2FYUG

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
b'GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
molecule tags Oxidoreductase
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 2fyuG00
1SQQG 3CWBG 1PPJG 1KB9H 1NTMG 1EZVG 2A06G 1SQVG 3L72G 5KLVG 3H1IG 3L75G 3TGUG 2BCCG 2IBZG 4D6TG 3CX5H 1L0NG 1SQBG 1NTZG 1L0LG 1NU1G 1KYOH 3L71G 3BCCG 1BGYG 3L74G 3L70G 1SQXG 4PD4H 3CXHH 3H1HG 2FYUG 3L73G 1P84H 4U3FG 1BE3G 1PP9G 1NTKG 3H1KG 1BCCG 3H1JG 3H1LG 1SQPG
chains in the Genus database with same CATH superfamily
3GW6A 2E74C 1L0NJ 1CW5A 2FYUJ 2OTKE 1PP9D 3H1IJ 2OYHB 1WRGA 4O9BA 1IC2A 2KNCB 3L75G 2ZT9D 3TNUA 1VQMP 3L72J 1KQSO 4GOFA 1RF1A 5AW1B 2KNCA 1ZRTE 1AV1A 2VRSA 3EWKA 4I7ZB 4H0LB 4WY4C 4D6TG 3KYQA 1D7MA 1L0NG 1K9MQ 4H13D 1LT1A 2KYVA 1HVVA 3VTPC 5APQA 1Q82Q 3L75J 3A5TA 2NRGA 3CMEP 2E42A 3GF3A 1R5LA 1L0LD 1RQVA 4WVZA 2OTLP 1DX7A 3E7KA 3RL0B 1PL5A 2E5YA 2H89C 2K37A 2FY8A 3G3ZA 1N2DC 3II6A 2DW3A 4GT1A 5AW5B 5GTIE 1RE4C 2M3EA 2WT7A 1JUNA 1FS0E 2FXPA 1SQBK 3B8EB 3USSA 2B88A 1OZHA 3V2RA 4ZNCA 1JY2N 2WSEH 5KLVE 3NMDA 3H1JG 1T6AA 1M8OB 3AE4C 3LIDA 1JY3N 3E1IA 5AW4B 3CCMP 1T8ZA 1NTMG 3SWKA 2ZFCA 2Q3EA 1YJ9P 2IYOA 3AEBC 1G1IA 1IK7A 3VMXA 2HPCA 1N7SA 3CC4P 1GK6A 2QEXP 1R5SA 5AVVB 2GUSA 3FWLA 3G4SP 1XTGB 2R3CA 1NKNA 3AEGC 1H88A 3V4QA 1FDMA 2PAJA 1URQC 2E43A 5AVYB 2QJPC 1SQBE 1M57D 2XNDH 2ZJSE 3B5ND 3FWNA 3OA7A 5AVZB 5CCHD 1DD4A 3H1LD 1OVVA 1OW7A 1SQPJ 1H8AA 3Q2YA 1NTKE 3L73G 1GU5A 2P58A 1VQ4P 2QJKC 1P84H 2GM4A 2OYHC 3SFDC 1X8YA 2OYOA 3B5NC 4PJ0H 1KB9D 2E74B 5C39A 2RKLA 1SQVE 3H1HD 3TSIA 5CCGA 2Y9ZA 4C7RA 2O1JA 2E74D 1SQPG 3CXHI 3CC7P 1VQ6P 1JOCA 2LKMA 1JEKA 3O6QA 3S9OA 5KLVK 4UB6H 1KFMA 1BGYJ 4YPCA 3U1CA 1MZ9A 1T2KD 3LIEA 2I8DA 5B66H 2B9BA 3P8CE 4EDFA 2QJYC 3D71A 3L70D 2CK3H 3AEEC 2AEFA 3BCCG 1BGYG 3HD7D 3PHLA 1N73B 1KTMA 3WU2H 5APSA 2D2CD 2J5UA 2V4HA 3GF7A 1FBMA 2ZVOB 2QM7A 4ASVA 3ZDMA 1SS1A 3A0BH 3RBZA 1IFDA 3WUTA 4DZOA 2MJZA 1Q81Q 1BE3E 1SQQK 2AXTE 3H1HG 4UB6E 1HF9A 2ZXXA 1LTJC 3AEDC 4IL6X 3AE9C 3P32A 1VQPP 3EFFK 3L72D 3CWBD 1OXZA 1YJNP 2FYNB 1M1JC 2C9LY 1NTKG 2WSEJ 4WWIA 4I2LC 4BRYB 1A02F 1VQLP 1PP9J 3M0DA 2P2UA 3H1LG 2BCCE 1P84E 1S2EA 2E76B 3H1HJ 4A7PA 4CPGA 3A3YB 2HG5D 2IPPA 3L35A 2OYIA 1GL2B 1VQ5P 1J1DC 1SQVG 3GMAA 4LGDE 3TDKA 2WSFJ 1LTJB 3C1LA 1S4XA 5BU8B 4NPDA 5CHXA 1G2CA 1NTKJ 1BGYD 2GUVA 2YMKA 5KJ7D 3I55P 1SQXD 3L73E 1G2CB 2WPRA 4OH8B 3HE4A 1ZOYC 1S3JA 1VL2A 2QJPB 3L71G 1LT9B 1LTBC 2FYZA 1S1CX 3CCSP 1VQKP 2IDBA 3NXSA 3BASA 5APTA 1ZP0C 1KILC 1KQLA 3L71D 3AE1C 1T2KC 5AVQB 3P8CD 5DJUB 3RBXA 2HR3A 1KFNA 4JPZB 1AQTA 2IBZE 1AQ5A 2Q1KA 3MP7B 1MFZA 1QL1A 2AXTH 1HGVA 2JR8A 4OGQC 3L73D 2Q9IA 2J58A 2OGUA 3D6YA 1IJDB 2B89A 1NAFA 2ZYGA 2HPCB 2KIKA 1NU1D 3L72G 4W7YA 1K8AQ 1HJBA 1OIPA 2WMMA 2XKMA 2BCCG 3HD7B 1W2EA 3M0DC 1NU1E 5GTHH 3V5BA 4D6TE 2WVRA 3L70J 3CMAP 1Q86Q 3G71P 2B87A 1ZW0A 2SPZA 1N73C 2C0WA 3I56P 1SFCD 1PGPA 1R8EA 1RH5B 2KXPB 1SVFA 2IBZI 2JDIH 3M9BA 4PD4E 1HWTC 3RL0D 2WSCJ 3F89A 1HUCA 2LXBA 2WWWA 3L70G 3L74J 2L5GB 4MN4C 1FZCB 1SQXJ 3C9IA 3CX5D 5H2FE 3PP5A 3CD6P 1KILD 2Y0CA 3CX5E 1FU1A 4IFMA 3MHVA 1FZBA 4W80A 5GTHE 1ZMEC 2RMZA 2HLOA 3H1JJ 2QA4P 1KYOE 3PLNA 1QL2A 2QJKB 3L71E 5CBNA 1XTCC 3GG2A 1BDDA 4PD4I 2A45G 5AW6B 2OQQA 1K04A 4KJMA 2POHA 2IZ0A 3JCUH 1EDIA 1LJ2A 2Q6QA 4HKZH 2QRXA 1FZGA 2P10A 1QVFO 2UWJE 3FGAD 2HODB 5CCGC 2WTYA 1FOSE 3G6EP 4BXLA 5CCHA 3A0HH 2MKVA 2BCCD 1NU1G 5BU5A 1S9KD 2PGDA 4D6TD 1L4AD 5CJ0A 1AA0A 3VMYA 1M7LA 3R2PA 1VQNP 2FYUE 3MGNA 2KK7A 1KMIZ 3TK1A 1PFIA 2A45H 4WY4D 1JY2P 1KB9I 4R4LA 1FZCA 2HFED 2K9JA 2KZIA 1VQOP 1AVYA 1YHQP 4N3YB 2G3AA 1BCCD 2R44A 3BCCJ 1JMBA 4OGQB 2FFDB 1IZNB 2WQYC 3ITKA 1S5LH 3KDPB 3HUSA 1ZXGA 1HTLC 1NTMD 3JSVC 4JQ0D 5GTIH 3T97B 4OVNF 1S72P 4LC1A 3PRJA 5TISE 1SQQG 2N9YB 4GODA 1AJYA 2O01J 3FXEA 3KHUA 3M9HA 5KLVG 2M5AB 1HGZA 4UB8H 3C8VA 5KAFE 4C46A 1PPJE 1PZQA 1EQ7A 2K88A 1M90Q 4KHXA 1JO5A 3H1LJ 4H44C 4HYTB 2J59M 1DEBA 1NTZG 1L0LG 5AW2B 1VDFA 1EDKA 1SQVJ 2K1AA 5KLVJ 2ZXEB 3F5HA 1GW4A 4N78D 2N1TC 2M3BA 2PP6A 1BE3D 4L73A 1JTHA 3IR9A 2ZYAA 1NTKD 1L0ND 1L4AA 1ZRTD 3A7OA 3IAOA 5E79H 1NTZJ 1M1JA 1RY3A 1SQPK 1W5CE 2WZ7A 4L74A 4QMAA 1URQA 2NZ2A 1J1EC 1L0NK 4JYCA 4OGQD 1PGJA 1NU1K 1PP9G 2IX7C 3FXDA 2OYIB 4YTPC 3CCRP 1RF1C 1ZLLA 3TGUE 1T3JA 3MZWB 3P7KA 4IL6H 5M1BA 3D70A 1X0TA 1OVUA 1EZVG 3BCCD 3WU2E 5H2FH 2KSEA 1BCCE 1USDA 2G8YA 2WSFH 1GL2D 3AECC 3RL0g 2HYNA 3S1KA 1NKZB 2QE7H 3JCUE 3IN6A 5B5EE 3JC22 2O01N 2Y0DA 2ZT9B 3EQ2A 1Q7YQ 1LTSC 1KYOH 5TJHA 1GMJA 2BCCJ 1N73A 1JCCA 1FC2C 1KB9E 5B5EH 3AE8C 5KTBA 1SQQE 4OWFA 1S5LX 3CXHH 3IFMA 2H8PD 4ZKPA 1RQUA 1OWAA 2GA1A 1ZV8A 3AE2C 3KXDA 4AQRD 1KQGB 4PV1D 1VF5B 3H1KD 1BSNA 4DJGA 1OVRA 1MKMA 1M56D 2K9YA 2N1TA 2W83C 1IFPA 1K05A 2K3RA 1NTZK 2XU6A 3I5CA 1OMIA 1BE3G 1RE3A 2FYUD 1KILB 3H32A 3V6IA 4K35A 1LP1A 1WMKA 2QG4A 1NTZD 1N7LA 2E75D 2ZT9C 1NGMB 3AEFC 2JO1A 3B71A 2B87B 3LW5J 2W6AA 1NTME 2KP8A 2KSJA 3HD7C 5KLVD 3GHGA 2QM8A 3CX5I 1LP1B 2KLUA 2R5DA 3KQGA 3L36A 2R32A 3L74G 2JJLA 2BEQD 2V7QH 1JY2O 2C0XA 4N6JA 3H25A 1SQXG 2FXOA 4UB8E 4XA4A 3H6PA 3CWBJ 1NU1J 3CPWO 2YKPA 1MV8A 3AE7C 1RF0A 3M9QA 5L8RJ 3Q1MA 2OYIC 1YBKA 1KN7A 4IFFA 4U3FJ 4XE5B 1Z56A 3O6QB 2KI7B 3CWBG 3M91A 3BATA 3L37A 1KB9H 1Q90D 2O01H 2P7JA 2XDJA 2L91A 3HE5A 4KT0J 4R4MA 3VP8A 3VYIA 3H1IG 5CCHC 1EXIA 1N86A 1BDCA 1TU3F 2P67A 4H44D 2CPSA 3ABVC 1KYOI 3HTKA 4Y99C 3U1AA 4D6TJ 3H32B 3CXHD 1FDIA 3MUDA 3L75D 1GD2E 2FFDA 1HJ0A 1X79B 3HUSB 2M8RA 5DJTB 2N9BA 2IBZD 4IFDK 4WBAA 1K73Q 1OW8A 1LTAC 1N8RQ 1VQ7P 3VMZA 4W7ZA 4BWNA 2KS1A 2R3SA 1GL2A 1BGYE 1QEXA 1OX3A 2E76D 2HODA 2KOGA 3B5NB 1LNQA 3CLQA 4I6MC 2OYHA 2Z4EA 3L70E 4NPFX 1JMMA 1NVOA 2BEZF 2NPSD 1N7SD 1HH0A 1JY3P 5KJ7C 2KUBA 4PJ0E 1L0LE 1NOHA 1RE4A 1SQBJ 1IFJA 3L74E 1J2JB 4YXWH 1JCDA 3SWFA 1AVOA 1M1KQ 1IK9A 1Y8AA 2ITAA 3QH9A 4GDOA 3VP9A 2IYPA 3CWBE 2M5AA 1VQ9P 4PV1C 4C7NB 1T3UA 3Q5RA 1SQBG 1IO4A 1GDTA 4H13C 1Q2NA 1CZQA 2IFMA 3QWOC 3RK3B 2FYUK 1FJKA 4XFJA 3FX0A 1PGQA 5KJ7A 1RF0C 4JBZA 1KORA 4N78E 4H44B 3CI9A 5TISH 4PV1B 2WSSH 5AVTB 1KC8Q 2AXCA 3RK3E 3SFEC 4RESB 4DCKA 1OW6A 3PJSK 1VQ8P 4IOIH 1GL2C 2JKVA 3V2NA 1E79H 1VF5C 2I1JA 2YIUB 1UIXA 1E5WA 2YXRB 1FE6A 3L75E 3OAKA 4JYBA 5APVA 1YIJP 1LWUB 2ZYDA 5AVUB 3HUSC 3Q5SA 3HD7A 1YQ3C 1GTWA 2KLVA 4M3LA 3B4SA 4TLFA 1NTZE 2CPBA 2FFDC 1BE3J 2XZRA 5E79E 3BCCE 2JWDA 3VOPA 2E75C 1SQVD 3CCQP 3R4YA 1PIXA 1GW3A 3UIAA 3H1ID 1LWUA 2N1TD 1L0NE 2Z5IA 1KZUB 3H1HE 1NH4A 2QJYB 3H1IE 4L76A 5AW7B 1W2BO 1EDLA 4EI2A 1MUUA 1H89A 1PGOA 4DOJA 3VMAA 3L72E 2RN0A 3BRTB 3HRNA 3M06A 1SFCA 2YIUC 1ZN5A 4TT3H 3Q5PA 1A02J 5KLIC 3CCJP 2IFNA 2JEEA 3N4XA 1QVGO 2W6BA 3CCUP 4YXDC 3HE5B 1LTTC 1N7SC 1FZEA 1CSBA 1LTIC 4U3FD 3A2AA 1NWQA 3SSUA 2KZJA 3WUVA 5K5GB 3GHGC 2LR2A 1SQXE 2P1JA 1DD3A 2E5TA 3A0BE 3TGUG 3EFGA 3KZIE 3RK3C 2YKQA 1KQFB 1ZR2A 2IBZG 1DIPA 2NPSA 4H13B 1QGKB 4U7JA 1DEEG 1PV3A 4H0LD 2Q7CA 4WB4A 1FZAA 1NTKK 1JB0J 4JF7A 1USEA 2FXMA 2FKWB 1NYHA 2Q5UA 2YNYA 3L71J 1LT9A 2Y9YA 3TGUJ 2M0BA 4RJTA 4ZKUA 1YTZT 2ZAEB 1S9KE 1RE3C 3M0AA 4HJGH 1SQVK 5AW0B 2BASA 1SQBD 1BCCJ 1RHZB 1SQXK 2ZVNB 3E1RA 1MFTA 1LWUC 5APXA 4I1LA 1YJWP 2FYUG 2QIWA 2RH0A 2W90A 2WPQA 3AE3C 5APWA 4ASWA 3HE4B 4GOEA 1PPJD 2Q3IA 1LTGC 2WPSA 3N7NA 3TF5A 3CCEP 1FJPA 1L0LK 1P84I 1H0TA 1YITP 2O1KA 4WY4A 1IFNA 4L75A 5AVWB 2PRRA 2D2CC 2JP3A 2WSCH 1KYOD 3W67A 1ZR4A 3CCLP 1FAVA 1H0TB 1EXJA 2A06G 1NAYA 1NTMK 3AE5C 4B86A 1UIIA 4NPEA 3L74D 1SQPE 3PTZA 1S5LE 1NO4A 3HTKB 2N1TB 3WMM0 3D6ZA 1SP4A 5APUA 1KILA 1JY3O 1VF5D 3TGUD 3KZIH 4U3FE 4WY4B 4Y99B 5AVXB 4BRYA 3K5BA 1CI6A 1X22A 3O8ZA 1U7MA 5KAIE 1L4AB 4K3AA 3MD0A 2FYNC 5CBOA 2W6JH 3H1KJ 2W8ZA 1J1EB 1EZVI 3RK2C 3G9RA 1N7SB 2H88C 2Y0EA 3MUDC 4Z1MH 3OW2O 1NJIQ 2D2CB 4HB1A 3CC2P 1NTMJ 3GHGB 3H1LE 3L73J 1J1DB 4GKGA 4IL6E 4EOTA 3T97A 1DH3A 4PD4D 1FOSF 3H1KG 1L4AC 1KV4A 1CI6B 3MIWA 1AFOA 1GU4A 1LTJA 4AUWA 2YO2A 2KB7P 1URQD 3AE6C 2K9JB 3CL3D 1YTZI 3NFQA 3Q3DA 1LGHB 1BSHA 1QX8A 2PFXA 2WPVB 4EYYQ 2A45I 5CCGD 1JNMA 2IZ1A 5EFWB 5AW3B 5KAFH 1EZVE 1L2PA 1URQB 2JWAA 3A0HE 3CX5H 3GLMA 1KILE 5B66E 1EC5A 1EDJA 4C7NA 4H0LC 1GK4A 2YXQB 3RGUA 1PP9E 2NPSC 2XNXA 2QSIA 4I7ZC 1FDOA 2YKOA 5KAIH 3RK3D 5AW9B 2LXCB 3V2QA 4PD4H 3VN0A 4AYCA 1FZFA 3TYYA 3V4WA 1SFCB 4Y28J 2O3JA 2A06E 2E76C 1JTHB 2R5BA 4RO0A 3TNUB 4DT0A 3U59A 1RF1B 3H1JD 3OJAB 2A06D 1M1JB 1SQPD 3CCVP 2OARA 2I1KA 3RL0C 3W68A 1HBWA 4GIFA 1Y47A 3SWYA 1FZCC 5KLIB 5APYA 3V2PA 3CXHE 1GZLA 1VPCA 1SFCC 1PPJG 2H43A 4ZMDA 1SQQJ 2KS1B 3AEAC 3B5NA 3H1KE 3S4RA 1QLED 2QVAA 3P8MC 1P84D 5CMZA 1G1JA 2XV5A 2NPSB 3PH0A 5AW8B 2FBWC 5CJ4A 5KKZB 4HH2A 1Y9BA 1SLQA 2Z5HA 4EIJA 3RK2B 1LT9C 3BRVB 2V7QJ 3L4FA 5AVRB 5BVZA 1IFIA 2E75B 3H1JE 1JM0A 2YO3A 1OFCX 3IF4A 4LLHA 1YI2P 1L0LJ 3RK2D 1KD1Q 1U7JA 2C9NY 1NHLA 2AEJA 1YYCA 2WITA 4RKUJ 5KKZC 1X9VA 1WT6A 2AEMA 3LW5H 2WT7B 1SQQD 3WUUA 2YMYA 2OTJP 1U57A 3KPEA 3NTNA 3BVHA 3MTUE 5AVSB 2W27A 4U3FG 1EZVD 1YQ4C 1IFMA 2H7HA 1BCCG
chains in the Genus database with same CATH topology
1SQQG 3CWBG 1PPJG 1KB9H 1NTMG 1EZVG 2A06G 1SQVG 3L72G 5KLVG 3H1IG 3L75G 3TGUG 2BCCG 2IBZG 4D6TG 3CX5H 1L0NG 1SQBG 1NTZG 1L0LG 1NU1G 1KYOH 3L71G 3BCCG 1BGYG 3L74G 3L70G 1SQXG 4PD4H 3CXHH 3H1HG 2FYUG 3L73G 1P84H 4U3FG 1BE3G 1PP9G 1NTKG 3H1KG 1BCCG 3H1JG 3H1LG 1SQPG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ G;  3CWB G;  1PPJ G;  1KB9 H;  1NTM G;  1EZV G;  2A06 G;  1SQV G;  3L72 G;  5KLV G;  3H1I G;  3L75 G;  3TGU G;  2BCC G;  2IBZ G;  4D6T G;  3CX5 H;  1L0N G;  1SQB G;  1NTZ G;  1L0L G;  1NU1 G;  1KYO H;  3L71 G;  3BCC G;  1BGY G;  3L74 G;  3L70 G;  1SQX G;  4PD4 H;  3CXH H;  3H1H G;  2FYU G;  3L73 G;  1P84 H;  4U3F G;  1BE3 G;  1PP9 G;  1NTK G;  3H1K G;  1BCC G;  3H1J G;  3H1L G;  1SQP G; 
#chains in the Genus database with same CATH topology
 3GW6 A;  2E74 C;  1L0N J;  1CW5 A;  2FYU J;  2OTK E;  1PP9 D;  3H1I J;  2OYH B;  1WRG A;  4O9B A;  1IC2 A;  2KNC B;  3L75 G;  2ZT9 D;  3TNU A;  1VQM P;  3L72 J;  1KQS O;  4GOF A;  1RF1 A;  5AW1 B;  2KNC A;  1ZRT E;  1AV1 A;  2VRS A;  3EWK A;  4I7Z B;  4H0L B;  4WY4 C;  4D6T G;  3KYQ A;  1D7M A;  1L0N G;  1K9M Q;  4H13 D;  1LT1 A;  2KYV A;  1HVV A;  3VTP C;  5APQ A;  1Q82 Q;  3L75 J;  3A5T A;  2NRG A;  3CME P;  2E42 A;  3GF3 A;  1R5L A;  1L0L D;  1RQV A;  4WVZ A;  2OTL P;  1DX7 A;  3E7K A;  3RL0 B;  1PL5 A;  2E5Y A;  2H89 C;  2K37 A;  2FY8 A;  3G3Z A;  1N2D C;  3II6 A;  2DW3 A;  4GT1 A;  5AW5 B;  5GTI E;  1RE4 C;  2M3E A;  2WT7 A;  1JUN A;  1FS0 E;  2FXP A;  1SQB K;  3B8E B;  3USS A;  2B88 A;  1OZH A;  3V2R A;  4ZNC A;  1JY2 N;  2WSE H;  5KLV E;  3NMD A;  3H1J G;  1T6A A;  1M8O B;  3AE4 C;  3LID A;  1JY3 N;  3E1I A;  5AW4 B;  3CCM P;  1T8Z A;  1NTM G;  3SWK A;  2ZFC A;  2Q3E A;  1YJ9 P;  2IYO A;  3AEB C;  1G1I A;  1IK7 A;  3VMX A;  2HPC A;  1N7S A;  3CC4 P;  1GK6 A;  2QEX P;  1R5S A;  5AVV B;  2GUS A;  3FWL A;  3G4S P;  1XTG B;  2R3C A;  1NKN A;  3AEG C;  1H88 A;  3V4Q A;  1FDM A;  2PAJ A;  1URQ C;  2E43 A;  5AVY B;  2QJP C;  1SQB E;  1M57 D;  2XND H;  2ZJS E;  3B5N D;  3FWN A;  3OA7 A;  5AVZ B;  5CCH D;  1DD4 A;  3H1L D;  1OVV A;  1OW7 A;  1SQP J;  1H8A A;  3Q2Y A;  1NTK E;  3L73 G;  1GU5 A;  2P58 A;  1VQ4 P;  2QJK C;  1P84 H;  2GM4 A;  2OYH C;  3SFD C;  1X8Y A;  2OYO A;  3B5N C;  4PJ0 H;  1KB9 D;  2E74 B;  5C39 A;  2RKL A;  1SQV E;  3H1H D;  3TSI A;  5CCG A;  2Y9Z A;  4C7R A;  2O1J A;  2E74 D;  1SQP G;  3CXH I;  3CC7 P;  1VQ6 P;  1JOC A;  2LKM A;  1JEK A;  3O6Q A;  3S9O A;  5KLV K;  4UB6 H;  1KFM A;  1BGY J;  4YPC A;  3U1C A;  1MZ9 A;  1T2K D;  3LIE A;  2I8D A;  5B66 H;  2B9B A;  3P8C E;  4EDF A;  2QJY C;  3D71 A;  3L70 D;  2CK3 H;  3AEE C;  2AEF A;  3BCC G;  1BGY G;  3HD7 D;  3PHL A;  1N73 B;  1KTM A;  3WU2 H;  5APS A;  2D2C D;  2J5U A;  2V4H A;  3GF7 A;  1FBM A;  2ZVO B;  2QM7 A;  4ASV A;  3ZDM A;  1SS1 A;  3A0B H;  3RBZ A;  1IFD A;  3WUT A;  4DZO A;  2MJZ A;  1Q81 Q;  1BE3 E;  1SQQ K;  2AXT E;  3H1H G;  4UB6 E;  1HF9 A;  2ZXX A;  1LTJ C;  3AED C;  4IL6 X;  3AE9 C;  3P32 A;  1VQP P;  3EFF K;  3L72 D;  3CWB D;  1OXZ A;  1YJN P;  2FYN B;  1M1J C;  2C9L Y;  1NTK G;  2WSE J;  4WWI A;  4I2L C;  4BRY B;  1A02 F;  1VQL P;  1PP9 J;  3M0D A;  2P2U A;  3H1L G;  2BCC E;  1P84 E;  1S2E A;  2E76 B;  3H1H J;  4A7P A;  4CPG A;  3A3Y B;  2HG5 D;  2IPP A;  3L35 A;  2OYI A;  1GL2 B;  1VQ5 P;  1J1D C;  1SQV G;  3GMA A;  4LGD E;  3TDK A;  2WSF J;  1LTJ B;  3C1L A;  1S4X A;  5BU8 B;  4NPD A;  5CHX A;  1G2C A;  1NTK J;  1BGY D;  2GUV A;  2YMK A;  5KJ7 D;  3I55 P;  1SQX D;  3L73 E;  1G2C B;  2WPR A;  4OH8 B;  3HE4 A;  1ZOY C;  1S3J A;  1VL2 A;  2QJP B;  3L71 G;  1LT9 B;  1LTB C;  2FYZ A;  1S1C X;  3CCS P;  1VQK P;  2IDB A;  3NXS A;  3BAS A;  5APT A;  1ZP0 C;  1KIL C;  1KQL A;  3L71 D;  3AE1 C;  1T2K C;  5AVQ B;  3P8C D;  5DJU B;  3RBX A;  2HR3 A;  1KFN A;  4JPZ B;  1AQT A;  2IBZ E;  1AQ5 A;  2Q1K A;  3MP7 B;  1MFZ A;  1QL1 A;  2AXT H;  1HGV A;  2JR8 A;  4OGQ C;  3L73 D;  2Q9I A;  2J58 A;  2OGU A;  3D6Y A;  1IJD B;  2B89 A;  1NAF A;  2ZYG A;  2HPC B;  2KIK A;  1NU1 D;  3L72 G;  4W7Y A;  1K8A Q;  1HJB A;  1OIP A;  2WMM A;  2XKM A;  2BCC G;  3HD7 B;  1W2E A;  3M0D C;  1NU1 E;  5GTH H;  3V5B A;  4D6T E;  2WVR A;  3L70 J;  3CMA P;  1Q86 Q;  3G71 P;  2B87 A;  1ZW0 A;  2SPZ A;  1N73 C;  2C0W A;  3I56 P;  1SFC D;  1PGP A;  1R8E A;  1RH5 B;  2KXP B;  1SVF A;  2IBZ I;  2JDI H;  3M9B A;  4PD4 E;  1HWT C;  3RL0 D;  2WSC J;  3F89 A;  1HUC A;  2LXB A;  2WWW A;  3L70 G;  3L74 J;  2L5G B;  4MN4 C;  1FZC B;  1SQX J;  3C9I A;  3CX5 D;  5H2F E;  3PP5 A;  3CD6 P;  1KIL D;  2Y0C A;  3CX5 E;  1FU1 A;  4IFM A;  3MHV A;  1FZB A;  4W80 A;  5GTH E;  1ZME C;  2RMZ A;  2HLO A;  3H1J J;  2QA4 P;  1KYO E;  3PLN A;  1QL2 A;  2QJK B;  3L71 E;  5CBN A;  1XTC C;  3GG2 A;  1BDD A;  4PD4 I;  2A45 G;  5AW6 B;  2OQQ A;  1K04 A;  4KJM A;  2POH A;  2IZ0 A;  3JCU H;  1EDI A;  1LJ2 A;  2Q6Q A;  4HKZ H;  2QRX A;  1FZG A;  2P10 A;  1QVF O;  2UWJ E;  3FGA D;  2HOD B;  5CCG C;  2WTY A;  1FOS E;  3G6E P;  4BXL A;  5CCH A;  3A0H H;  2MKV A;  2BCC D;  1NU1 G;  5BU5 A;  1S9K D;  2PGD A;  4D6T D;  1L4A D;  5CJ0 A;  1AA0 A;  3VMY A;  1M7L A;  3R2P A;  1VQN P;  2FYU E;  3MGN A;  2KK7 A;  1KMI Z;  3TK1 A;  1PFI A;  2A45 H;  4WY4 D;  1JY2 P;  1KB9 I;  4R4L A;  1FZC A;  2HFE D;  2K9J A;  2KZI A;  1VQO P;  1AVY A;  1YHQ P;  4N3Y B;  2G3A A;  1BCC D;  2R44 A;  3BCC J;  1JMB A;  4OGQ B;  2FFD B;  1IZN B;  2WQY C;  3ITK A;  1S5L H;  3KDP B;  3HUS A;  1ZXG A;  1HTL C;  1NTM D;  3JSV C;  4JQ0 D;  5GTI H;  3T97 B;  4OVN F;  1S72 P;  4LC1 A;  3PRJ A;  5TIS E;  1SQQ G;  2N9Y B;  4GOD A;  1AJY A;  2O01 J;  3FXE A;  3KHU A;  3M9H A;  5KLV G;  2M5A B;  1HGZ A;  4UB8 H;  3C8V A;  5KAF E;  4C46 A;  1PPJ E;  1PZQ A;  1EQ7 A;  2K88 A;  1M90 Q;  4KHX A;  1JO5 A;  3H1L J;  4H44 C;  4HYT B;  2J59 M;  1DEB A;  1NTZ G;  1L0L G;  5AW2 B;  1VDF A;  1EDK A;  1SQV J;  2K1A A;  5KLV J;  2ZXE B;  3F5H A;  1GW4 A;  4N78 D;  2N1T C;  2M3B A;  2PP6 A;  1BE3 D;  4L73 A;  1JTH A;  3IR9 A;  2ZYA A;  1NTK D;  1L0N D;  1L4A A;  1ZRT D;  3A7O A;  3IAO A;  5E79 H;  1NTZ J;  1M1J A;  1RY3 A;  1SQP K;  1W5C E;  2WZ7 A;  4L74 A;  4QMA A;  1URQ A;  2NZ2 A;  1J1E C;  1L0N K;  4JYC A;  4OGQ D;  1PGJ A;  1NU1 K;  1PP9 G;  2IX7 C;  3FXD A;  2OYI B;  4YTP C;  3CCR P;  1RF1 C;  1ZLL A;  3TGU E;  1T3J A;  3MZW B;  3P7K A;  4IL6 H;  5M1B A;  3D70 A;  1X0T A;  1OVU A;  1EZV G;  3BCC D;  3WU2 E;  5H2F H;  2KSE A;  1BCC E;  1USD A;  2G8Y A;  2WSF H;  1GL2 D;  3AEC C;  3RL0 g;  2HYN A;  3S1K A;  1NKZ B;  2QE7 H;  3JCU E;  3IN6 A;  5B5E E;  3JC2 2;  2O01 N;  2Y0D A;  2ZT9 B;  3EQ2 A;  1Q7Y Q;  1LTS C;  1KYO H;  5TJH A;  1GMJ A;  2BCC J;  1N73 A;  1JCC A;  1FC2 C;  1KB9 E;  5B5E H;  3AE8 C;  5KTB A;  1SQQ E;  4OWF A;  1S5L X;  3CXH H;  3IFM A;  2H8P D;  4ZKP A;  1RQU A;  1OWA A;  2GA1 A;  1ZV8 A;  3AE2 C;  3KXD A;  4AQR D;  1KQG B;  4PV1 D;  1VF5 B;  3H1K D;  1BSN A;  4DJG A;  1OVR A;  1MKM A;  1M56 D;  2K9Y A;  2N1T A;  2W83 C;  1IFP A;  1K05 A;  2K3R A;  1NTZ K;  2XU6 A;  3I5C A;  1OMI A;  1BE3 G;  1RE3 A;  2FYU D;  1KIL B;  3H32 A;  3V6I A;  4K35 A;  1LP1 A;  1WMK A;  2QG4 A;  1NTZ D;  1N7L A;  2E75 D;  2ZT9 C;  1NGM B;  3AEF C;  2JO1 A;  3B71 A;  2B87 B;  3LW5 J;  2W6A A;  1NTM E;  2KP8 A;  2KSJ A;  3HD7 C;  5KLV D;  3GHG A;  2QM8 A;  3CX5 I;  1LP1 B;  2KLU A;  2R5D A;  3KQG A;  3L36 A;  2R32 A;  3L74 G;  2JJL A;  2BEQ D;  2V7Q H;  1JY2 O;  2C0X A;  4N6J A;  3H25 A;  1SQX G;  2FXO A;  4UB8 E;  4XA4 A;  3H6P A;  3CWB J;  1NU1 J;  3CPW O;  2YKP A;  1MV8 A;  3AE7 C;  1RF0 A;  3M9Q A;  5L8R J;  3Q1M A;  2OYI C;  1YBK A;  1KN7 A;  4IFF A;  4U3F J;  4XE5 B;  1Z56 A;  3O6Q B;  2KI7 B;  3CWB G;  3M91 A;  3BAT A;  3L37 A;  1KB9 H;  1Q90 D;  2O01 H;  2P7J A;  2XDJ A;  2L91 A;  3HE5 A;  4KT0 J;  4R4M A;  3VP8 A;  3VYI A;  3H1I G;  5CCH C;  1EXI A;  1N86 A;  1BDC A;  1TU3 F;  2P67 A;  4H44 D;  2CPS A;  3ABV C;  1KYO I;  3HTK A;  4Y99 C;  3U1A A;  4D6T J;  3H32 B;  3CXH D;  1FDI A;  3MUD A;  3L75 D;  1GD2 E;  2FFD A;  1HJ0 A;  1X79 B;  3HUS B;  2M8R A;  5DJT B;  2N9B A;  2IBZ D;  4IFD K;  4WBA A;  1K73 Q;  1OW8 A;  1LTA C;  1N8R Q;  1VQ7 P;  3VMZ A;  4W7Z A;  4BWN A;  2KS1 A;  2R3S A;  1GL2 A;  1BGY E;  1QEX A;  1OX3 A;  2E76 D;  2HOD A;  2KOG A;  3B5N B;  1LNQ A;  3CLQ A;  4I6M C;  2OYH A;  2Z4E A;  3L70 E;  4NPF X;  1JMM A;  1NVO A;  2BEZ F;  2NPS D;  1N7S D;  1HH0 A;  1JY3 P;  5KJ7 C;  2KUB A;  4PJ0 E;  1L0L E;  1NOH A;  1RE4 A;  1SQB J;  1IFJ A;  3L74 E;  1J2J B;  4YXW H;  1JCD A;  3SWF A;  1AVO A;  1M1K Q;  1IK9 A;  1Y8A A;  2ITA A;  3QH9 A;  4GDO A;  3VP9 A;  2IYP A;  3CWB E;  2M5A A;  1VQ9 P;  4PV1 C;  4C7N B;  1T3U A;  3Q5R A;  1SQB G;  1IO4 A;  1GDT A;  4H13 C;  1Q2N A;  1CZQ A;  2IFM A;  3QWO C;  3RK3 B;  2FYU K;  1FJK A;  4XFJ A;  3FX0 A;  1PGQ A;  5KJ7 A;  1RF0 C;  4JBZ A;  1KOR A;  4N78 E;  4H44 B;  3CI9 A;  5TIS H;  4PV1 B;  2WSS H;  5AVT B;  1KC8 Q;  2AXC A;  3RK3 E;  3SFE C;  4RES B;  4DCK A;  1OW6 A;  3PJS K;  1VQ8 P;  4IOI H;  1GL2 C;  2JKV A;  3V2N A;  1E79 H;  1VF5 C;  2I1J A;  2YIU B;  1UIX A;  1E5W A;  2YXR B;  1FE6 A;  3L75 E;  3OAK A;  4JYB A;  5APV A;  1YIJ P;  1LWU B;  2ZYD A;  5AVU B;  3HUS C;  3Q5S A;  3HD7 A;  1YQ3 C;  1GTW A;  2KLV A;  4M3L A;  3B4S A;  4TLF A;  1NTZ E;  2CPB A;  2FFD C;  1BE3 J;  2XZR A;  5E79 E;  3BCC E;  2JWD A;  3VOP A;  2E75 C;  1SQV D;  3CCQ P;  3R4Y A;  1PIX A;  1GW3 A;  3UIA A;  3H1I D;  1LWU A;  2N1T D;  1L0N E;  2Z5I A;  1KZU B;  3H1H E;  1NH4 A;  2QJY B;  3H1I E;  4L76 A;  5AW7 B;  1W2B O;  1EDL A;  4EI2 A;  1MUU A;  1H89 A;  1PGO A;  4DOJ A;  3VMA A;  3L72 E;  2RN0 A;  3BRT B;  3HRN A;  3M06 A;  1SFC A;  2YIU C;  1ZN5 A;  4TT3 H;  3Q5P A;  1A02 J;  5KLI C;  3CCJ P;  2IFN A;  2JEE A;  3N4X A;  1QVG O;  2W6B A;  3CCU P;  4YXD C;  3HE5 B;  1LTT C;  1N7S C;  1FZE A;  1CSB A;  1LTI C;  4U3F D;  3A2A A;  1NWQ A;  3SSU A;  2KZJ A;  3WUV A;  5K5G B;  3GHG C;  2LR2 A;  1SQX E;  2P1J A;  1DD3 A;  2E5T A;  3A0B E;  3TGU G;  3EFG A;  3KZI E;  3RK3 C;  2YKQ A;  1KQF B;  1ZR2 A;  2IBZ G;  1DIP A;  2NPS A;  4H13 B;  1QGK B;  4U7J A;  1DEE G;  1PV3 A;  4H0L D;  2Q7C A;  4WB4 A;  1FZA A;  1NTK K;  1JB0 J;  4JF7 A;  1USE A;  2FXM A;  2FKW B;  1NYH A;  2Q5U A;  2YNY A;  3L71 J;  1LT9 A;  2Y9Y A;  3TGU J;  2M0B A;  4RJT A;  4ZKU A;  1YTZ T;  2ZAE B;  1S9K E;  1RE3 C;  3M0A A;  4HJG H;  1SQV K;  5AW0 B;  2BAS A;  1SQB D;  1BCC J;  1RHZ B;  1SQX K;  2ZVN B;  3E1R A;  1MFT A;  1LWU C;  5APX A;  4I1L A;  1YJW P;  2FYU G;  2QIW A;  2RH0 A;  2W90 A;  2WPQ A;  3AE3 C;  5APW A;  4ASW A;  3HE4 B;  4GOE A;  1PPJ D;  2Q3I A;  1LTG C;  2WPS A;  3N7N A;  3TF5 A;  3CCE P;  1FJP A;  1L0L K;  1P84 I;  1H0T A;  1YIT P;  2O1K A;  4WY4 A;  1IFN A;  4L75 A;  5AVW B;  2PRR A;  2D2C C;  2JP3 A;  2WSC H;  1KYO D;  3W67 A;  1ZR4 A;  3CCL P;  1FAV A;  1H0T B;  1EXJ A;  2A06 G;  1NAY A;  1NTM K;  3AE5 C;  4B86 A;  1UII A;  4NPE A;  3L74 D;  1SQP E;  3PTZ A;  1S5L E;  1NO4 A;  3HTK B;  2N1T B;  3WMM 0;  3D6Z A;  1SP4 A;  5APU A;  1KIL A;  1JY3 O;  1VF5 D;  3TGU D;  3KZI H;  4U3F E;  4WY4 B;  4Y99 B;  5AVX B;  4BRY A;  3K5B A;  1CI6 A;  1X22 A;  3O8Z A;  1U7M A;  5KAI E;  1L4A B;  4K3A A;  3MD0 A;  2FYN C;  5CBO A;  2W6J H;  3H1K J;  2W8Z A;  1J1E B;  1EZV I;  3RK2 C;  3G9R A;  1N7S B;  2H88 C;  2Y0E A;  3MUD C;  4Z1M H;  3OW2 O;  1NJI Q;  2D2C B;  4HB1 A;  3CC2 P;  1NTM J;  3GHG B;  3H1L E;  3L73 J;  1J1D B;  4GKG A;  4IL6 E;  4EOT A;  3T97 A;  1DH3 A;  4PD4 D;  1FOS F;  3H1K G;  1L4A C;  1KV4 A;  1CI6 B;  3MIW A;  1AFO A;  1GU4 A;  1LTJ A;  4AUW A;  2YO2 A;  2KB7 P;  1URQ D;  3AE6 C;  2K9J B;  3CL3 D;  1YTZ I;  3NFQ A;  3Q3D A;  1LGH B;  1BSH A;  1QX8 A;  2PFX A;  2WPV B;  4EYY Q;  2A45 I;  5CCG D;  1JNM A;  2IZ1 A;  5EFW B;  5AW3 B;  5KAF H;  1EZV E;  1L2P A;  1URQ B;  2JWA A;  3A0H E;  3CX5 H;  3GLM A;  1KIL E;  5B66 E;  1EC5 A;  1EDJ A;  4C7N A;  4H0L C;  1GK4 A;  2YXQ B;  3RGU A;  1PP9 E;  2NPS C;  2XNX A;  2QSI A;  4I7Z C;  1FDO A;  2YKO A;  5KAI H;  3RK3 D;  5AW9 B;  2LXC B;  3V2Q A;  4PD4 H;  3VN0 A;  4AYC A;  1FZF A;  3TYY A;  3V4W A;  1SFC B;  4Y28 J;  2O3J A;  2A06 E;  2E76 C;  1JTH B;  2R5B A;  4RO0 A;  3TNU B;  4DT0 A;  3U59 A;  1RF1 B;  3H1J D;  3OJA B;  2A06 D;  1M1J B;  1SQP D;  3CCV P;  2OAR A;  2I1K A;  3RL0 C;  3W68 A;  1HBW A;  4GIF A;  1Y47 A;  3SWY A;  1FZC C;  5KLI B;  5APY A;  3V2P A;  3CXH E;  1GZL A;  1VPC A;  1SFC C;  1PPJ G;  2H43 A;  4ZMD A;  1SQQ J;  2KS1 B;  3AEA C;  3B5N A;  3H1K E;  3S4R A;  1QLE D;  2QVA A;  3P8M C;  1P84 D;  5CMZ A;  1G1J A;  2XV5 A;  2NPS B;  3PH0 A;  5AW8 B;  2FBW C;  5CJ4 A;  5KKZ B;  4HH2 A;  1Y9B A;  1SLQ A;  2Z5H A;  4EIJ A;  3RK2 B;  1LT9 C;  3BRV B;  2V7Q J;  3L4F A;  5AVR B;  5BVZ A;  1IFI A;  2E75 B;  3H1J E;  1JM0 A;  2YO3 A;  1OFC X;  3IF4 A;  4LLH A;  1YI2 P;  1L0L J;  3RK2 D;  1KD1 Q;  1U7J A;  2C9N Y;  1NHL A;  2AEJ A;  1YYC A;  2WIT A;  4RKU J;  5KKZ C;  1X9V A;  1WT6 A;  2AEM A;  3LW5 H;  2WT7 B;  1SQQ D;  3WUU A;  2YMY A;  2OTJ P;  1U57 A;  3KPE A;  3NTN A;  3BVH A;  3MTU E;  5AVS B;  2W27 A;  4U3F G;  1EZV D;  1YQ4 C;  1IFM A;  2H7H A;  1BCC G; 
#chains in the Genus database with same CATH homology
 1SQQ G;  3CWB G;  1PPJ G;  1KB9 H;  1NTM G;  1EZV G;  2A06 G;  1SQV G;  3L72 G;  5KLV G;  3H1I G;  3L75 G;  3TGU G;  2BCC G;  2IBZ G;  4D6T G;  3CX5 H;  1L0N G;  1SQB G;  1NTZ G;  1L0L G;  1NU1 G;  1KYO H;  3L71 G;  3BCC G;  1BGY G;  3L74 G;  3L70 G;  1SQX G;  4PD4 H;  3CXH H;  3H1H G;  2FYU G;  3L73 G;  1P84 H;  4U3F G;  1BE3 G;  1PP9 G;  1NTK G;  3H1K G;  1BCC G;  3H1J G;  3H1L G;  1SQP G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...