2FYUJ

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
60
structure length
60
Chain Sequence
b'APTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 20
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 2fyuJ00
3L71J 3L73J 1SQQJ 3H1KJ 2BCCJ 3L72J 4PD4I 3CWBJ 2IBZI 3H1HJ 3BCCJ 3L75J 1L0NJ 1NTZJ 1L0LJ 1NTKJ 3CX5I 3TGUJ 1EZVI 3CXHI 1KYOI 1SQXJ 1PP9J 2FYUJ 1BE3J 4U3FJ 1NTMJ 1NU1J 3H1JJ 1BGYJ 1SQBJ 1SQVJ 3H1LJ 1KB9I 3L74J 1BCCJ 1SQPJ 5KLVJ 1P84I 4D6TJ 3H1IJ 3L70J
chains in the Genus database with same CATH superfamily
1VQ8P 1KILE 1LTSC 4PD4D 5AVRB 3HE4A 3PH0A 2HLOA 1SQBG 1BSHA 1HBWA 2Z5HA 4GDOA 3CCUP 3VTPC 2Y0DA 1YTZT 2M5AB 3BCCE 1RY3A 4EIJA 2H43A 3CLQA 1KZUB 1FDIA 3CCRP 2JEEA 2B9BA 1DD3A 1PL5A 2JDIH 1M56D 1S5LE 4HKZH 5CMZA 1G2CA 1KILC 2ZT9D 1OW7A 1A02F 1AFOA 1GU5A 1QEXA 2N1TC 1R8EA 3MTUE 4H13B 5APSA 2B88A 1BCCD 3SFDC 1IFJA 1NOHA 1T2KC 3GG2A 2W27A 2Q5UA 2HODB 1SQQE 1OWAA 2E75C 2XZRA 5AW6B 3V2PA 4LGDE 5KJ7C 3AEAC 3M91A 2CK3H 5B66E 2IBZD 2R5DA 2IX7C 1LWUA 3BVHA 3CX5D 1KN7A 3CX5H 2I8DA 2E5YA 2BCCE 4AYCA 3H1HD 1ZW0A 3TGUD 1FU1A 1NKNA 2AXTH 2KIKA 2E75B 5CCGA 1K9MQ 1L4AC 4Y99B 1PPJD 3H1IJ 2BEZF 1GK6A 4WBAA 1JY2N 2B89A 5AW7B 2GM4A 1DX7A 5KTBA 5AW5B 5BU8B 3HE5A 1NU1G 1KORA 1SQVD 2QEXP 3P8MC 1EZVD 1XTGB 1DH3A 4D6TD 2KYVA 5CCGD 4DJGA 3OAKA 3P7KA 2AXCA 4IL6E 1L4AB 1ZMEC 1Y47A 3RBZA 3QWOC 1OW6A 3M9BA 4N78D 1SQXJ 1R5SA 3MZWB 2ZAEB 3BRTB 3L35A 1YITP 1KYOD 1FZFA 1KYOH 1K73Q 5APYA 1AQTA 2WSFH 3L71G 3JCUH 2HODA 2CPSA 3NFQA 1L0LK 3H1JD 2FYUE 3VN0A 1KILA 1KTMA 2R3CA 3GMAA 2N1TA 1JNMA 4K3AA 5AVYB 1JMBA 3M9QA 3MD0A 2XDJA 1NAFA 2PFXA 3AEEC 1NYHA 4EYYQ 5AVXB 1VF5D 2QM8A 2OARA 3L74J 3GF7A 1GU4A 1ZXGA 5KLVK 1CI6B 3B5NC 1KILD 1SQQK 2POHA 4O9BA 3V6IA 1VQ7P 2N1TD 3L36A 1ZR2A 4QMAA 3Q2YA 1OIPA 3S4RA 4L76A 3EWKA 1CW5A 4ZNCA 1T2KD 3G9RA 3VMZA 3AEGC 1KB9D 1KB9H 2E75D 3AE2C 3BCCD 1S1CX 5KJ7D 1H89A 1NTZG 4YTPC 1GW4A 1L4AA 3VP9A 2WQYC 3MUDC 2CPBA 3PRJA 1KQFB 3WMM0 2LKMA 3F89A 3OJAB 4WVZA 1LTJC 3CCSP 2A45I 4KHXA 3GF3A 2H88C 5KAIH 4XE5B 1L4AD 3CC2P 3CMEP 1SQPK 1SQQD 3W68A 5H2FE 4M3LA 5AVSB 3CWBD 3GHGB 2WPQA 2QRXA 1RE3C 1L0NK 5B66H 3RL0g 3E1IA 4I2LC 1T3JA 3CCLP 3G71P 1JTHB 1VPCA 2Z4EA 1Q81Q 3KDPB 2O1JA 3H1IE 3FXDA 2BCCD 4IFDK 1NGMB 2NPSD 3L72G 1IZNB 2FYNB 2V7QJ 5GTIE 4JYCA 2WVRA 3IF4A 2M8RA 1NU1E 2FY8A 2FYUK 1BGYJ 2RN0A 1SVFA 1BGYG 3UIAA 1T8ZA 4UB8H 3AEBC 4KT0J 3AE1C 1OZHA 2KS1B 5B5EE 1LTIC 1KFMA 4R4MA 3FX0A 4IFFA 1SQXE 1J1EB 2W90A 3B5NA 1GL2D 4IL6H 2JP3A 2G8YA 1OVUA 1J1DC 2OQQA 1E79H 1Y9BA 1L0LG 2KOGA 5AVVB 1BE3G 4HJGH 1H8AA 3IN6A 3CXHE 3AE5C 1HGZA 5AVWB 2N9YB 3B5ND 1KQGB 1T3UA 3I56P 4C46A 2E5TA 5CJ4A 2FYUD 1J1DB 3MUDA 1WT6A 4B86A 2XKMA 2QA4P 3H1LG 2A06D 1K05A 3L74E 5KLVG 3CCVP 1JTHA 1LTJA 3A2AA 1NVOA 1USEA 1X0TA 2D2CC 1VQ9P 1LTTC 1NH4A 3N4XA 2P1JA 1S2EA 4JYBA 1ZV8A 3TF5A 2FXOA 3A0BE 2YMKA 1FZGA 1RE3A 1LTBC 1NTZE 4RJTA 1VDFA 4R4LA 2D2CB 1N8RQ 4JF7A 2KS1A 1DIPA 1FDOA 1S72P 1J2JB 2WSEJ 4H0LC 1EDJA 3B71A 3U1AA 1D7MA 4LC1A 5AVZB 2KI7B 5M1BA 1JY3N 3RL0C 1W5CE 2PAJA 1SQPG 4OH8B 1P84E 2WPSA 2QJYB 1L0NG 5APXA 2E74D 3CXHI 1PP9J 1SQXK 4N3YB 1PGQA 4L74A 3ITKA 1FZCC 2KUBA 4PV1C 1MZ9A 3PTZA 3P32A 3RL0B 2P2UA 4JQ0D 5EFWB 2ZXEB 4PD4H 4GODA 1DEEG 1FDMA 4C7NA 3C1LA 1BGYE 1SQBJ 4YXDC 1LT1A 3HD7D 1OVVA 3H1ID 3RK3B 1Y8AA 1JM0A 3V4WA 1M7LA 4WB4A 2XNXA 2Z5IA 1FZCB 3L75G 4H13C 3VMAA 1NJIQ 5GTIH 4WY4C 4PV1B 2IYPA 2OGUA 5CBNA 1EXIA 2ZVOB 1JO5A 1VQ5P 2I1JA 3B4SA 2IFMA 1GK4A 3FWNA 5DJTB 3A3YB 5B5EH 1NTKJ 1NTKG 1SQXD 1YHQP 3MIWA 1BE3E 5CCHC 5E79E 1SQVK 4WY4B 1IFDA 3V2NA 5KKZB 2D2CD 3H1KD 1PV3A 1LT9B 5AW4B 2FXMA 1FOSE 1FAVA 3SSUA 4Y99C 4U3FG 3LW5H 1NTMG 5CJ0A 2B87B 2WTYA 1U7JA 3RK2C 1P84I 2YXQB 5AW0B 2JO1A 1VQKP 3KYQA 2JKVA 4YXWH 2W6AA 5AW8B 5AW3B 2AEJA 3W67A 3L74D 2IZ1A 4H0LD 1Q7YQ 1TU3F 1YQ4C 1GMJA 2SPZA 3RK2B 3D6ZA 1JCDA 4UB6E 1IK9A 1KFNA 3TDKA 1FZCA 2M5AA 1NU1J 2W6BA 3A0BH 3PJSK 3OA7A 2GA1A 4W80A 3CI9A 3USSA 5AW1B 2OYHB 2FYZA 1LJ2A 3VP8A 3C8VA 1IO4A 1VQ6P 1MKMA 3WU2H 1ZLLA 2IYOA 5KLIC 1QLED 4PV1D 3L71J 5C39A 2M0BA 4WY4A 2OYIB 3VOPA 1PP9E 1G1IA 1YTZI 1BCCG 4KJMA 2IDBA 1LP1B 4JPZB 2B87A 1P84D 1YIJP 2IFNA 5KLIB 4H13D 5CCHA 2V4HA 4A7PA 2IBZG 3HUSB 2ZYGA 1SQBE 3L37A 2W8ZA 2FKWB 3BASA 4AUWA 3NMDA 4W7ZA 3H1HG 2RH0A 2WT7B 3A0HE 3TGUG 1N2DC 1N7SC 3B8EB 3SWFA 4Y28J 2P58A 4ZMDA 2YMYA 2LXCB 1Q2NA 5KAFE 1DEBA 3IFMA 1XTCC 4C7RA 1NTZJ 1JB0J 1YJWP 1NTKE 2QJKC 3AEDC 1SQVG 1SP4A 1WRGA 1EZVG 1URQC 3F5HA 4K35A 3GHGC 1SS1A 4D6TG 1N7LA 2ZYAA 2I1KA 5TISE 1S5LH 3VMXA 1N7SB 2Y9YA 2KLVA 2ZVNB 3S9OA 4XFJA 4I6MC 2E43A 1NTME 4RKUJ 2JWAA 2P7JA 3EFFK 1GZLA 2HG5D 2FYNC 2QJKB 5AVTB 2LXBA 1URQB 3FWLA 1LP1A 2MKVA 1HH0A 2WSSH 1H88A 5CBOA 4BRYB 2XV5A 4LLHA 3HUSA 3M06A 2H7HA 4DT0A 1VQ4P 2WZ7A 4GKGA 3NTNA 2QM7A 1IFIA 3L72J 1KQLA 1J1EC 2KP8A 1CI6A 1U57A 1USDA 3A5TA 1M8OB 3N7NA 1PGOA 3ZDMA 3V2QA 1M1JC 2M3EA 2WSCJ 3Q5RA 1FS0E 2YKOA 5L8RJ 3E1RA 4H44C 1HTLC 1BSNA 2QIWA 1ZOYC 1FZBA 1X8YA 1N86A 4UB6H 3M0DC 1YI2P 1S4XA 3RBXA 4BXLA 2WMMA 1EDLA 1H0TB 3WUVA 4HH2A 1RQVA 3G4SP 2Q3EA 1RHZB 2PRRA 2WSEH 3L71E 4RESB 4EDFA 1HJBA 1M1JB 1RE4C 3BCCG 1N7SA 1ZN5A 1L0LJ 3TK1A 3CC7P 4H44B 2K9JB 1BE3J 2W6JH 2Y0EA 1HGVA 1BCCE 2A45H 1PGJA 3I55P 1QL1A 4L75A 1QVFO 4NPFX 5DJUB 1URQA 2IBZE 3GHGA 1PP9D 1YYCA 1MFZA 3SFEC 3JSVC 1OFCX 3H1LJ 5KLVJ 1PFIA 1SQQG 2K3RA 2ZT9C 3CWBG 2ZXXA 1IC2A 3KZIE 1JEKA 1FE6A 1ZRTE 3MGNA 1SQBD 2UWJE 4DCKA 3II6A 4YPCA 1NAYA 2DW3A 2BCCG 2ZFCA 1HWTC 3H6PA 1MV8A 1EDIA 3A0HH 3BATA 2ZT9B 1VQOP 3RK3E 3CCJP 2O01J 3PP5A 2QJYC 1HUCA 2OYOA 1IFMA 3L70J 4IL6X 1W2EA 3L70G 5KAFH 3CCEP 4CPGA 2M3BA 2R5BA 1M1JA 4N78E 3D70A 1NU1K 1FJKA 3M9HA 1SFCC 1KYOE 1MUUA 2K9JA 1BDDA 1SQPJ 1FZEA 4BWNA 3GLMA 5TISH 1PZQA 2WWWA 3JCUE 3M0DA 3G6EP 3HTKB 1EC5A 1L0NJ 4JBZA 4EOTA 3TYYA 3RK3C 3PLNA 3VMYA 2HPCB 1Q90D 1RE4A 1LNQA 1RF1C 1NKZB 4H44D 5H2FH 3HRNA 1GW3A 2IZ0A 3L72E 1SFCB 2IBZI 4L73A 1AA0A 3EFGA 4DOJA 3CX5I 2KNCB 1LTGC 2K1AA 2RMZA 1KMIZ 2FYUG 2NRGA 1HJ0A 2P10A 2A06G 2C0XA 1QVGO 3AE7C 3L73J 3L73G 2YO2A 3L75J 1WMKA 1RF1B 2Q3IA 5AVQB 1A02J 1FBMA 1X79B 3V4QA 1NU1D 5KKZC 1LT9C 2C9NY 2KZJA 3VYIA 4OGQC 1KB9E 3HE5B 1JY2P 2L91A 1L0LE 1EZVI 2K9YA 1VF5C 3TNUB 5APUA 1KQSO 3L71D 3FXEA 3CC4P 3L4FA 1NTZK 4OGQB 3HTKA 2HR3A 2LR2A 2QE7H 3R2PA 1KYOI 3D6YA 4U3FJ 1NTMJ 3O8ZA 5KAIE 1OX3A 3CXHD 3CXHH 3H1LE 1YQ3C 5KLVE 1RH5B 4IOIH 2HPCA 1VF5B 3KPEA 3CWBE 1OW8A 1M90Q 3T97B 2VRSA 1KILB 1CZQA 1SFCA 3V2RA 3KHUA 2E76C 1JMMA 2N1TB 1PGPA 2KNCA 1DD4A 2OYHC 2MJZA 5APTA 5BVZA 2Q9IA 3KZIH 1YBKA 4PJ0E 2PGDA 4IFMA 1ZRTD 1RF1A 4UB8E 1SFCD 3RL0D 2OYIC 3AEFC 3H1IG 2FBWC 3L70E 2E76B 1SLQA 1R5LA 2O1KA 1NTZD 1KV4A 1UIIA 3RK3D 2Y0CA 2H89C 1KB9I 4U7JA 3V5BA 3RGUA 3CD6P 1SQPE 2N9BA 4HYTB 1JY2O 3TNUA 2K37A 2NPSC 3HUSC 4GIFA 1L0NE 4GT1A 2OTJP 1LT9A 4HB1A 3U1CA 1SQXG 4WWIA 1VQPP 1KD1Q 1BCCJ 3H1KJ 1PIXA 3A7OA 3H1KG 3LIEA 1P84H 2YIUC 4EI2A 5AW9B 3PHLA 3CMAP 2K88A 4WY4D 2OTKE 3LW5J 2NPSB 2XU6A 5TJHA 3T97A 3Q5PA 2JR8A 2A06E 1ZP0C 1ZR4A 1GL2C 2YXRB 4OGQD 2IPPA 3L73E 4I7ZC 2QSIA 3L72D 4NPEA 5APVA 3H1HJ 2R44A 1NHLA 3L75E 1IJDB 2V7QH 3CCMP 3TGUJ 3QH9A 5CCHD 1BGYD 2YIUB 3U59A 3BRVB 3CPWO 1FC2C 3L74G 4AQRD 2WSCH 2FFDC 2ZYDA 5KJ7A 1PPJG 3H32B 2BASA 3WUUA 3IAOA 3AE3C 3EQ2A 5AW2B 2W83C 1GL2B 2C9LY 2FXPA 2G3AA 4I7ZB 2YKPA 2AEMA 1T6AA 2OYHA 1SQVJ 3RK2D 4D6TJ 1S9KE 1QL2A 3GW6A 2FFDB 1L0LD 3B5NB 4GOEA 1BE3D 1L2PA 2E76D 3Q1MA 2OYIA 1AV1A 4U3FE 2Y9ZA 5E79H 4ZKUA 4GOFA 2YNYA 2WSFJ 2XNDH 4W7YA 3O6QB 3KQGA 1UIXA 3I5CA 2WPRA 2KXPB 5GTHE 4TLFA 3H1JJ 1AVOA 3H1JG 3H1LD 3P8CE 1VQNP 2R32A 2NPSA 5KLVD 2P67A 1QX8A 1M57D 3AECC 1FJPA 1GTWA 1N73C 2GUSA 3MHVA 2YKQA 2HYNA 2KB7P 4PD4E 4NPDA 2H8PD 1AJYA 1LTJB 2WT7A 4MN4C 3C9IA 1JOCA 2Q6QA 1VQLP 2NZ2A 1OVRA 1IFPA 3H32A 3JC22 1VQMP 4PJ0H 3MP7B 3E7KA 2E74C 1EQ7A 4I1LA 1GL2A 5APWA 3Q5SA 3R4YA 2RKLA 3S1KA 1N73B 4Z1MH 2O01H 1MFTA 1SQBK 1Z56A 1CSBA 3L70D 4ASVA 4ZKPA 2OTLP 1S5LX 1OMIA 3BCCJ 4OWFA 3D71A 3Q3DA 3M0AA 1NWQA 1OXZA 1RF0C 3FGAD 2FFDA 2KLUA 2J58A 3HD7C 1W2BO 1SQPD 2E74B 2R3SA 2J5UA 2C0WA 3H1KE 1VL2A 1L0ND 1KC8Q 1S3JA 3CCQP 1LTAC 4ASWA 2QJPC 1X22A 1NTKK 3O6QA 2KSJA 1N7SD 2E42A 3CX5E 1G1JA 3KXDA 1Q82Q 4BRYA 1JY3P 1SQQJ 1IFNA 1LGHB 2O3JA 3HD7B 3NXSA 3CWBJ 3H1HE 2O01N 3TGUE 2KZIA 2AXTE 2GUVA 3AE9C 1NTMK 2JJLA 1URQD 2AEFA 2QJPB 4TT3H 1PPJE 3L73D 1FOSF 2BCCJ 1AVYA 1RQUA 3TSIA 4PD4I 3HE4B 3L75D 4C7NB 5BU5A 1YJ9P 1M1KQ 5CHXA 4XA4A 3ABVC 2PP6A 3H25A 1X9VA 1SQVE 4RO0A 2ITAA 1EZVE 1JUNA 4N6JA 2QG4A 1H0TA 4D6TE 1U7MA 2Q7CA 1N73A 1EXJA 1GDTA 2BEQD 2KK7A 1JCCA 3AE4C 1NTKD 3CL3D 1HVVA 2HFED 1GD2E 3G3ZA 3WU2E 2ZJSE 2KSEA 1G2CB 1NO4A 3AE6C 1YJNP 1Q86Q 1EDKA 4DZOA 1S9KD 1LWUC 2QVAA 1FZAA 5K5GB 3SWYA 2YO3A 1HF9A 3WUTA 1K04A 1BDCA 2WPVB 4U3FD 2JWDA 1NTMD 3H1JE 1AQ5A 2A45G 3K5BA 3OW2O 2L5GB 5APQA 5CCGC 2WITA 3SWKA 5AVUB 4OVNF 1K8AQ 2J59M 1RF0A 2Q1KA 1LWUB 4H0LB 3AE8C 3LIDA 5GTHH 3HD7A 3IR9A 1PP9G 2FYUJ 1JY3O 3P8CD 1QGKB 1IK7A 1E5WA
chains in the Genus database with same CATH topology
3L71J 3L73J 1SQQJ 3H1KJ 2BCCJ 3L72J 4PD4I 3CWBJ 2IBZI 3H1HJ 3BCCJ 3L75J 1L0NJ 1NTZJ 1L0LJ 1NTKJ 3CX5I 3TGUJ 1EZVI 3CXHI 1KYOI 1SQXJ 1PP9J 2FYUJ 1BE3J 4U3FJ 1NTMJ 1NU1J 3H1JJ 1BGYJ 1SQBJ 1SQVJ 3H1LJ 1KB9I 3L74J 1BCCJ 1SQPJ 5KLVJ 1P84I 4D6TJ 3H1IJ 3L70J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L71 J;  3L73 J;  1SQQ J;  3H1K J;  2BCC J;  3L72 J;  4PD4 I;  3CWB J;  2IBZ I;  3H1H J;  3BCC J;  3L75 J;  1L0N J;  1NTZ J;  1L0L J;  1NTK J;  3CX5 I;  3TGU J;  1EZV I;  3CXH I;  1KYO I;  1SQX J;  1PP9 J;  2FYU J;  1BE3 J;  4U3F J;  1NTM J;  1NU1 J;  3H1J J;  1BGY J;  1SQB J;  1SQV J;  3H1L J;  1KB9 I;  3L74 J;  1BCC J;  1SQP J;  5KLV J;  1P84 I;  4D6T J;  3H1I J;  3L70 J; 
#chains in the Genus database with same CATH topology
 1VQ8 P;  1KIL E;  1LTS C;  4PD4 D;  5AVR B;  3HE4 A;  3PH0 A;  2HLO A;  1SQB G;  1BSH A;  1HBW A;  2Z5H A;  4GDO A;  3CCU P;  3VTP C;  2Y0D A;  1YTZ T;  2M5A B;  3BCC E;  1RY3 A;  4EIJ A;  2H43 A;  3CLQ A;  1KZU B;  1FDI A;  3CCR P;  2JEE A;  2B9B A;  1DD3 A;  1PL5 A;  2JDI H;  1M56 D;  1S5L E;  4HKZ H;  5CMZ A;  1G2C A;  1KIL C;  2ZT9 D;  1OW7 A;  1A02 F;  1AFO A;  1GU5 A;  1QEX A;  2N1T C;  1R8E A;  3MTU E;  4H13 B;  5APS A;  2B88 A;  1BCC D;  3SFD C;  1IFJ A;  1NOH A;  1T2K C;  3GG2 A;  2W27 A;  2Q5U A;  2HOD B;  1SQQ E;  1OWA A;  2E75 C;  2XZR A;  5AW6 B;  3V2P A;  4LGD E;  5KJ7 C;  3AEA C;  3M91 A;  2CK3 H;  5B66 E;  2IBZ D;  2R5D A;  2IX7 C;  1LWU A;  3BVH A;  3CX5 D;  1KN7 A;  3CX5 H;  2I8D A;  2E5Y A;  2BCC E;  4AYC A;  3H1H D;  1ZW0 A;  3TGU D;  1FU1 A;  1NKN A;  2AXT H;  2KIK A;  2E75 B;  5CCG A;  1K9M Q;  1L4A C;  4Y99 B;  1PPJ D;  3H1I J;  2BEZ F;  1GK6 A;  4WBA A;  1JY2 N;  2B89 A;  5AW7 B;  2GM4 A;  1DX7 A;  5KTB A;  5AW5 B;  5BU8 B;  3HE5 A;  1NU1 G;  1KOR A;  1SQV D;  2QEX P;  3P8M C;  1EZV D;  1XTG B;  1DH3 A;  4D6T D;  2KYV A;  5CCG D;  4DJG A;  3OAK A;  3P7K A;  2AXC A;  4IL6 E;  1L4A B;  1ZME C;  1Y47 A;  3RBZ A;  3QWO C;  1OW6 A;  3M9B A;  4N78 D;  1SQX J;  1R5S A;  3MZW B;  2ZAE B;  3BRT B;  3L35 A;  1YIT P;  1KYO D;  1FZF A;  1KYO H;  1K73 Q;  5APY A;  1AQT A;  2WSF H;  3L71 G;  3JCU H;  2HOD A;  2CPS A;  3NFQ A;  1L0L K;  3H1J D;  2FYU E;  3VN0 A;  1KIL A;  1KTM A;  2R3C A;  3GMA A;  2N1T A;  1JNM A;  4K3A A;  5AVY B;  1JMB A;  3M9Q A;  3MD0 A;  2XDJ A;  1NAF A;  2PFX A;  3AEE C;  1NYH A;  4EYY Q;  5AVX B;  1VF5 D;  2QM8 A;  2OAR A;  3L74 J;  3GF7 A;  1GU4 A;  1ZXG A;  5KLV K;  1CI6 B;  3B5N C;  1KIL D;  1SQQ K;  2POH A;  4O9B A;  3V6I A;  1VQ7 P;  2N1T D;  3L36 A;  1ZR2 A;  4QMA A;  3Q2Y A;  1OIP A;  3S4R A;  4L76 A;  3EWK A;  1CW5 A;  4ZNC A;  1T2K D;  3G9R A;  3VMZ A;  3AEG C;  1KB9 D;  1KB9 H;  2E75 D;  3AE2 C;  3BCC D;  1S1C X;  5KJ7 D;  1H89 A;  1NTZ G;  4YTP C;  1GW4 A;  1L4A A;  3VP9 A;  2WQY C;  3MUD C;  2CPB A;  3PRJ A;  1KQF B;  3WMM 0;  2LKM A;  3F89 A;  3OJA B;  4WVZ A;  1LTJ C;  3CCS P;  2A45 I;  4KHX A;  3GF3 A;  2H88 C;  5KAI H;  4XE5 B;  1L4A D;  3CC2 P;  3CME P;  1SQP K;  1SQQ D;  3W68 A;  5H2F E;  4M3L A;  5AVS B;  3CWB D;  3GHG B;  2WPQ A;  2QRX A;  1RE3 C;  1L0N K;  5B66 H;  3RL0 g;  3E1I A;  4I2L C;  1T3J A;  3CCL P;  3G71 P;  1JTH B;  1VPC A;  2Z4E A;  1Q81 Q;  3KDP B;  2O1J A;  3H1I E;  3FXD A;  2BCC D;  4IFD K;  1NGM B;  2NPS D;  3L72 G;  1IZN B;  2FYN B;  2V7Q J;  5GTI E;  4JYC A;  2WVR A;  3IF4 A;  2M8R A;  1NU1 E;  2FY8 A;  2FYU K;  1BGY J;  2RN0 A;  1SVF A;  1BGY G;  3UIA A;  1T8Z A;  4UB8 H;  3AEB C;  4KT0 J;  3AE1 C;  1OZH A;  2KS1 B;  5B5E E;  1LTI C;  1KFM A;  4R4M A;  3FX0 A;  4IFF A;  1SQX E;  1J1E B;  2W90 A;  3B5N A;  1GL2 D;  4IL6 H;  2JP3 A;  2G8Y A;  1OVU A;  1J1D C;  2OQQ A;  1E79 H;  1Y9B A;  1L0L G;  2KOG A;  5AVV B;  1BE3 G;  4HJG H;  1H8A A;  3IN6 A;  3CXH E;  3AE5 C;  1HGZ A;  5AVW B;  2N9Y B;  3B5N D;  1KQG B;  1T3U A;  3I56 P;  4C46 A;  2E5T A;  5CJ4 A;  2FYU D;  1J1D B;  3MUD A;  1WT6 A;  4B86 A;  2XKM A;  2QA4 P;  3H1L G;  2A06 D;  1K05 A;  3L74 E;  5KLV G;  3CCV P;  1JTH A;  1LTJ A;  3A2A A;  1NVO A;  1USE A;  1X0T A;  2D2C C;  1VQ9 P;  1LTT C;  1NH4 A;  3N4X A;  2P1J A;  1S2E A;  4JYB A;  1ZV8 A;  3TF5 A;  2FXO A;  3A0B E;  2YMK A;  1FZG A;  1RE3 A;  1LTB C;  1NTZ E;  4RJT A;  1VDF A;  4R4L A;  2D2C B;  1N8R Q;  4JF7 A;  2KS1 A;  1DIP A;  1FDO A;  1S72 P;  1J2J B;  2WSE J;  4H0L C;  1EDJ A;  3B71 A;  3U1A A;  1D7M A;  4LC1 A;  5AVZ B;  2KI7 B;  5M1B A;  1JY3 N;  3RL0 C;  1W5C E;  2PAJ A;  1SQP G;  4OH8 B;  1P84 E;  2WPS A;  2QJY B;  1L0N G;  5APX A;  2E74 D;  3CXH I;  1PP9 J;  1SQX K;  4N3Y B;  1PGQ A;  4L74 A;  3ITK A;  1FZC C;  2KUB A;  4PV1 C;  1MZ9 A;  3PTZ A;  3P32 A;  3RL0 B;  2P2U A;  4JQ0 D;  5EFW B;  2ZXE B;  4PD4 H;  4GOD A;  1DEE G;  1FDM A;  4C7N A;  3C1L A;  1BGY E;  1SQB J;  4YXD C;  1LT1 A;  3HD7 D;  1OVV A;  3H1I D;  3RK3 B;  1Y8A A;  1JM0 A;  3V4W A;  1M7L A;  4WB4 A;  2XNX A;  2Z5I A;  1FZC B;  3L75 G;  4H13 C;  3VMA A;  1NJI Q;  5GTI H;  4WY4 C;  4PV1 B;  2IYP A;  2OGU A;  5CBN A;  1EXI A;  2ZVO B;  1JO5 A;  1VQ5 P;  2I1J A;  3B4S A;  2IFM A;  1GK4 A;  3FWN A;  5DJT B;  3A3Y B;  5B5E H;  1NTK J;  1NTK G;  1SQX D;  1YHQ P;  3MIW A;  1BE3 E;  5CCH C;  5E79 E;  1SQV K;  4WY4 B;  1IFD A;  3V2N A;  5KKZ B;  2D2C D;  3H1K D;  1PV3 A;  1LT9 B;  5AW4 B;  2FXM A;  1FOS E;  1FAV A;  3SSU A;  4Y99 C;  4U3F G;  3LW5 H;  1NTM G;  5CJ0 A;  2B87 B;  2WTY A;  1U7J A;  3RK2 C;  1P84 I;  2YXQ B;  5AW0 B;  2JO1 A;  1VQK P;  3KYQ A;  2JKV A;  4YXW H;  2W6A A;  5AW8 B;  5AW3 B;  2AEJ A;  3W67 A;  3L74 D;  2IZ1 A;  4H0L D;  1Q7Y Q;  1TU3 F;  1YQ4 C;  1GMJ A;  2SPZ A;  3RK2 B;  3D6Z A;  1JCD A;  4UB6 E;  1IK9 A;  1KFN A;  3TDK A;  1FZC A;  2M5A A;  1NU1 J;  2W6B A;  3A0B H;  3PJS K;  3OA7 A;  2GA1 A;  4W80 A;  3CI9 A;  3USS A;  5AW1 B;  2OYH B;  2FYZ A;  1LJ2 A;  3VP8 A;  3C8V A;  1IO4 A;  1VQ6 P;  1MKM A;  3WU2 H;  1ZLL A;  2IYO A;  5KLI C;  1QLE D;  4PV1 D;  3L71 J;  5C39 A;  2M0B A;  4WY4 A;  2OYI B;  3VOP A;  1PP9 E;  1G1I A;  1YTZ I;  1BCC G;  4KJM A;  2IDB A;  1LP1 B;  4JPZ B;  2B87 A;  1P84 D;  1YIJ P;  2IFN A;  5KLI B;  4H13 D;  5CCH A;  2V4H A;  4A7P A;  2IBZ G;  3HUS B;  2ZYG A;  1SQB E;  3L37 A;  2W8Z A;  2FKW B;  3BAS A;  4AUW A;  3NMD A;  4W7Z A;  3H1H G;  2RH0 A;  2WT7 B;  3A0H E;  3TGU G;  1N2D C;  1N7S C;  3B8E B;  3SWF A;  4Y28 J;  2P58 A;  4ZMD A;  2YMY A;  2LXC B;  1Q2N A;  5KAF E;  1DEB A;  3IFM A;  1XTC C;  4C7R A;  1NTZ J;  1JB0 J;  1YJW P;  1NTK E;  2QJK C;  3AED C;  1SQV G;  1SP4 A;  1WRG A;  1EZV G;  1URQ C;  3F5H A;  4K35 A;  3GHG C;  1SS1 A;  4D6T G;  1N7L A;  2ZYA A;  2I1K A;  5TIS E;  1S5L H;  3VMX A;  1N7S B;  2Y9Y A;  2KLV A;  2ZVN B;  3S9O A;  4XFJ A;  4I6M C;  2E43 A;  1NTM E;  4RKU J;  2JWA A;  2P7J A;  3EFF K;  1GZL A;  2HG5 D;  2FYN C;  2QJK B;  5AVT B;  2LXB A;  1URQ B;  3FWL A;  1LP1 A;  2MKV A;  1HH0 A;  2WSS H;  1H88 A;  5CBO A;  4BRY B;  2XV5 A;  4LLH A;  3HUS A;  3M06 A;  2H7H A;  4DT0 A;  1VQ4 P;  2WZ7 A;  4GKG A;  3NTN A;  2QM7 A;  1IFI A;  3L72 J;  1KQL A;  1J1E C;  2KP8 A;  1CI6 A;  1U57 A;  1USD A;  3A5T A;  1M8O B;  3N7N A;  1PGO A;  3ZDM A;  3V2Q A;  1M1J C;  2M3E A;  2WSC J;  3Q5R A;  1FS0 E;  2YKO A;  5L8R J;  3E1R A;  4H44 C;  1HTL C;  1BSN A;  2QIW A;  1ZOY C;  1FZB A;  1X8Y A;  1N86 A;  4UB6 H;  3M0D C;  1YI2 P;  1S4X A;  3RBX A;  4BXL A;  2WMM A;  1EDL A;  1H0T B;  3WUV A;  4HH2 A;  1RQV A;  3G4S P;  2Q3E A;  1RHZ B;  2PRR A;  2WSE H;  3L71 E;  4RES B;  4EDF A;  1HJB A;  1M1J B;  1RE4 C;  3BCC G;  1N7S A;  1ZN5 A;  1L0L J;  3TK1 A;  3CC7 P;  4H44 B;  2K9J B;  1BE3 J;  2W6J H;  2Y0E A;  1HGV A;  1BCC E;  2A45 H;  1PGJ A;  3I55 P;  1QL1 A;  4L75 A;  1QVF O;  4NPF X;  5DJU B;  1URQ A;  2IBZ E;  3GHG A;  1PP9 D;  1YYC A;  1MFZ A;  3SFE C;  3JSV C;  1OFC X;  3H1L J;  5KLV J;  1PFI A;  1SQQ G;  2K3R A;  2ZT9 C;  3CWB G;  2ZXX A;  1IC2 A;  3KZI E;  1JEK A;  1FE6 A;  1ZRT E;  3MGN A;  1SQB D;  2UWJ E;  4DCK A;  3II6 A;  4YPC A;  1NAY A;  2DW3 A;  2BCC G;  2ZFC A;  1HWT C;  3H6P A;  1MV8 A;  1EDI A;  3A0H H;  3BAT A;  2ZT9 B;  1VQO P;  3RK3 E;  3CCJ P;  2O01 J;  3PP5 A;  2QJY C;  1HUC A;  2OYO A;  1IFM A;  3L70 J;  4IL6 X;  1W2E A;  3L70 G;  5KAF H;  3CCE P;  4CPG A;  2M3B A;  2R5B A;  1M1J A;  4N78 E;  3D70 A;  1NU1 K;  1FJK A;  3M9H A;  1SFC C;  1KYO E;  1MUU A;  2K9J A;  1BDD A;  1SQP J;  1FZE A;  4BWN A;  3GLM A;  5TIS H;  1PZQ A;  2WWW A;  3JCU E;  3M0D A;  3G6E P;  3HTK B;  1EC5 A;  1L0N J;  4JBZ A;  4EOT A;  3TYY A;  3RK3 C;  3PLN A;  3VMY A;  2HPC B;  1Q90 D;  1RE4 A;  1LNQ A;  1RF1 C;  1NKZ B;  4H44 D;  5H2F H;  3HRN A;  1GW3 A;  2IZ0 A;  3L72 E;  1SFC B;  2IBZ I;  4L73 A;  1AA0 A;  3EFG A;  4DOJ A;  3CX5 I;  2KNC B;  1LTG C;  2K1A A;  2RMZ A;  1KMI Z;  2FYU G;  2NRG A;  1HJ0 A;  2P10 A;  2A06 G;  2C0X A;  1QVG O;  3AE7 C;  3L73 J;  3L73 G;  2YO2 A;  3L75 J;  1WMK A;  1RF1 B;  2Q3I A;  5AVQ B;  1A02 J;  1FBM A;  1X79 B;  3V4Q A;  1NU1 D;  5KKZ C;  1LT9 C;  2C9N Y;  2KZJ A;  3VYI A;  4OGQ C;  1KB9 E;  3HE5 B;  1JY2 P;  2L91 A;  1L0L E;  1EZV I;  2K9Y A;  1VF5 C;  3TNU B;  5APU A;  1KQS O;  3L71 D;  3FXE A;  3CC4 P;  3L4F A;  1NTZ K;  4OGQ B;  3HTK A;  2HR3 A;  2LR2 A;  2QE7 H;  3R2P A;  1KYO I;  3D6Y A;  4U3F J;  1NTM J;  3O8Z A;  5KAI E;  1OX3 A;  3CXH D;  3CXH H;  3H1L E;  1YQ3 C;  5KLV E;  1RH5 B;  4IOI H;  2HPC A;  1VF5 B;  3KPE A;  3CWB E;  1OW8 A;  1M90 Q;  3T97 B;  2VRS A;  1KIL B;  1CZQ A;  1SFC A;  3V2R A;  3KHU A;  2E76 C;  1JMM A;  2N1T B;  1PGP A;  2KNC A;  1DD4 A;  2OYH C;  2MJZ A;  5APT A;  5BVZ A;  2Q9I A;  3KZI H;  1YBK A;  4PJ0 E;  2PGD A;  4IFM A;  1ZRT D;  1RF1 A;  4UB8 E;  1SFC D;  3RL0 D;  2OYI C;  3AEF C;  3H1I G;  2FBW C;  3L70 E;  2E76 B;  1SLQ A;  1R5L A;  2O1K A;  1NTZ D;  1KV4 A;  1UII A;  3RK3 D;  2Y0C A;  2H89 C;  1KB9 I;  4U7J A;  3V5B A;  3RGU A;  3CD6 P;  1SQP E;  2N9B A;  4HYT B;  1JY2 O;  3TNU A;  2K37 A;  2NPS C;  3HUS C;  4GIF A;  1L0N E;  4GT1 A;  2OTJ P;  1LT9 A;  4HB1 A;  3U1C A;  1SQX G;  4WWI A;  1VQP P;  1KD1 Q;  1BCC J;  3H1K J;  1PIX A;  3A7O A;  3H1K G;  3LIE A;  1P84 H;  2YIU C;  4EI2 A;  5AW9 B;  3PHL A;  3CMA P;  2K88 A;  4WY4 D;  2OTK E;  3LW5 J;  2NPS B;  2XU6 A;  5TJH A;  3T97 A;  3Q5P A;  2JR8 A;  2A06 E;  1ZP0 C;  1ZR4 A;  1GL2 C;  2YXR B;  4OGQ D;  2IPP A;  3L73 E;  4I7Z C;  2QSI A;  3L72 D;  4NPE A;  5APV A;  3H1H J;  2R44 A;  1NHL A;  3L75 E;  1IJD B;  2V7Q H;  3CCM P;  3TGU J;  3QH9 A;  5CCH D;  1BGY D;  2YIU B;  3U59 A;  3BRV B;  3CPW O;  1FC2 C;  3L74 G;  4AQR D;  2WSC H;  2FFD C;  2ZYD A;  5KJ7 A;  1PPJ G;  3H32 B;  2BAS A;  3WUU A;  3IAO A;  3AE3 C;  3EQ2 A;  5AW2 B;  2W83 C;  1GL2 B;  2C9L Y;  2FXP A;  2G3A A;  4I7Z B;  2YKP A;  2AEM A;  1T6A A;  2OYH A;  1SQV J;  3RK2 D;  4D6T J;  1S9K E;  1QL2 A;  3GW6 A;  2FFD B;  1L0L D;  3B5N B;  4GOE A;  1BE3 D;  1L2P A;  2E76 D;  3Q1M A;  2OYI A;  1AV1 A;  4U3F E;  2Y9Z A;  5E79 H;  4ZKU A;  4GOF A;  2YNY A;  2WSF J;  2XND H;  4W7Y A;  3O6Q B;  3KQG A;  1UIX A;  3I5C A;  2WPR A;  2KXP B;  5GTH E;  4TLF A;  3H1J J;  1AVO A;  3H1J G;  3H1L D;  3P8C E;  1VQN P;  2R32 A;  2NPS A;  5KLV D;  2P67 A;  1QX8 A;  1M57 D;  3AEC C;  1FJP A;  1GTW A;  1N73 C;  2GUS A;  3MHV A;  2YKQ A;  2HYN A;  2KB7 P;  4PD4 E;  4NPD A;  2H8P D;  1AJY A;  1LTJ B;  2WT7 A;  4MN4 C;  3C9I A;  1JOC A;  2Q6Q A;  1VQL P;  2NZ2 A;  1OVR A;  1IFP A;  3H32 A;  3JC2 2;  1VQM P;  4PJ0 H;  3MP7 B;  3E7K A;  2E74 C;  1EQ7 A;  4I1L A;  1GL2 A;  5APW A;  3Q5S A;  3R4Y A;  2RKL A;  3S1K A;  1N73 B;  4Z1M H;  2O01 H;  1MFT A;  1SQB K;  1Z56 A;  1CSB A;  3L70 D;  4ASV A;  4ZKP A;  2OTL P;  1S5L X;  1OMI A;  3BCC J;  4OWF A;  3D71 A;  3Q3D A;  3M0A A;  1NWQ A;  1OXZ A;  1RF0 C;  3FGA D;  2FFD A;  2KLU A;  2J58 A;  3HD7 C;  1W2B O;  1SQP D;  2E74 B;  2R3S A;  2J5U A;  2C0W A;  3H1K E;  1VL2 A;  1L0N D;  1KC8 Q;  1S3J A;  3CCQ P;  1LTA C;  4ASW A;  2QJP C;  1X22 A;  1NTK K;  3O6Q A;  2KSJ A;  1N7S D;  2E42 A;  3CX5 E;  1G1J A;  3KXD A;  1Q82 Q;  4BRY A;  1JY3 P;  1SQQ J;  1IFN A;  1LGH B;  2O3J A;  3HD7 B;  3NXS A;  3CWB J;  3H1H E;  2O01 N;  3TGU E;  2KZI A;  2AXT E;  2GUV A;  3AE9 C;  1NTM K;  2JJL A;  1URQ D;  2AEF A;  2QJP B;  4TT3 H;  1PPJ E;  3L73 D;  1FOS F;  2BCC J;  1AVY A;  1RQU A;  3TSI A;  4PD4 I;  3HE4 B;  3L75 D;  4C7N B;  5BU5 A;  1YJ9 P;  1M1K Q;  5CHX A;  4XA4 A;  3ABV C;  2PP6 A;  3H25 A;  1X9V A;  1SQV E;  4RO0 A;  2ITA A;  1EZV E;  1JUN A;  4N6J A;  2QG4 A;  1H0T A;  4D6T E;  1U7M A;  2Q7C A;  1N73 A;  1EXJ A;  1GDT A;  2BEQ D;  2KK7 A;  1JCC A;  3AE4 C;  1NTK D;  3CL3 D;  1HVV A;  2HFE D;  1GD2 E;  3G3Z A;  3WU2 E;  2ZJS E;  2KSE A;  1G2C B;  1NO4 A;  3AE6 C;  1YJN P;  1Q86 Q;  1EDK A;  4DZO A;  1S9K D;  1LWU C;  2QVA A;  1FZA A;  5K5G B;  3SWY A;  2YO3 A;  1HF9 A;  3WUT A;  1K04 A;  1BDC A;  2WPV B;  4U3F D;  2JWD A;  1NTM D;  3H1J E;  1AQ5 A;  2A45 G;  3K5B A;  3OW2 O;  2L5G B;  5APQ A;  5CCG C;  2WIT A;  3SWK A;  5AVU B;  4OVN F;  1K8A Q;  2J59 M;  1RF0 A;  2Q1K A;  1LWU B;  4H0L B;  3AE8 C;  3LID A;  5GTH H;  3HD7 A;  3IR9 A;  1PP9 G;  2FYU J;  1JY3 O;  3P8C D;  1QGK B;  1IK7 A;  1E5W A; 
#chains in the Genus database with same CATH homology
 3L71 J;  3L73 J;  1SQQ J;  3H1K J;  2BCC J;  3L72 J;  4PD4 I;  3CWB J;  2IBZ I;  3H1H J;  3BCC J;  3L75 J;  1L0N J;  1NTZ J;  1L0L J;  1NTK J;  3CX5 I;  3TGU J;  1EZV I;  3CXH I;  1KYO I;  1SQX J;  1PP9 J;  2FYU J;  1BE3 J;  4U3F J;  1NTM J;  1NU1 J;  3H1J J;  1BGY J;  1SQB J;  1SQV J;  3H1L J;  1KB9 I;  3L74 J;  1BCC J;  1SQP J;  5KLV J;  1P84 I;  4D6T J;  3H1I J;  3L70 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...