2FYUG

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 2fyuG00
3L74G 3CXHH 3H1KG 3CWBG 2BCCG 3H1HG 3H1IG 3L72G 3L71G 3BCCG 4D6TG 2IBZG 1BE3G 3L70G 3L73G 1BGYG 4U3FG 3H1JG 1L0NG 1NTKG 3TGUG 5KLVG 3H1LG 2FYUG 1PPJG 1P84H 3CX5H 2A06G 1SQBG 3L75G 1NTMG 1PP9G 1KYOH 1KB9H 1SQPG 1BCCG 1EZVG 1SQVG 1SQXG 1L0LG 1NTZG 1NU1G 1SQQG 4PD4H
chains in the Genus database with same CATH superfamily
1NVOA 3N4XA 1BCCE 2BCCG 1IFNA 5AVRB 1SQXK 3K5BA 3BRVB 2D2CB 3AE3C 1OW6A 3CX5E 2L5GB 4JYBA 4LLHA 1JMBA 2QJKB 1GL2B 4HH2A 2R44A 3I55P 5TISE 1N7SC 3H32B 2IBZG 2KS1B 1FZFA 5KLVD 1GTWA 1AA0A 4YXDC 4C7NB 3B5NC 4JYCA 4I7ZB 3V6IA 1JOCA 4M3LA 4OH8B 3H1HG 2XU6A 2E76B 1K04A 1LTTC 5KLVJ 1Q86Q 3VMXA 1Q81Q 3QWOC 1KQSO 1PGOA 1SQVG 2W27A 1YITP 2IPPA 2IFMA 3CXHI 1QVGO 3NTNA 1PP9E 2NPSC 2Z5IA 3M06A 3RK3C 1BGYG 2E42A 2O01H 1FS0E 3Q5RA 2Q1KA 1EZVD 3MGNA 3Q5PA 1RF1A 1L0LD 4ASVA 3L75E 3A0BH 1KORA 3L71D 1KYOD 1ZN5A 1DEBA 3G71P 1URQD 2RMZA 1OMIA 1VF5C 2FY8A 3CPWO 4RESB 4ZNCA 2FFDA 2AEFA 3RL0B 1LJ2A 1PPJE 2H88C 4C7RA 2Q6QA 3L71J 3OAKA 3LW5J 3JCUH 1R8EA 3HD7A 1VQLP 3AE1C 1BDDA 2D2CD 3AEEC 2J59M 2YIUC 5KLVE 1FZCA 1XTGB 1JMMA 1N73B 3L72D 3BCCD 1PGPA 3U1CA 1QEXA 1KC8Q 4CPGA 1L4AC 1CI6B 1JY2O 1QL1A 5AW3B 2E74C 2NZ2A 4RO0A 5KLVK 2OYIB 1NTZG 1YTZI 2B89A 3S4RA 3BCCJ 4WVZA 1DD4A 1M1KQ 1AFOA 3SSUA 1NU1E 1WRGA 3IFMA 5CMZA 3TYYA 2JWDA 1T3UA 4EDFA 2FYNC 2QIWA 2E76D 2O01N 2ZAEB 5AW1B 1GK4A 3CWBD 5KAIE 5APUA 1NU1K 1L0LE 2AXCA 1J1DB 2PRRA 5CCHA 3L35A 3FWNA 4XE5B 1SFCC 2FYZA 5CJ0A 3G3ZA 4JPZB 1KYOE 1S3JA 2YKOA 3BASA 2L91A 2M3BA 3CWBJ 1MFTA 2K1AA 1IFIA 2K9YA 1L0LK 2E75B 1RY3A 2LXBA 2YO3A 3KQGA 2N9BA 4C46A 2H89C 2O1JA 2Y0EA 2C9LY 2WSFH 1GDTA 3S1KA 2WSCJ 3C1LA 3HE5B 1N2DC 3RL0D 1OVVA 3OA7A 4WY4C 1ZOYC 2M0BA 2GUSA 1KILA 4PJ0H 2HODB 3ZDMA 2I1KA 3L72E 3A2AA 3KPEA 2KI7B 1IFDA 3H1IG 2QEXP 3PHLA 2QJPB 4PV1C 2ZJSE 5KTBA 2RH0A 3R4YA 1IK7A 4HKZH 3H1JG 2N1TA 2A06D 2B88A 1AQ5A 3B71A 2JWAA 1BSNA 1SQXG 2UWJE 1JY3P 2WVRA 4EYYQ 1PFIA 1PIXA 2JO1A 3SWFA 5KJ7D 2WMMA 4B86A 1JY3N 2ZT9C 1NHLA 3CWBE 2V7QH 1K05A 3V4QA 1P84I 2M5AB 1KN7A 1VQ8P 3U59A 5CHXA 1BCCG 2NRGA 5KKZB 1KTMA 2OTKE 3OJAB 4IFMA 4HJGH 5AW8B 1GZLA 3JSVC 3O8ZA 3RBXA 1SP4A 3VMAA 5CBNA 2KSJA 4KJMA 1FDOA 2XNXA 2BEQD 1Y8AA 1LT9B 1RF1C 3MIWA 1A02F 3VP8A 3ABVC 3BVHA 4RJTA 2ZFCA 2QJYB 2IZ0A 2KLVA 1VL2A 3CLQA 1AQTA 4UB8E 3TF5A 5H2FE 1LTJA 2E75D 2KUBA 1W5CE 5AW5B 2ZXEB 3W67A 3HD7C 2HLOA 4K35A 1KFMA 1M1JA 5GTIH 3O6QA 1KB9D 5APVA 2B9BA 3LIDA 3CC7P 2PP6A 3SFEC 1NH4A 3V2RA 3TNUA 1NTKE 3H1KG 4UB6E 2WQYC 1QVFO 2OYHA 3VMZA 2KK7A 1Y9BA 1E5WA 1R5SA 3T97A 2FYUD 4UB8H 5H2FH 1D7MA 4KHXA 3L75G 1GU5A 1ZMEC 5DJUB 4TT3H 1NTKK 1LT1A 3NFQA 4H44C 3M9HA 2WSEH 3HUSB 2FYUJ 1MZ9A 2OARA 2NPSB 3IAOA 4BXLA 3RK3B 1BE3E 1YBKA 1G1IA 3VMYA 2ITAA 2HR3A 1URQA 5CCHC 2W6JH 1DH3A 1P84D 4DOJA 5BU5A 2Y0DA 2YMKA 1LWUA 3E1IA 5KLVG 1KQFB 1SQBD 1LP1A 1NTMD 5KLIC 3V2QA 1JY2P 1T2KD 1NOHA 1RE4A 2WPSA 3GHGB 3Q1MA 1NYHA 3H6PA 1QL2A 1IFMA 2IFNA 1JY2N 1SQBJ 1JCDA 3EWKA 1NTMJ 2HPCB 4JQ0D 4ZKUA 1KB9E 1GL2A 3A3YB 4O9BA 1NU1G 2I1JA 4PD4E 1QLED 1S2EA 3H32A 4GDOA 3M0DA 4I2LC 1Z56A 3G9RA 2KS1A 1KILC 5DJTB 5TJHA 1M57D 1IZNB 1X79B 1NGMB 4C7NA 1FZGA 4Y28J 1KQGB 1EZVG 1L0LG 2FYUE 1YJWP 1Q7YQ 3KYQA 4R4MA 2E43A 1VQNP 3L71G 4H13B 1HJBA 1PGJA 2N1TC 1L0ND 3IN6A 1N8RQ 3AEDC 2IBZI 5AVWB 4JBZA 2FYUK 2P10A 4PD4H 3CD6P 3HE4B 2R3CA 3E1RA 1Y47A 1L0NJ 1KILE 1ZR4A 1A02J 1FAVA 2Y9ZA 2WTYA 2H43A 1SFCB 2Q5UA 4IL6X 2NPSD 3NMDA 2JDIH 3VYIA 3WMM0 1SQBE 3PTZA 1NTME 4D6TD 3L72G 3BCCG 5CCGD 2E5YA 3BATA 3CCVP 3CX5H 3M9BA 2KSEA 4ZMDA 3AECC 1HJ0A 1EDJA 2Q9IA 3U1AA 1H0TB 3AEFC 1SQBK 1NTMK 1MV8A 4D6TJ 1U7MA 5TISH 2P7JA 3CMAP 1LTGC 2E5TA 5B66E 3H1KE 1J1EC 4WY4B 4IL6E 4XA4A 4WB4A 2XDJA 3I56P 2WT7B 1FDIA 3HRNA 4H0LC 1XTCC 1N73A 3B8EB 3CWBG 1FZEA 5C39A 3TGUJ 1HUCA 1ZP0C 2WPRA 2FBWC 1CI6A 3P32A 5KJ7A 1M7LA 2OYIA 3AE8C 3KZIE 1L0NE 1LGHB 2BCCD 3FGAD 3WU2E 1YQ4C 2K88A 1OW7A 2PFXA 5B66H 2HYNA 1YI2P 1RF0A 4L76A 4W80A 4A7PA 4IL6H 4H13D 2R3SA 2G8YA 1L0NK 4BRYB 1OVUA 2BCCJ 3CMEP 4JF7A 1RE3A 2K9JB 4N78D 2IBZD 1GL2D 2H7HA 4U3FD 5GTHE 1K9MQ 1DD3A 2QM8A 3CCLP 4D6TE 1SVFA 1BDCA 2I8DA 4DJGA 5AW9B 1URQC 3EFGA 1DIPA 1ZV8A 1USDA 1GW4A 3F5HA 1SFCD 2HFED 3RL0g 3D6YA 4U3FJ 1RH5B 1LWUC 1G2CB 3H25A 1FU1A 1FDMA 3Q2YA 2GUVA 1NTKG 1IO4A 3W68A 4DCKA 1SQVD 2A06G 3HE5A 1SS1A 1E79H 2D2CC 1R5LA 1EZVE 2IDBA 2WITA 2HODA 5GTHH 2QJKC 3C9IA 1VQ6P 3CXHD 1JTHB 1SQVJ 1ZRTD 3PH0A 3HTKB 2CPSA 2Y9YA 3L71E 5CBOA 4WY4D 3M0DC 2KNCB 4MN4C 2FXMA 1GD2E 4Y99C 3RK2B 4ASWA 2YXQB 3VP9A 1WT6A 2AXTE 2XNDH 1BE3G 1OX3A 1HF9A 4I7ZC 1S9KD 2IX7C 1LTSC 4L74A 1VQ4P 1SQQD 2E76C 1U57A 1VQKP 3C8VA 3B4SA 5KAIH 2M5AA 1LTIC 2R5DA 4N78E 2Z4EA 1X22A 3BCCE 2QE7H 1K73Q 3LW5H 1KYOH 3FXEA 1SQQJ 4U3FE 3CCQP 4PD4I 3P8CD 1KQLA 1FE6A 3L73D 2AXTH 1M56D 1LT9A 1JNMA 2KOGA 4BWNA 2WSSH 3WUUA 2ZYDA 5KAFE 5EFWB 3GG2A 4N6JA 3GLMA 1LTBC 3L73J 5BU8B 3RL0C 1X0TA 2YKPA 3FXDA 2FYUG 4OGQB 1HGZA 3CX5I 4W7YA 4EIJA 2W8ZA 3RBZA 3M9QA 2WWWA 4DZOA 4AUWA 4IFDK 1WMKA 1VQ5P 2W83C 3AEBC 4WWIA 2Y0CA 2K3RA 3GMAA 2KZJA 2OTJP 1M8OB 1SQPD 2POHA 3AE9C 1EDIA 2A45G 1N73C 3IF4A 4GOEA 5AVVB 1HBWA 1H8AA 1CW5A 1FZAA 1USEA 1SQQE 3L70D 1KV4A 4GT1A 3EFFK 1OFCX 2OYIC 5AVQB 3RK2D 1SQPJ 2FFDC 1MFZA 3AE5C 3CCRP 4TLFA 1SQBG 1NTMG 5AVYB 2QG4A 4K3AA 1PL5A 3HUSA 3L70J 1SQQK 2WSCH 1N7SB 1S5LX 2NPSA 2ZVNB 2XKMA 3PLNA 1FZCC 1VQPP 3VN0A 1EDKA 3V2PA 1S72P 1RE3C 2FXPA 5CCGA 1IJDB 2A06E 3B5NB 5E79E 2B87B 2JJLA 4DT0A 2Q3IA 2Q7CA 1X8YA 1HTLC 3H1IJ 3L74D 2K37A 3A5TA 1CSBA 1S5LE 2J5UA 3H1JJ 3GHGA 1YHQP 1UIXA 1TU3F 1L0NG 2HPCA 1DEEG 1SQXJ 3P7KA 1J1EB 5AVXB 3L74J 2OYOA 1IK9A 1EC5A 4OGQD 1VDFA 2ZYGA 4UB6H 3CC4P 2Z5HA 4H0LB 1AVOA 3MTUE 5E79H 3I5CA 2AEMA 4Z1MH 2DW3A 2SPZA 3BRTB 2LR2A 2QJPC 2P67A 3L70E 5CJ4A 3GF3A 5AVSB 3G4SP 4IFFA 1FBMA 1VF5B 1YTZT 2IYOA 1FJPA 1S5LH 4L73A 3L36A 4D6TG 4R4LA 5B5EE 5AW6B 1PGQA 3R2PA 3HE4A 2LXCB 2O01J 3PP5A 4GKGA 2YIUB 1VQ7P 1ZR2A 1EZVI 1KZUB 1FOSF 4YPCA 3TSIA 4KT0J 3H1LD 3TK1A 2YO2A 1PP9D 1SFCA 1KYOI 1L4AB 1JM0A 1N7SD 3V2NA 2FXOA 1AVYA 1YYCA 1Q2NA 3G6EP 2E74B 1S4XA 3AE7C 1LT9C 3L74E 3H1LJ 1T2KC 5B5EH 1PV3A 2YXRB 3B5ND 1PP9J 1GU4A 5APSA 1KB9H 2Q3EA 2FYNB 5AVZB 2QJYC 1H0TA 5AW2B 3E7KA 4WY4A 3L75J 3CCUP 1PPJD 2KXPB 1YJNP 1P84E 2WT7A 3VTPC 1HGVA 2M8RA 2YKQA 1U7JA 1Q82Q 3RK3D 3VOPA 4Y99B 2ZVOB 4U3FG 4HYTB 1LTAC 2KP8A 1AV1A 2C0WA 4H0LD 1SLQA 1EQ7A 2GM4A 2CK3H 5AW4B 4AYCA 3A0BE 2JR8A 3A0HE 2A45H 1ZXGA 3MZWB 2RN0A 3WUVA 1VF5D 1LTJC 3TGUD 1IFJA 2LKMA 4OWFA 3M91A 1P84H 2KLUA 2GA1A 1NU1D 4BRYA 3H1LE 3HUSC 2K9JA 1M1JC 1CZQA 3L4FA 5APQA 2PGDA 1K8AQ 3JCUE 1JCCA 2OQQA 1OVRA 5AVTB 2XV5A 4PV1B 4WBAA 2AEJA 2XZRA 1NU1J 5CCGC 2JP3A 3AE6C 2OTLP 3P8MC 1RQUA 2WSFJ 2OYHC 3A0HH 1L4AD 3CCEP 1HH0A 1G2CA 1RHZB 1JUNA 4IOIH 2R32A 2CPBA 4W7ZA 2E74D 2O1KA 1L0LJ 1NKZB 2ZT9B 1YQ3C 5APWA 3QH9A 1HWTC 4GOFA 1YJ9P 2BASA 5APTA 1SQQG 4NPDA 1KD1Q 1VPCA 3GHGC 1JTHA 3HTKA 1OW8A 1ZW0A 3RK3E 1NO4A 2M3EA 2P58A 2G3AA 2KNCA 4RKUJ 2W6BA 3KZIH 1RF1B 3AE4C 4YTPC 1KFNA 3H1HD 3WU2H 4I1LA 3MUDA 3GW6A 3L73G 1LNQA 3AEAC 3V4WA 2FFDB 3TGUE 2V7QJ 4HB1A 1FC2C 4H13C 3L72J 3H1HJ 1RE4C 1EXJA 3SWYA 1BGYD 3HD7B 1EXIA 4GIFA 4L75A 3TDKA 2J58A 1GL2C 2WPVB 1NAYA 3KXDA 3SWKA 1S1CX 2P2UA 5BVZA 2QVAA 1FZCB 1VQMP 3CCMP 3S9OA 1BGYJ 1OWAA 4PJ0E 3M0AA 2BCCE 4OVNF 1SQPG 4PV1D 1M90Q 1H88A 1AJYA 1N86A 3MHVA 3WUTA 3LIEA 4H44B 2ZXXA 1KMIZ 3L70G 2MKVA 2V4HA 2IBZE 1KB9I 2ZT9D 1GW3A 1NWQA 3CCJP 2JEEA 3CL3D 1DX7A 3H1HE 1FOSE 1QX8A 3KDPB 3FWLA 1NTZD 3D6ZA 2YNYA 3FX0A 1SQVE 4NPFX 2QM7A 5KLIB 4LGDE 1JO5A 1NTKD 2IYPA 2WSEJ 3GF7A 1FJKA 2WZ7A 1X9VA 1NTZJ 1EDLA 2KB7P 1BGYE 1NKNA 4ZKPA 3CXHE 3L74G 1BSHA 1OZHA 1ZRTE 1SQVK 2A45I 1W2EA 1FZBA 1NTKJ 1N7SA 1ZLLA 2P1JA 1Q90D 1KILB 2MJZA 2QA4P 4QMAA 3HD7D 5KAFH 3RGUA 1N7LA 1MKMA 3B5NA 1S9KE 3A7OA 5GTIE 2B87A 1GMJA 3D71A 2O3JA 1BE3D 2KIKA 2QRXA 5KJ7C 3L37A 1G1JA 3D70A 2N1TB 2C9NY 1T3JA 3PRJA 3CXHH 1HVVA 2R5BA 3USSA 3UIAA 1IC2A 3PJSK 1BE3J 3V5BA 5K5GB 1RF0C 3P8CE 4GODA 3CC2P 4H44D 2JKVA 3CI9A 2KYVA 3L73E 3EQ2A 3H1ID 5APYA 1J1DC 3NXSA 3AE2C 1NTZE 2W90A 2OGUA 3II6A 5APXA 3H1JD 4PD4D 2RKLA 3H1LG 1VQ9P 3AEGC 1RQVA 1PZQA 2QSIA 4AQRD 1OXZA 1PP9G 5CCHD 1SQXD 3RK2C 2E75C 3MUDC 3Q3DA 1NTZK 3Q5SA 4LC1A 4XFJA 1LTJB 1BCCD 4I6MC 1VQOP 2H8PD 3CX5D 1SQPE 5AVUB 3ITKA 1M1JB 3O6QB 4EI2A 5AW7B 1PPJG 1BCCJ 1L4AA 2VRSA 1NJIQ 3N7NA 3IR9A 3CCSP 3TNUB 1KILD 3MD0A 2C0XA 4YXWH 1SQPK 2N9YB 2ZYAA 5M1BA 2KZIA 2FKWB 3MP7B 2HG5D 1JB0J 1MUUA 2OYHB 5AW0B 4EOTA 3T97B 2BEZF 3OW2O 3JC22 4U7JA 5L8RJ 3SFDC 4N3YB 1JEKA 1QGKB 1T8ZA 2N1TD 2W6AA 4OGQC 3H1IE 3F89A 3TGUG 2PAJA 5KKZC 1H89A 4NPEA 3H1JE 1L2PA 1UIIA 1YIJP 1GK6A 3H1KD 1T6AA 1W2BO 1URQB 1OIPA 1SQXE 2WPQA 1J2JB 1NAFA 1JY3O 3KHUA 1LWUB 3L75D 1LP1B 1IFPA 3H1KJ 2IZ1A 2YMYA
chains in the Genus database with same CATH topology
3L74G 3CXHH 3H1KG 3CWBG 2BCCG 3H1HG 3H1IG 3L72G 3L71G 3BCCG 4D6TG 2IBZG 1BE3G 3L70G 3L73G 1BGYG 4U3FG 3H1JG 1L0NG 1NTKG 3TGUG 5KLVG 3H1LG 2FYUG 1PPJG 1P84H 3CX5H 2A06G 1SQBG 3L75G 1NTMG 1PP9G 1KYOH 1KB9H 1SQPG 1BCCG 1EZVG 1SQVG 1SQXG 1L0LG 1NTZG 1NU1G 1SQQG 4PD4H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L74 G;  3CXH H;  3H1K G;  3CWB G;  2BCC G;  3H1H G;  3H1I G;  3L72 G;  3L71 G;  3BCC G;  4D6T G;  2IBZ G;  1BE3 G;  3L70 G;  3L73 G;  1BGY G;  4U3F G;  3H1J G;  1L0N G;  1NTK G;  3TGU G;  5KLV G;  3H1L G;  2FYU G;  1PPJ G;  1P84 H;  3CX5 H;  2A06 G;  1SQB G;  3L75 G;  1NTM G;  1PP9 G;  1KYO H;  1KB9 H;  1SQP G;  1BCC G;  1EZV G;  1SQV G;  1SQX G;  1L0L G;  1NTZ G;  1NU1 G;  1SQQ G;  4PD4 H; 
#chains in the Genus database with same CATH topology
 1NVO A;  3N4X A;  1BCC E;  2BCC G;  1IFN A;  5AVR B;  1SQX K;  3K5B A;  3BRV B;  2D2C B;  3AE3 C;  1OW6 A;  3CX5 E;  2L5G B;  4JYB A;  4LLH A;  1JMB A;  2QJK B;  1GL2 B;  4HH2 A;  2R44 A;  3I55 P;  5TIS E;  1N7S C;  3H32 B;  2IBZ G;  2KS1 B;  1FZF A;  5KLV D;  1GTW A;  1AA0 A;  4YXD C;  4C7N B;  3B5N C;  4JYC A;  4I7Z B;  3V6I A;  1JOC A;  4M3L A;  4OH8 B;  3H1H G;  2XU6 A;  2E76 B;  1K04 A;  1LTT C;  5KLV J;  1Q86 Q;  3VMX A;  1Q81 Q;  3QWO C;  1KQS O;  1PGO A;  1SQV G;  2W27 A;  1YIT P;  2IPP A;  2IFM A;  3CXH I;  1QVG O;  3NTN A;  1PP9 E;  2NPS C;  2Z5I A;  3M06 A;  3RK3 C;  1BGY G;  2E42 A;  2O01 H;  1FS0 E;  3Q5R A;  2Q1K A;  1EZV D;  3MGN A;  3Q5P A;  1RF1 A;  1L0L D;  4ASV A;  3L75 E;  3A0B H;  1KOR A;  3L71 D;  1KYO D;  1ZN5 A;  1DEB A;  3G71 P;  1URQ D;  2RMZ A;  1OMI A;  1VF5 C;  2FY8 A;  3CPW O;  4RES B;  4ZNC A;  2FFD A;  2AEF A;  3RL0 B;  1LJ2 A;  1PPJ E;  2H88 C;  4C7R A;  2Q6Q A;  3L71 J;  3OAK A;  3LW5 J;  3JCU H;  1R8E A;  3HD7 A;  1VQL P;  3AE1 C;  1BDD A;  2D2C D;  3AEE C;  2J59 M;  2YIU C;  5KLV E;  1FZC A;  1XTG B;  1JMM A;  1N73 B;  3L72 D;  3BCC D;  1PGP A;  3U1C A;  1QEX A;  1KC8 Q;  4CPG A;  1L4A C;  1CI6 B;  1JY2 O;  1QL1 A;  5AW3 B;  2E74 C;  2NZ2 A;  4RO0 A;  5KLV K;  2OYI B;  1NTZ G;  1YTZ I;  2B89 A;  3S4R A;  3BCC J;  4WVZ A;  1DD4 A;  1M1K Q;  1AFO A;  3SSU A;  1NU1 E;  1WRG A;  3IFM A;  5CMZ A;  3TYY A;  2JWD A;  1T3U A;  4EDF A;  2FYN C;  2QIW A;  2E76 D;  2O01 N;  2ZAE B;  5AW1 B;  1GK4 A;  3CWB D;  5KAI E;  5APU A;  1NU1 K;  1L0L E;  2AXC A;  1J1D B;  2PRR A;  5CCH A;  3L35 A;  3FWN A;  4XE5 B;  1SFC C;  2FYZ A;  5CJ0 A;  3G3Z A;  4JPZ B;  1KYO E;  1S3J A;  2YKO A;  3BAS A;  2L91 A;  2M3B A;  3CWB J;  1MFT A;  2K1A A;  1IFI A;  2K9Y A;  1L0L K;  2E75 B;  1RY3 A;  2LXB A;  2YO3 A;  3KQG A;  2N9B A;  4C46 A;  2H89 C;  2O1J A;  2Y0E A;  2C9L Y;  2WSF H;  1GDT A;  3S1K A;  2WSC J;  3C1L A;  3HE5 B;  1N2D C;  3RL0 D;  1OVV A;  3OA7 A;  4WY4 C;  1ZOY C;  2M0B A;  2GUS A;  1KIL A;  4PJ0 H;  2HOD B;  3ZDM A;  2I1K A;  3L72 E;  3A2A A;  3KPE A;  2KI7 B;  1IFD A;  3H1I G;  2QEX P;  3PHL A;  2QJP B;  4PV1 C;  2ZJS E;  5KTB A;  2RH0 A;  3R4Y A;  1IK7 A;  4HKZ H;  3H1J G;  2N1T A;  2A06 D;  2B88 A;  1AQ5 A;  3B71 A;  2JWA A;  1BSN A;  1SQX G;  2UWJ E;  1JY3 P;  2WVR A;  4EYY Q;  1PFI A;  1PIX A;  2JO1 A;  3SWF A;  5KJ7 D;  2WMM A;  4B86 A;  1JY3 N;  2ZT9 C;  1NHL A;  3CWB E;  2V7Q H;  1K05 A;  3V4Q A;  1P84 I;  2M5A B;  1KN7 A;  1VQ8 P;  3U59 A;  5CHX A;  1BCC G;  2NRG A;  5KKZ B;  1KTM A;  2OTK E;  3OJA B;  4IFM A;  4HJG H;  5AW8 B;  1GZL A;  3JSV C;  3O8Z A;  3RBX A;  1SP4 A;  3VMA A;  5CBN A;  2KSJ A;  4KJM A;  1FDO A;  2XNX A;  2BEQ D;  1Y8A A;  1LT9 B;  1RF1 C;  3MIW A;  1A02 F;  3VP8 A;  3ABV C;  3BVH A;  4RJT A;  2ZFC A;  2QJY B;  2IZ0 A;  2KLV A;  1VL2 A;  3CLQ A;  1AQT A;  4UB8 E;  3TF5 A;  5H2F E;  1LTJ A;  2E75 D;  2KUB A;  1W5C E;  5AW5 B;  2ZXE B;  3W67 A;  3HD7 C;  2HLO A;  4K35 A;  1KFM A;  1M1J A;  5GTI H;  3O6Q A;  1KB9 D;  5APV A;  2B9B A;  3LID A;  3CC7 P;  2PP6 A;  3SFE C;  1NH4 A;  3V2R A;  3TNU A;  1NTK E;  3H1K G;  4UB6 E;  2WQY C;  1QVF O;  2OYH A;  3VMZ A;  2KK7 A;  1Y9B A;  1E5W A;  1R5S A;  3T97 A;  2FYU D;  4UB8 H;  5H2F H;  1D7M A;  4KHX A;  3L75 G;  1GU5 A;  1ZME C;  5DJU B;  4TT3 H;  1NTK K;  1LT1 A;  3NFQ A;  4H44 C;  3M9H A;  2WSE H;  3HUS B;  2FYU J;  1MZ9 A;  2OAR A;  2NPS B;  3IAO A;  4BXL A;  3RK3 B;  1BE3 E;  1YBK A;  1G1I A;  3VMY A;  2ITA A;  2HR3 A;  1URQ A;  5CCH C;  2W6J H;  1DH3 A;  1P84 D;  4DOJ A;  5BU5 A;  2Y0D A;  2YMK A;  1LWU A;  3E1I A;  5KLV G;  1KQF B;  1SQB D;  1LP1 A;  1NTM D;  5KLI C;  3V2Q A;  1JY2 P;  1T2K D;  1NOH A;  1RE4 A;  2WPS A;  3GHG B;  3Q1M A;  1NYH A;  3H6P A;  1QL2 A;  1IFM A;  2IFN A;  1JY2 N;  1SQB J;  1JCD A;  3EWK A;  1NTM J;  2HPC B;  4JQ0 D;  4ZKU A;  1KB9 E;  1GL2 A;  3A3Y B;  4O9B A;  1NU1 G;  2I1J A;  4PD4 E;  1QLE D;  1S2E A;  3H32 A;  4GDO A;  3M0D A;  4I2L C;  1Z56 A;  3G9R A;  2KS1 A;  1KIL C;  5DJT B;  5TJH A;  1M57 D;  1IZN B;  1X79 B;  1NGM B;  4C7N A;  1FZG A;  4Y28 J;  1KQG B;  1EZV G;  1L0L G;  2FYU E;  1YJW P;  1Q7Y Q;  3KYQ A;  4R4M A;  2E43 A;  1VQN P;  3L71 G;  4H13 B;  1HJB A;  1PGJ A;  2N1T C;  1L0N D;  3IN6 A;  1N8R Q;  3AED C;  2IBZ I;  5AVW B;  4JBZ A;  2FYU K;  2P10 A;  4PD4 H;  3CD6 P;  3HE4 B;  2R3C A;  3E1R A;  1Y47 A;  1L0N J;  1KIL E;  1ZR4 A;  1A02 J;  1FAV A;  2Y9Z A;  2WTY A;  2H43 A;  1SFC B;  2Q5U A;  4IL6 X;  2NPS D;  3NMD A;  2JDI H;  3VYI A;  3WMM 0;  1SQB E;  3PTZ A;  1NTM E;  4D6T D;  3L72 G;  3BCC G;  5CCG D;  2E5Y A;  3BAT A;  3CCV P;  3CX5 H;  3M9B A;  2KSE A;  4ZMD A;  3AEC C;  1HJ0 A;  1EDJ A;  2Q9I A;  3U1A A;  1H0T B;  3AEF C;  1SQB K;  1NTM K;  1MV8 A;  4D6T J;  1U7M A;  5TIS H;  2P7J A;  3CMA P;  1LTG C;  2E5T A;  5B66 E;  3H1K E;  1J1E C;  4WY4 B;  4IL6 E;  4XA4 A;  4WB4 A;  2XDJ A;  3I56 P;  2WT7 B;  1FDI A;  3HRN A;  4H0L C;  1XTC C;  1N73 A;  3B8E B;  3CWB G;  1FZE A;  5C39 A;  3TGU J;  1HUC A;  1ZP0 C;  2WPR A;  2FBW C;  1CI6 A;  3P32 A;  5KJ7 A;  1M7L A;  2OYI A;  3AE8 C;  3KZI E;  1L0N E;  1LGH B;  2BCC D;  3FGA D;  3WU2 E;  1YQ4 C;  2K88 A;  1OW7 A;  2PFX A;  5B66 H;  2HYN A;  1YI2 P;  1RF0 A;  4L76 A;  4W80 A;  4A7P A;  4IL6 H;  4H13 D;  2R3S A;  2G8Y A;  1L0N K;  4BRY B;  1OVU A;  2BCC J;  3CME P;  4JF7 A;  1RE3 A;  2K9J B;  4N78 D;  2IBZ D;  1GL2 D;  2H7H A;  4U3F D;  5GTH E;  1K9M Q;  1DD3 A;  2QM8 A;  3CCL P;  4D6T E;  1SVF A;  1BDC A;  2I8D A;  4DJG A;  5AW9 B;  1URQ C;  3EFG A;  1DIP A;  1ZV8 A;  1USD A;  1GW4 A;  3F5H A;  1SFC D;  2HFE D;  3RL0 g;  3D6Y A;  4U3F J;  1RH5 B;  1LWU C;  1G2C B;  3H25 A;  1FU1 A;  1FDM A;  3Q2Y A;  2GUV A;  1NTK G;  1IO4 A;  3W68 A;  4DCK A;  1SQV D;  2A06 G;  3HE5 A;  1SS1 A;  1E79 H;  2D2C C;  1R5L A;  1EZV E;  2IDB A;  2WIT A;  2HOD A;  5GTH H;  2QJK C;  3C9I A;  1VQ6 P;  3CXH D;  1JTH B;  1SQV J;  1ZRT D;  3PH0 A;  3HTK B;  2CPS A;  2Y9Y A;  3L71 E;  5CBO A;  4WY4 D;  3M0D C;  2KNC B;  4MN4 C;  2FXM A;  1GD2 E;  4Y99 C;  3RK2 B;  4ASW A;  2YXQ B;  3VP9 A;  1WT6 A;  2AXT E;  2XND H;  1BE3 G;  1OX3 A;  1HF9 A;  4I7Z C;  1S9K D;  2IX7 C;  1LTS C;  4L74 A;  1VQ4 P;  1SQQ D;  2E76 C;  1U57 A;  1VQK P;  3C8V A;  3B4S A;  5KAI H;  2M5A A;  1LTI C;  2R5D A;  4N78 E;  2Z4E A;  1X22 A;  3BCC E;  2QE7 H;  1K73 Q;  3LW5 H;  1KYO H;  3FXE A;  1SQQ J;  4U3F E;  3CCQ P;  4PD4 I;  3P8C D;  1KQL A;  1FE6 A;  3L73 D;  2AXT H;  1M56 D;  1LT9 A;  1JNM A;  2KOG A;  4BWN A;  2WSS H;  3WUU A;  2ZYD A;  5KAF E;  5EFW B;  3GG2 A;  4N6J A;  3GLM A;  1LTB C;  3L73 J;  5BU8 B;  3RL0 C;  1X0T A;  2YKP A;  3FXD A;  2FYU G;  4OGQ B;  1HGZ A;  3CX5 I;  4W7Y A;  4EIJ A;  2W8Z A;  3RBZ A;  3M9Q A;  2WWW A;  4DZO A;  4AUW A;  4IFD K;  1WMK A;  1VQ5 P;  2W83 C;  3AEB C;  4WWI A;  2Y0C A;  2K3R A;  3GMA A;  2KZJ A;  2OTJ P;  1M8O B;  1SQP D;  2POH A;  3AE9 C;  1EDI A;  2A45 G;  1N73 C;  3IF4 A;  4GOE A;  5AVV B;  1HBW A;  1H8A A;  1CW5 A;  1FZA A;  1USE A;  1SQQ E;  3L70 D;  1KV4 A;  4GT1 A;  3EFF K;  1OFC X;  2OYI C;  5AVQ B;  3RK2 D;  1SQP J;  2FFD C;  1MFZ A;  3AE5 C;  3CCR P;  4TLF A;  1SQB G;  1NTM G;  5AVY B;  2QG4 A;  4K3A A;  1PL5 A;  3HUS A;  3L70 J;  1SQQ K;  2WSC H;  1N7S B;  1S5L X;  2NPS A;  2ZVN B;  2XKM A;  3PLN A;  1FZC C;  1VQP P;  3VN0 A;  1EDK A;  3V2P A;  1S72 P;  1RE3 C;  2FXP A;  5CCG A;  1IJD B;  2A06 E;  3B5N B;  5E79 E;  2B87 B;  2JJL A;  4DT0 A;  2Q3I A;  2Q7C A;  1X8Y A;  1HTL C;  3H1I J;  3L74 D;  2K37 A;  3A5T A;  1CSB A;  1S5L E;  2J5U A;  3H1J J;  3GHG A;  1YHQ P;  1UIX A;  1TU3 F;  1L0N G;  2HPC A;  1DEE G;  1SQX J;  3P7K A;  1J1E B;  5AVX B;  3L74 J;  2OYO A;  1IK9 A;  1EC5 A;  4OGQ D;  1VDF A;  2ZYG A;  4UB6 H;  3CC4 P;  2Z5H A;  4H0L B;  1AVO A;  3MTU E;  5E79 H;  3I5C A;  2AEM A;  4Z1M H;  2DW3 A;  2SPZ A;  3BRT B;  2LR2 A;  2QJP C;  2P67 A;  3L70 E;  5CJ4 A;  3GF3 A;  5AVS B;  3G4S P;  4IFF A;  1FBM A;  1VF5 B;  1YTZ T;  2IYO A;  1FJP A;  1S5L H;  4L73 A;  3L36 A;  4D6T G;  4R4L A;  5B5E E;  5AW6 B;  1PGQ A;  3R2P A;  3HE4 A;  2LXC B;  2O01 J;  3PP5 A;  4GKG A;  2YIU B;  1VQ7 P;  1ZR2 A;  1EZV I;  1KZU B;  1FOS F;  4YPC A;  3TSI A;  4KT0 J;  3H1L D;  3TK1 A;  2YO2 A;  1PP9 D;  1SFC A;  1KYO I;  1L4A B;  1JM0 A;  1N7S D;  3V2N A;  2FXO A;  1AVY A;  1YYC A;  1Q2N A;  3G6E P;  2E74 B;  1S4X A;  3AE7 C;  1LT9 C;  3L74 E;  3H1L J;  1T2K C;  5B5E H;  1PV3 A;  2YXR B;  3B5N D;  1PP9 J;  1GU4 A;  5APS A;  1KB9 H;  2Q3E A;  2FYN B;  5AVZ B;  2QJY C;  1H0T A;  5AW2 B;  3E7K A;  4WY4 A;  3L75 J;  3CCU P;  1PPJ D;  2KXP B;  1YJN P;  1P84 E;  2WT7 A;  3VTP C;  1HGV A;  2M8R A;  2YKQ A;  1U7J A;  1Q82 Q;  3RK3 D;  3VOP A;  4Y99 B;  2ZVO B;  4U3F G;  4HYT B;  1LTA C;  2KP8 A;  1AV1 A;  2C0W A;  4H0L D;  1SLQ A;  1EQ7 A;  2GM4 A;  2CK3 H;  5AW4 B;  4AYC A;  3A0B E;  2JR8 A;  3A0H E;  2A45 H;  1ZXG A;  3MZW B;  2RN0 A;  3WUV A;  1VF5 D;  1LTJ C;  3TGU D;  1IFJ A;  2LKM A;  4OWF A;  3M91 A;  1P84 H;  2KLU A;  2GA1 A;  1NU1 D;  4BRY A;  3H1L E;  3HUS C;  2K9J A;  1M1J C;  1CZQ A;  3L4F A;  5APQ A;  2PGD A;  1K8A Q;  3JCU E;  1JCC A;  2OQQ A;  1OVR A;  5AVT B;  2XV5 A;  4PV1 B;  4WBA A;  2AEJ A;  2XZR A;  1NU1 J;  5CCG C;  2JP3 A;  3AE6 C;  2OTL P;  3P8M C;  1RQU A;  2WSF J;  2OYH C;  3A0H H;  1L4A D;  3CCE P;  1HH0 A;  1G2C A;  1RHZ B;  1JUN A;  4IOI H;  2R32 A;  2CPB A;  4W7Z A;  2E74 D;  2O1K A;  1L0L J;  1NKZ B;  2ZT9 B;  1YQ3 C;  5APW A;  3QH9 A;  1HWT C;  4GOF A;  1YJ9 P;  2BAS A;  5APT A;  1SQQ G;  4NPD A;  1KD1 Q;  1VPC A;  3GHG C;  1JTH A;  3HTK A;  1OW8 A;  1ZW0 A;  3RK3 E;  1NO4 A;  2M3E A;  2P58 A;  2G3A A;  2KNC A;  4RKU J;  2W6B A;  3KZI H;  1RF1 B;  3AE4 C;  4YTP C;  1KFN A;  3H1H D;  3WU2 H;  4I1L A;  3MUD A;  3GW6 A;  3L73 G;  1LNQ A;  3AEA C;  3V4W A;  2FFD B;  3TGU E;  2V7Q J;  4HB1 A;  1FC2 C;  4H13 C;  3L72 J;  3H1H J;  1RE4 C;  1EXJ A;  3SWY A;  1BGY D;  3HD7 B;  1EXI A;  4GIF A;  4L75 A;  3TDK A;  2J58 A;  1GL2 C;  2WPV B;  1NAY A;  3KXD A;  3SWK A;  1S1C X;  2P2U A;  5BVZ A;  2QVA A;  1FZC B;  1VQM P;  3CCM P;  3S9O A;  1BGY J;  1OWA A;  4PJ0 E;  3M0A A;  2BCC E;  4OVN F;  1SQP G;  4PV1 D;  1M90 Q;  1H88 A;  1AJY A;  1N86 A;  3MHV A;  3WUT A;  3LIE A;  4H44 B;  2ZXX A;  1KMI Z;  3L70 G;  2MKV A;  2V4H A;  2IBZ E;  1KB9 I;  2ZT9 D;  1GW3 A;  1NWQ A;  3CCJ P;  2JEE A;  3CL3 D;  1DX7 A;  3H1H E;  1FOS E;  1QX8 A;  3KDP B;  3FWL A;  1NTZ D;  3D6Z A;  2YNY A;  3FX0 A;  1SQV E;  4NPF X;  2QM7 A;  5KLI B;  4LGD E;  1JO5 A;  1NTK D;  2IYP A;  2WSE J;  3GF7 A;  1FJK A;  2WZ7 A;  1X9V A;  1NTZ J;  1EDL A;  2KB7 P;  1BGY E;  1NKN A;  4ZKP A;  3CXH E;  3L74 G;  1BSH A;  1OZH A;  1ZRT E;  1SQV K;  2A45 I;  1W2E A;  1FZB A;  1NTK J;  1N7S A;  1ZLL A;  2P1J A;  1Q90 D;  1KIL B;  2MJZ A;  2QA4 P;  4QMA A;  3HD7 D;  5KAF H;  3RGU A;  1N7L A;  1MKM A;  3B5N A;  1S9K E;  3A7O A;  5GTI E;  2B87 A;  1GMJ A;  3D71 A;  2O3J A;  1BE3 D;  2KIK A;  2QRX A;  5KJ7 C;  3L37 A;  1G1J A;  3D70 A;  2N1T B;  2C9N Y;  1T3J A;  3PRJ A;  3CXH H;  1HVV A;  2R5B A;  3USS A;  3UIA A;  1IC2 A;  3PJS K;  1BE3 J;  3V5B A;  5K5G B;  1RF0 C;  3P8C E;  4GOD A;  3CC2 P;  4H44 D;  2JKV A;  3CI9 A;  2KYV A;  3L73 E;  3EQ2 A;  3H1I D;  5APY A;  1J1D C;  3NXS A;  3AE2 C;  1NTZ E;  2W90 A;  2OGU A;  3II6 A;  5APX A;  3H1J D;  4PD4 D;  2RKL A;  3H1L G;  1VQ9 P;  3AEG C;  1RQV A;  1PZQ A;  2QSI A;  4AQR D;  1OXZ A;  1PP9 G;  5CCH D;  1SQX D;  3RK2 C;  2E75 C;  3MUD C;  3Q3D A;  1NTZ K;  3Q5S A;  4LC1 A;  4XFJ A;  1LTJ B;  1BCC D;  4I6M C;  1VQO P;  2H8P D;  3CX5 D;  1SQP E;  5AVU B;  3ITK A;  1M1J B;  3O6Q B;  4EI2 A;  5AW7 B;  1PPJ G;  1BCC J;  1L4A A;  2VRS A;  1NJI Q;  3N7N A;  3IR9 A;  3CCS P;  3TNU B;  1KIL D;  3MD0 A;  2C0X A;  4YXW H;  1SQP K;  2N9Y B;  2ZYA A;  5M1B A;  2KZI A;  2FKW B;  3MP7 B;  2HG5 D;  1JB0 J;  1MUU A;  2OYH B;  5AW0 B;  4EOT A;  3T97 B;  2BEZ F;  3OW2 O;  3JC2 2;  4U7J A;  5L8R J;  3SFD C;  4N3Y B;  1JEK A;  1QGK B;  1T8Z A;  2N1T D;  2W6A A;  4OGQ C;  3H1I E;  3F89 A;  3TGU G;  2PAJ A;  5KKZ C;  1H89 A;  4NPE A;  3H1J E;  1L2P A;  1UII A;  1YIJ P;  1GK6 A;  3H1K D;  1T6A A;  1W2B O;  1URQ B;  1OIP A;  1SQX E;  2WPQ A;  1J2J B;  1NAF A;  1JY3 O;  3KHU A;  1LWU B;  3L75 D;  1LP1 B;  1IFP A;  3H1K J;  2IZ1 A;  2YMY A; 
#chains in the Genus database with same CATH homology
 3L74 G;  3CXH H;  3H1K G;  3CWB G;  2BCC G;  3H1H G;  3H1I G;  3L72 G;  3L71 G;  3BCC G;  4D6T G;  2IBZ G;  1BE3 G;  3L70 G;  3L73 G;  1BGY G;  4U3F G;  3H1J G;  1L0N G;  1NTK G;  3TGU G;  5KLV G;  3H1L G;  2FYU G;  1PPJ G;  1P84 H;  3CX5 H;  2A06 G;  1SQB G;  3L75 G;  1NTM G;  1PP9 G;  1KYO H;  1KB9 H;  1SQP G;  1BCC G;  1EZV G;  1SQV G;  1SQX G;  1L0L G;  1NTZ G;  1NU1 G;  1SQQ G;  4PD4 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...