3D6YA 5KJ7A 1SQXG 1RHZB 1LTAC 1KILD 5L8RJ 1VL2A 1MUUA 1SQQK 3SFDC 5E79E 1BCCG 4XA4A 1N7LA 1UIIA 1KMIZ 2FYUJ 2OYHB 2HMLA 1H89A 3B5ND 3WUUA 2H43A 3L75J 5AW2B 2QJKC 4NPDA 1QLED 2W27A 1KZUB 3H1KD 3GCEA 4W80A 4LLHA 2M8RA 2XU6A 4NB8D 1JB0J 1JO5A 5AW6B 4K35A 1VDFA 2BMRA 4MN4C 3M06A 1KFMA 1EZVI 5E79H 2R3CA 4HM5A 3C8VA 4IL6X 1P84E 1BGYG 1LT9C 3AEBC 1AJYA 1GU5A 3M9BA 1X0TA 1N73A 2JP3A 3AEGC 1SS1A 1RF1C 3EN1A 3LIDA 2E74B 4Y99C 2L91A 2Z5IA 1NTMJ 3GHGB 4RKUJ 1VQ9P 1AFOA 1EDLA 5K5GB 5APVA 4N78D 3RK3B 4GKGA 1RIEA 4QDFB 1IO4A 1Y9BA 3PHLA 1T3JA 2OYIC 3KZIH 3TNUB 4U3FG 3VN0A 3I55P 2FYUE 4C7NB 4PV1D 2O1JA 3CCQP 1BCCJ 1GW4A 3VP8A 2QVAA 1FS0E 3PRJA 3A5TA 3AEFC 2Q3EA 4WY4C 3SWFA 3IR9A 3CWBD 1L4AB 1VQ4P 2I1KA 2JKVA 4YTPC 1VF5C 4NBFD 3V5BA 4W7YA 1ZR2A 1R5LA 4ZMDA 1EQ7A 2QM8A 3AE6C 1NTMG 2E74D 2OQQA 2OTJP 3N0QA 2I7FA 1S9KD 1U7MA 5AVQB 4NBGD 3USSA 1UUWA 5AEUA 1BGYJ 3T97B 3GW6A 5GTHE 1FJKA 2ZT9D 2OGUA 3CXHD 1RE4C 4QMAA 3U1AA 3H1KE 3L74G 1URQB 2RKLA 3I5CA 3RK3C 1EDKA 1EZVE 2AXCA 3HUSB 5DJTB 1RE3A 2JR8A 1T8ZA 2YKOA 3E1IA 3CCEP 1BDCA 3HRNA 4HYTB 4K3AA 1VF5B 1T2KD 1DH3A 3HUSA 1JY2P 1L0NG 3IAOA 5DJUB 3BATA 5APXA 1E5WA 2HODA 1PPJD 2BASA 3AEDC 1YTZT 2I8DA 4L73A 4N78E 3L75G 5AVZB 1NKZB 3V2QA 2D2CD 5APSA 2WSFH 4ZKUA 2WSCJ 4UB8H 1M1JC 1QVFO 4QDFA 1DIPA 1NU1G 1ULJA 1GW3A 3BCCE 2JO1A 3AE7C 1M1KQ 3A0BE 3GHGA 1LTSC 2IDBA 2N9BA 4HKZH 5CCGC 4LC1A 4H13B 3H1KG 1HH0A 1RF0A 2XZRA 1LTJB 1PL5A 2K3RA 1SQXK 4IFFA 5H2FH 3GL2A 3MIWA 1SQVD 1VQNP 3CMEP 1CZQA 1OVVA 4OH8B 3VYIA 2W90A 1S9KE 5CJ4A 1GMJA 2H89C 3P32A 4GOEA 2QE7H 2Q9IA 1ZOYC 3L70G 3CCUP 4QCKA 3M9HA 3P7KA 3TDKA 4LGDE 1HTLC 4AIVA 2NVGA 3RL0D 4ZKPA 3VMZA 1W2EA 4R4MA 4YXDC 1DX7A 2QJYC 3OW2O 5APQA 1S5LH 2OYIB 3Q1MA 2D2CB 1SQBG 1VQPP 2JEEA 4DT0A 2FKWB 3H6PA 3H1HD 3TYYA 1GK6A 2Y9ZA 3GG2A 2FYUK 1KYOH 3H1JG 5CMZA 5KLIB 1KILC 4XFJA 1SQPE 1A02J 3H1IJ 1OIPA 5AVVB 1BDDA 3V4QA 1JTHB 3F5HA 3SFEC 1YQ4C 4O9BA 2I1JA 1KQGB 3H1LJ 3H1IE 4HM6A 2PRRA 1VQKP 3OJAB 2G8YA 1YBKA 1S1CX 4PV1C 2JO6A 1IFNA 1FAVA 3EWKA 2LXBA 3VMXA 3RK3E 1AVOA 2N1TA 1IFDA 1D7MA 1PPJG 4PJ0E 3W68A 3HE5A 2SPZA 4NPEA 1USDA 2JDIH 1S5LX 1GDTA 2NPSA 3L74E 2Q3IA 3PTZA 4JQ0D 1NTKE 2E4QA 1X8YA 1NTZG 3KYQA 2QJKB 5AVUB 3VMAA 5KLVD 2WITA 1KFNA 1PP9E 2GUVA 3S4RA 1JCCA 3LW5J 3TK1A 2A06D 2WSSH 1VF5D 1LWUC 4UB6H 1OWAA 5AW8B 4C46A 3B4SA 2JWDA 3CC4P 2IZ1A 3L71E 3AEEC 5KLVG 3TGUG 1IFPA 3L73G 2K1AA 3FXDA 1NYHA 1GD2E 4I7ZB 3C0DA 1EDIA 4N3YB 1NAYA 2FYNC 2ZXXA 3MUDC 4UB8E 1AQ5A 2K88A 3ABVC 1ZW0A 2ZYGA 1M90Q 3CCJP 1VQMP 1FJPA 2D2CC 1PGJA 3A0BH 2ZJSE 1ULIA 3EFGA 2K9JB 1G2CB 3L37A 1T6AA 2E75D 1JNMA 4U3FJ 1ZN5A 4ASVA 1OMIA 2R5DA 5KLVK 3CCLP 1X9VA 3KHUA 4U3FD 3AE9C 1M56D 1YQ3C 5B66H 1SLQA 5C39A 2PFXA 2YVJB 2QJYB 3GLMA 3MZWB 4CPGA 1N8RQ 1SQQG 3CCMP 3A0HE 5B66E 4H0LB 3NXSA 4GOFA 3G3ZA 3L35A 2OYOA 3RK3D 1J1EC 3LW5H 1EXIA 3H1JD 4NBAD 1Q90C 1VM9A 3S1KA 2KUBA 1FZEA 2FXMA 3HD7C 3B5NC 4YXWH 2QRXA 2DW3A 2AEMA 2R3SA 3IFMA 3CL3D 1SJGA 4D6TE 3AE5C 2FXOA 3L74J 1J1EB 3P8CD 5AVSB 1X22A 3RL0B 1KILE 2BCCG 1G2CA 3CXHH 1LTTC 1LTJA 2E76C 2B87B 5BU8B 4HJGH 2A06G 1KB9D 5HL4A 1L4AC 2YFLA 1Y47A 3QWOC 4EYYQ 1LTBC 3VMID 1SFCA 4DJGA 1LT9A 1SQVK 4W7ZA 1GU4A 3GMAA 1W2BO 4HM0A 4QUQA 4AQRD 1Q86Q 5KJ7D 2DE7D 1NVOA 1QVGO 1P84D 2OTKE 3O8ZA 3AECC 1LGHB 2FYNB 3N4XA 1GL2B 1JMMA 3G9RA 3U1CA 4JYBA 2Y0DA 2E74C 3M91A 1J1DC 4PJ0H 1DD3A 3CX5H 1OX3A 5GTHH 3GKEA 4HM3A 1GL2D 2HMOA 1NH4A 3W67A 1KQLA 1IC2A 4R4LA 5CCHC 3BVHA 2YFIA 2E5TA 2WSEH 1NGMB 2NPSB 1SQVE 1ZR4A 4GDOA 3FWLA 1IZNB 3L4FA 1FDOA 2NUMA 2P58A 3V6IA 4EMJB 4U7JA 2K9JA 1NTZE 3L36A 3FWNA 4GIFA 2ZYLA 2N1TB 2V4HA 4NBBD 5BVZA 1W5CE 2WT7A 2IYOA 3G6EP 3AZCA 3BRTB 2W6JH 3BASA 2G3AA 4H13D 2KLUA 5CCHD 3EFFK 3WU2E 2XV5A 4OGQD 4RESB 3GZXA 3E1RA 5TJHA 1FDIA 4M3LA 4YPCA 1YTZI 1J1DB 2QEXP 3SSUA 1OW6A 5TISE 1CSBA 1KQSO 1AV1A 2ITAA 1HBWA 3FX0A 3EQ2A 3Q5SA 1NYKA 1N7SC 1SQPG 2WTYA 1KB9H 4NBCD 4HKVA 1SQVG 5KJ7C 3H1LD 4JPZB 4EIJA 3KDPB 1SQPD 1Z56A 5B5EE 3TGUE 2WZ7A 3AE3C 3E7KA 2QJPB 3PP5A 1SFCD 2ZT9C 4I1LA 3OA7A 3AE8C 1N73C 3H1ID 2IPPA 1FU1A 4PD4I 4QURA 3RBXA 1RFSA 4KJMA 1PP9G 1RQUA 1GK4A 1DD4A 1JY3O 1VQ8P 3CI9A 3HTKB 1KB9I 1FQTA 2OARA 1MKMA 1CI6A 1RH5B 3CX5D 1K04A 5KLVE 3QH9A 1NTZD 1NU1E 2IZ0A 1PGQA 1FZCC 2LXCB 1VQ5P 1UIXA 4WY4D 2BEQD 2C0XA 1IFIA 2HMJA 1KN7A 2FFDA 3M0AA 3H1HG 1RF1A 3BCCJ 2PGDA 2CPSA 1QEXA 1WQLA 4WY4B 1N86A 3JCUE 1L0NE 1KYOE 1XTGB 5AW9B 1BSHA 2UWJE 1USEA 1BE3E 1FZCB 1KILA 4QUPA 2E5YA 2RMZA 1FBMA 1L4AD 1P84I 3CWBG 3RK2B 2R44A 3D89A 3L71D 3VMGD 1KC8Q 4L75A 3H1JE 3D6ZA 2WVRA 4HH2A 3VCPA 2JJLA 2H8PD 3HE4A 4PV1B 2XDJA 5AW7B 3Q2YA 4L76A 2KOGA 2M5AB 2HMKA 1FDMA 2WPVB 3HE4B 2QSIA 2BCCJ 1JY3P 3FOUA 1VCKA 1YHQP 2KZIA 1L0LJ 1T3UA 3Q3DA 1NTMD 2GM4A 3N7NA 2NRGA 3L73D 4H44B 4I6MC 2HODB 3L72J 2AXTH 1OFCX 1EDJA 2HLOA 3JC22 5KAFH 4IL6H 3WUTA 1O7HA 3CPWO 3O6QB 1RF0C 2K9YA 2WMMA 3I56P 1SQPK 3EQQA 3H32A 5KAIE 1IK7A 2RH0A 1YIJP 1G8KB 2YO3A 5KAIH 1QX8A 4ZNCA 2W6BA 3CX5I 2XKMA 2YXQB 3H32B 4BXLA 3GTEA 4Z1MH 1NAFA 3P8CE 2YXRB 3CCRP 1T2KC 5KAFE 4IL6E 3B8EB 3B5NB 2ZVNB 2KI7B 1Q81Q 4DOJA 2IYPA 2N9YB 2KLVA 3MUDA 3MP7B 3CC2P 3PH0A 2PP6A 2QA4P 4OVNF 1M7LA 1QL2A 1G1JA 1HF9A 1NDOA 3A7OA 3VCAA 3L70D 1GL2C 3L73J 2H7HA 1M57D 5B5EH 1FOSF 1Q2NA 1QGKB 1N7SB 2Q6QA 2YKPA 1ZV8A 1DEBA 2GA1A 2W8ZA 3TNUA 3F89A 4HM2A 2YFJA 4A7PA 1LNQA 2A45I 4HM8A 2N1TD 4GT1A 2HFED 3R2PA 1NTZK 1O7MA 1SQXD 4HJLA 1LJ2A 2C0WA 1JOCA 3GTSA 1SQXJ 4D6TJ 4Y99B 1HGVA 4RJTA 2ZXEB 4C7RA 2IFNA 2YMKA 4D6TG 4WY4A 1P84H 1NTMK 1M8OB 1JTHA 1NU1J 5APWA 1Y8AA 1OXZA 2HG5D 2YIUC 2FBWC 5AW5B 3B71A 2YMYA 2Y0CA 3V2RA 3KQGA 2J5UA 1E79H 4GODA 4I2LC 3HTKA 4L74A 2XNDH 2V7QJ 3H1JJ 4DZOA 2KNCB 2A45H 1ZRTD 4U3FE 1IJDB 1PFIA 2YNYA 2C9LY 4P1CH 1XTCC 2Y0EA 1AVYA 1GZLA 2VRSA 3IF4A 3M0DC 3MGNA 2WT7B 1L0LD 2ZAEB 3BRVB 1L0LK 2FYUG 3WMM0 1LTGC 4OWFA 1URQD 1JY2O 5AW0B 1N7SA 3L70E 3RK2D 3BCCG 1JEKA 1MZ9A 2HMMA 3H1HJ 1NHLA 2CKFA 2ZT9B 5KLVJ 2O01N 1M1JB 3CC7P 3CLQA 1G8JB 2AXTE 3LIEA 5APUA 1WRGA 4JBZA 2Z4EA 2B89A 1SQQJ 3VTPC 4HM7A 1G1IA 1N2DC 4TT3H 5AVRB 1SQQD 2KS1B 2R5BA 1H0TA 3C1LA 3VOPA 2KNCA 1PGOA 2M0BA 3GF3A 1CW5A 2OYIA 2HR3A 2FYUD 2W6AA 3U59A 3FGAD 5TISH 2Z5HA 1YJWP 1RE4A 3CX5E 2O01H 3CWBE 1K8AQ 3TF5A 3V4WA 5AVWB 2OTLP 1NKNA 4NBHD 2FYZA 3JSVC 4EOTA 1FC2C 3FXEA 5CCHA 2WPSA 3HD7B 1OW8A 3H1LG 2KP8A 2HMNA 3AE1C 2ZFCA 4UB6E 2QG4A 3CCVP 1KYOD 1L0ND 3V2NA 1BE3D 1LP1A 2ZYDA 1FOSE 1KB9E 3SWYA 1SQBD 3RBZA 1WMKA 4NBDD 2O1KA 2HYNA 3KPEA 4H0LC 2KIKA 2DE6D 3VMHD 2IBZG 1R8EA 4WVZA 4IOIH 1EG9A 4BRYA 3GOBA 2M5AA 1NTZJ 4OGQB 1EXJA 5AVYB 1Q82Q 3A2AA 3L70J 4P1BH 5H2FE 2WPRA 1PGPA 3CWBJ 4BRYB 2JZAA 2W83C 3GHGC 1SQBE 3A0HH 1VQOP 1QL1A 2P7JA 1IFJA 1L2PA 1OZHA 5BOKA 2P10A 5CBOA 1KILB 1JY3N 3JCUH 4NPFX 1JY2N 1YJNP 2B9BA 2IFMA 1NO4A 2QJPC 3CD6P 1PIXA 5M1BA 1BGYD 1KYOI 4B86A 2Q5UA 3UIAA 3V2PA 5BU5A 4WBAA 3B5NA 1SQQE 1L0NK 4N6JA 2E76B 2WSEJ 1S5LE 2PAJA 1SFCC 2M3EA 1M1JA 3AEAC 2YO2A 1Q90D 2NVFA 3L74D 2P2UA 1L0LG 3CXHE 2LR2A 1URQC 4JF7A 3MTUE 1U57A 1SQBK 5APTA 1LTJC 2GBXA 1ZXGA 5AVTB 1BCCD 3G71P 1N7SD 3D70A 2KS1A 1S72P 1WT6A 1OVUA 3MHVA 2J58A 3VP9A 1SVFA 1EZVG 3DQYA 1FZCA 4WWIA 2WWWA 2E75C 3RL0g 1BSNA 2A06E 1X79B 3A3YB
chains in the Genus database with same CATH topology
2BMOA 4P1BH 2BCCE 2E75D 1L0NE 1KYOE 2NVEA 4H44D 4HM7A 1JM1A 2DE7D 1EZVE 1ZRTE 4QCKA 1BE3E 3GTEA 1UUVA 2NUKA 1BCCE 2JZAA 3L72E 2XR8A 4QUPA 2IBZE 2XSOA 1NYKA 2YIUC 1SQBE 3D89A 3L75E 1RIEA 2QPZA 4QDFB 4AIVA 4H0LD 3VMGD 5BOKA 2NVGA 2E76D 5KKZC 1L0LE 2E4PA 2YVJB 3L74E 4NBCD 3H1JE 4PD4E 1NTKE 2E4QA 4HKVA 3VCPA 2QJYC 2QJPC 1PP9E 2FYUE 3CX5E 3TGUE 3GKEA 4PV1D 4AAYB 4HM3A 2XSHA 4NBAD 1Q90C 4NB9D 1O7PA 2HMOA 1VM9A 3CWBE 2HMKA 1VF5D 1O7WA 1SQQE 4U3FE 1NTME 2YFIA 4HM1A 2D2CD 2XRXA 4NBHD 3FOUA 1VCKA 4P1CH 2HMLA 1NDOA 1SQVE 3VCAA 4NBFD 2B1XA 3L71E 2HMNA 4QDFA 1O7NA 1SJGA 3GL0A 2NVFA 4D6TE 1ULJA 1SQXE 1SQPE 2NUMA 4QURA 2QJKC 4EMJB 1O7GA 3CXHE 1RFSA 3BCCE 1NTZE 2JO6A 2ZYLA 1BGYE 3GCEA 2B24A 2E74D 3GB4A 3C0DA 3N0QA 1FQTA 2I7FA 4NBBD 4HM2A 4NB8D 3L70E 5AEWA 2GBXA 2YFJA 1KB9E 2NWFA 4NBGD 2FYNC 4QDDA 4HM4A 2HMMA 3H1LE 2GBWA 4NBDD 3AZCA 2BMRA 2CKFA 5KLVE 4HM8A 1NU1E 3GZYA 1O7HA 2DE6D 3H1HE 1UUWA 3VMHD 4HM5A 5AEUA 5HL4A 1O7MA 2YFLA 4H13D 1P84E 3DQYA 4HJLA 4NBED 1G8JB 5KLIC 3H1IE 2BMQA 1EG9A 3EQQA 1PPJE 2ZT9D 2HMJA 3GL2A 3GTSA 2Q3WA 3L73E 2DE5D 3GOBA 4HM6A 4OGQD 3VMID 3GZXA 1ULIA 5CXMA 3H1KE 2A06E 3EN1A 1WQLA 4HM0A 4QUQA 1G8KB 4QDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMO A;  4P1B H;  2BCC E;  2E75 D;  1L0N E;  1KYO E;  2NVE A;  4H44 D;  4HM7 A;  1JM1 A;  2DE7 D;  1EZV E;  1ZRT E;  4QCK A;  1BE3 E;  3GTE A;  1UUV A;  2NUK A;  1BCC E;  2JZA A;  3L72 E;  2XR8 A;  4QUP A;  2IBZ E;  2XSO A;  1NYK A;  2YIU C;  1SQB E;  3D89 A;  3L75 E;  1RIE A;  2QPZ A;  4QDF B;  4AIV A;  4H0L D;  3VMG D;  5BOK A;  2NVG A;  2E76 D;  5KKZ C;  1L0L E;  2E4P A;  2YVJ B;  3L74 E;  4NBC D;  3H1J E;  4PD4 E;  1NTK E;  2E4Q A;  4HKV A;  3VCP A;  2QJY C;  2QJP C;  1PP9 E;  2FYU E;  3CX5 E;  3TGU E;  3GKE A;  4PV1 D;  4AAY B;  4HM3 A;  2XSH A;  4NBA D;  1Q90 C;  4NB9 D;  1O7P A;  2HMO A;  1VM9 A;  3CWB E;  2HMK A;  1VF5 D;  1O7W A;  1SQQ E;  4U3F E;  1NTM E;  2YFI A;  4HM1 A;  2D2C D;  2XRX A;  4NBH D;  3FOU A;  1VCK A;  4P1C H;  2HML A;  1NDO A;  1SQV E;  3VCA A;  4NBF D;  2B1X A;  3L71 E;  2HMN A;  4QDF A;  1O7N A;  1SJG A;  3GL0 A;  2NVF A;  4D6T E;  1ULJ A;  1SQX E;  1SQP E;  2NUM A;  4QUR A;  2QJK C;  4EMJ B;  1O7G A;  3CXH E;  1RFS A;  3BCC E;  1NTZ E;  2JO6 A;  2ZYL A;  1BGY E;  3GCE A;  2B24 A;  2E74 D;  3GB4 A;  3C0D A;  3N0Q A;  1FQT A;  2I7F A;  4NBB D;  4HM2 A;  4NB8 D;  3L70 E;  5AEW A;  2GBX A;  2YFJ A;  1KB9 E;  2NWF A;  4NBG D;  2FYN C;  4QDD A;  4HM4 A;  2HMM A;  3H1L E;  2GBW A;  4NBD D;  3AZC A;  2BMR A;  2CKF A;  5KLV E;  4HM8 A;  1NU1 E;  3GZY A;  1O7H A;  2DE6 D;  3H1H E;  1UUW A;  3VMH D;  4HM5 A;  5AEU A;  5HL4 A;  1O7M A;  2YFL A;  4H13 D;  1P84 E;  3DQY A;  4HJL A;  4NBE D;  1G8J B;  5KLI C;  3H1I E;  2BMQ A;  1EG9 A;  3EQQ A;  1PPJ E;  2ZT9 D;  2HMJ A;  3GL2 A;  3GTS A;  2Q3W A;  3L73 E;  2DE5 D;  3GOB A;  4HM6 A;  4OGQ D;  3VMI D;  3GZX A;  1ULI A;  5CXM A;  3H1K E;  2A06 E;  3EN1 A;  1WQL A;  4HM0 A;  4QUQ A;  1G8K B;  4QDC A; 
#chains in the Genus database with same CATH topology
 3CMA P;  2IX7 C;  1MV8 A;  2NVE A;  1NU1 K;  2KZJ A;  1DEE G;  3M9Q A;  1JM1 A;  2WSC H;  2NUK A;  1NU1 D;  2Q1K A;  2XSO A;  1HVV A;  2QPZ A;  3MD0 A;  1K73 Q;  5CCG D;  2ZVO B;  5KKZ C;  2O3J A;  4D6T D;  3HE5 B;  2NPS C;  2V7Q H;  1SP4 A;  4HB1 A;  1JMB A;  3NMD A;  4I7Z C;  1RQV A;  1R5S A;  2XSH A;  2FXP A;  1H0T B;  4IFD K;  2P67 A;  1YJ9 P;  1PP9 J;  3RGU A;  5KKZ B;  2FY8 A;  1MFZ A;  1ZP0 C;  3H1K J;  1TU3 F;  2Q7C A;  1YI2 P;  4RO0 A;  3GL0 A;  3P8M C;  1RE3 C;  1SQX E;  1S2E A;  3BCC D;  5CJ0 A;  2KSE A;  1RF1 B;  1BGY E;  2KK7 A;  2B24 A;  2CK3 H;  4XE5 B;  1FZF A;  2WQY C;  3C9I A;  3S9O A;  3ITK A;  2BCC D;  1LWU B;  5AEW A;  4QDD A;  4HM4 A;  1OVR A;  4DCK A;  1LT9 B;  3PLN A;  1PV3 A;  3GZY A;  1LT1 A;  2IBZ D;  5GTI H;  1ZLL A;  2E75 B;  3CCS P;  4NBE D;  1LWU A;  3CXH I;  3NFQ A;  2L5G B;  3OAK A;  2KSJ A;  2Q3W A;  3HD7 D;  3L73 E;  5GTI E;  1AA0 A;  2FFD C;  4ASW A;  4PD4 D;  1NWQ A;  2BMO A;  2POH A;  1YIT P;  1S3J A;  2QM7 A;  4H44 D;  3L71 J;  3R4Y A;  1ZRT E;  1OW7 A;  1BCC E;  2H88 C;  1GL2 A;  3L72 E;  1HGZ A;  2OYH A;  1YYC A;  3L75 E;  2KB7 P;  4H0L D;  1L0L E;  1A02 F;  4AYC A;  2IBZ I;  1SQP J;  5CCG A;  3AE2 C;  4Y28 J;  1PP9 D;  2NZ2 A;  1MFT A;  3KXD A;  1LTI C;  1NTK J;  3GF7 A;  3Q5R A;  4AAY B;  5AW4 B;  1SFC B;  2YIU B;  1SQB J;  4TLF A;  1NTM E;  2HPC A;  1BE3 G;  1NOH A;  1KD1 Q;  4H13 C;  1K9M Q;  1VQL P;  5CHX A;  2B1X A;  3L75 D;  3Q5P A;  1HJB A;  4EDF A;  1ZME C;  3VMY A;  4WB4 A;  1FZG A;  2MKV A;  1S4X A;  1IFM A;  2NWF A;  1URQ A;  1NJI Q;  3H1L E;  2GBW A;  1IK9 A;  3ZDM A;  3NTN A;  2R32 A;  3TGU D;  3L72 G;  4BWN A;  2BMQ A;  3TSI A;  1AQT A;  1PPJ E;  1FZA A;  5CXM A;  4QDC A;  1VPC A;  5APY A;  3KZI E;  2BCC E;  2E43 A;  1VQ6 P;  4OGQ C;  3AE4 C;  2XR8 A;  3L72 D;  2QIW A;  2ZYA A;  5CBN A;  2IBZ E;  2P1J A;  1PZQ A;  3O6Q A;  1HWT C;  2AEJ A;  2B87 A;  2E4P A;  1EZV D;  2WSF J;  3RK2 C;  1FZB A;  4PD4 E;  1LP1 B;  1NTK D;  1JUN A;  5AW3 B;  1FE6 A;  3K5B A;  4PD4 H;  1K05 A;  3II6 A;  3TGU J;  1GTW A;  4EI2 A;  4NB9 D;  1O7P A;  1BE3 J;  3HD7 A;  1H88 A;  5AW1 B;  1O7W A;  2FFD B;  2Y9Y A;  1EC5 A;  1L0N J;  1KQF B;  5AVX B;  4HM1 A;  2XRX A;  3G4S P;  2N1T C;  2AEF A;  2E42 A;  1O7N A;  2O01 J;  1CI6 B;  1O7G A;  2JWA A;  1HJ0 A;  4JYC A;  3M0D A;  3IN6 A;  2J59 M;  3GB4 A;  2YKQ A;  1KOR A;  1VQ7 P;  1U7J A;  1HUC A;  5KTB A;  1RY3 A;  1N73 B;  2C9N Y;  3H1H E;  1H8A A;  1JM0 A;  1L4A A;  4IFM A;  5KLI C;  1NTK G;  2HPC B;  2DE5 D;  4H44 C;  2M3B A;  1Q7Y Q;  1KTM A;  2BEZ F;  2KYV A;  2RN0 A;  4KT0 J;  4C7N A;  1KV4 A;  3WUV A;  4KHX A;  3SWK A;  3H25 A;  2K37 A;  2GUS A;  3WU2 H;  2CPB A;  3PJS K;  1UUV A;  2NPS D;  3T97 A;  3RL0 C;  2XNX A;  3D71 A;  3L71 G;  2WPQ A;  2MJZ A;  3HUS C;  2OYH C;  1J2J B;  2E76 D;  1NTK K;  1SQV J;  1JCD A;  2LKM A;  5EFW B;  3H1I G;  2B88 A;  4AUW A;  2A45 G;  2KXP B;  3D6Y A;  5KJ7 A;  1SQX G;  1RHZ B;  1LTA C;  1KIL D;  5L8R J;  1VL2 A;  1MUU A;  1SQQ K;  3SFD C;  5E79 E;  1BCC G;  4XA4 A;  1N7L A;  1UII A;  1KMI Z;  2FYU J;  2OYH B;  2HML A;  1H89 A;  3B5N D;  3WUU A;  2H43 A;  3L75 J;  5AW2 B;  2QJK C;  4NPD A;  1QLE D;  2W27 A;  1KZU B;  3H1K D;  3GCE A;  4W80 A;  4LLH A;  2M8R A;  2XU6 A;  4NB8 D;  1JB0 J;  1JO5 A;  5AW6 B;  4K35 A;  1VDF A;  2BMR A;  4MN4 C;  3M06 A;  1KFM A;  1EZV I;  5E79 H;  2R3C A;  4HM5 A;  3C8V A;  4IL6 X;  1P84 E;  1BGY G;  1LT9 C;  3AEB C;  1AJY A;  1GU5 A;  3M9B A;  1X0T A;  1N73 A;  2JP3 A;  3AEG C;  1SS1 A;  1RF1 C;  3EN1 A;  3LID A;  2E74 B;  4Y99 C;  2L91 A;  2Z5I A;  1NTM J;  3GHG B;  4RKU J;  1VQ9 P;  1AFO A;  1EDL A;  5K5G B;  5APV A;  4N78 D;  3RK3 B;  4GKG A;  1RIE A;  4QDF B;  1IO4 A;  1Y9B A;  3PHL A;  1T3J A;  2OYI C;  3KZI H;  3TNU B;  4U3F G;  3VN0 A;  3I55 P;  2FYU E;  4C7N B;  4PV1 D;  2O1J A;  3CCQ P;  1BCC J;  1GW4 A;  3VP8 A;  2QVA A;  1FS0 E;  3PRJ A;  3A5T A;  3AEF C;  2Q3E A;  4WY4 C;  3SWF A;  3IR9 A;  3CWB D;  1L4A B;  1VQ4 P;  2I1K A;  2JKV A;  4YTP C;  1VF5 C;  4NBF D;  3V5B A;  4W7Y A;  1ZR2 A;  1R5L A;  4ZMD A;  1EQ7 A;  2QM8 A;  3AE6 C;  1NTM G;  2E74 D;  2OQQ A;  2OTJ P;  3N0Q A;  2I7F A;  1S9K D;  1U7M A;  5AVQ B;  4NBG D;  3USS A;  1UUW A;  5AEU A;  1BGY J;  3T97 B;  3GW6 A;  5GTH E;  1FJK A;  2ZT9 D;  2OGU A;  3CXH D;  1RE4 C;  4QMA A;  3U1A A;  3H1K E;  3L74 G;  1URQ B;  2RKL A;  3I5C A;  3RK3 C;  1EDK A;  1EZV E;  2AXC A;  3HUS B;  5DJT B;  1RE3 A;  2JR8 A;  1T8Z A;  2YKO A;  3E1I A;  3CCE P;  1BDC A;  3HRN A;  4HYT B;  4K3A A;  1VF5 B;  1T2K D;  1DH3 A;  3HUS A;  1JY2 P;  1L0N G;  3IAO A;  5DJU B;  3BAT A;  5APX A;  1E5W A;  2HOD A;  1PPJ D;  2BAS A;  3AED C;  1YTZ T;  2I8D A;  4L73 A;  4N78 E;  3L75 G;  5AVZ B;  1NKZ B;  3V2Q A;  2D2C D;  5APS A;  2WSF H;  4ZKU A;  2WSC J;  4UB8 H;  1M1J C;  1QVF O;  4QDF A;  1DIP A;  1NU1 G;  1ULJ A;  1GW3 A;  3BCC E;  2JO1 A;  3AE7 C;  1M1K Q;  3A0B E;  3GHG A;  1LTS C;  2IDB A;  2N9B A;  4HKZ H;  5CCG C;  4LC1 A;  4H13 B;  3H1K G;  1HH0 A;  1RF0 A;  2XZR A;  1LTJ B;  1PL5 A;  2K3R A;  1SQX K;  4IFF A;  5H2F H;  3GL2 A;  3MIW A;  1SQV D;  1VQN P;  3CME P;  1CZQ A;  1OVV A;  4OH8 B;  3VYI A;  2W90 A;  1S9K E;  5CJ4 A;  1GMJ A;  2H89 C;  3P32 A;  4GOE A;  2QE7 H;  2Q9I A;  1ZOY C;  3L70 G;  3CCU P;  4QCK A;  3M9H A;  3P7K A;  3TDK A;  4LGD E;  1HTL C;  4AIV A;  2NVG A;  3RL0 D;  4ZKP A;  3VMZ A;  1W2E A;  4R4M A;  4YXD C;  1DX7 A;  2QJY C;  3OW2 O;  5APQ A;  1S5L H;  2OYI B;  3Q1M A;  2D2C B;  1SQB G;  1VQP P;  2JEE A;  4DT0 A;  2FKW B;  3H6P A;  3H1H D;  3TYY A;  1GK6 A;  2Y9Z A;  3GG2 A;  2FYU K;  1KYO H;  3H1J G;  5CMZ A;  5KLI B;  1KIL C;  4XFJ A;  1SQP E;  1A02 J;  3H1I J;  1OIP A;  5AVV B;  1BDD A;  3V4Q A;  1JTH B;  3F5H A;  3SFE C;  1YQ4 C;  4O9B A;  2I1J A;  1KQG B;  3H1L J;  3H1I E;  4HM6 A;  2PRR A;  1VQK P;  3OJA B;  2G8Y A;  1YBK A;  1S1C X;  4PV1 C;  2JO6 A;  1IFN A;  1FAV A;  3EWK A;  2LXB A;  3VMX A;  3RK3 E;  1AVO A;  2N1T A;  1IFD A;  1D7M A;  1PPJ G;  4PJ0 E;  3W68 A;  3HE5 A;  2SPZ A;  4NPE A;  1USD A;  2JDI H;  1S5L X;  1GDT A;  2NPS A;  3L74 E;  2Q3I A;  3PTZ A;  4JQ0 D;  1NTK E;  2E4Q A;  1X8Y A;  1NTZ G;  3KYQ A;  2QJK B;  5AVU B;  3VMA A;  5KLV D;  2WIT A;  1KFN A;  1PP9 E;  2GUV A;  3S4R A;  1JCC A;  3LW5 J;  3TK1 A;  2A06 D;  2WSS H;  1VF5 D;  1LWU C;  4UB6 H;  1OWA A;  5AW8 B;  4C46 A;  3B4S A;  2JWD A;  3CC4 P;  2IZ1 A;  3L71 E;  3AEE C;  5KLV G;  3TGU G;  1IFP A;  3L73 G;  2K1A A;  3FXD A;  1NYH A;  1GD2 E;  4I7Z B;  3C0D A;  1EDI A;  4N3Y B;  1NAY A;  2FYN C;  2ZXX A;  3MUD C;  4UB8 E;  1AQ5 A;  2K88 A;  3ABV C;  1ZW0 A;  2ZYG A;  1M90 Q;  3CCJ P;  1VQM P;  1FJP A;  2D2C C;  1PGJ A;  3A0B H;  2ZJS E;  1ULI A;  3EFG A;  2K9J B;  1G2C B;  3L37 A;  1T6A A;  2E75 D;  1JNM A;  4U3F J;  1ZN5 A;  4ASV A;  1OMI A;  2R5D A;  5KLV K;  3CCL P;  1X9V A;  3KHU A;  4U3F D;  3AE9 C;  1M56 D;  1YQ3 C;  5B66 H;  1SLQ A;  5C39 A;  2PFX A;  2YVJ B;  2QJY B;  3GLM A;  3MZW B;  4CPG A;  1N8R Q;  1SQQ G;  3CCM P;  3A0H E;  5B66 E;  4H0L B;  3NXS A;  4GOF A;  3G3Z A;  3L35 A;  2OYO A;  3RK3 D;  1J1E C;  3LW5 H;  1EXI A;  3H1J D;  4NBA D;  1Q90 C;  1VM9 A;  3S1K A;  2KUB A;  1FZE A;  2FXM A;  3HD7 C;  3B5N C;  4YXW H;  2QRX A;  2DW3 A;  2AEM A;  2R3S A;  3IFM A;  3CL3 D;  1SJG A;  4D6T E;  3AE5 C;  2FXO A;  3L74 J;  1J1E B;  3P8C D;  5AVS B;  1X22 A;  3RL0 B;  1KIL E;  2BCC G;  1G2C A;  3CXH H;  1LTT C;  1LTJ A;  2E76 C;  2B87 B;  5BU8 B;  4HJG H;  2A06 G;  1KB9 D;  5HL4 A;  1L4A C;  2YFL A;  1Y47 A;  3QWO C;  4EYY Q;  1LTB C;  3VMI D;  1SFC A;  4DJG A;  1LT9 A;  1SQV K;  4W7Z A;  1GU4 A;  3GMA A;  1W2B O;  4HM0 A;  4QUQ A;  4AQR D;  1Q86 Q;  5KJ7 D;  2DE7 D;  1NVO A;  1QVG O;  1P84 D;  2OTK E;  3O8Z A;  3AEC C;  1LGH B;  2FYN B;  3N4X A;  1GL2 B;  1JMM A;  3G9R A;  3U1C A;  4JYB A;  2Y0D A;  2E74 C;  3M91 A;  1J1D C;  4PJ0 H;  1DD3 A;  3CX5 H;  1OX3 A;  5GTH H;  3GKE A;  4HM3 A;  1GL2 D;  2HMO A;  1NH4 A;  3W67 A;  1KQL A;  1IC2 A;  4R4L A;  5CCH C;  3BVH A;  2YFI A;  2E5T A;  2WSE H;  1NGM B;  2NPS B;  1SQV E;  1ZR4 A;  4GDO A;  3FWL A;  1IZN B;  3L4F A;  1FDO A;  2NUM A;  2P58 A;  3V6I A;  4EMJ B;  4U7J A;  2K9J A;  1NTZ E;  3L36 A;  3FWN A;  4GIF A;  2ZYL A;  2N1T B;  2V4H A;  4NBB D;  5BVZ A;  1W5C E;  2WT7 A;  2IYO A;  3G6E P;  3AZC A;  3BRT B;  2W6J H;  3BAS A;  2G3A A;  4H13 D;  2KLU A;  5CCH D;  3EFF K;  3WU2 E;  2XV5 A;  4OGQ D;  4RES B;  3GZX A;  3E1R A;  5TJH A;  1FDI A;  4M3L A;  4YPC A;  1YTZ I;  1J1D B;  2QEX P;  3SSU A;  1OW6 A;  5TIS E;  1CSB A;  1KQS O;  1AV1 A;  2ITA A;  1HBW A;  3FX0 A;  3EQ2 A;  3Q5S A;  1NYK A;  1N7S C;  1SQP G;  2WTY A;  1KB9 H;  4NBC D;  4HKV A;  1SQV G;  5KJ7 C;  3H1L D;  4JPZ B;  4EIJ A;  3KDP B;  1SQP D;  1Z56 A;  5B5E E;  3TGU E;  2WZ7 A;  3AE3 C;  3E7K A;  2QJP B;  3PP5 A;  1SFC D;  2ZT9 C;  4I1L A;  3OA7 A;  3AE8 C;  1N73 C;  3H1I D;  2IPP A;  1FU1 A;  4PD4 I;  4QUR A;  3RBX A;  1RFS A;  4KJM A;  1PP9 G;  1RQU A;  1GK4 A;  1DD4 A;  1JY3 O;  1VQ8 P;  3CI9 A;  3HTK B;  1KB9 I;  1FQT A;  2OAR A;  1MKM A;  1CI6 A;  1RH5 B;  3CX5 D;  1K04 A;  5KLV E;  3QH9 A;  1NTZ D;  1NU1 E;  2IZ0 A;  1PGQ A;  1FZC C;  2LXC B;  1VQ5 P;  1UIX A;  4WY4 D;  2BEQ D;  2C0X A;  1IFI A;  2HMJ A;  1KN7 A;  2FFD A;  3M0A A;  3H1H G;  1RF1 A;  3BCC J;  2PGD A;  2CPS A;  1QEX A;  1WQL A;  4WY4 B;  1N86 A;  3JCU E;  1L0N E;  1KYO E;  1XTG B;  5AW9 B;  1BSH A;  2UWJ E;  1USE A;  1BE3 E;  1FZC B;  1KIL A;  4QUP A;  2E5Y A;  2RMZ A;  1FBM A;  1L4A D;  1P84 I;  3CWB G;  3RK2 B;  2R44 A;  3D89 A;  3L71 D;  3VMG D;  1KC8 Q;  4L75 A;  3H1J E;  3D6Z A;  2WVR A;  4HH2 A;  3VCP A;  2JJL A;  2H8P D;  3HE4 A;  4PV1 B;  2XDJ A;  5AW7 B;  3Q2Y A;  4L76 A;  2KOG A;  2M5A B;  2HMK A;  1FDM A;  2WPV B;  3HE4 B;  2QSI A;  2BCC J;  1JY3 P;  3FOU A;  1VCK A;  1YHQ P;  2KZI A;  1L0L J;  1T3U A;  3Q3D A;  1NTM D;  2GM4 A;  3N7N A;  2NRG A;  3L73 D;  4H44 B;  4I6M C;  2HOD B;  3L72 J;  2AXT H;  1OFC X;  1EDJ A;  2HLO A;  3JC2 2;  5KAF H;  4IL6 H;  3WUT A;  1O7H A;  3CPW O;  3O6Q B;  1RF0 C;  2K9Y A;  2WMM A;  3I56 P;  1SQP K;  3EQQ A;  3H32 A;  5KAI E;  1IK7 A;  2RH0 A;  1YIJ P;  1G8K B;  2YO3 A;  5KAI H;  1QX8 A;  4ZNC A;  2W6B A;  3CX5 I;  2XKM A;  2YXQ B;  3H32 B;  4BXL A;  3GTE A;  4Z1M H;  1NAF A;  3P8C E;  2YXR B;  3CCR P;  1T2K C;  5KAF E;  4IL6 E;  3B8E B;  3B5N B;  2ZVN B;  2KI7 B;  1Q81 Q;  4DOJ A;  2IYP A;  2N9Y B;  2KLV A;  3MUD A;  3MP7 B;  3CC2 P;  3PH0 A;  2PP6 A;  2QA4 P;  4OVN F;  1M7L A;  1QL2 A;  1G1J A;  1HF9 A;  1NDO A;  3A7O A;  3VCA A;  3L70 D;  1GL2 C;  3L73 J;  2H7H A;  1M57 D;  5B5E H;  1FOS F;  1Q2N A;  1QGK B;  1N7S B;  2Q6Q A;  2YKP A;  1ZV8 A;  1DEB A;  2GA1 A;  2W8Z A;  3TNU A;  3F89 A;  4HM2 A;  2YFJ A;  4A7P A;  1LNQ A;  2A45 I;  4HM8 A;  2N1T D;  4GT1 A;  2HFE D;  3R2P A;  1NTZ K;  1O7M A;  1SQX D;  4HJL A;  1LJ2 A;  2C0W A;  1JOC A;  3GTS A;  1SQX J;  4D6T J;  4Y99 B;  1HGV A;  4RJT A;  2ZXE B;  4C7R A;  2IFN A;  2YMK A;  4D6T G;  4WY4 A;  1P84 H;  1NTM K;  1M8O B;  1JTH A;  1NU1 J;  5APW A;  1Y8A A;  1OXZ A;  2HG5 D;  2YIU C;  2FBW C;  5AW5 B;  3B71 A;  2YMY A;  2Y0C A;  3V2R A;  3KQG A;  2J5U A;  1E79 H;  4GOD A;  4I2L C;  3HTK A;  4L74 A;  2XND H;  2V7Q J;  3H1J J;  4DZO A;  2KNC B;  2A45 H;  1ZRT D;  4U3F E;  1IJD B;  1PFI A;  2YNY A;  2C9L Y;  4P1C H;  1XTC C;  2Y0E A;  1AVY A;  1GZL A;  2VRS A;  3IF4 A;  3M0D C;  3MGN A;  2WT7 B;  1L0L D;  2ZAE B;  3BRV B;  1L0L K;  2FYU G;  3WMM 0;  1LTG C;  4OWF A;  1URQ D;  1JY2 O;  5AW0 B;  1N7S A;  3L70 E;  3RK2 D;  3BCC G;  1JEK A;  1MZ9 A;  2HMM A;  3H1H J;  1NHL A;  2CKF A;  2ZT9 B;  5KLV J;  2O01 N;  1M1J B;  3CC7 P;  3CLQ A;  1G8J B;  2AXT E;  3LIE A;  5APU A;  1WRG A;  4JBZ A;  2Z4E A;  2B89 A;  1SQQ J;  3VTP C;  4HM7 A;  1G1I A;  1N2D C;  4TT3 H;  5AVR B;  1SQQ D;  2KS1 B;  2R5B A;  1H0T A;  3C1L A;  3VOP A;  2KNC A;  1PGO A;  2M0B A;  3GF3 A;  1CW5 A;  2OYI A;  2HR3 A;  2FYU D;  2W6A A;  3U59 A;  3FGA D;  5TIS H;  2Z5H A;  1YJW P;  1RE4 A;  3CX5 E;  2O01 H;  3CWB E;  1K8A Q;  3TF5 A;  3V4W A;  5AVW B;  2OTL P;  1NKN A;  4NBH D;  2FYZ A;  3JSV C;  4EOT A;  1FC2 C;  3FXE A;  5CCH A;  2WPS A;  3HD7 B;  1OW8 A;  3H1L G;  2KP8 A;  2HMN A;  3AE1 C;  2ZFC A;  4UB6 E;  2QG4 A;  3CCV P;  1KYO D;  1L0N D;  3V2N A;  1BE3 D;  1LP1 A;  2ZYD A;  1FOS E;  1KB9 E;  3SWY A;  1SQB D;  3RBZ A;  1WMK A;  4NBD D;  2O1K A;  2HYN A;  3KPE A;  4H0L C;  2KIK A;  2DE6 D;  3VMH D;  2IBZ G;  1R8E A;  4WVZ A;  4IOI H;  1EG9 A;  4BRY A;  3GOB A;  2M5A A;  1NTZ J;  4OGQ B;  1EXJ A;  5AVY B;  1Q82 Q;  3A2A A;  3L70 J;  4P1B H;  5H2F E;  2WPR A;  1PGP A;  3CWB J;  4BRY B;  2JZA A;  2W83 C;  3GHG C;  1SQB E;  3A0H H;  1VQO P;  1QL1 A;  2P7J A;  1IFJ A;  1L2P A;  1OZH A;  5BOK A;  2P10 A;  5CBO A;  1KIL B;  1JY3 N;  3JCU H;  4NPF X;  1JY2 N;  1YJN P;  2B9B A;  2IFM A;  1NO4 A;  2QJP C;  3CD6 P;  1PIX A;  5M1B A;  1BGY D;  1KYO I;  4B86 A;  2Q5U A;  3UIA A;  3V2P A;  5BU5 A;  4WBA A;  3B5N A;  1SQQ E;  1L0N K;  4N6J A;  2E76 B;  2WSE J;  1S5L E;  2PAJ A;  1SFC C;  2M3E A;  1M1J A;  3AEA C;  2YO2 A;  1Q90 D;  2NVF A;  3L74 D;  2P2U A;  1L0L G;  3CXH E;  2LR2 A;  1URQ C;  4JF7 A;  3MTU E;  1U57 A;  1SQB K;  5APT A;  1LTJ C;  2GBX A;  1ZXG A;  5AVT B;  1BCC D;  3G71 P;  1N7S D;  3D70 A;  2KS1 A;  1S72 P;  1WT6 A;  1OVU A;  3MHV A;  2J58 A;  3VP9 A;  1SVF A;  1EZV G;  3DQY A;  1FZC A;  4WWI A;  2WWW A;  2E75 C;  3RL0 g;  1BSN A;  2A06 E;  1X79 B;  3A3Y B; 
#chains in the Genus database with same CATH homology
 2BMO A;  4P1B H;  2BCC E;  2E75 D;  1L0N E;  1KYO E;  2NVE A;  4H44 D;  4HM7 A;  1JM1 A;  2DE7 D;  1EZV E;  1ZRT E;  4QCK A;  1BE3 E;  3GTE A;  1UUV A;  2NUK A;  1BCC E;  2JZA A;  3L72 E;  2XR8 A;  4QUP A;  2IBZ E;  2XSO A;  1NYK A;  2YIU C;  1SQB E;  3D89 A;  3L75 E;  1RIE A;  2QPZ A;  4QDF B;  4AIV A;  4H0L D;  3VMG D;  5BOK A;  2NVG A;  2E76 D;  5KKZ C;  1L0L E;  2E4P A;  2YVJ B;  3L74 E;  4NBC D;  3H1J E;  4PD4 E;  1NTK E;  2E4Q A;  4HKV A;  3VCP A;  2QJY C;  2QJP C;  1PP9 E;  2FYU E;  3CX5 E;  3TGU E;  3GKE A;  4PV1 D;  4AAY B;  4HM3 A;  2XSH A;  4NBA D;  1Q90 C;  4NB9 D;  1O7P A;  2HMO A;  1VM9 A;  3CWB E;  2HMK A;  1VF5 D;  1O7W A;  1SQQ E;  4U3F E;  1NTM E;  2YFI A;  4HM1 A;  2D2C D;  2XRX A;  4NBH D;  3FOU A;  1VCK A;  4P1C H;  2HML A;  1NDO A;  1SQV E;  3VCA A;  4NBF D;  2B1X A;  3L71 E;  2HMN A;  4QDF A;  1O7N A;  1SJG A;  3GL0 A;  2NVF A;  4D6T E;  1ULJ A;  1SQX E;  1SQP E;  2NUM A;  4QUR A;  2QJK C;  4EMJ B;  1O7G A;  3CXH E;  1RFS A;  3BCC E;  1NTZ E;  2JO6 A;  2ZYL A;  1BGY E;  3GCE A;  2B24 A;  2E74 D;  3GB4 A;  3C0D A;  3N0Q A;  1FQT A;  2I7F A;  4NBB D;  4HM2 A;  4NB8 D;  3L70 E;  5AEW A;  2GBX A;  2YFJ A;  1KB9 E;  2NWF A;  4NBG D;  2FYN C;  4QDD A;  4HM4 A;  2HMM A;  3H1L E;  2GBW A;  4NBD D;  3AZC A;  2BMR A;  2CKF A;  5KLV E;  4HM8 A;  1NU1 E;  3GZY A;  1O7H A;  2DE6 D;  3H1H E;  1UUW A;  3VMH D;  4HM5 A;  5AEU A;  5HL4 A;  1O7M A;  2YFL A;  4H13 D;  1P84 E;  3DQY A;  4HJL A;  4NBE D;  1G8J B;  5KLI C;  3H1I E;  2BMQ A;  1EG9 A;  3EQQ A;  1PPJ E;  2ZT9 D;  2HMJ A;  3GL2 A;  3GTS A;  2Q3W A;  3L73 E;  2DE5 D;  3GOB A;  4HM6 A;  4OGQ D;  3VMI D;  3GZX A;  1ULI A;  5CXM A;  3H1K E;  2A06 E;  3EN1 A;  1WQL A;  4HM0 A;  4QUQ A;  1G8K B;  4QDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...