2FYUG

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
molecule tags Oxidoreductase
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 2fyuG00
2BCCG 4D6TG 1SQBG 2IBZG 1NTKG 3L72G 3L73G 3H1JG 3L74G 3H1IG 1KYOH 2FYUG 1SQXG 3L71G 1PPJG 1SQQG 3H1LG 3H1HG 1L0NG 3H1KG 3L70G 4PD4H 3BCCG 1P84H 3L75G 1NTZG 4U3FG 1L0LG 1NTMG 1PP9G 3CWBG 2A06G 1SQPG 1BCCG 5KLVG 1BE3G 1SQVG 1BGYG 3TGUG 3CX5H 1NU1G 1EZVG 3CXHH 1KB9H
chains in the Genus database with same CATH superfamily
2KLUA 3P32A 3KQGA 2L91A 2FXPA 2E75D 3V2QA 1JB0J 1HGVA 1YTZI 4L76A 2J5UA 4XA4A 5APTA 1FOSF 2WSEJ 2XU6A 3G9RA 3CD6P 3P8MC 2GA1A 1HBWA 4PD4E 1SQXJ 1GK4A 1GW4A 2FYUD 3A0HE 1NVOA 4IL6H 1G2CB 2XZRA 3B5NA 1OVVA 4H13D 5GTHE 5AW3B 2JEEA 2Q5UA 3L37A 1LTTC 4PV1D 1ZMEC 2KZJA 3L73E 3H1LJ 3MP7B 1USDA 3NMDA 1LP1B 5GTIE 1VQ6P 2OGUA 1CZQA 2YMYA 3L75E 3HD7C 5AVUB 2I1JA 3L74G 2AEFA 2M3BA 1NTZK 1LTJC 2PGDA 4HB1A 3WU2E 2H89C 2Q7CA 2OYOA 2A06D 3HUSC 1JUNA 2IFMA 1SQPE 2O3JA 1NTKG 1L4AD 4IL6X 2QEXP 3H1IG 1FJKA 3KYQA 1RE4A 3V2PA 2M5AA 2WQYC 3R4YA 3CMAP 2HYNA 1GTWA 1BDDA 5APQA 3HD7A 1JOCA 1MZ9A 1CI6B 5AVXB 2YKPA 1BCCE 1KQLA 1RY3A 1VL2A 3CXHE 1VQ7P 1AFOA 2HPCB 1ZN5A 4IFDK 1NTMG 3HUSA 1J1EB 4OGQB 1DH3A 4WY4B 3KZIH 2J58A 4GODA 2QG4A 3SFEC 1SQBD 3AE7C 4HJGH 2V4HA 4I6MC 1EZVE 3F5HA 3CX5E 3WUTA 3AE3C 1LT9B 1VQ5P 1FS0E 3JCUE 2R3SA 1NU1G 3PP5A 1KB9I 2XKMA 3O6QA 2C0WA 1KYOH 3FXDA 3MD0A 3AE4C 1GK6A 4H44C 2XNXA 2BCCE 3A0BE 2WSEH 2RMZA 5B5EE 5KLVG 4C46A 2RKLA 4DZOA 3T97B 2KUBA 1BSNA 3A3YB 4UB6H 4GDOA 1FBMA 3CCRP 2QRXA 4L74A 2JKVA 3OAKA 3CCQP 1SQQJ 1FZCA 4U3FG 3GHGB 3IAOA 5TISH 1KV4A 3TGUG 1LTAC 2QIWA 2KNCA 5AW9B 1QGKB 2D2CD 4ZNCA 3RBXA 1LWUC 5KAFH 4WWIA 3FWNA 4WBAA 1GL2B 2G8YA 4HYTB 4QMAA 2QJKC 1LTIC 3U1AA 1H0TB 3V4QA 3JSVC 3H1HD 4N78D 4I2LC 1IC2A 1YYCA 4YPCA 4PD4I 2E75C 1M1JA 1ZRTD 1L0LD 4YTPC 1SQVG 4O9BA 2OYHC 3HE4B 2IBZD 2P58A 3L72D 1FC2C 3L71G 3USSA 2OYIA 3H1KJ 4GIFA 2IFNA 5DJTB 4H13C 1LWUA 2A06E 3RGUA 1BGYJ 1PIXA 1L0NK 3VP9A 4PV1C 5AW4B 1PV3A 2IDBA 2WSSH 3AE9C 1U7JA 2FFDA 3KHUA 1OX3A 3V2NA 1KILD 2Q6QA 3EFFK 1SQXG 2QA4P 1NGMB 1OW8A 1K9MQ 1K04A 3H1JJ 1J1DC 5KAIH 2O01J 3M0DA 1G1IA 1S5LH 3CC2P 2KLVA 2W6BA 3PH0A 1FDIA 5APVA 1ZW0A 2LR2A 1IFIA 2E74B 1SQBE 3H1LG 3RK2B 2HR3A 4JQ0D 1JY2P 3VMZA 1HWTC 2UWJE 2WSFH 1VQ9P 2Y0CA 4D6TD 3HE5A 2HG5D 4EDFA 1DEEG 2Z5HA 2K9YA 2YIUC 3L70D 2NPSC 1EDLA 3C9IA 4DOJA 3HD7D 2K37A 4N6JA 3RK3B 2YKOA 1Q90D 3EWKA 2FYUG 1S5LX 1QVGO 1S9KD 5KKZC 3D70A 3U59A 2ZT9B 1NTZD 3W67A 3K5BA 4Y99B 5M1BA 1NKZB 1EDJA 2L5GB 3BATA 4R4LA 3I56P 1IFPA 4KT0J 1BE3J 5APXA 1KFMA 2OQQA 2WSCJ 2E43A 5AW5B 1N7LA 2JP3A 1RQVA 3AEAC 1KD1Q 3CCEP 3H1HE 4N78E 3TNUB 1DD3A 4EI2A 1ZRTE 3M9HA 1L0LE 3FWLA 2AEJA 4L75A 1U57A 2IBZE 3L72E 3I55P 3L4FA 2JO1A 4XFJA 3M9BA 1IZNB 1SFCB 2Y9YA 3L35A 1M8OB 1LTGC 3GF3A 2M8RA 3MZWB 3P8CD 2D2CC 4GOEA 2P1JA 2K88A 3AEBC 1IK7A 2O01H 4GKGA 1AQTA 1KILE 4A7PA 3TGUJ 1HGZA 4H44D 3G3ZA 2CPSA 2B87B 3L73J 2IYPA 5AW0B 2GUVA 2CPBA 1SQQG 1KYOD 3CC7P 1EDKA 1N8RQ 1WT6A 3B71A 2KIKA 1M1KQ 2H43A 3V4WA 3L75J 2FXOA 1W2EA 1P84D 3BCCD 3M91A 3CCMP 1OW7A 2OTKE 1VPCA 2AXTE 4ZKPA 5K5GB 5AW8B 4H0LB 1NTKK 1IO4A 4IL6E 1VF5D 1SQPJ 1KILC 3B5NB 2I8DA 2ZYGA 4NPDA 4RKUJ 1M90Q 2BCCD 3M9QA 1KQSO 2PRRA 1SP4A 4D6TE 1NJIQ 3H1KG 3G4SP 4HH2A 3Q1MA 3L70E 1YTZT 1BGYG 1BCCJ 4K35A 1KB9H 1A02F 2Z5IA 3PHLA 2VRSA 4AQRD 2W83C 1PPJD 1GD2E 3OW2O 1X9VA 1NTMK 2FBWC 1RHZB 2R32A 1S9KE 1XTCC 2B89A 5B66H 1EC5A 2WSCH 1TU3F 4PJ0E 1KILA 1NTZE 4B86A 2W8ZA 2PAJA 1Y8AA 3CCVP 3H1JG 5APUA 2ZVNB 1PGQA 3ABVC 1L0ND 1T6AA 1S3JA 1MV8A 5AW1B 1URQD 4C7NA 1NU1K 1X8YA 3KPEA 1JCDA 1KQFB 1GU4A 2M5AB 3VMXA 2CK3H 2ZJSE 2JJLA 3RL0D 2N1TB 3AE1C 1T3UA 3D6ZA 4BRYA 4PD4H 5KLVK 2K3RA 3CLQA 1PP9D 5APYA 3MUDC 2M3EA 3LW5J 4KHXA 1PL5A 3HUSB 5AVWB 2FYUJ 3P8CE 5GTHH 2QJYB 3KZIE 5AVZB 1ZP0C 1CW5A 1EXIA 4LLHA 1EQ7A 1RE3C 1KC8Q 2FYZA 1PGOA 3CCJP 2WT7A 3SFDC 3B8EB 1LTJA 1LGHB 4WB4A 3O6QB 2NPSD 1KYOE 1SQVK 3CCSP 2LKMA 3MUDA 3E1RA 3MIWA 3WMM0 1BE3G 3WU2H 1T2KC 1HJ0A 3TDKA 1P84E 3AE6C 2IX7C 3BCCE 1IFJA 4OGQC 3A5TA 1QX8A 1X0TA 4WY4C 5CJ0A 3VMYA 1M56D 2OTLP 1FZAA 2N9YB 1RE3A 1RH5B 1FZCB 1NKNA 2Q1KA 1NO4A 3E1IA 1LT9C 1OVRA 2R3CA 3GW6A 2KNCB 1Q86Q 5KAFE 3F89A 1SQXK 1NH4A 5BVZA 2ZYAA 3TYYA 3Q5SA 3CXHH 1M1JB 2QVAA 2K9JA 2O1KA 4WY4A 3KXDA 2Q9IA 1PPJE 2HLOA 2ZVOB 2KS1A 2WTYA 1WMKA 4YXDC 2OYIB 1VF5C 2E76B 3L73G 4EYYQ 5AW7B 1SQBJ 4IFFA 1VQKP 4WVZA 4W7YA 1AQ5A 1XTGB 1K8AQ 1K05A 2Q3EA 4GOFA 1N7SD 2Q3IA 3L75G 1PFIA 1L0NE 3A0BH 1RF1C 1GL2C 2E75B 1J2JB 3Q3DA 2FFDB 1HH0A 3II6A 5E79H 4K3AA 1NYHA 3H25A 1SQPG 1S5LE 1AA0A 1PP9E 3L74D 3A7OA 4H13B 3B4SA 3SWKA 1FZEA 1ZV8A 1QL1A 2A45G 1EDIA 1RF1A 4PV1B 3PTZA 1URQC 2B9BA 2H8PD 1DX7A 1BCCG 1H0TA 2OYHA 3I5CA 3E7KA 3EQ2A 3V6IA 3P7KA 2WPRA 3RL0C 1NTKD 3H1ID 2LXBA 4W7ZA 3H6PA 3HE5B 3H1HJ 1K73Q 1J1DB 3BASA 2ZXEB 1L0LJ 3JC22 3R2PA 1EZVG 2LXCB 1KB9D 3L72J 1Y9BA 3CCUP 2A45I 3UIAA 1L4AB 3CPWO 1URQA 5DJUB 5KLIC 3NXSA 1NTMD 2BEQD 3QH9A 3IR9A 1VQOP 3CWBE 5CBNA 2BCCG 3RK2C 3CXHI 5H2FE 4W80A 2WVRA 2FYNC 1JM0A 2Z4EA 3M0AA 2SPZA 2FXMA 2YIUB 2YNYA 3NTNA 4HKZH 1EZVI 1HJBA 2O1JA 1NU1D 3CX5I 2ZYDA 1R5LA 1SQQK 1GDTA 1JEKA 1A02J 3HTKB 4TT3H 1EXJA 3TF5A 1SLQA 3N7NA 3GG2A 1PZQA 1KMIZ 4JBZA 1FAVA 1T8ZA 3U1CA 2HFED 4R4MA 2RN0A 5KLVD 1JY3O 1YJNP 1KN7A 3FXEA 1QLED 4RESB 3AE8C 2XNDH 4Y99C 4ZKUA 1JTHA 1Q2NA 2P10A 2YMKA 4ASWA 2E42A 2NPSA 2JWDA 2HODA 2WPVB 3PRJA 3D6YA 1VDFA 3FX0A 4AUWA 1YQ3C 1N86A 5BU8B 4D6TJ 1LJ2A 1QVFO 3H32A 3WUUA 3L70J 2B88A 4UB8H 2GM4A 1AVYA 2A06G 3VYIA 1T2KD 1SQVD 3CL3D 2C9NY 5CCHD 2YXRB 3L71D 4OGQD 2PP6A 4I7ZB 1SFCC 3L74E 3VOPA 4WY4D 2D2CB 2PFXA 1S2EA 1DD4A 1QL2A 2RH0A 1ZOYC 1N7SC 1NTZJ 2Y0DA 3EFGA 2KXPB 4AYCA 1PGJA 2C0XA 4JF7A 3IF4A 1NTKE 4KJMA 3H1IE 1FZGA 1IK9A 3PLNA 1R5SA 3V5BA 1ZXGA 4DJGA 4BWNA 2WPQA 1SQXD 1SQBG 1S1CX 1AVOA 1N73C 2JR8A 1VQ4P 3SSUA 1SFCA 1KB9E 1M57D 2ZXXA 1YITP 2OTJP 1N7SA 2WMMA 3VP8A 4OH8B 1KORA 2IPPA 2DW3A 1NOHA 2QJPC 1Q7YQ 1NTME 3GF7A 1RQUA 1IFMA 2QM7A 5B66E 2QSIA 1KILB 4JPZB 4XE5B 4H0LC 3H1LD 2KSEA 3C1LA 3RL0g 2J59M 1AV1A 1LTSC 3RBZA 2B87A 1GL2D 2POHA 1GU5A 4ZMDA 1FJPA 2ITAA 1N73A 4C7NB 1H89A 3QWOC 1NU1E 4GT1A 4LGDE 3VTPC 5CHXA 2R5DA 2ZAEB 5CCGD 2AXTH 3D71A 4CPGA 5AVYB 4BRYB 2KSJA 3BCCJ 5KLVE 4Y28J 1VQLP 2P2UA 3AEDC 1JMMA 2P7JA 1YI2P 1T3JA 5EFWB 3H1HG 3VN0A 1USEA 4ASVA 1L0LG 3OJAB 2FY8A 2KB7P 2BEZF 4U3FE 2IBZG 5KTBA 3L72G 1JMBA 2IZ1A 2BCCJ 3TGUE 3Q5RA 3HD7B 2ZFCA 1RE4C 1VQMP 3CMEP 2WT7B 1D7MA 2Y9ZA 1ZR2A 2N1TC 1LTJB 1RF0C 3A0HH 1YIJP 2QM8A 3VMAA 1G2CA 2R5BA 5AW6B 1SQVE 3L36A 4PJ0H 3AEFC 4YXWH 3FGAD 4OWFA 3L71E 1HUCA 5APSA 5KJ7C 2NZ2A 1OIPA 1KQGB 2V7QJ 2E74D 4M3LA 5CJ4A 3ZDMA 2IBZI 3RK2D 2QJYC 1MFZA 1LP1A 5GTIH 2XV5A 2N1TA 1L0NJ 1SS1A 1RF0A 3Q5PA 1SQXE 5CCHC 1G1JA 4U7JA 1SQQD 1J1EC 3RK3D 5KJ7A 1SQPK 4UB6E 3SWYA 3IN6A 2K9JB 1LT1A 3CWBD 1PP9J 3S1KA 2W6JH 2G3AA 4D6TG 2ZT9D 2A45H 1BDCA 5TISE 2KS1B 1WRGA 1X79B 3BRTB 5CBOA 3L70G 1CI6A 1FZCC 4H44B 2E5TA 3H1LE 2YO2A 2M0BA 5CCHA 2HPCA 1OVUA 2BASA 1FE6A 1MFTA 2WSFJ 1OXZA 3S9OA 3H1KD 1E5WA 3PJSK 1OW6A 1P84H 1NTZG 1M1JC 3MHVA 1BSHA 2H88C 5E79E 2YKQA 4NPFX 3AEEC 3GMAA 3CX5H 1BGYD 4BXLA 1LNQA 1LT9A 1SFCD 1CSBA 1VF5B 3BRVB 2FYUE 3GHGC 3O8ZA 1LWUB 3JCUH 4IOIH 1H88A 2WWWA 1W2BO 3TSIA 3Q2YA 2QJKB 2OYIC 2E76C 1SVFA 1UIIA 3N4XA 1KFNA 3CWBJ 1RF1B 1FZBA 3H1JD 2OYHB 5B5EH 1MKMA 1FU1A 3T97A 3LW5H 2FFDC 3W68A 3C8VA 5KAIE 1KTMA 2YXQB 5CCGC 1HVVA 2IYOA 2FYUK 1Y47A 2W27A 1N2DC 4TLFA 3GHGA 1GZLA 2V7QH 3M0DC 1AJYA 3ITKA 1Q81Q 2P67A 1GL2A 1PGPA 1YHQP 2AEMA 4OVNF 1URQB 2MJZA 1Z56A 3V2RA 4H0LD 3RL0B 3B5ND 5AVRB 3A2AA 3CC4P 3HE4A 4IFMA 2W6AA 3MTUE 5CCGA 4DCKA 1OZHA 3BCCG 5C39A 1YJWP 1QEXA 3AEGC 1MUUA 1FDMA 1HF9A 1JY3P 5AVSB 1NHLA 1IFDA 4N3YB 1SQQE 3RK3E 2FKWB 3TK1A 2W90A 1BE3D 2E74C 4EIJA 5KLIB 3HRNA 1L4AC 4NPEA 1KYOI 3G71P 3L74J 2KYVA 1OFCX 1VQNP 5TJHA 4EOTA 4RO0A 1OMIA 1FDOA 1R8EA 2FYNB 3NFQA 1P84I 2WITA 1JTHB 1JNMA 2E5YA 2NPSB 2HODB 5AW2B 1NTKJ 5CMZA 2KZIA 1PPJG 3H1IJ 2KOGA 2JDIH 1ZR4A 5BU5A 2Y0EA 1YJ9P 1NAFA 3RK3C 2N1TD 1H8AA 3LIEA 5L8RJ 3H1KE 4Z1MH 1SQBK 5APWA 1DEBA 4PD4D 5KKZB 1JCCA 3H32B 3S4RA 1KZUB 5AVVB 2K1AA 1L4AA 1NAYA 4MN4C 4UB8E 2KI7B 1BGYE 3WUVA 2ZT9C 4LC1A 3LIDA 1W5CE 1L0NG 2I1KA 5KJ7D 2O01N 5H2FH 2OARA 2WZ7A 4DT0A 1S4XA 4U3FD 1IFNA 1NTMJ 1UIXA 3TGUD 3CI9A 3L73D 2C9LY 1IJDB 1X22A 4L73A 4C7RA 3H1JE 1JY2O 3M06A 3MGNA 4I1LA 3L75D 1PP9G 1FZFA 2MKVA 3HTKA 1GW3A 1Q82Q 3AE5C 2NRGA 1NU1J 1YBKA 3KDPB 2GUSA 1VQPP 1NWQA 3AE2C 5AVQB 2QE7H 2KK7A 1GMJA 5AVTB 1SQPD 2KP8A 1OWAA 5KLVJ 4I7ZC 1E79H 2IZ0A 1N7SB 1L2PA 3TNUA 2N9BA 1YQ4C 4RJTA 1L0LK 3SWFA 1U7MA 1DIPA 2YO3A 1JY3N 4JYCA 4U3FJ 1BCCD 1VQ8P 3GLMA 2JWAA 2R44A 3CXHD 1FOSE 3AECC 2XDJA 2AXCA 3OA7A 1N73B 3CWBG 3G6EP 3BVHA 1HTLC 1EZVD 1JY2N 1SQVJ 3CCLP 2WPSA 1BE3E 3CX5D 2QJPB 3L71J 1JO5A 2E76D 1S72P 3B5NC 1ZLLA 4JYBA 1LTBC 3IFMA 2H7HA 1M7LA
chains in the Genus database with same CATH topology
2BCCG 4D6TG 1SQBG 2IBZG 1NTKG 3L72G 3L73G 3H1JG 3L74G 3H1IG 1KYOH 2FYUG 1SQXG 3L71G 1PPJG 1SQQG 3H1LG 3H1HG 1L0NG 3H1KG 3L70G 4PD4H 3BCCG 1P84H 3L75G 1NTZG 4U3FG 1L0LG 1NTMG 1PP9G 3CWBG 2A06G 1SQPG 1BCCG 5KLVG 1BE3G 1SQVG 1BGYG 3TGUG 3CX5H 1NU1G 1EZVG 3CXHH 1KB9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCC G;  4D6T G;  1SQB G;  2IBZ G;  1NTK G;  3L72 G;  3L73 G;  3H1J G;  3L74 G;  3H1I G;  1KYO H;  2FYU G;  1SQX G;  3L71 G;  1PPJ G;  1SQQ G;  3H1L G;  3H1H G;  1L0N G;  3H1K G;  3L70 G;  4PD4 H;  3BCC G;  1P84 H;  3L75 G;  1NTZ G;  4U3F G;  1L0L G;  1NTM G;  1PP9 G;  3CWB G;  2A06 G;  1SQP G;  1BCC G;  5KLV G;  1BE3 G;  1SQV G;  1BGY G;  3TGU G;  3CX5 H;  1NU1 G;  1EZV G;  3CXH H;  1KB9 H; 
#chains in the Genus database with same CATH topology
 2KLU A;  3P32 A;  3KQG A;  2L91 A;  2FXP A;  2E75 D;  3V2Q A;  1JB0 J;  1HGV A;  1YTZ I;  4L76 A;  2J5U A;  4XA4 A;  5APT A;  1FOS F;  2WSE J;  2XU6 A;  3G9R A;  3CD6 P;  3P8M C;  2GA1 A;  1HBW A;  4PD4 E;  1SQX J;  1GK4 A;  1GW4 A;  2FYU D;  3A0H E;  1NVO A;  4IL6 H;  1G2C B;  2XZR A;  3B5N A;  1OVV A;  4H13 D;  5GTH E;  5AW3 B;  2JEE A;  2Q5U A;  3L37 A;  1LTT C;  4PV1 D;  1ZME C;  2KZJ A;  3L73 E;  3H1L J;  3MP7 B;  1USD A;  3NMD A;  1LP1 B;  5GTI E;  1VQ6 P;  2OGU A;  1CZQ A;  2YMY A;  3L75 E;  3HD7 C;  5AVU B;  2I1J A;  3L74 G;  2AEF A;  2M3B A;  1NTZ K;  1LTJ C;  2PGD A;  4HB1 A;  3WU2 E;  2H89 C;  2Q7C A;  2OYO A;  2A06 D;  3HUS C;  1JUN A;  2IFM A;  1SQP E;  2O3J A;  1NTK G;  1L4A D;  4IL6 X;  2QEX P;  3H1I G;  1FJK A;  3KYQ A;  1RE4 A;  3V2P A;  2M5A A;  2WQY C;  3R4Y A;  3CMA P;  2HYN A;  1GTW A;  1BDD A;  5APQ A;  3HD7 A;  1JOC A;  1MZ9 A;  1CI6 B;  5AVX B;  2YKP A;  1BCC E;  1KQL A;  1RY3 A;  1VL2 A;  3CXH E;  1VQ7 P;  1AFO A;  2HPC B;  1ZN5 A;  4IFD K;  1NTM G;  3HUS A;  1J1E B;  4OGQ B;  1DH3 A;  4WY4 B;  3KZI H;  2J58 A;  4GOD A;  2QG4 A;  3SFE C;  1SQB D;  3AE7 C;  4HJG H;  2V4H A;  4I6M C;  1EZV E;  3F5H A;  3CX5 E;  3WUT A;  3AE3 C;  1LT9 B;  1VQ5 P;  1FS0 E;  3JCU E;  2R3S A;  1NU1 G;  3PP5 A;  1KB9 I;  2XKM A;  3O6Q A;  2C0W A;  1KYO H;  3FXD A;  3MD0 A;  3AE4 C;  1GK6 A;  4H44 C;  2XNX A;  2BCC E;  3A0B E;  2WSE H;  2RMZ A;  5B5E E;  5KLV G;  4C46 A;  2RKL A;  4DZO A;  3T97 B;  2KUB A;  1BSN A;  3A3Y B;  4UB6 H;  4GDO A;  1FBM A;  3CCR P;  2QRX A;  4L74 A;  2JKV A;  3OAK A;  3CCQ P;  1SQQ J;  1FZC A;  4U3F G;  3GHG B;  3IAO A;  5TIS H;  1KV4 A;  3TGU G;  1LTA C;  2QIW A;  2KNC A;  5AW9 B;  1QGK B;  2D2C D;  4ZNC A;  3RBX A;  1LWU C;  5KAF H;  4WWI A;  3FWN A;  4WBA A;  1GL2 B;  2G8Y A;  4HYT B;  4QMA A;  2QJK C;  1LTI C;  3U1A A;  1H0T B;  3V4Q A;  3JSV C;  3H1H D;  4N78 D;  4I2L C;  1IC2 A;  1YYC A;  4YPC A;  4PD4 I;  2E75 C;  1M1J A;  1ZRT D;  1L0L D;  4YTP C;  1SQV G;  4O9B A;  2OYH C;  3HE4 B;  2IBZ D;  2P58 A;  3L72 D;  1FC2 C;  3L71 G;  3USS A;  2OYI A;  3H1K J;  4GIF A;  2IFN A;  5DJT B;  4H13 C;  1LWU A;  2A06 E;  3RGU A;  1BGY J;  1PIX A;  1L0N K;  3VP9 A;  4PV1 C;  5AW4 B;  1PV3 A;  2IDB A;  2WSS H;  3AE9 C;  1U7J A;  2FFD A;  3KHU A;  1OX3 A;  3V2N A;  1KIL D;  2Q6Q A;  3EFF K;  1SQX G;  2QA4 P;  1NGM B;  1OW8 A;  1K9M Q;  1K04 A;  3H1J J;  1J1D C;  5KAI H;  2O01 J;  3M0D A;  1G1I A;  1S5L H;  3CC2 P;  2KLV A;  2W6B A;  3PH0 A;  1FDI A;  5APV A;  1ZW0 A;  2LR2 A;  1IFI A;  2E74 B;  1SQB E;  3H1L G;  3RK2 B;  2HR3 A;  4JQ0 D;  1JY2 P;  3VMZ A;  1HWT C;  2UWJ E;  2WSF H;  1VQ9 P;  2Y0C A;  4D6T D;  3HE5 A;  2HG5 D;  4EDF A;  1DEE G;  2Z5H A;  2K9Y A;  2YIU C;  3L70 D;  2NPS C;  1EDL A;  3C9I A;  4DOJ A;  3HD7 D;  2K37 A;  4N6J A;  3RK3 B;  2YKO A;  1Q90 D;  3EWK A;  2FYU G;  1S5L X;  1QVG O;  1S9K D;  5KKZ C;  3D70 A;  3U59 A;  2ZT9 B;  1NTZ D;  3W67 A;  3K5B A;  4Y99 B;  5M1B A;  1NKZ B;  1EDJ A;  2L5G B;  3BAT A;  4R4L A;  3I56 P;  1IFP A;  4KT0 J;  1BE3 J;  5APX A;  1KFM A;  2OQQ A;  2WSC J;  2E43 A;  5AW5 B;  1N7L A;  2JP3 A;  1RQV A;  3AEA C;  1KD1 Q;  3CCE P;  3H1H E;  4N78 E;  3TNU B;  1DD3 A;  4EI2 A;  1ZRT E;  3M9H A;  1L0L E;  3FWL A;  2AEJ A;  4L75 A;  1U57 A;  2IBZ E;  3L72 E;  3I55 P;  3L4F A;  2JO1 A;  4XFJ A;  3M9B A;  1IZN B;  1SFC B;  2Y9Y A;  3L35 A;  1M8O B;  1LTG C;  3GF3 A;  2M8R A;  3MZW B;  3P8C D;  2D2C C;  4GOE A;  2P1J A;  2K88 A;  3AEB C;  1IK7 A;  2O01 H;  4GKG A;  1AQT A;  1KIL E;  4A7P A;  3TGU J;  1HGZ A;  4H44 D;  3G3Z A;  2CPS A;  2B87 B;  3L73 J;  2IYP A;  5AW0 B;  2GUV A;  2CPB A;  1SQQ G;  1KYO D;  3CC7 P;  1EDK A;  1N8R Q;  1WT6 A;  3B71 A;  2KIK A;  1M1K Q;  2H43 A;  3V4W A;  3L75 J;  2FXO A;  1W2E A;  1P84 D;  3BCC D;  3M91 A;  3CCM P;  1OW7 A;  2OTK E;  1VPC A;  2AXT E;  4ZKP A;  5K5G B;  5AW8 B;  4H0L B;  1NTK K;  1IO4 A;  4IL6 E;  1VF5 D;  1SQP J;  1KIL C;  3B5N B;  2I8D A;  2ZYG A;  4NPD A;  4RKU J;  1M90 Q;  2BCC D;  3M9Q A;  1KQS O;  2PRR A;  1SP4 A;  4D6T E;  1NJI Q;  3H1K G;  3G4S P;  4HH2 A;  3Q1M A;  3L70 E;  1YTZ T;  1BGY G;  1BCC J;  4K35 A;  1KB9 H;  1A02 F;  2Z5I A;  3PHL A;  2VRS A;  4AQR D;  2W83 C;  1PPJ D;  1GD2 E;  3OW2 O;  1X9V A;  1NTM K;  2FBW C;  1RHZ B;  2R32 A;  1S9K E;  1XTC C;  2B89 A;  5B66 H;  1EC5 A;  2WSC H;  1TU3 F;  4PJ0 E;  1KIL A;  1NTZ E;  4B86 A;  2W8Z A;  2PAJ A;  1Y8A A;  3CCV P;  3H1J G;  5APU A;  2ZVN B;  1PGQ A;  3ABV C;  1L0N D;  1T6A A;  1S3J A;  1MV8 A;  5AW1 B;  1URQ D;  4C7N A;  1NU1 K;  1X8Y A;  3KPE A;  1JCD A;  1KQF B;  1GU4 A;  2M5A B;  3VMX A;  2CK3 H;  2ZJS E;  2JJL A;  3RL0 D;  2N1T B;  3AE1 C;  1T3U A;  3D6Z A;  4BRY A;  4PD4 H;  5KLV K;  2K3R A;  3CLQ A;  1PP9 D;  5APY A;  3MUD C;  2M3E A;  3LW5 J;  4KHX A;  1PL5 A;  3HUS B;  5AVW B;  2FYU J;  3P8C E;  5GTH H;  2QJY B;  3KZI E;  5AVZ B;  1ZP0 C;  1CW5 A;  1EXI A;  4LLH A;  1EQ7 A;  1RE3 C;  1KC8 Q;  2FYZ A;  1PGO A;  3CCJ P;  2WT7 A;  3SFD C;  3B8E B;  1LTJ A;  1LGH B;  4WB4 A;  3O6Q B;  2NPS D;  1KYO E;  1SQV K;  3CCS P;  2LKM A;  3MUD A;  3E1R A;  3MIW A;  3WMM 0;  1BE3 G;  3WU2 H;  1T2K C;  1HJ0 A;  3TDK A;  1P84 E;  3AE6 C;  2IX7 C;  3BCC E;  1IFJ A;  4OGQ C;  3A5T A;  1QX8 A;  1X0T A;  4WY4 C;  5CJ0 A;  3VMY A;  1M56 D;  2OTL P;  1FZA A;  2N9Y B;  1RE3 A;  1RH5 B;  1FZC B;  1NKN A;  2Q1K A;  1NO4 A;  3E1I A;  1LT9 C;  1OVR A;  2R3C A;  3GW6 A;  2KNC B;  1Q86 Q;  5KAF E;  3F89 A;  1SQX K;  1NH4 A;  5BVZ A;  2ZYA A;  3TYY A;  3Q5S A;  3CXH H;  1M1J B;  2QVA A;  2K9J A;  2O1K A;  4WY4 A;  3KXD A;  2Q9I A;  1PPJ E;  2HLO A;  2ZVO B;  2KS1 A;  2WTY A;  1WMK A;  4YXD C;  2OYI B;  1VF5 C;  2E76 B;  3L73 G;  4EYY Q;  5AW7 B;  1SQB J;  4IFF A;  1VQK P;  4WVZ A;  4W7Y A;  1AQ5 A;  1XTG B;  1K8A Q;  1K05 A;  2Q3E A;  4GOF A;  1N7S D;  2Q3I A;  3L75 G;  1PFI A;  1L0N E;  3A0B H;  1RF1 C;  1GL2 C;  2E75 B;  1J2J B;  3Q3D A;  2FFD B;  1HH0 A;  3II6 A;  5E79 H;  4K3A A;  1NYH A;  3H25 A;  1SQP G;  1S5L E;  1AA0 A;  1PP9 E;  3L74 D;  3A7O A;  4H13 B;  3B4S A;  3SWK A;  1FZE A;  1ZV8 A;  1QL1 A;  2A45 G;  1EDI A;  1RF1 A;  4PV1 B;  3PTZ A;  1URQ C;  2B9B A;  2H8P D;  1DX7 A;  1BCC G;  1H0T A;  2OYH A;  3I5C A;  3E7K A;  3EQ2 A;  3V6I A;  3P7K A;  2WPR A;  3RL0 C;  1NTK D;  3H1I D;  2LXB A;  4W7Z A;  3H6P A;  3HE5 B;  3H1H J;  1K73 Q;  1J1D B;  3BAS A;  2ZXE B;  1L0L J;  3JC2 2;  3R2P A;  1EZV G;  2LXC B;  1KB9 D;  3L72 J;  1Y9B A;  3CCU P;  2A45 I;  3UIA A;  1L4A B;  3CPW O;  1URQ A;  5DJU B;  5KLI C;  3NXS A;  1NTM D;  2BEQ D;  3QH9 A;  3IR9 A;  1VQO P;  3CWB E;  5CBN A;  2BCC G;  3RK2 C;  3CXH I;  5H2F E;  4W80 A;  2WVR A;  2FYN C;  1JM0 A;  2Z4E A;  3M0A A;  2SPZ A;  2FXM A;  2YIU B;  2YNY A;  3NTN A;  4HKZ H;  1EZV I;  1HJB A;  2O1J A;  1NU1 D;  3CX5 I;  2ZYD A;  1R5L A;  1SQQ K;  1GDT A;  1JEK A;  1A02 J;  3HTK B;  4TT3 H;  1EXJ A;  3TF5 A;  1SLQ A;  3N7N A;  3GG2 A;  1PZQ A;  1KMI Z;  4JBZ A;  1FAV A;  1T8Z A;  3U1C A;  2HFE D;  4R4M A;  2RN0 A;  5KLV D;  1JY3 O;  1YJN P;  1KN7 A;  3FXE A;  1QLE D;  4RES B;  3AE8 C;  2XND H;  4Y99 C;  4ZKU A;  1JTH A;  1Q2N A;  2P10 A;  2YMK A;  4ASW A;  2E42 A;  2NPS A;  2JWD A;  2HOD A;  2WPV B;  3PRJ A;  3D6Y A;  1VDF A;  3FX0 A;  4AUW A;  1YQ3 C;  1N86 A;  5BU8 B;  4D6T J;  1LJ2 A;  1QVF O;  3H32 A;  3WUU A;  3L70 J;  2B88 A;  4UB8 H;  2GM4 A;  1AVY A;  2A06 G;  3VYI A;  1T2K D;  1SQV D;  3CL3 D;  2C9N Y;  5CCH D;  2YXR B;  3L71 D;  4OGQ D;  2PP6 A;  4I7Z B;  1SFC C;  3L74 E;  3VOP A;  4WY4 D;  2D2C B;  2PFX A;  1S2E A;  1DD4 A;  1QL2 A;  2RH0 A;  1ZOY C;  1N7S C;  1NTZ J;  2Y0D A;  3EFG A;  2KXP B;  4AYC A;  1PGJ A;  2C0X A;  4JF7 A;  3IF4 A;  1NTK E;  4KJM A;  3H1I E;  1FZG A;  1IK9 A;  3PLN A;  1R5S A;  3V5B A;  1ZXG A;  4DJG A;  4BWN A;  2WPQ A;  1SQX D;  1SQB G;  1S1C X;  1AVO A;  1N73 C;  2JR8 A;  1VQ4 P;  3SSU A;  1SFC A;  1KB9 E;  1M57 D;  2ZXX A;  1YIT P;  2OTJ P;  1N7S A;  2WMM A;  3VP8 A;  4OH8 B;  1KOR A;  2IPP A;  2DW3 A;  1NOH A;  2QJP C;  1Q7Y Q;  1NTM E;  3GF7 A;  1RQU A;  1IFM A;  2QM7 A;  5B66 E;  2QSI A;  1KIL B;  4JPZ B;  4XE5 B;  4H0L C;  3H1L D;  2KSE A;  3C1L A;  3RL0 g;  2J59 M;  1AV1 A;  1LTS C;  3RBZ A;  2B87 A;  1GL2 D;  2POH A;  1GU5 A;  4ZMD A;  1FJP A;  2ITA A;  1N73 A;  4C7N B;  1H89 A;  3QWO C;  1NU1 E;  4GT1 A;  4LGD E;  3VTP C;  5CHX A;  2R5D A;  2ZAE B;  5CCG D;  2AXT H;  3D71 A;  4CPG A;  5AVY B;  4BRY B;  2KSJ A;  3BCC J;  5KLV E;  4Y28 J;  1VQL P;  2P2U A;  3AED C;  1JMM A;  2P7J A;  1YI2 P;  1T3J A;  5EFW B;  3H1H G;  3VN0 A;  1USE A;  4ASV A;  1L0L G;  3OJA B;  2FY8 A;  2KB7 P;  2BEZ F;  4U3F E;  2IBZ G;  5KTB A;  3L72 G;  1JMB A;  2IZ1 A;  2BCC J;  3TGU E;  3Q5R A;  3HD7 B;  2ZFC A;  1RE4 C;  1VQM P;  3CME P;  2WT7 B;  1D7M A;  2Y9Z A;  1ZR2 A;  2N1T C;  1LTJ B;  1RF0 C;  3A0H H;  1YIJ P;  2QM8 A;  3VMA A;  1G2C A;  2R5B A;  5AW6 B;  1SQV E;  3L36 A;  4PJ0 H;  3AEF C;  4YXW H;  3FGA D;  4OWF A;  3L71 E;  1HUC A;  5APS A;  5KJ7 C;  2NZ2 A;  1OIP A;  1KQG B;  2V7Q J;  2E74 D;  4M3L A;  5CJ4 A;  3ZDM A;  2IBZ I;  3RK2 D;  2QJY C;  1MFZ A;  1LP1 A;  5GTI H;  2XV5 A;  2N1T A;  1L0N J;  1SS1 A;  1RF0 A;  3Q5P A;  1SQX E;  5CCH C;  1G1J A;  4U7J A;  1SQQ D;  1J1E C;  3RK3 D;  5KJ7 A;  1SQP K;  4UB6 E;  3SWY A;  3IN6 A;  2K9J B;  1LT1 A;  3CWB D;  1PP9 J;  3S1K A;  2W6J H;  2G3A A;  4D6T G;  2ZT9 D;  2A45 H;  1BDC A;  5TIS E;  2KS1 B;  1WRG A;  1X79 B;  3BRT B;  5CBO A;  3L70 G;  1CI6 A;  1FZC C;  4H44 B;  2E5T A;  3H1L E;  2YO2 A;  2M0B A;  5CCH A;  2HPC A;  1OVU A;  2BAS A;  1FE6 A;  1MFT A;  2WSF J;  1OXZ A;  3S9O A;  3H1K D;  1E5W A;  3PJS K;  1OW6 A;  1P84 H;  1NTZ G;  1M1J C;  3MHV A;  1BSH A;  2H88 C;  5E79 E;  2YKQ A;  4NPF X;  3AEE C;  3GMA A;  3CX5 H;  1BGY D;  4BXL A;  1LNQ A;  1LT9 A;  1SFC D;  1CSB A;  1VF5 B;  3BRV B;  2FYU E;  3GHG C;  3O8Z A;  1LWU B;  3JCU H;  4IOI H;  1H88 A;  2WWW A;  1W2B O;  3TSI A;  3Q2Y A;  2QJK B;  2OYI C;  2E76 C;  1SVF A;  1UII A;  3N4X A;  1KFN A;  3CWB J;  1RF1 B;  1FZB A;  3H1J D;  2OYH B;  5B5E H;  1MKM A;  1FU1 A;  3T97 A;  3LW5 H;  2FFD C;  3W68 A;  3C8V A;  5KAI E;  1KTM A;  2YXQ B;  5CCG C;  1HVV A;  2IYO A;  2FYU K;  1Y47 A;  2W27 A;  1N2D C;  4TLF A;  3GHG A;  1GZL A;  2V7Q H;  3M0D C;  1AJY A;  3ITK A;  1Q81 Q;  2P67 A;  1GL2 A;  1PGP A;  1YHQ P;  2AEM A;  4OVN F;  1URQ B;  2MJZ A;  1Z56 A;  3V2R A;  4H0L D;  3RL0 B;  3B5N D;  5AVR B;  3A2A A;  3CC4 P;  3HE4 A;  4IFM A;  2W6A A;  3MTU E;  5CCG A;  4DCK A;  1OZH A;  3BCC G;  5C39 A;  1YJW P;  1QEX A;  3AEG C;  1MUU A;  1FDM A;  1HF9 A;  1JY3 P;  5AVS B;  1NHL A;  1IFD A;  4N3Y B;  1SQQ E;  3RK3 E;  2FKW B;  3TK1 A;  2W90 A;  1BE3 D;  2E74 C;  4EIJ A;  5KLI B;  3HRN A;  1L4A C;  4NPE A;  1KYO I;  3G71 P;  3L74 J;  2KYV A;  1OFC X;  1VQN P;  5TJH A;  4EOT A;  4RO0 A;  1OMI A;  1FDO A;  1R8E A;  2FYN B;  3NFQ A;  1P84 I;  2WIT A;  1JTH B;  1JNM A;  2E5Y A;  2NPS B;  2HOD B;  5AW2 B;  1NTK J;  5CMZ A;  2KZI A;  1PPJ G;  3H1I J;  2KOG A;  2JDI H;  1ZR4 A;  5BU5 A;  2Y0E A;  1YJ9 P;  1NAF A;  3RK3 C;  2N1T D;  1H8A A;  3LIE A;  5L8R J;  3H1K E;  4Z1M H;  1SQB K;  5APW A;  1DEB A;  4PD4 D;  5KKZ B;  1JCC A;  3H32 B;  3S4R A;  1KZU B;  5AVV B;  2K1A A;  1L4A A;  1NAY A;  4MN4 C;  4UB8 E;  2KI7 B;  1BGY E;  3WUV A;  2ZT9 C;  4LC1 A;  3LID A;  1W5C E;  1L0N G;  2I1K A;  5KJ7 D;  2O01 N;  5H2F H;  2OAR A;  2WZ7 A;  4DT0 A;  1S4X A;  4U3F D;  1IFN A;  1NTM J;  1UIX A;  3TGU D;  3CI9 A;  3L73 D;  2C9L Y;  1IJD B;  1X22 A;  4L73 A;  4C7R A;  3H1J E;  1JY2 O;  3M06 A;  3MGN A;  4I1L A;  3L75 D;  1PP9 G;  1FZF A;  2MKV A;  3HTK A;  1GW3 A;  1Q82 Q;  3AE5 C;  2NRG A;  1NU1 J;  1YBK A;  3KDP B;  2GUS A;  1VQP P;  1NWQ A;  3AE2 C;  5AVQ B;  2QE7 H;  2KK7 A;  1GMJ A;  5AVT B;  1SQP D;  2KP8 A;  1OWA A;  5KLV J;  4I7Z C;  1E79 H;  2IZ0 A;  1N7S B;  1L2P A;  3TNU A;  2N9B A;  1YQ4 C;  4RJT A;  1L0L K;  3SWF A;  1U7M A;  1DIP A;  2YO3 A;  1JY3 N;  4JYC A;  4U3F J;  1BCC D;  1VQ8 P;  3GLM A;  2JWA A;  2R44 A;  3CXH D;  1FOS E;  3AEC C;  2XDJ A;  2AXC A;  3OA7 A;  1N73 B;  3CWB G;  3G6E P;  3BVH A;  1HTL C;  1EZV D;  1JY2 N;  1SQV J;  3CCL P;  2WPS A;  1BE3 E;  3CX5 D;  2QJP B;  3L71 J;  1JO5 A;  2E76 D;  1S72 P;  3B5N C;  1ZLL A;  4JYB A;  1LTB C;  3IFM A;  2H7H A;  1M7L A; 
#chains in the Genus database with same CATH homology
 2BCC G;  4D6T G;  1SQB G;  2IBZ G;  1NTK G;  3L72 G;  3L73 G;  3H1J G;  3L74 G;  3H1I G;  1KYO H;  2FYU G;  1SQX G;  3L71 G;  1PPJ G;  1SQQ G;  3H1L G;  3H1H G;  1L0N G;  3H1K G;  3L70 G;  4PD4 H;  3BCC G;  1P84 H;  3L75 G;  1NTZ G;  4U3F G;  1L0L G;  1NTM G;  1PP9 G;  3CWB G;  2A06 G;  1SQP G;  1BCC G;  5KLV G;  1BE3 G;  1SQV G;  1BGY G;  3TGU G;  3CX5 H;  1NU1 G;  1EZV G;  3CXH H;  1KB9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...