2FYUG

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 2fyuG00
2FYUG 3CXHH 5KLVG 1NTZG 3H1LG 4PD4H 3H1HG 1SQPG 3CX5H 1SQVG 1BCCG 3L73G 2A06G 3H1KG 3H1JG 4U3FG 1NU1G 1L0NG 2BCCG 3H1IG 1SQBG 1PPJG 3BCCG 3TGUG 3CWBG 3L71G 1EZVG 1L0LG 1P84H 1KYOH 3L75G 3L72G 1SQXG 1BE3G 3L74G 1NTMG 1NTKG 1BGYG 4D6TG 3L70G 1SQQG 2IBZG 1PP9G 1KB9H
chains in the Genus database with same CATH superfamily
2WT7B 4UB6H 3H1JE 2SPZA 1KQSO 2WT7A 3KDPB 1X8YA 3CCLP 1VQNP 4DCKA 1KILD 1AFOA 3H1IE 2O01N 1VQLP 4WY4D 3JC22 1Y47A 4GOFA 3FWNA 4KHXA 5AW8B 2ZXEB 2QM7A 3M9HA 2OYHB 1SLQA 5CCGA 4U3FJ 5KAFH 1L0NG 2Y0DA 3C9IA 1VQPP 1N7SB 2A06D 3HUSA 1BCCD 1SP4A 2WQYC 3FGAD 2Y9ZA 1FBMA 1N7SC 1S4XA 2CPSA 2FYNC 3AEDC 3PRJA 1M1KQ 1URQC 2N9BA 2WMMA 2FY8A 1SQQE 2YKOA 1VQ7P 2IDBA 2NPSA 1HBWA 2YMKA 2NPSB 1WT6A 1PGQA 3CC7P 3AE8C 1NKZB 5B66H 3CCQP 3N4XA 2WSCJ 1FZCC 1L0NJ 3O6QB 2C0WA 5APSA 5KLIC 1GU5A 2FFDB 1NU1J 2IBZD 1OMIA 2XNXA 1S72P 1RF0A 3SFDC 1JOCA 1Z56A 2A06E 2IFMA 2V4HA 1N73B 1USDA 2ZVOB 4IOIH 1VQ8P 1K04A 1DX7A 5E79H 1AQTA 1CI6B 1EC5A 2G3AA 2JP3A 4LGDE 4PV1B 4W7YA 5AW3B 3I55P 1KC8Q 3B5ND 1RQVA 5L8RJ 1GZLA 1T3UA 5CCHD 5KJ7D 1FZAA 1RH5B 2Q1KA 1QL2A 3IFMA 1ZP0C 1FS0E 1GD2E 1LP1B 4DZOA 1UIIA 4WY4B 4TLFA 3VOPA 1IJDB 1L0NK 1JMBA 2YKPA 1T3JA 2V7QJ 5AVUB 3V2NA 1NTKE 2GA1A 1JY3O 1NTZD 3L73D 1EXJA 2WZ7A 4NPEA 3WUUA 3RK2C 3L70E 1NAYA 1KYOH 1P84H 2K9JA 3L75D 5AW4B 3WUTA 3Q5PA 5BVZA 2WSCH 4L75A 3OAKA 1S5LX 1TU3F 2ZJSE 3PH0A 1FJPA 1KN7A 1NTZE 1BSNA 2NPSD 1J1EC 4O9BA 1BE3D 4JF7A 4H44D 1KILC 3V2RA 1KB9H 2O1KA 3FXEA 2JDIH 2O01H 3CXHH 3NMDA 3RBZA 4AYCA 2J59M 1G2CB 2Q7CA 4EDFA 1NWQA 2YXQB 5KLVJ 5AVTB 4RO0A 1MUUA 3L35A 1AA0A 2QIWA 2OYIC 1A02F 3L71E 4DOJA 3MP7B 2FYUE 1PFIA 4H13C 1XTCC 3H1IJ 1GTWA 1SQPK 3G3ZA 2B87A 1NTMD 1PGPA 2HLOA 1FAVA 1Q7YQ 2IFNA 1EZVG 1NTKD 1AVYA 1SQQK 2HODB 5CCGD 3L75J 3V6IA 1RF1B 3FWLA 4YPCA 2IYPA 2R32A 1PGOA 1U7MA 1FZBA 3MTUE 5AW1B 3H1LD 2IYOA 3L36A 1PPJE 4EYYQ 4Z1MH 1Q90D 3AECC 4K35A 3CC2P 1JUNA 4PJ0H 3CX5D 1AVOA 3L70G 5EFWB 3T97B 3SWFA 1FDMA 2XNDH 1GL2D 1QGKB 4OVNF 2QVAA 1J1DB 2B87B 2R3CA 5CCHC 1P84E 3GLMA 2GM4A 2K1AA 5CJ0A 1SQBE 5CCGC 5BU8B 2H8PD 1H88A 3O6QA 2JEEA 3GF7A 3A7OA 2LXCB 3HUSC 3CCSP 1NU1D 1L4AB 1OW7A 2Z4EA 3II6A 4D6TJ 1MFZA 1PIXA 1ZR4A 1YTZI 1SFCC 2E75C 1S1CX 3L73E 3CCEP 3CCRP 3KPEA 3CMEP 2OYIA 2JKVA 2HR3A 1JNMA 1ZW0A 1LT9A 5KJ7C 3VMAA 4GOEA 1M1JC 5AW5B 5E79E 3U1AA 4N78D 2P10A 1GW3A 3JSVC 1X79B 2QJKC 2VRSA 2IBZI 2JO1A 4H44C 2K37A 3AE3C 4L76A 2OARA 2Z5HA 4PD4D 4U3FD 1NOHA 1UIXA 3AE2C 3L74E 2CK3H 4LC1A 1LTAC 1PP9G 2IZ0A 1SVFA 4I6MC 2AXTE 1HJBA 1S2EA 2KNCB 3TF5A 2KLUA 1SQVD 4WVZA 5APWA 3RL0D 1GDTA 3D71A 1N7LA 3I5CA 1YJ9P 3M0DA 3TK1A 2WSSH 2NPSC 2HPCA 2YIUC 2ZXXA 3H1KG 2Q5UA 3VTPC 3AE1C 3KQGA 5AVSB 1K73Q 5KLVE 1N73A 3GHGC 2YXRB 3VP8A 1CSBA 1P84I 2RN0A 1SQXD 2RH0A 2YO3A 3L71J 4H44B 3MZWB 4KJMA 4R4LA 3AE9C 4GDOA 1Q82Q 2QEXP 3BCCJ 1VQ9P 1L2PA 3BATA 2KIKA 5AVQB 2M0BA 4OH8B 1BDCA 2WPSA 1BGYE 1S9KD 1OWAA 1M56D 2O01J 1QVGO 2Q3EA 1M90Q 3EFFK 1MFTA 4EIJA 4IL6E 3B5NB 1LP1A 3B71A 3L72E 2GUSA 4HYTB 2KI7B 1PGJA 3H32A 4HB1A 3H1HD 3R2PA 3CI9A 1JY3N 1LTTC 2QJPC 4HJGH 4C7RA 4AUWA 3H1HG 1KORA 3P8CD 1E79H 1L0LJ 1NTMK 1SS1A 1FZCB 1VF5C 2AEMA 1SQBD 2AXCA 3CWBE 3N7NA 4BXLA 3RL0C 2Q6QA 1JY2O 1CW5A 4OGQC 2O1JA 4QMAA 2FFDA 1LWUC 4OGQB 2WITA 1HUCA 4Y99C 1R5LA 2UWJE 3H1KD 1N8RQ 4BRYB 4PV1C 1FJKA 4H0LD 5AW9B 3VMXA 4D6TE 1VQOP 4IFDK 3L73J 1D7MA 1HH0A 3M9BA 3M9QA 2BEZF 3S1KA 1IK9A 1SQPJ 1SQXG 1DEBA 2JWAA 3CL3D 3CLQA 4XA4A 3W67A 3KZIH 1L4AD 3A5TA 1SFCB 5KLIB 1IFMA 5K5GB 2E76C 3BRVB 3M0AA 3R4YA 5APQA 3V2PA 2B88A 3BVHA 3KXDA 4I7ZC 3G4SP 1LTGC 3TYYA 2FYUG 4RJTA 4C46A 3HD7D 3JCUE 3VN0A 1NKNA 2KOGA 3L74J 5GTHH 5H2FE 2IPPA 1GMJA 2K3RA 1IFNA 1GK4A 5GTIH 4U3FG 3Q5SA 4MN4C 2W6JH 1IFJA 3GHGB 1EDIA 2BCCG 3CXHD 1SQBG 1SQQJ 2WWWA 1ZR2A 2WTYA 1HWTC 4W80A 1URQA 3H1KE 3KYQA 2M5AA 5CMZA 5GTIE 1YYCA 1NTKK 4GODA 2ZYGA 4GKGA 1L0NE 1S9KE 1OVUA 1FDIA 3V2QA 2KS1B 3G71P 1M57D 1USEA 1MKMA 1JB0J 1NHLA 1KB9E 1X9VA 1LWUB 2KLVA 2Y0EA 3EWKA 1RE3A 4WBAA 1YJNP 1FZFA 1KZUB 2I1JA 1KILE 4XE5B 1PP9J 2OYOA 1EDJA 3WU2H 3USSA 3H1JD 1FZGA 3H25A 1AQ5A 2A45I 1QX8A 1QL1A 2E74C 2FYUK 3H32B 2QJPB 2KNCA 1LT9C 2I8DA 3CX5H 3QWOC 1KQLA 1OZHA 1BCCG 1SQVG 2FXOA 2HG5D 2A06G 4M3LA 4GIFA 5AW2B 1G2CA 2QJYB 3Q1MA 1PP9D 2N1TB 1Q86Q 2GUVA 1PL5A 2WSEH 3VMYA 2LR2A 4H0LC 1M8OB 1IFDA 1PV3A 3CWBJ 2KB7P 1YBKA 3D70A 4U7JA 2P58A 1NTZK 5H2FH 3CPWO 2R5DA 1VQ4P 1U57A 4KT0J 3TNUB 1VQ5P 1N2DC 2E76D 2L91A 3M91A 1FE6A 2AXTH 2FYUD 1NTMG 2M5AB 3GF3A 1JY2N 3IF4A 1LTBC 1KMIZ 5APXA 3S4RA 3Q5RA 1H8AA 5BU5A 1JEKA 2N1TA 2P67A 3RBXA 1W5CE 1DH3A 2OQQA 1GL2A 1N86A 1GK6A 2QG4A 4JPZB 2MKVA 3TDKA 4H0LB 4A7PA 2JWDA 4JYCA 5CHXA 2XKMA 2W6AA 1X22A 3A0HE 3LW5J 2C9NY 1YI2P 3IAOA 1RF1C 2Q9IA 3SFEC 2E74D 1EZVE 1SFCD 1CI6A 3H1JG 2LXBA 3B8EB 2J58A 2KZIA 1NU1G 1LGHB 3SWKA 1P84D 3L75E 4C7NA 3L70D 1RE4A 4YXDC 2WVRA 2H43A 1FDOA 2PGDA 1LTJB 3HD7B 1M1JB 2E43A 5C39A 1URQB 1ZV8A 2AEJA 2C0XA 2MJZA 2P2UA 2Q3IA 3H1KJ 1JO5A 2LKMA 1EXIA 1JMMA 3FX0A 3GHGA 4IL6H 1KFNA 1LTJA 3HD7A 1NYHA 1ZRTE 2BCCD 2E76B 1KQGB 1WMKA 2H88C 2IBZG 3HUSB 1HJ0A 3IN6A 2P1JA 1SQBJ 2YO2A 3MGNA 4ZKPA 2V7QH 3MUDA 5KLVK 2OTKE 2B9BA 4HH2A 1OIPA 2PRRA 4PD4H 1X0TA 2IBZE 4OGQD 1ZRTD 1OW6A 2BCCE 5B5EE 3LIEA 2N1TC 3NTNA 3MIWA 5AW0B 5M1BA 3ABVC 3CCJP 1VDFA 2M8RA 3Q2YA 1DIPA 2QA4P 1LT1A 3H1LE 4ZNCA 3H1HE 2L5GB 2KS1A 2R3SA 4WY4C 3M06A 3VP9A 3BCCG 4ASVA 2BASA 3PHLA 2HODA 3P8MC 4UB8E 1G1IA 1LTSC 2ZFCA 3A0HH 1RF1A 4I2LC 1Q2NA 3U59A 3L75G 1QEXA 3D6ZA 1IFIA 2R5BA 3VMZA 5CCHA 1BE3G 1LTIC 3HTKB 4PV1D 3BRTB 3WUVA 2JR8A 1NAFA 2WPRA 5AVWB 1N7SA 2KK7A 3RL0g 1EQ7A 3HRNA 1ZOYC 4Y99B 4DJGA 4XFJA 3QH9A 3AE7C 3E1IA 1L0LK 5TJHA 5KAIH 2HPCB 2D2CB 1VQKP 5KLVG 1IC2A 1FOSE 1NTZG 5APYA 1AV1A 2HFED 1HGVA 3M0DC 4IFFA 2KYVA 2WSFH 1OVRA 3AEFC 3H1JJ 3G6EP 1DD4A 3OW2O 4L74A 3VYIA 3HTKA 1PPJD 2M3EA 1YQ4C 4AQRD 1JTHA 1SQXK 2OGUA 3FXDA 2K9JB 2W8ZA 3TGUG 4CPGA 1M7LA 1JY2P 3B5NC 3MD0A 4U3FE 1CZQA 2K88A 3KHUA 2ZT9B 1K8AQ 3V4QA 2OTLP 3TNUA 1KTMA 4N78E 2IZ1A 4L73A 3L72G 4WY4A 3E7KA 3F89A 1DD3A 2YNYA 4IL6X 1T6AA 5AVZB 2YKQA 3MHVA 4GT1A 1T2KD 1KYOD 1LTJC 3HD7C 1FZCA 1SQVE 4H13B 3C8VA 1Y8AA 1JTHB 2PFXA 3AEBC 1MZ9A 1RHZB 2FXPA 1IK7A 2N1TD 3LIDA 1JY3P 4JYBA 1H0TB 4IFMA 1NU1E 1SQBK 3CCMP 3H1LG 5KKZC 2BEQD 1T8ZA 4RESB 1VPCA 4RKUJ 1KB9D 3CC4P 1J2JB 1VF5B 4N3YB 5AVRB 4ZKUA 2FFDC 5APVA 3GW6A 2BCCJ 4JBZA 5AW7B 3E1RA 1HGZA 1HTLC 1L4AC 2B89A 5KTBA 1ZMEC 2ZVNB 3CWBG 1SQPD 3AEAC 1A02J 3TGUJ 3H1LJ 1GL2C 2FXMA 3L37A 2QM8A 3CXHE 5DJTB 1K05A 1G1JA 5AVVB 2QJKB 1OX3A 1KQFB 3TGUD 1NTKJ 3L74G 1VQMP 2E42A 2ZAEB 1HF9A 1EDLA 2E5TA 2ZT9D 1RF0C 1LNQA 3L70J 3NXSA 1NTMJ 3P32A 3EFGA 3CX5I 3H1ID 3KZIE 2A45G 2G8YA 2D2CC 3G9RA 3RK2D 4NPFX 1BGYG 2H7HA 1KV4A 1FZEA 5KLVD 4OWFA 4DT0A 1QLED 2WPQA 2Z5IA 1SQPG 4R4MA 3D6YA 2QJYC 5TISH 3L73G 1YQ3C 1SQVK 1YTZT 2KSEA 2YIUB 3PLNA 3U1CA 1BE3J 1Y9BA 1RQUA 2N9YB 3T97A 1YHQP 2YMYA 3RK3C 1WRGA 3WMM0 3F5HA 3HE5A 5KAFE 1W2BO 1URQD 1NJIQ 3P7KA 2KP8A 1OFCX 3IR9A 2FYUJ 4N6JA 3RK3E 2XZRA 3AE4C 3PTZA 1PZQA 4LLHA 2OYIB 3AEEC 1L0LG 2R44A 1R8EA 2WSFJ 1OXZA 2QE7H 2KZJA 3BCCD 1N7SD 2W6BA 3B4SA 1RE3C 3RL0B 1L4AA 1PP9E 2KUBA 1EZVD 1NTKG 1SQXJ 1JM0A 2KSJA 3GG2A 3L71D 4WB4A 3WU2E 3CCVP 1ZLLA 2M3BA 3P8CE 3W68A 1FU1A 4PD4I 5B66E 1LJ2A 4ASWA 3TSIA 3AEGC 3NFQA 1NU1K 2ZYDA 3EQ2A 4TT3H 2KXPB 3SWYA 2O3JA 4ZMDA 3Q3DA 1VQ6P 1H0TA 3AE6C 1S3JA 1SQVJ 3RK2B 2NZ2A 1YIJP 2POHA 2H89C 1S5LH 3GMAA 1BSHA 3CXHI 2WPVB 3B5NA 1L0ND 1NVOA 1KB9I 2P7JA 5CBNA 1IZNB 2E75B 5TISE 2XU6A 2OTJP 1J1EB 3A3YB 2IX7C 2RKLA 1QVFO 3PJSK 2ZT9C 5GTHE 3CX5E 1GU4A 2FBWC 4UB6E 4YTPC 2NRGA 1JCCA 2DW3A 2FKWB 5KJ7A 4B86A 1M1JA 1OVVA 3TGUE 3BASA 1BCCJ 1AJYA 1KYOI 1BDDA 1LT9B 1SQQD 2D2CD 2ITAA 4D6TD 4D6TG 4WWIA 1SQQG 2C9LY 3HE4B 4EI2A 2XV5A 1J1DC 2QRXA 1NTME 4PJ0E 1KFMA 3L74D 4I1LA 5KKZB 4W7ZA 2K9YA 2QSIA 4EOTA 3RGUA 2FYZA 2I1KA 2CPBA 4UB8H 1SFCA 1GW4A 3A0BE 1VL2A 3LW5H 3O8ZA 4JQ0D 3RK3B 1KILA 5DJUB 1KD1Q 2HYNA 2OYHC 1NH4A 1S5LE 1OW8A 3A0BH 1BE3E 3AE5C 3L71G 3SSUA 3ZDMA 4I7ZB 1T2KC 3ITKA 3JCUH 1K9MQ 2E75D 4H13D 3A2AA 3BCCE 3I56P 5KAIE 3HE5B 1FC2C 3V5BA 2PP6A 4NPDA 1XTGB 3CCUP 1EZVI 1IFPA 3L4FA 2Y0CA 1BGYJ 4Y28J 1NGMB 3CD6P 1EDKA 1KILB 1SQXE 1W2EA 2A45H 1FOSF 4K3AA 2RMZA 1E5WA 1VF5D 5APTA 5AW6B 1L0LD 3K5BA 3L72D 3S9OA 5CBOA 2XDJA 1RE4C 3CMAP 1KYOE 2WSEJ 3L72J 5AVXB 1ZXGA 2JJLA 1GL2B 3H1HJ 1YITP 1YJWP 3C1LA 2ZYAA 2W27A 1BGYD 2J5UA 2Y9YA 4BWNA 1L0LE 1IO4A 1ZN5A 3H1IG 1PPJG 3HE4A 3UIAA 1LWUA 3RK3D 4HKZH 1Q81Q 5CJ4A 1HVVA 4PD4E 1JCDA 1U7JA 4YXWH 1MV8A 2E74B 5B5EH 2PAJA 2AEFA 1NTZJ 3OJAB 1NO4A 3MUDC 5APUA 4C7NB 1H89A 2E5YA 1RY3A 1DEEG 2OYHA 2W83C 3CWBD 3V4WA 2W90A 5AVYB 4BRYA 3PP5A 1R5SA 1SQPE 1N73C 1BCCE 2FYNB 3H6PA 3OA7A
chains in the Genus database with same CATH topology
2FYUG 3CXHH 5KLVG 1NTZG 3H1LG 4PD4H 3H1HG 1SQPG 3CX5H 1SQVG 1BCCG 3L73G 2A06G 3H1KG 3H1JG 4U3FG 1NU1G 1L0NG 2BCCG 3H1IG 1SQBG 1PPJG 3BCCG 3TGUG 3CWBG 3L71G 1EZVG 1L0LG 1P84H 1KYOH 3L75G 3L72G 1SQXG 1BE3G 3L74G 1NTMG 1NTKG 1BGYG 4D6TG 3L70G 1SQQG 2IBZG 1PP9G 1KB9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU G;  3CXH H;  5KLV G;  1NTZ G;  3H1L G;  4PD4 H;  3H1H G;  1SQP G;  3CX5 H;  1SQV G;  1BCC G;  3L73 G;  2A06 G;  3H1K G;  3H1J G;  4U3F G;  1NU1 G;  1L0N G;  2BCC G;  3H1I G;  1SQB G;  1PPJ G;  3BCC G;  3TGU G;  3CWB G;  3L71 G;  1EZV G;  1L0L G;  1P84 H;  1KYO H;  3L75 G;  3L72 G;  1SQX G;  1BE3 G;  3L74 G;  1NTM G;  1NTK G;  1BGY G;  4D6T G;  3L70 G;  1SQQ G;  2IBZ G;  1PP9 G;  1KB9 H; 
#chains in the Genus database with same CATH topology
 2WT7 B;  4UB6 H;  3H1J E;  2SPZ A;  1KQS O;  2WT7 A;  3KDP B;  1X8Y A;  3CCL P;  1VQN P;  4DCK A;  1KIL D;  1AFO A;  3H1I E;  2O01 N;  1VQL P;  4WY4 D;  3JC2 2;  1Y47 A;  4GOF A;  3FWN A;  4KHX A;  5AW8 B;  2ZXE B;  2QM7 A;  3M9H A;  2OYH B;  1SLQ A;  5CCG A;  4U3F J;  5KAF H;  1L0N G;  2Y0D A;  3C9I A;  1VQP P;  1N7S B;  2A06 D;  3HUS A;  1BCC D;  1SP4 A;  2WQY C;  3FGA D;  2Y9Z A;  1FBM A;  1N7S C;  1S4X A;  2CPS A;  2FYN C;  3AED C;  3PRJ A;  1M1K Q;  1URQ C;  2N9B A;  2WMM A;  2FY8 A;  1SQQ E;  2YKO A;  1VQ7 P;  2IDB A;  2NPS A;  1HBW A;  2YMK A;  2NPS B;  1WT6 A;  1PGQ A;  3CC7 P;  3AE8 C;  1NKZ B;  5B66 H;  3CCQ P;  3N4X A;  2WSC J;  1FZC C;  1L0N J;  3O6Q B;  2C0W A;  5APS A;  5KLI C;  1GU5 A;  2FFD B;  1NU1 J;  2IBZ D;  1OMI A;  2XNX A;  1S72 P;  1RF0 A;  3SFD C;  1JOC A;  1Z56 A;  2A06 E;  2IFM A;  2V4H A;  1N73 B;  1USD A;  2ZVO B;  4IOI H;  1VQ8 P;  1K04 A;  1DX7 A;  5E79 H;  1AQT A;  1CI6 B;  1EC5 A;  2G3A A;  2JP3 A;  4LGD E;  4PV1 B;  4W7Y A;  5AW3 B;  3I55 P;  1KC8 Q;  3B5N D;  1RQV A;  5L8R J;  1GZL A;  1T3U A;  5CCH D;  5KJ7 D;  1FZA A;  1RH5 B;  2Q1K A;  1QL2 A;  3IFM A;  1ZP0 C;  1FS0 E;  1GD2 E;  1LP1 B;  4DZO A;  1UII A;  4WY4 B;  4TLF A;  3VOP A;  1IJD B;  1L0N K;  1JMB A;  2YKP A;  1T3J A;  2V7Q J;  5AVU B;  3V2N A;  1NTK E;  2GA1 A;  1JY3 O;  1NTZ D;  3L73 D;  1EXJ A;  2WZ7 A;  4NPE A;  3WUU A;  3RK2 C;  3L70 E;  1NAY A;  1KYO H;  1P84 H;  2K9J A;  3L75 D;  5AW4 B;  3WUT A;  3Q5P A;  5BVZ A;  2WSC H;  4L75 A;  3OAK A;  1S5L X;  1TU3 F;  2ZJS E;  3PH0 A;  1FJP A;  1KN7 A;  1NTZ E;  1BSN A;  2NPS D;  1J1E C;  4O9B A;  1BE3 D;  4JF7 A;  4H44 D;  1KIL C;  3V2R A;  1KB9 H;  2O1K A;  3FXE A;  2JDI H;  2O01 H;  3CXH H;  3NMD A;  3RBZ A;  4AYC A;  2J59 M;  1G2C B;  2Q7C A;  4EDF A;  1NWQ A;  2YXQ B;  5KLV J;  5AVT B;  4RO0 A;  1MUU A;  3L35 A;  1AA0 A;  2QIW A;  2OYI C;  1A02 F;  3L71 E;  4DOJ A;  3MP7 B;  2FYU E;  1PFI A;  4H13 C;  1XTC C;  3H1I J;  1GTW A;  1SQP K;  3G3Z A;  2B87 A;  1NTM D;  1PGP A;  2HLO A;  1FAV A;  1Q7Y Q;  2IFN A;  1EZV G;  1NTK D;  1AVY A;  1SQQ K;  2HOD B;  5CCG D;  3L75 J;  3V6I A;  1RF1 B;  3FWL A;  4YPC A;  2IYP A;  2R32 A;  1PGO A;  1U7M A;  1FZB A;  3MTU E;  5AW1 B;  3H1L D;  2IYO A;  3L36 A;  1PPJ E;  4EYY Q;  4Z1M H;  1Q90 D;  3AEC C;  4K35 A;  3CC2 P;  1JUN A;  4PJ0 H;  3CX5 D;  1AVO A;  3L70 G;  5EFW B;  3T97 B;  3SWF A;  1FDM A;  2XND H;  1GL2 D;  1QGK B;  4OVN F;  2QVA A;  1J1D B;  2B87 B;  2R3C A;  5CCH C;  1P84 E;  3GLM A;  2GM4 A;  2K1A A;  5CJ0 A;  1SQB E;  5CCG C;  5BU8 B;  2H8P D;  1H88 A;  3O6Q A;  2JEE A;  3GF7 A;  3A7O A;  2LXC B;  3HUS C;  3CCS P;  1NU1 D;  1L4A B;  1OW7 A;  2Z4E A;  3II6 A;  4D6T J;  1MFZ A;  1PIX A;  1ZR4 A;  1YTZ I;  1SFC C;  2E75 C;  1S1C X;  3L73 E;  3CCE P;  3CCR P;  3KPE A;  3CME P;  2OYI A;  2JKV A;  2HR3 A;  1JNM A;  1ZW0 A;  1LT9 A;  5KJ7 C;  3VMA A;  4GOE A;  1M1J C;  5AW5 B;  5E79 E;  3U1A A;  4N78 D;  2P10 A;  1GW3 A;  3JSV C;  1X79 B;  2QJK C;  2VRS A;  2IBZ I;  2JO1 A;  4H44 C;  2K37 A;  3AE3 C;  4L76 A;  2OAR A;  2Z5H A;  4PD4 D;  4U3F D;  1NOH A;  1UIX A;  3AE2 C;  3L74 E;  2CK3 H;  4LC1 A;  1LTA C;  1PP9 G;  2IZ0 A;  1SVF A;  4I6M C;  2AXT E;  1HJB A;  1S2E A;  2KNC B;  3TF5 A;  2KLU A;  1SQV D;  4WVZ A;  5APW A;  3RL0 D;  1GDT A;  3D71 A;  1N7L A;  3I5C A;  1YJ9 P;  3M0D A;  3TK1 A;  2WSS H;  2NPS C;  2HPC A;  2YIU C;  2ZXX A;  3H1K G;  2Q5U A;  3VTP C;  3AE1 C;  3KQG A;  5AVS B;  1K73 Q;  5KLV E;  1N73 A;  3GHG C;  2YXR B;  3VP8 A;  1CSB A;  1P84 I;  2RN0 A;  1SQX D;  2RH0 A;  2YO3 A;  3L71 J;  4H44 B;  3MZW B;  4KJM A;  4R4L A;  3AE9 C;  4GDO A;  1Q82 Q;  2QEX P;  3BCC J;  1VQ9 P;  1L2P A;  3BAT A;  2KIK A;  5AVQ B;  2M0B A;  4OH8 B;  1BDC A;  2WPS A;  1BGY E;  1S9K D;  1OWA A;  1M56 D;  2O01 J;  1QVG O;  2Q3E A;  1M90 Q;  3EFF K;  1MFT A;  4EIJ A;  4IL6 E;  3B5N B;  1LP1 A;  3B71 A;  3L72 E;  2GUS A;  4HYT B;  2KI7 B;  1PGJ A;  3H32 A;  4HB1 A;  3H1H D;  3R2P A;  3CI9 A;  1JY3 N;  1LTT C;  2QJP C;  4HJG H;  4C7R A;  4AUW A;  3H1H G;  1KOR A;  3P8C D;  1E79 H;  1L0L J;  1NTM K;  1SS1 A;  1FZC B;  1VF5 C;  2AEM A;  1SQB D;  2AXC A;  3CWB E;  3N7N A;  4BXL A;  3RL0 C;  2Q6Q A;  1JY2 O;  1CW5 A;  4OGQ C;  2O1J A;  4QMA A;  2FFD A;  1LWU C;  4OGQ B;  2WIT A;  1HUC A;  4Y99 C;  1R5L A;  2UWJ E;  3H1K D;  1N8R Q;  4BRY B;  4PV1 C;  1FJK A;  4H0L D;  5AW9 B;  3VMX A;  4D6T E;  1VQO P;  4IFD K;  3L73 J;  1D7M A;  1HH0 A;  3M9B A;  3M9Q A;  2BEZ F;  3S1K A;  1IK9 A;  1SQP J;  1SQX G;  1DEB A;  2JWA A;  3CL3 D;  3CLQ A;  4XA4 A;  3W67 A;  3KZI H;  1L4A D;  3A5T A;  1SFC B;  5KLI B;  1IFM A;  5K5G B;  2E76 C;  3BRV B;  3M0A A;  3R4Y A;  5APQ A;  3V2P A;  2B88 A;  3BVH A;  3KXD A;  4I7Z C;  3G4S P;  1LTG C;  3TYY A;  2FYU G;  4RJT A;  4C46 A;  3HD7 D;  3JCU E;  3VN0 A;  1NKN A;  2KOG A;  3L74 J;  5GTH H;  5H2F E;  2IPP A;  1GMJ A;  2K3R A;  1IFN A;  1GK4 A;  5GTI H;  4U3F G;  3Q5S A;  4MN4 C;  2W6J H;  1IFJ A;  3GHG B;  1EDI A;  2BCC G;  3CXH D;  1SQB G;  1SQQ J;  2WWW A;  1ZR2 A;  2WTY A;  1HWT C;  4W80 A;  1URQ A;  3H1K E;  3KYQ A;  2M5A A;  5CMZ A;  5GTI E;  1YYC A;  1NTK K;  4GOD A;  2ZYG A;  4GKG A;  1L0N E;  1S9K E;  1OVU A;  1FDI A;  3V2Q A;  2KS1 B;  3G71 P;  1M57 D;  1USE A;  1MKM A;  1JB0 J;  1NHL A;  1KB9 E;  1X9V A;  1LWU B;  2KLV A;  2Y0E A;  3EWK A;  1RE3 A;  4WBA A;  1YJN P;  1FZF A;  1KZU B;  2I1J A;  1KIL E;  4XE5 B;  1PP9 J;  2OYO A;  1EDJ A;  3WU2 H;  3USS A;  3H1J D;  1FZG A;  3H25 A;  1AQ5 A;  2A45 I;  1QX8 A;  1QL1 A;  2E74 C;  2FYU K;  3H32 B;  2QJP B;  2KNC A;  1LT9 C;  2I8D A;  3CX5 H;  3QWO C;  1KQL A;  1OZH A;  1BCC G;  1SQV G;  2FXO A;  2HG5 D;  2A06 G;  4M3L A;  4GIF A;  5AW2 B;  1G2C A;  2QJY B;  3Q1M A;  1PP9 D;  2N1T B;  1Q86 Q;  2GUV A;  1PL5 A;  2WSE H;  3VMY A;  2LR2 A;  4H0L C;  1M8O B;  1IFD A;  1PV3 A;  3CWB J;  2KB7 P;  1YBK A;  3D70 A;  4U7J A;  2P58 A;  1NTZ K;  5H2F H;  3CPW O;  2R5D A;  1VQ4 P;  1U57 A;  4KT0 J;  3TNU B;  1VQ5 P;  1N2D C;  2E76 D;  2L91 A;  3M91 A;  1FE6 A;  2AXT H;  2FYU D;  1NTM G;  2M5A B;  3GF3 A;  1JY2 N;  3IF4 A;  1LTB C;  1KMI Z;  5APX A;  3S4R A;  3Q5R A;  1H8A A;  5BU5 A;  1JEK A;  2N1T A;  2P67 A;  3RBX A;  1W5C E;  1DH3 A;  2OQQ A;  1GL2 A;  1N86 A;  1GK6 A;  2QG4 A;  4JPZ B;  2MKV A;  3TDK A;  4H0L B;  4A7P A;  2JWD A;  4JYC A;  5CHX A;  2XKM A;  2W6A A;  1X22 A;  3A0H E;  3LW5 J;  2C9N Y;  1YI2 P;  3IAO A;  1RF1 C;  2Q9I A;  3SFE C;  2E74 D;  1EZV E;  1SFC D;  1CI6 A;  3H1J G;  2LXB A;  3B8E B;  2J58 A;  2KZI A;  1NU1 G;  1LGH B;  3SWK A;  1P84 D;  3L75 E;  4C7N A;  3L70 D;  1RE4 A;  4YXD C;  2WVR A;  2H43 A;  1FDO A;  2PGD A;  1LTJ B;  3HD7 B;  1M1J B;  2E43 A;  5C39 A;  1URQ B;  1ZV8 A;  2AEJ A;  2C0X A;  2MJZ A;  2P2U A;  2Q3I A;  3H1K J;  1JO5 A;  2LKM A;  1EXI A;  1JMM A;  3FX0 A;  3GHG A;  4IL6 H;  1KFN A;  1LTJ A;  3HD7 A;  1NYH A;  1ZRT E;  2BCC D;  2E76 B;  1KQG B;  1WMK A;  2H88 C;  2IBZ G;  3HUS B;  1HJ0 A;  3IN6 A;  2P1J A;  1SQB J;  2YO2 A;  3MGN A;  4ZKP A;  2V7Q H;  3MUD A;  5KLV K;  2OTK E;  2B9B A;  4HH2 A;  1OIP A;  2PRR A;  4PD4 H;  1X0T A;  2IBZ E;  4OGQ D;  1ZRT D;  1OW6 A;  2BCC E;  5B5E E;  3LIE A;  2N1T C;  3NTN A;  3MIW A;  5AW0 B;  5M1B A;  3ABV C;  3CCJ P;  1VDF A;  2M8R A;  3Q2Y A;  1DIP A;  2QA4 P;  1LT1 A;  3H1L E;  4ZNC A;  3H1H E;  2L5G B;  2KS1 A;  2R3S A;  4WY4 C;  3M06 A;  3VP9 A;  3BCC G;  4ASV A;  2BAS A;  3PHL A;  2HOD A;  3P8M C;  4UB8 E;  1G1I A;  1LTS C;  2ZFC A;  3A0H H;  1RF1 A;  4I2L C;  1Q2N A;  3U59 A;  3L75 G;  1QEX A;  3D6Z A;  1IFI A;  2R5B A;  3VMZ A;  5CCH A;  1BE3 G;  1LTI C;  3HTK B;  4PV1 D;  3BRT B;  3WUV A;  2JR8 A;  1NAF A;  2WPR A;  5AVW B;  1N7S A;  2KK7 A;  3RL0 g;  1EQ7 A;  3HRN A;  1ZOY C;  4Y99 B;  4DJG A;  4XFJ A;  3QH9 A;  3AE7 C;  3E1I A;  1L0L K;  5TJH A;  5KAI H;  2HPC B;  2D2C B;  1VQK P;  5KLV G;  1IC2 A;  1FOS E;  1NTZ G;  5APY A;  1AV1 A;  2HFE D;  1HGV A;  3M0D C;  4IFF A;  2KYV A;  2WSF H;  1OVR A;  3AEF C;  3H1J J;  3G6E P;  1DD4 A;  3OW2 O;  4L74 A;  3VYI A;  3HTK A;  1PPJ D;  2M3E A;  1YQ4 C;  4AQR D;  1JTH A;  1SQX K;  2OGU A;  3FXD A;  2K9J B;  2W8Z A;  3TGU G;  4CPG A;  1M7L A;  1JY2 P;  3B5N C;  3MD0 A;  4U3F E;  1CZQ A;  2K88 A;  3KHU A;  2ZT9 B;  1K8A Q;  3V4Q A;  2OTL P;  3TNU A;  1KTM A;  4N78 E;  2IZ1 A;  4L73 A;  3L72 G;  4WY4 A;  3E7K A;  3F89 A;  1DD3 A;  2YNY A;  4IL6 X;  1T6A A;  5AVZ B;  2YKQ A;  3MHV A;  4GT1 A;  1T2K D;  1KYO D;  1LTJ C;  3HD7 C;  1FZC A;  1SQV E;  4H13 B;  3C8V A;  1Y8A A;  1JTH B;  2PFX A;  3AEB C;  1MZ9 A;  1RHZ B;  2FXP A;  1IK7 A;  2N1T D;  3LID A;  1JY3 P;  4JYB A;  1H0T B;  4IFM A;  1NU1 E;  1SQB K;  3CCM P;  3H1L G;  5KKZ C;  2BEQ D;  1T8Z A;  4RES B;  1VPC A;  4RKU J;  1KB9 D;  3CC4 P;  1J2J B;  1VF5 B;  4N3Y B;  5AVR B;  4ZKU A;  2FFD C;  5APV A;  3GW6 A;  2BCC J;  4JBZ A;  5AW7 B;  3E1R A;  1HGZ A;  1HTL C;  1L4A C;  2B89 A;  5KTB A;  1ZME C;  2ZVN B;  3CWB G;  1SQP D;  3AEA C;  1A02 J;  3TGU J;  3H1L J;  1GL2 C;  2FXM A;  3L37 A;  2QM8 A;  3CXH E;  5DJT B;  1K05 A;  1G1J A;  5AVV B;  2QJK B;  1OX3 A;  1KQF B;  3TGU D;  1NTK J;  3L74 G;  1VQM P;  2E42 A;  2ZAE B;  1HF9 A;  1EDL A;  2E5T A;  2ZT9 D;  1RF0 C;  1LNQ A;  3L70 J;  3NXS A;  1NTM J;  3P32 A;  3EFG A;  3CX5 I;  3H1I D;  3KZI E;  2A45 G;  2G8Y A;  2D2C C;  3G9R A;  3RK2 D;  4NPF X;  1BGY G;  2H7H A;  1KV4 A;  1FZE A;  5KLV D;  4OWF A;  4DT0 A;  1QLE D;  2WPQ A;  2Z5I A;  1SQP G;  4R4M A;  3D6Y A;  2QJY C;  5TIS H;  3L73 G;  1YQ3 C;  1SQV K;  1YTZ T;  2KSE A;  2YIU B;  3PLN A;  3U1C A;  1BE3 J;  1Y9B A;  1RQU A;  2N9Y B;  3T97 A;  1YHQ P;  2YMY A;  3RK3 C;  1WRG A;  3WMM 0;  3F5H A;  3HE5 A;  5KAF E;  1W2B O;  1URQ D;  1NJI Q;  3P7K A;  2KP8 A;  1OFC X;  3IR9 A;  2FYU J;  4N6J A;  3RK3 E;  2XZR A;  3AE4 C;  3PTZ A;  1PZQ A;  4LLH A;  2OYI B;  3AEE C;  1L0L G;  2R44 A;  1R8E A;  2WSF J;  1OXZ A;  2QE7 H;  2KZJ A;  3BCC D;  1N7S D;  2W6B A;  3B4S A;  1RE3 C;  3RL0 B;  1L4A A;  1PP9 E;  2KUB A;  1EZV D;  1NTK G;  1SQX J;  1JM0 A;  2KSJ A;  3GG2 A;  3L71 D;  4WB4 A;  3WU2 E;  3CCV P;  1ZLL A;  2M3B A;  3P8C E;  3W68 A;  1FU1 A;  4PD4 I;  5B66 E;  1LJ2 A;  4ASW A;  3TSI A;  3AEG C;  3NFQ A;  1NU1 K;  2ZYD A;  3EQ2 A;  4TT3 H;  2KXP B;  3SWY A;  2O3J A;  4ZMD A;  3Q3D A;  1VQ6 P;  1H0T A;  3AE6 C;  1S3J A;  1SQV J;  3RK2 B;  2NZ2 A;  1YIJ P;  2POH A;  2H89 C;  1S5L H;  3GMA A;  1BSH A;  3CXH I;  2WPV B;  3B5N A;  1L0N D;  1NVO A;  1KB9 I;  2P7J A;  5CBN A;  1IZN B;  2E75 B;  5TIS E;  2XU6 A;  2OTJ P;  1J1E B;  3A3Y B;  2IX7 C;  2RKL A;  1QVF O;  3PJS K;  2ZT9 C;  5GTH E;  3CX5 E;  1GU4 A;  2FBW C;  4UB6 E;  4YTP C;  2NRG A;  1JCC A;  2DW3 A;  2FKW B;  5KJ7 A;  4B86 A;  1M1J A;  1OVV A;  3TGU E;  3BAS A;  1BCC J;  1AJY A;  1KYO I;  1BDD A;  1LT9 B;  1SQQ D;  2D2C D;  2ITA A;  4D6T D;  4D6T G;  4WWI A;  1SQQ G;  2C9L Y;  3HE4 B;  4EI2 A;  2XV5 A;  1J1D C;  2QRX A;  1NTM E;  4PJ0 E;  1KFM A;  3L74 D;  4I1L A;  5KKZ B;  4W7Z A;  2K9Y A;  2QSI A;  4EOT A;  3RGU A;  2FYZ A;  2I1K A;  2CPB A;  4UB8 H;  1SFC A;  1GW4 A;  3A0B E;  1VL2 A;  3LW5 H;  3O8Z A;  4JQ0 D;  3RK3 B;  1KIL A;  5DJU B;  1KD1 Q;  2HYN A;  2OYH C;  1NH4 A;  1S5L E;  1OW8 A;  3A0B H;  1BE3 E;  3AE5 C;  3L71 G;  3SSU A;  3ZDM A;  4I7Z B;  1T2K C;  3ITK A;  3JCU H;  1K9M Q;  2E75 D;  4H13 D;  3A2A A;  3BCC E;  3I56 P;  5KAI E;  3HE5 B;  1FC2 C;  3V5B A;  2PP6 A;  4NPD A;  1XTG B;  3CCU P;  1EZV I;  1IFP A;  3L4F A;  2Y0C A;  1BGY J;  4Y28 J;  1NGM B;  3CD6 P;  1EDK A;  1KIL B;  1SQX E;  1W2E A;  2A45 H;  1FOS F;  4K3A A;  2RMZ A;  1E5W A;  1VF5 D;  5APT A;  5AW6 B;  1L0L D;  3K5B A;  3L72 D;  3S9O A;  5CBO A;  2XDJ A;  1RE4 C;  3CMA P;  1KYO E;  2WSE J;  3L72 J;  5AVX B;  1ZXG A;  2JJL A;  1GL2 B;  3H1H J;  1YIT P;  1YJW P;  3C1L A;  2ZYA A;  2W27 A;  1BGY D;  2J5U A;  2Y9Y A;  4BWN A;  1L0L E;  1IO4 A;  1ZN5 A;  3H1I G;  1PPJ G;  3HE4 A;  3UIA A;  1LWU A;  3RK3 D;  4HKZ H;  1Q81 Q;  5CJ4 A;  1HVV A;  4PD4 E;  1JCD A;  1U7J A;  4YXW H;  1MV8 A;  2E74 B;  5B5E H;  2PAJ A;  2AEF A;  1NTZ J;  3OJA B;  1NO4 A;  3MUD C;  5APU A;  4C7N B;  1H89 A;  2E5Y A;  1RY3 A;  1DEE G;  2OYH A;  2W83 C;  3CWB D;  3V4W A;  2W90 A;  5AVY B;  4BRY A;  3PP5 A;  1R5S A;  1SQP E;  1N73 C;  1BCC E;  2FYN B;  3H6P A;  3OA7 A; 
#chains in the Genus database with same CATH homology
 2FYU G;  3CXH H;  5KLV G;  1NTZ G;  3H1L G;  4PD4 H;  3H1H G;  1SQP G;  3CX5 H;  1SQV G;  1BCC G;  3L73 G;  2A06 G;  3H1K G;  3H1J G;  4U3F G;  1NU1 G;  1L0N G;  2BCC G;  3H1I G;  1SQB G;  1PPJ G;  3BCC G;  3TGU G;  3CWB G;  3L71 G;  1EZV G;  1L0L G;  1P84 H;  1KYO H;  3L75 G;  3L72 G;  1SQX G;  1BE3 G;  3L74 G;  1NTM G;  1NTK G;  1BGY G;  4D6T G;  3L70 G;  1SQQ G;  2IBZ G;  1PP9 G;  1KB9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...