2FYUG

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
b'GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 2fyuG00
5KLVG 1SQQG 1NTKG 2BCCG 4D6TG 3L70G 1SQPG 1SQBG 3L73G 3CX5H 1BE3G 1NU1G 3H1HG 1L0LG 1KB9H 2A06G 3CXHH 1BGYG 1L0NG 1NTMG 1EZVG 3L75G 3L72G 3H1JG 2IBZG 3H1IG 3CWBG 1SQVG 1KYOH 3H1KG 3H1LG 1SQXG 4U3FG 3L71G 3TGUG 3BCCG 1NTZG 1BCCG 1PP9G 3L74G 2FYUG 4PD4H 1P84H 1PPJG
chains in the Genus database with same CATH superfamily
1N7SB 1URQA 3B5NB 4I7ZC 1HF9A 3TNUA 3L75G 3P8MC 4GODA 3BASA 3H1LD 2D2CD 4UB8H 1X79B 4HYTB 1FOSF 1KILD 2XU6A 1DEEG 4EOTA 2IYOA 1M7LA 3EFGA 4I7ZB 5DJTB 4ASWA 4CPGA 1BGYJ 4IL6E 3MUDA 3BRTB 1LJ2A 1FZGA 1PGQA 1VQ7P 2BCCE 3G4SP 1X0TA 1IFNA 4LC1A 1P84D 5KJ7D 2C0XA 1HJBA 1HH0A 4H44C 3H1IG 1RQUA 3HE4A 3M9BA 3CMEP 1SQBD 2HG5D 3GMAA 4L75A 3CCQP 2P2UA 1KYOE 2J5UA 3SWFA 2Y9ZA 1FOSE 3VMYA 1IJDB 2WWWA 5TISE 3A0HE 2E75C 4H44B 5M1BA 1X22A 2WSFH 5AVUB 1IFJA 2K88A 3AE3C 4LLHA 4PV1D 1PP9E 1IZNB 3H32B 1KMIZ 2MJZA 1D7MA 3O6QB 2AXCA 1NU1G 2G3AA 4HJGH 2FXPA 4H0LD 1T3UA 1JCCA 2E75B 4AYCA 2I1KA 2H7HA 1H0TB 2FBWC 3HE4B 3M0DA 2P7JA 4DZOA 1T8ZA 1EXIA 3TGUG 3SSUA 2WPQA 4OWFA 3V2NA 1VQ9P 1L0NE 1L0LE 2W6JH 3S9OA 1EZVE 3RL0D 3MZWB 1J1EC 3EQ2A 2OGUA 1NTZE 4PD4H 4AUWA 1BGYD 1E5WA 1USEA 2WSFJ 4C7NA 3HE5A 1VQMP 1SFCD 1IK7A 1NHLA 4ZNCA 4NPFX 1S2EA 1J1EB 5CJ0A 1YTZT 1YJ9P 3GHGC 3CXHE 1SQXG 1JTHA 3V2QA 2Q6QA 3IN6A 1KV4A 3L74J 2ZYDA 3KQGA 1EC5A 2XNXA 2SPZA 2HODA 1YQ3C 3VN0A 4I2LC 1M8OB 3GHGB 1Q7YQ 4GDOA 1EQ7A 3S4RA 1N8RQ 2NPSD 1X9VA 3BATA 4UB6H 1OW8A 2R5BA 3Q5PA 1OZHA 1XTCC 5CCHA 2Q9IA 4JF7A 1OFCX 1SQVE 3IF4A 3ZDMA 4XFJA 1KB9I 1FZFA 2ZT9D 1H88A 4Z1MH 2KNCB 1JY2N 2I8DA 1YTZI 1XTGB 2Y0CA 1NTKD 4JBZA 4RESB 1R8EA 2M5AB 2OYIC 3H1HJ 5CCHC 3P7KA 2E76D 3M06A 3V5BA 4N78D 1FDOA 1VQ8P 3M9HA 5C39A 1CZQA 4U3FJ 2N1TC 2HR3A 2KS1A 1NAFA 4JYBA 1LTGC 1GL2C 2IYPA 3CPWO 1SQBG 1LNQA 2OYIB 2IX7C 2H89C 3G9RA 2HPCA 3HD7D 5TJHA 3AEEC 4OGQD 3NTNA 3H1KJ 5EFWB 2OYHA 1JMMA 1SQPD 1VQPP 1OVUA 2N1TB 3BCCJ 2KUBA 3L70E 1GL2B 2WT7B 3R4YA 3F89A 1BE3J 3RK2B 1AQTA 1VDFA 2ZXEB 3L74D 5AVVB 3VMXA 2PAJA 4DJGA 3FXDA 5CBOA 1BCCG 3WMM0 1PZQA 1EDLA 5AW8B 1JB0J 1HVVA 4JQ0D 1K8AQ 3BRVB 2M8RA 4IOIH 1JY2P 1SQQK 1VQ6P 3A7OA 2V4HA 4GOFA 3RBZA 4NPDA 1SQQJ 4PD4D 3W67A 4TT3H 1BGYG 3AE2C 3IFMA 1FBMA 1YJNP 2OTLP 2W6BA 5GTHE 1VQOP 2WPVB 2WPSA 3MGNA 3SWYA 1PFIA 3H1HD 3USSA 4GIFA 3TGUJ 1N86A 1KQFB 5KAIE 1KORA 2JKVA 1AQ5A 4JYCA 3L72J 3CX5I 2R44A 3AE9C 4U3FD 5AW0B 4W80A 2Z5IA 3KHUA 2JDIH 3AEGC 1UIIA 1U57A 3L73E 1Q81Q 4D6TJ 2IBZD 1RE3A 1HJ0A 2QE7H 3H1KD 3CCJP 1Q86Q 3CX5E 5CCGA 1YYCA 1VF5D 3BCCD 4H13D 2GUSA 3M91A 1A02J 3H25A 1BE3D 1LTSC 3MD0A 2O3JA 1RE3C 1ZR4A 2QA4P 3UIAA 3D71A 2OQQA 3IR9A 3P8CE 1ZOYC 1YI2P 1ZXGA 1KTMA 3A0BH 2E5TA 1L4AA 3V4WA 3LIDA 3RL0B 3E1IA 2Q5UA 1T3JA 1HGVA 3V6IA 1GTWA 1LT1A 2YKOA 3CCUP 2FYUK 1FZBA 3S1KA 4ASVA 5GTIE 5KLVK 2WITA 5AW7B 1SQQD 1GW4A 3WUTA 1LT9A 4KJMA 5AW3B 4IL6H 2FYUJ 2ZXXA 1L4AC 5KLVJ 3CCMP 1AA0A 2QJPB 2KB7P 1S9KD 2Z4EA 2HYNA 4WB4A 3H1JG 2RKLA 2ZYAA 4HH2A 1CW5A 4K3AA 3TGUD 5L8RJ 1NGMB 3VMZA 1TU3F 3L74G 3L71J 1LT9C 1N7SA 2Q7CA 4GOEA 3L72D 4BWNA 1L4AB 4ZMDA 1IFIA 5APUA 3V2RA 5DJUB 3KPEA 1KYOH 1VQKP 3H1LE 1BSNA 1LGHB 2NPSB 4D6TD 5TISH 1DEBA 3A0HH 1LT9B 1N7SC 3JSVC 3CC7P 5E79H 3CC2P 1NTME 1AVOA 1W2BO 3L4FA 2IPPA 1ZP0C 1HBWA 3KDPB 1GK6A 3U59A 4YTPC 4IFDK 3EWKA 1HWTC 4N3YB 3H6PA 2YMKA 3A3YB 2W27A 2Z5HA 2A06E 2BCCJ 3H1HG 4TLFA 2CPSA 5KLIC 1W5CE 2KSJA 3HD7C 2E76B 1P84E 1QL2A 4IFMA 1RE4C 2OTKE 3B8EB 2XNDH 4U3FG 4R4LA 1U7MA 5KLIB 1Q82Q 3HD7B 2IBZG 1T2KD 2ITAA 3AE6C 3AE8C 4OGQB 4YXWH 2O01N 3H1KG 2FYUD 4WVZA 5KLVD 3BCCG 2L5GB 2JWDA 1GZLA 1PP9J 3H32A 2O1JA 2AEFA 2OTJP 3O6QA 1BE3G 4Y99C 3JCUE 1NJIQ 3CXHH 2K3RA 1GD2E 1H0TA 3T97B 1GU4A 2W83C 1L0NK 1L0LK 2QJYC 3Q1MA 1L2PA 5APYA 2NZ2A 3MHVA 4Y99B 2RMZA 3C9IA 5B5EE 1L0LJ 1JNMA 3SWKA 1NTZK 2I1JA 2QJYB 2KP8A 1PPJE 1SQQG 3AE4C 3I56P 1ZRTD 3AECC 2E5YA 2QIWA 2K1AA 1YBKA 4YXDC 4WY4C 1FAVA 1M90Q 1KFNA 1OW6A 2FYZA 2R5DA 2W6AA 2XV5A 1BCCD 1S3JA 2BCCD 2PFXA 2KK7A 3PH0A 4I6MC 5AVZB 4BRYB 1NH4A 3L72G 3RK3D 1SVFA 1QEXA 4WY4B 4RJTA 3GHGA 2LR2A 2K9JB 1ZW0A 1KYOD 2WSCH 3CCSP 2HLOA 2QM8A 4D6TG 4UB8E 5AVXB 1SQVK 2YXQB 1RY3A 1GDTA 3GW6A 3HTKB 3H1JJ 1ZV8A 1SQVJ 1Y8AA 3R2PA 1PP9D 2KNCA 1NAYA 1GK4A 5AVTB 1NTKE 2M5AA 2B9BA 3PRJA 2YNYA 3K5BA 4WWIA 2XDJA 2P67A 1KQLA 1L0LD 1LP1B 2IDBA 1EZVD 4DT0A 2OYIA 1FJPA 1N73C 2WSCJ 2B87B 2ZJSE 5APTA 4I1LA 1QVGO 3SFDC 1M57D 1M1JC 2FYUG 1M56D 2N1TA 1PGOA 2P1JA 1SQPE 1VPCA 5KLVG 1GL2A 2WT7A 3L70J 5GTHH 2KXPB 2LKMA 3HUSC 2FXOA 3WU2E 3CXHD 1N73B 1OX3A 1NKNA 4HKZH 3CL3D 1KB9E 2LXCB 3OAKA 5KAIH 3L71G 1K9MQ 4R4MA 3FXEA 1BDDA 1M1JB 3MP7B 3B5ND 2AEMA 3M0AA 4PD4I 4EYYQ 5KAFH 1J2JB 3E7KA 4Y28J 2JO1A 3HUSB 3QH9A 1RHZB 3II6A 3CCRP 2N9YB 3RK2C 2ZVNB 3QWOC 1MFTA 3PJSK 2FFDA 2E74D 1RQVA 3H1JD 3CLQA 2VRSA 1SQVD 2QJKB 5APVA 3PLNA 2D2CC 1AJYA 1ZMEC 3CWBE 1KILC 5CJ4A 1Z56A 2P10A 3VYIA 3AE5C 2BCCG 5KJ7A 2FFDC 1T2KC 1URQD 2IBZI 3L75E 1X8YA 3WUUA 1RH5B 1KN7A 2AEJA 1YQ4C 2D2CB 4L74A 4QMAA 1KILB 1S5LH 2A45H 1LTAC 2IZ1A 1WMKA 4HB1A 3A5TA 1LTJB 1OXZA 5KJ7C 2FFDB 3L73J 5GTIH 2QM7A 4NPEA 1KQGB 1YIJP 2HFED 4H44D 3P32A 1VQ5P 4MN4C 2JEEA 1KZUB 2BEQD 4W7YA 2KI7B 1PP9G 3B71A 2GA1A 1DX7A 2Y0DA 3TK1A 1DH3A 3H1IE 1IK9A 1EDIA 2E75D 1PIXA 4PV1C 2PGDA 1OVVA 3ITKA 2Q1KA 4H0LC 2N9BA 2YXRB 1L0LG 1T6AA 1EZVG 4PV1B 1LTBC 1Q90D 1NTZG 2POHA 1NU1E 4H0LB 3RK3C 1DD4A 1U7JA 3RL0C 3FX0A 1J1DB 1SQXK 2M3BA 1S9KE 1RF1C 1S1CX 1FU1A 1KD1Q 1RF0A 1BSHA 3TGUE 2FXMA 2G8YA 1P84H 3KYQA 1IO4A 2XKMA 3CCVP 3RK3B 2R32A 1SFCC 3L72E 3AEBC 2QJPC 4M3LA 1ZR2A 1G1JA 3AE7C 3V2PA 1RF1B 2NRGA 5AVSB 1NYHA 1RF0C 2RH0A 3FGAD 1FZAA 2NPSA 3L73D 1NTMK 1AV1A 3FWLA 1Q2NA 2KZJA 2K37A 1VL2A 1SFCB 1JUNA 2YIUC 5APWA 2KLUA 1NTMJ 4GT1A 1SQVG 2IFNA 5AW1B 1FDIA 1SQXE 3JCUH 1BDCA 2NPSC 1IFPA 2YKQA 1VQ4P 3A2AA 4RKUJ 3G3ZA 5CBNA 3PHLA 2FKWB 1GW3A 1JM0A 2YIUB 2ZT9C 4OH8B 4JPZB 1QLED 1Y47A 5B5EH 1NO4A 1KILE 2WSSH 2ZAEB 1AVYA 1FZCC 5B66E 1G2CA 2E76C 3HD7A 1OWAA 1VQLP 3Q5SA 2ZT9B 5CCHD 1K04A 3AEDC 1PL5A 1RE4A 5H2FE 1LWUA 2BEZF 2E42A 1YJWP 2H88C 3C8VA 5KKZB 4PJ0E 3D6ZA 3RL0g 1OMIA 3L70G 2B88A 5AVWB 2H43A 5AW9B 1FZCB 3G6EP 1GL2D 2QVAA 2IFMA 2CK3H 2B89A 2WZ7A 4OGQC 1LWUC 4KT0J 1WRGA 1CI6B 3T97A 2FYNB 2ZYGA 4N6JA 2JR8A 1QL1A 1SQBE 1HGZA 3V4QA 1G2CB 3JC22 3A0BE 1DD3A 5K5GB 2DW3A 2UWJE 4AQRD 1LWUB 1JY3P 1H8AA 2AXTE 3OW2O 3G71P 1URQC 2E74B 3NXSA 3CCEP 1NTMD 2OARA 3TYYA 1K05A 2E43A 1ZRTE 2PRRA 2KSEA 3GG2A 2JWAA 1JY3O 3L71D 3MTUE 1BCCE 1KYOI 2O1KA 2WMMA 2A06D 1URQB 4BRYA 3TNUB 1IFMA 1L0NJ 3MUDC 2IZ0A 3PP5A 4WY4A 3RK3E 1PGJA 4RO0A 4BXLA 2K9JA 1S5LX 3Q5RA 1NTZJ 4KHXA 3TSIA 3L73G 1BGYE 1MFZA 5KTBA 2QSIA 3HTKA 5E79E 3KZIE 1KQSO 1H89A 1NTKK 2XZRA 1K73Q 3CD6P 3WU2H 1KC8Q 4ZKPA 1NTKJ 2BASA 1EZVI 1KB9H 2LXBA 2KIKA 5AW2B 1VF5C 4H13C 3VMAA 1MZ9A 1WT6A 1LP1A 3U1AA 1N2DC 2A45G 1NWQA 2W8ZA 3CMAP 2B87A 1VF5B 3CXHI 4H13B 5CCGD 3M0DC 2R3SA 1SQPK 1MV8A 1PPJD 3GF3A 1SQPJ 3EFFK 1EDJA 1NKZB 1N73A 2Q3EA 1SLQA 4N78E 2C9NY 1R5SA 1M1JA 1S4XA 1L0ND 3D6YA 4DOJA 1ZLLA 3O8ZA 1L4AD 1E79H 3HRNA 3HUSA 2WVRA 3B4SA 2P58A 1OIPA 2CPBA 3H1LG 4DCKA 1NTZD 1MUUA 1DIPA 2YO3A 1G1IA 3I5CA 4C7NB 4IL6X 1FZEA 2YMYA 3HE5B 1NTMG 3H1JE 4XE5B 3VOPA 3SFEC 3N4XA 1QGKB 4EIJA 4K35A 3CWBJ 3CCLP 3D70A 1JTHB 2PP6A 3L74E 4O9BA 1EXJA 2Q3IA 1N7SD 2A06G 2QEXP 2HODB 2QJKC 3L75J 1PV3A 1SP4A 5AW5B 2WPRA 1KILA 1LTTC 2Y0EA 3W68A 1LTJA 4OVNF 5AW4B 3CX5H 2WSEH 4W7ZA 1YHQP 3CC4P 3M9QA 1NVOA 4PD4E 1QX8A 3GLMA 1AFOA 2ZVOB 3BVHA 1FDMA 1IFDA 2R3CA 2O01H 4B86A 1CSBA 4A7PA 5BU5A 3TF5A 3CI9A 1LTJC 4IFFA 3H1HE 5APSA 2W90A 3L37A 1FC2C 4GKGA 3PTZA 1KB9D 3H1IJ 1USDA 2YKPA 4U3FE 2WQYC 2OYHC 2GM4A 5CMZA 2KS1B 2M3EA 1OW7A 1JOCA 2K9YA 2MKVA 2IBZE 1HTLC 2HPCB 3H1KE 4UB6E 1JMBA 2H8PD 2WSEJ 5AVRB 1NU1K 3BCCE 3MIWA 5AVYB 2OYHB 3L70D 2Y9YA 2C0WA 1NOHA 1PPJG 4EDFA 1BE3E 1FS0E 1JEKA 1NU1J 3RBXA 3CWBD 2O01J 1KFMA 4L76A 1W2EA 1VQNP 1JY2O 1ZN5A 3L75D 3AE1C 5AVQB 1YITP 1L0NG 1J1DC 1EDKA 1RF1A 4WY4D 5KAFE 1UIXA 1SS1A 3LIEA 1PGPA 5B66H 1JO5A 1SQQE 5BVZA 3AEAC 5H2FH 1A02F 1SFCA 2QRXA 4EI2A 3U1CA 2QG4A 3AEFC 2C9LY 4PJ0H 1FJKA 2J59M 1GU5A 5APQA 2OYOA 3TDKA 3IAOA 1SQXJ 2WTYA 3LW5H 1NTKG 1JCDA 2A45I 3H1ID 1N7LA 1LTIC 5CCGC 2JJLA 3E1RA 2L91A 4WBAA 1HUCA 3H1LJ 1M1KQ 4YPCA 4U7JA 1OVRA 4D6TE 2GUVA 3F5HA 1S5LE 1GMJA 3NMDA 2M0BA 3CX5D 4C46A 2AXTH 3I55P 3FWNA 2JP3A 2ZFCA 5CHXA 5AW6B 3N7NA 1QVFO 1JY3N 1NU1D 1SQPG 4L73A 2V7QH 2KOGA 1FZCA 2KLVA 4XA4A 3WUVA 3GF7A 3NFQA 2FY8A 4LGDE 3LW5J 3P8CD 4C7RA 1CI6A 1R5LA 1SQBK 3RGUA 1S72P 3VP8A 5KKZC 3B5NA 1Y9BA 2J58A 3OJAB 1SQBJ 3C1LA 2KYVA 2YO2A 3ABVC 2FYNC 3L36A 3L35A 2FYUE 1IC2A 3VP9A 2KZIA 5KLVE 3B5NC 5APXA 3OA7A 3VTPC 3KZIH 4ZKUA 2N1TD 3KXDA 1MKMA 1P84I 5BU8B 1SQXD 3CWBG 1FE6A 3Q2YA 3Q3DA 3RK2D 2V7QJ 2RN0A 3L71E 1BCCJ 2E74C
chains in the Genus database with same CATH topology
5KLVG 1SQQG 1NTKG 2BCCG 4D6TG 3L70G 1SQPG 1SQBG 3L73G 3CX5H 1BE3G 1NU1G 3H1HG 1L0LG 1KB9H 2A06G 3CXHH 1BGYG 1L0NG 1NTMG 1EZVG 3L75G 3L72G 3H1JG 2IBZG 3H1IG 3CWBG 1SQVG 1KYOH 3H1KG 3H1LG 1SQXG 4U3FG 3L71G 3TGUG 3BCCG 1NTZG 1BCCG 1PP9G 3L74G 2FYUG 4PD4H 1P84H 1PPJG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV G;  1SQQ G;  1NTK G;  2BCC G;  4D6T G;  3L70 G;  1SQP G;  1SQB G;  3L73 G;  3CX5 H;  1BE3 G;  1NU1 G;  3H1H G;  1L0L G;  1KB9 H;  2A06 G;  3CXH H;  1BGY G;  1L0N G;  1NTM G;  1EZV G;  3L75 G;  3L72 G;  3H1J G;  2IBZ G;  3H1I G;  3CWB G;  1SQV G;  1KYO H;  3H1K G;  3H1L G;  1SQX G;  4U3F G;  3L71 G;  3TGU G;  3BCC G;  1NTZ G;  1BCC G;  1PP9 G;  3L74 G;  2FYU G;  4PD4 H;  1P84 H;  1PPJ G; 
#chains in the Genus database with same CATH topology
 1N7S B;  1URQ A;  3B5N B;  4I7Z C;  1HF9 A;  3TNU A;  3L75 G;  3P8M C;  4GOD A;  3BAS A;  3H1L D;  2D2C D;  4UB8 H;  1X79 B;  4HYT B;  1FOS F;  1KIL D;  2XU6 A;  1DEE G;  4EOT A;  2IYO A;  1M7L A;  3EFG A;  4I7Z B;  5DJT B;  4ASW A;  4CPG A;  1BGY J;  4IL6 E;  3MUD A;  3BRT B;  1LJ2 A;  1FZG A;  1PGQ A;  1VQ7 P;  2BCC E;  3G4S P;  1X0T A;  1IFN A;  4LC1 A;  1P84 D;  5KJ7 D;  2C0X A;  1HJB A;  1HH0 A;  4H44 C;  3H1I G;  1RQU A;  3HE4 A;  3M9B A;  3CME P;  1SQB D;  2HG5 D;  3GMA A;  4L75 A;  3CCQ P;  2P2U A;  1KYO E;  2J5U A;  3SWF A;  2Y9Z A;  1FOS E;  3VMY A;  1IJD B;  2WWW A;  5TIS E;  3A0H E;  2E75 C;  4H44 B;  5M1B A;  1X22 A;  2WSF H;  5AVU B;  1IFJ A;  2K88 A;  3AE3 C;  4LLH A;  4PV1 D;  1PP9 E;  1IZN B;  3H32 B;  1KMI Z;  2MJZ A;  1D7M A;  3O6Q B;  2AXC A;  1NU1 G;  2G3A A;  4HJG H;  2FXP A;  4H0L D;  1T3U A;  1JCC A;  2E75 B;  4AYC A;  2I1K A;  2H7H A;  1H0T B;  2FBW C;  3HE4 B;  3M0D A;  2P7J A;  4DZO A;  1T8Z A;  1EXI A;  3TGU G;  3SSU A;  2WPQ A;  4OWF A;  3V2N A;  1VQ9 P;  1L0N E;  1L0L E;  2W6J H;  3S9O A;  1EZV E;  3RL0 D;  3MZW B;  1J1E C;  3EQ2 A;  2OGU A;  1NTZ E;  4PD4 H;  4AUW A;  1BGY D;  1E5W A;  1USE A;  2WSF J;  4C7N A;  3HE5 A;  1VQM P;  1SFC D;  1IK7 A;  1NHL A;  4ZNC A;  4NPF X;  1S2E A;  1J1E B;  5CJ0 A;  1YTZ T;  1YJ9 P;  3GHG C;  3CXH E;  1SQX G;  1JTH A;  3V2Q A;  2Q6Q A;  3IN6 A;  1KV4 A;  3L74 J;  2ZYD A;  3KQG A;  1EC5 A;  2XNX A;  2SPZ A;  2HOD A;  1YQ3 C;  3VN0 A;  4I2L C;  1M8O B;  3GHG B;  1Q7Y Q;  4GDO A;  1EQ7 A;  3S4R A;  1N8R Q;  2NPS D;  1X9V A;  3BAT A;  4UB6 H;  1OW8 A;  2R5B A;  3Q5P A;  1OZH A;  1XTC C;  5CCH A;  2Q9I A;  4JF7 A;  1OFC X;  1SQV E;  3IF4 A;  3ZDM A;  4XFJ A;  1KB9 I;  1FZF A;  2ZT9 D;  1H88 A;  4Z1M H;  2KNC B;  1JY2 N;  2I8D A;  1YTZ I;  1XTG B;  2Y0C A;  1NTK D;  4JBZ A;  4RES B;  1R8E A;  2M5A B;  2OYI C;  3H1H J;  5CCH C;  3P7K A;  2E76 D;  3M06 A;  3V5B A;  4N78 D;  1FDO A;  1VQ8 P;  3M9H A;  5C39 A;  1CZQ A;  4U3F J;  2N1T C;  2HR3 A;  2KS1 A;  1NAF A;  4JYB A;  1LTG C;  1GL2 C;  2IYP A;  3CPW O;  1SQB G;  1LNQ A;  2OYI B;  2IX7 C;  2H89 C;  3G9R A;  2HPC A;  3HD7 D;  5TJH A;  3AEE C;  4OGQ D;  3NTN A;  3H1K J;  5EFW B;  2OYH A;  1JMM A;  1SQP D;  1VQP P;  1OVU A;  2N1T B;  3BCC J;  2KUB A;  3L70 E;  1GL2 B;  2WT7 B;  3R4Y A;  3F89 A;  1BE3 J;  3RK2 B;  1AQT A;  1VDF A;  2ZXE B;  3L74 D;  5AVV B;  3VMX A;  2PAJ A;  4DJG A;  3FXD A;  5CBO A;  1BCC G;  3WMM 0;  1PZQ A;  1EDL A;  5AW8 B;  1JB0 J;  1HVV A;  4JQ0 D;  1K8A Q;  3BRV B;  2M8R A;  4IOI H;  1JY2 P;  1SQQ K;  1VQ6 P;  3A7O A;  2V4H A;  4GOF A;  3RBZ A;  4NPD A;  1SQQ J;  4PD4 D;  3W67 A;  4TT3 H;  1BGY G;  3AE2 C;  3IFM A;  1FBM A;  1YJN P;  2OTL P;  2W6B A;  5GTH E;  1VQO P;  2WPV B;  2WPS A;  3MGN A;  3SWY A;  1PFI A;  3H1H D;  3USS A;  4GIF A;  3TGU J;  1N86 A;  1KQF B;  5KAI E;  1KOR A;  2JKV A;  1AQ5 A;  4JYC A;  3L72 J;  3CX5 I;  2R44 A;  3AE9 C;  4U3F D;  5AW0 B;  4W80 A;  2Z5I A;  3KHU A;  2JDI H;  3AEG C;  1UII A;  1U57 A;  3L73 E;  1Q81 Q;  4D6T J;  2IBZ D;  1RE3 A;  1HJ0 A;  2QE7 H;  3H1K D;  3CCJ P;  1Q86 Q;  3CX5 E;  5CCG A;  1YYC A;  1VF5 D;  3BCC D;  4H13 D;  2GUS A;  3M91 A;  1A02 J;  3H25 A;  1BE3 D;  1LTS C;  3MD0 A;  2O3J A;  1RE3 C;  1ZR4 A;  2QA4 P;  3UIA A;  3D71 A;  2OQQ A;  3IR9 A;  3P8C E;  1ZOY C;  1YI2 P;  1ZXG A;  1KTM A;  3A0B H;  2E5T A;  1L4A A;  3V4W A;  3LID A;  3RL0 B;  3E1I A;  2Q5U A;  1T3J A;  1HGV A;  3V6I A;  1GTW A;  1LT1 A;  2YKO A;  3CCU P;  2FYU K;  1FZB A;  3S1K A;  4ASV A;  5GTI E;  5KLV K;  2WIT A;  5AW7 B;  1SQQ D;  1GW4 A;  3WUT A;  1LT9 A;  4KJM A;  5AW3 B;  4IL6 H;  2FYU J;  2ZXX A;  1L4A C;  5KLV J;  3CCM P;  1AA0 A;  2QJP B;  2KB7 P;  1S9K D;  2Z4E A;  2HYN A;  4WB4 A;  3H1J G;  2RKL A;  2ZYA A;  4HH2 A;  1CW5 A;  4K3A A;  3TGU D;  5L8R J;  1NGM B;  3VMZ A;  1TU3 F;  3L74 G;  3L71 J;  1LT9 C;  1N7S A;  2Q7C A;  4GOE A;  3L72 D;  4BWN A;  1L4A B;  4ZMD A;  1IFI A;  5APU A;  3V2R A;  5DJU B;  3KPE A;  1KYO H;  1VQK P;  3H1L E;  1BSN A;  1LGH B;  2NPS B;  4D6T D;  5TIS H;  1DEB A;  3A0H H;  1LT9 B;  1N7S C;  3JSV C;  3CC7 P;  5E79 H;  3CC2 P;  1NTM E;  1AVO A;  1W2B O;  3L4F A;  2IPP A;  1ZP0 C;  1HBW A;  3KDP B;  1GK6 A;  3U59 A;  4YTP C;  4IFD K;  3EWK A;  1HWT C;  4N3Y B;  3H6P A;  2YMK A;  3A3Y B;  2W27 A;  2Z5H A;  2A06 E;  2BCC J;  3H1H G;  4TLF A;  2CPS A;  5KLI C;  1W5C E;  2KSJ A;  3HD7 C;  2E76 B;  1P84 E;  1QL2 A;  4IFM A;  1RE4 C;  2OTK E;  3B8E B;  2XND H;  4U3F G;  4R4L A;  1U7M A;  5KLI B;  1Q82 Q;  3HD7 B;  2IBZ G;  1T2K D;  2ITA A;  3AE6 C;  3AE8 C;  4OGQ B;  4YXW H;  2O01 N;  3H1K G;  2FYU D;  4WVZ A;  5KLV D;  3BCC G;  2L5G B;  2JWD A;  1GZL A;  1PP9 J;  3H32 A;  2O1J A;  2AEF A;  2OTJ P;  3O6Q A;  1BE3 G;  4Y99 C;  3JCU E;  1NJI Q;  3CXH H;  2K3R A;  1GD2 E;  1H0T A;  3T97 B;  1GU4 A;  2W83 C;  1L0N K;  1L0L K;  2QJY C;  3Q1M A;  1L2P A;  5APY A;  2NZ2 A;  3MHV A;  4Y99 B;  2RMZ A;  3C9I A;  5B5E E;  1L0L J;  1JNM A;  3SWK A;  1NTZ K;  2I1J A;  2QJY B;  2KP8 A;  1PPJ E;  1SQQ G;  3AE4 C;  3I56 P;  1ZRT D;  3AEC C;  2E5Y A;  2QIW A;  2K1A A;  1YBK A;  4YXD C;  4WY4 C;  1FAV A;  1M90 Q;  1KFN A;  1OW6 A;  2FYZ A;  2R5D A;  2W6A A;  2XV5 A;  1BCC D;  1S3J A;  2BCC D;  2PFX A;  2KK7 A;  3PH0 A;  4I6M C;  5AVZ B;  4BRY B;  1NH4 A;  3L72 G;  3RK3 D;  1SVF A;  1QEX A;  4WY4 B;  4RJT A;  3GHG A;  2LR2 A;  2K9J B;  1ZW0 A;  1KYO D;  2WSC H;  3CCS P;  2HLO A;  2QM8 A;  4D6T G;  4UB8 E;  5AVX B;  1SQV K;  2YXQ B;  1RY3 A;  1GDT A;  3GW6 A;  3HTK B;  3H1J J;  1ZV8 A;  1SQV J;  1Y8A A;  3R2P A;  1PP9 D;  2KNC A;  1NAY A;  1GK4 A;  5AVT B;  1NTK E;  2M5A A;  2B9B A;  3PRJ A;  2YNY A;  3K5B A;  4WWI A;  2XDJ A;  2P67 A;  1KQL A;  1L0L D;  1LP1 B;  2IDB A;  1EZV D;  4DT0 A;  2OYI A;  1FJP A;  1N73 C;  2WSC J;  2B87 B;  2ZJS E;  5APT A;  4I1L A;  1QVG O;  3SFD C;  1M57 D;  1M1J C;  2FYU G;  1M56 D;  2N1T A;  1PGO A;  2P1J A;  1SQP E;  1VPC A;  5KLV G;  1GL2 A;  2WT7 A;  3L70 J;  5GTH H;  2KXP B;  2LKM A;  3HUS C;  2FXO A;  3WU2 E;  3CXH D;  1N73 B;  1OX3 A;  1NKN A;  4HKZ H;  3CL3 D;  1KB9 E;  2LXC B;  3OAK A;  5KAI H;  3L71 G;  1K9M Q;  4R4M A;  3FXE A;  1BDD A;  1M1J B;  3MP7 B;  3B5N D;  2AEM A;  3M0A A;  4PD4 I;  4EYY Q;  5KAF H;  1J2J B;  3E7K A;  4Y28 J;  2JO1 A;  3HUS B;  3QH9 A;  1RHZ B;  3II6 A;  3CCR P;  2N9Y B;  3RK2 C;  2ZVN B;  3QWO C;  1MFT A;  3PJS K;  2FFD A;  2E74 D;  1RQV A;  3H1J D;  3CLQ A;  2VRS A;  1SQV D;  2QJK B;  5APV A;  3PLN A;  2D2C C;  1AJY A;  1ZME C;  3CWB E;  1KIL C;  5CJ4 A;  1Z56 A;  2P10 A;  3VYI A;  3AE5 C;  2BCC G;  5KJ7 A;  2FFD C;  1T2K C;  1URQ D;  2IBZ I;  3L75 E;  1X8Y A;  3WUU A;  1RH5 B;  1KN7 A;  2AEJ A;  1YQ4 C;  2D2C B;  4L74 A;  4QMA A;  1KIL B;  1S5L H;  2A45 H;  1LTA C;  2IZ1 A;  1WMK A;  4HB1 A;  3A5T A;  1LTJ B;  1OXZ A;  5KJ7 C;  2FFD B;  3L73 J;  5GTI H;  2QM7 A;  4NPE A;  1KQG B;  1YIJ P;  2HFE D;  4H44 D;  3P32 A;  1VQ5 P;  4MN4 C;  2JEE A;  1KZU B;  2BEQ D;  4W7Y A;  2KI7 B;  1PP9 G;  3B71 A;  2GA1 A;  1DX7 A;  2Y0D A;  3TK1 A;  1DH3 A;  3H1I E;  1IK9 A;  1EDI A;  2E75 D;  1PIX A;  4PV1 C;  2PGD A;  1OVV A;  3ITK A;  2Q1K A;  4H0L C;  2N9B A;  2YXR B;  1L0L G;  1T6A A;  1EZV G;  4PV1 B;  1LTB C;  1Q90 D;  1NTZ G;  2POH A;  1NU1 E;  4H0L B;  3RK3 C;  1DD4 A;  1U7J A;  3RL0 C;  3FX0 A;  1J1D B;  1SQX K;  2M3B A;  1S9K E;  1RF1 C;  1S1C X;  1FU1 A;  1KD1 Q;  1RF0 A;  1BSH A;  3TGU E;  2FXM A;  2G8Y A;  1P84 H;  3KYQ A;  1IO4 A;  2XKM A;  3CCV P;  3RK3 B;  2R32 A;  1SFC C;  3L72 E;  3AEB C;  2QJP C;  4M3L A;  1ZR2 A;  1G1J A;  3AE7 C;  3V2P A;  1RF1 B;  2NRG A;  5AVS B;  1NYH A;  1RF0 C;  2RH0 A;  3FGA D;  1FZA A;  2NPS A;  3L73 D;  1NTM K;  1AV1 A;  3FWL A;  1Q2N A;  2KZJ A;  2K37 A;  1VL2 A;  1SFC B;  1JUN A;  2YIU C;  5APW A;  2KLU A;  1NTM J;  4GT1 A;  1SQV G;  2IFN A;  5AW1 B;  1FDI A;  1SQX E;  3JCU H;  1BDC A;  2NPS C;  1IFP A;  2YKQ A;  1VQ4 P;  3A2A A;  4RKU J;  3G3Z A;  5CBN A;  3PHL A;  2FKW B;  1GW3 A;  1JM0 A;  2YIU B;  2ZT9 C;  4OH8 B;  4JPZ B;  1QLE D;  1Y47 A;  5B5E H;  1NO4 A;  1KIL E;  2WSS H;  2ZAE B;  1AVY A;  1FZC C;  5B66 E;  1G2C A;  2E76 C;  3HD7 A;  1OWA A;  1VQL P;  3Q5S A;  2ZT9 B;  5CCH D;  1K04 A;  3AED C;  1PL5 A;  1RE4 A;  5H2F E;  1LWU A;  2BEZ F;  2E42 A;  1YJW P;  2H88 C;  3C8V A;  5KKZ B;  4PJ0 E;  3D6Z A;  3RL0 g;  1OMI A;  3L70 G;  2B88 A;  5AVW B;  2H43 A;  5AW9 B;  1FZC B;  3G6E P;  1GL2 D;  2QVA A;  2IFM A;  2CK3 H;  2B89 A;  2WZ7 A;  4OGQ C;  1LWU C;  4KT0 J;  1WRG A;  1CI6 B;  3T97 A;  2FYN B;  2ZYG A;  4N6J A;  2JR8 A;  1QL1 A;  1SQB E;  1HGZ A;  3V4Q A;  1G2C B;  3JC2 2;  3A0B E;  1DD3 A;  5K5G B;  2DW3 A;  2UWJ E;  4AQR D;  1LWU B;  1JY3 P;  1H8A A;  2AXT E;  3OW2 O;  3G71 P;  1URQ C;  2E74 B;  3NXS A;  3CCE P;  1NTM D;  2OAR A;  3TYY A;  1K05 A;  2E43 A;  1ZRT E;  2PRR A;  2KSE A;  3GG2 A;  2JWA A;  1JY3 O;  3L71 D;  3MTU E;  1BCC E;  1KYO I;  2O1K A;  2WMM A;  2A06 D;  1URQ B;  4BRY A;  3TNU B;  1IFM A;  1L0N J;  3MUD C;  2IZ0 A;  3PP5 A;  4WY4 A;  3RK3 E;  1PGJ A;  4RO0 A;  4BXL A;  2K9J A;  1S5L X;  3Q5R A;  1NTZ J;  4KHX A;  3TSI A;  3L73 G;  1BGY E;  1MFZ A;  5KTB A;  2QSI A;  3HTK A;  5E79 E;  3KZI E;  1KQS O;  1H89 A;  1NTK K;  2XZR A;  1K73 Q;  3CD6 P;  3WU2 H;  1KC8 Q;  4ZKP A;  1NTK J;  2BAS A;  1EZV I;  1KB9 H;  2LXB A;  2KIK A;  5AW2 B;  1VF5 C;  4H13 C;  3VMA A;  1MZ9 A;  1WT6 A;  1LP1 A;  3U1A A;  1N2D C;  2A45 G;  1NWQ A;  2W8Z A;  3CMA P;  2B87 A;  1VF5 B;  3CXH I;  4H13 B;  5CCG D;  3M0D C;  2R3S A;  1SQP K;  1MV8 A;  1PPJ D;  3GF3 A;  1SQP J;  3EFF K;  1EDJ A;  1NKZ B;  1N73 A;  2Q3E A;  1SLQ A;  4N78 E;  2C9N Y;  1R5S A;  1M1J A;  1S4X A;  1L0N D;  3D6Y A;  4DOJ A;  1ZLL A;  3O8Z A;  1L4A D;  1E79 H;  3HRN A;  3HUS A;  2WVR A;  3B4S A;  2P58 A;  1OIP A;  2CPB A;  3H1L G;  4DCK A;  1NTZ D;  1MUU A;  1DIP A;  2YO3 A;  1G1I A;  3I5C A;  4C7N B;  4IL6 X;  1FZE A;  2YMY A;  3HE5 B;  1NTM G;  3H1J E;  4XE5 B;  3VOP A;  3SFE C;  3N4X A;  1QGK B;  4EIJ A;  4K35 A;  3CWB J;  3CCL P;  3D70 A;  1JTH B;  2PP6 A;  3L74 E;  4O9B A;  1EXJ A;  2Q3I A;  1N7S D;  2A06 G;  2QEX P;  2HOD B;  2QJK C;  3L75 J;  1PV3 A;  1SP4 A;  5AW5 B;  2WPR A;  1KIL A;  1LTT C;  2Y0E A;  3W68 A;  1LTJ A;  4OVN F;  5AW4 B;  3CX5 H;  2WSE H;  4W7Z A;  1YHQ P;  3CC4 P;  3M9Q A;  1NVO A;  4PD4 E;  1QX8 A;  3GLM A;  1AFO A;  2ZVO B;  3BVH A;  1FDM A;  1IFD A;  2R3C A;  2O01 H;  4B86 A;  1CSB A;  4A7P A;  5BU5 A;  3TF5 A;  3CI9 A;  1LTJ C;  4IFF A;  3H1H E;  5APS A;  2W90 A;  3L37 A;  1FC2 C;  4GKG A;  3PTZ A;  1KB9 D;  3H1I J;  1USD A;  2YKP A;  4U3F E;  2WQY C;  2OYH C;  2GM4 A;  5CMZ A;  2KS1 B;  2M3E A;  1OW7 A;  1JOC A;  2K9Y A;  2MKV A;  2IBZ E;  1HTL C;  2HPC B;  3H1K E;  4UB6 E;  1JMB A;  2H8P D;  2WSE J;  5AVR B;  1NU1 K;  3BCC E;  3MIW A;  5AVY B;  2OYH B;  3L70 D;  2Y9Y A;  2C0W A;  1NOH A;  1PPJ G;  4EDF A;  1BE3 E;  1FS0 E;  1JEK A;  1NU1 J;  3RBX A;  3CWB D;  2O01 J;  1KFM A;  4L76 A;  1W2E A;  1VQN P;  1JY2 O;  1ZN5 A;  3L75 D;  3AE1 C;  5AVQ B;  1YIT P;  1L0N G;  1J1D C;  1EDK A;  1RF1 A;  4WY4 D;  5KAF E;  1UIX A;  1SS1 A;  3LIE A;  1PGP A;  5B66 H;  1JO5 A;  1SQQ E;  5BVZ A;  3AEA C;  5H2F H;  1A02 F;  1SFC A;  2QRX A;  4EI2 A;  3U1C A;  2QG4 A;  3AEF C;  2C9L Y;  4PJ0 H;  1FJK A;  2J59 M;  1GU5 A;  5APQ A;  2OYO A;  3TDK A;  3IAO A;  1SQX J;  2WTY A;  3LW5 H;  1NTK G;  1JCD A;  2A45 I;  3H1I D;  1N7L A;  1LTI C;  5CCG C;  2JJL A;  3E1R A;  2L91 A;  4WBA A;  1HUC A;  3H1L J;  1M1K Q;  4YPC A;  4U7J A;  1OVR A;  4D6T E;  2GUV A;  3F5H A;  1S5L E;  1GMJ A;  3NMD A;  2M0B A;  3CX5 D;  4C46 A;  2AXT H;  3I55 P;  3FWN A;  2JP3 A;  2ZFC A;  5CHX A;  5AW6 B;  3N7N A;  1QVF O;  1JY3 N;  1NU1 D;  1SQP G;  4L73 A;  2V7Q H;  2KOG A;  1FZC A;  2KLV A;  4XA4 A;  3WUV A;  3GF7 A;  3NFQ A;  2FY8 A;  4LGD E;  3LW5 J;  3P8C D;  4C7R A;  1CI6 A;  1R5L A;  1SQB K;  3RGU A;  1S72 P;  3VP8 A;  5KKZ C;  3B5N A;  1Y9B A;  2J58 A;  3OJA B;  1SQB J;  3C1L A;  2KYV A;  2YO2 A;  3ABV C;  2FYN C;  3L36 A;  3L35 A;  2FYU E;  1IC2 A;  3VP9 A;  2KZI A;  5KLV E;  3B5N C;  5APX A;  3OA7 A;  3VTP C;  3KZI H;  4ZKU A;  2N1T D;  3KXD A;  1MKM A;  1P84 I;  5BU8 B;  1SQX D;  3CWB G;  1FE6 A;  3Q2Y A;  3Q3D A;  3RK2 D;  2V7Q J;  2RN0 A;  3L71 E;  1BCC J;  2E74 C; 
#chains in the Genus database with same CATH homology
 5KLV G;  1SQQ G;  1NTK G;  2BCC G;  4D6T G;  3L70 G;  1SQP G;  1SQB G;  3L73 G;  3CX5 H;  1BE3 G;  1NU1 G;  3H1H G;  1L0L G;  1KB9 H;  2A06 G;  3CXH H;  1BGY G;  1L0N G;  1NTM G;  1EZV G;  3L75 G;  3L72 G;  3H1J G;  2IBZ G;  3H1I G;  3CWB G;  1SQV G;  1KYO H;  3H1K G;  3H1L G;  1SQX G;  4U3F G;  3L71 G;  3TGU G;  3BCC G;  1NTZ G;  1BCC G;  1PP9 G;  3L74 G;  2FYU G;  4PD4 H;  1P84 H;  1PPJ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...