2FYUJ

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
60
structure length
60
Chain Sequence
APTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 20
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 2fyuJ00
2IBZI 1BE3J 3TGUJ 3L74J 1NTMJ 1SQXJ 3H1IJ 3CX5I 3H1JJ 1P84I 1KB9I 1SQPJ 3CXHI 1SQBJ 4U3FJ 1EZVI 3L75J 1PP9J 1BGYJ 1NTKJ 3L73J 1SQVJ 3H1LJ 1SQQJ 1L0LJ 4PD4I 3L71J 3BCCJ 2BCCJ 3H1KJ 1L0NJ 4D6TJ 3CWBJ 1BCCJ 2FYUJ 1KYOI 3L70J 5KLVJ 1NTZJ 1NU1J 3H1HJ 3L72J
chains in the Genus database with same CATH superfamily
4YPCA 1SQVK 1JCCA 5B66H 3JSVC 5APYA 4B86A 2RMZA 3CMEP 1BGYJ 1N2DC 1X79B 3LIEA 1BGYE 3CC2P 1YBKA 2E43A 2HODB 2E76D 2E75D 1PP9G 5CBNA 1JY2P 2QIWA 1HUCA 2BASA 2XV5A 1J1DC 1SQBD 1JCDA 3M0AA 1EZVE 3F89A 2WSEH 1JY2N 1SQXJ 4H44D 2OARA 1G2CA 5KLVD 1LT9C 1DX7A 3Q5PA 1SQXE 4LGDE 1JUNA 2WVRA 1KILE 1KILB 2B87A 4N6JA 4TLFA 3G3ZA 4KT0J 4L74A 2IFNA 2LXBA 2K9JA 5AW8B 3H6PA 2O01J 1AA0A 1P84I 3HE5A 2N1TC 1CZQA 5CCGD 3BCCG 5CJ4A 2OYHB 2HFED 2ZT9B 2PGDA 3SFEC 2A45H 4N78E 2WPVB 1JMBA 2IZ1A 1RF0C 1YYCA 1QVFO 2NPSA 1JY3P 5CCGC 2Q7CA 3L71J 2KZJA 1N73C 1N7LA 3L4FA 2WSCH 2ZYDA 3L71E 5GTHE 3L37A 1MV8A 2M8RA 1BE3J 1KFNA 1SQBG 3AEGC 3D70A 2PFXA 3GHGB 2IBZG 2MJZA 4PD4I 2B88A 3KHUA 3KPEA 4D6TJ 1Q90D 1AFOA 1AJYA 1L0LD 4D6TE 5GTIE 1YQ4C 3CMAP 3OW2O 3L73G 1SQQG 3H32A 2GUSA 3CCUP 4IFMA 3HTKA 1JMMA 4YTPC 2KNCA 2JDIH 3AEBC 1FAVA 4WB4A 3WUTA 1H8AA 1E79H 4YXWH 1EZVD 4GIFA 1IJDB 3RBXA 1FS0E 3B4SA 4Y28J 2Q6QA 1K04A 1SQXD 1M1JC 1KILD 3MGNA 3Q3DA 2QJYB 3H1KJ 3SSUA 4ZMDA 1LT9A 3A0BE 3NFQA 2LXCB 3H1LD 1SQPK 1BSNA 3H1KE 3M9BA 3HUSA 2ZFCA 1N7SB 1DH3A 5AW3B 4JQ0D 4GOFA 3V4QA 3L72D 2O01N 1BDDA 4WBAA 4Z1MH 1FZAA 1NTZG 5AW2B 2N1TA 3H1HG 3Q5SA 1S2EA 1OMIA 3A7OA 1Z56A 1NGMB 3H1JJ 2KYVA 3KDPB 2E5TA 1GW3A 3H1JE 3V2RA 3LW5J 1RF0A 1T8ZA 4BRYB 2IYPA 3AE5C 4H0LB 1Q2NA 2ZT9C 4ASVA 3A3YB 5CCGA 3CL3D 2BCCD 5KTBA 2AEJA 3AE8C 3RK3C 1WMKA 2A06D 1N73A 1NVOA 5CCHC 2QJKC 1NU1E 5AVYB 1NKNA 2KP8A 5KKZC 4GDOA 3T97B 3JCUE 1GZLA 1GL2C 1VQOP 1KMIZ 2POHA 2XKMA 3Q2YA 1W2EA 1BDCA 3GHGC 1NKZB 1NTMD 5B5EE 3MP7B 1FE6A 4LC1A 2YKPA 1KB9E 1L0NE 1GK4A 3GF3A 2W6BA 3AE9C 1GDTA 3C1LA 1SQVG 1YJ9P 1Y47A 3IAOA 2KK7A 3KZIE 2HPCB 2HLOA 3CI9A 1M1JA 2KXPB 2ZVOB 1DD3A 2RH0A 3EQ2A 1N7SD 3VMAA 1QLED 2Z5IA 2IPPA 2OYOA 1PL5A 4EYYQ 2HG5D 3L35A 2QJYC 1LT1A 1VQLP 3H1IG 2OYIB 1KILA 4OGQC 1L4AB 2Y9YA 2ZXXA 5KLVK 3B5NC 2G3AA 3H1JD 2Q5UA 1PV3A 3CWBJ 1YJWP 1LTGC 4GKGA 4HKZH 4H0LD 1DEBA 5L8RJ 3RGUA 2E42A 3CWBE 2OTLP 2V4HA 3V5BA 4NPEA 3E1RA 1NU1D 5DJTB 3V2NA 2JJLA 5CCHA 4AUWA 3IN6A 4OWFA 1T2KD 1LWUB 2VRSA 1S1CX 2M3BA 1JEKA 3BCCJ 4PJ0E 5EFWB 1PPJG 3MUDC 1SQPD 3BCCE 1FOSF 3OA7A 3AE6C 1FDOA 3GHGA 2V7QJ 1KB9D 1ZOYC 1L0ND 3BASA 4DOJA 1Y9BA 3P8MC 3CCQP 1R5SA 2WMMA 4GOEA 4L73A 1YTZT 1LP1B 2R3SA 3A0BH 4TT3H 3JC22 1HH0A 1VQ6P 1D7MA 4EOTA 4M3LA 2WSFJ 2WZ7A 4EDFA 3CX5I 1ZRTD 3M06A 1OVRA 2D2CB 1GU5A 2HR3A 2DW3A 2ZYAA 3GG2A 2IBZE 2OQQA 2WT7B 3R4YA 4DJGA 1Q7YQ 3AE3C 4U3FG 3TNUA 1L4AD 1SFCB 4RO0A 3AE2C 3L73J 1GMJA 1SQQJ 3H25A 5CHXA 2UWJE 1YI2P 2PRRA 4JYCA 1KYOD 3L73E 1SQQE 1SQXK 3FX0A 2IX7C 3VTPC 1GTWA 2NPSC 1SQPG 3CWBD 1AV1A 3CXHI 2OYIC 4W7ZA 1NTKJ 3M9HA 2RKLA 3JCUH 1RY3A 1NO4A 5AW7B 1AVYA 5AVTB 5BVZA 1NTKE 1RQUA 1SP4A 2QM7A 2SPZA 2QRXA 1NOHA 5AVZB 1W5CE 1VDFA 2AXCA 4BRYA 2NRGA 3RBZA 4CPGA 2Q3EA 2QG4A 5B5EH 1NTZJ 3QWOC 4DCKA 2ZJSE 3H1HJ 1KB9H 3FWLA 4HJGH 3T97A 1NTZE 3MUDA 5E79E 3BRVB 3P7KA 1VQ4P 1IFIA 1LWUC 2JP3A 5AVUB 1LGHB 1BCCG 2E74B 3KZIH 5AW5B 3CPWO 3L70J 3N7NA 3L70E 2A45G 2FYUD 1DIPA 2E76C 2E75C 1NAFA 2D2CD 1EXIA 1CSBA 3TGUD 3HUSC 3V2QA 5AVRB 4UB6H 1EDKA 1NTMK 4RJTA 1SS1A 5AVWB 3CCJP 1S9KE 4AYCA 4H44C 4DZOA 2HPCA 4Y99C 3C8VA 1SFCD 1KYOH 2D2CC 3VP9A 2L91A 4RESB 1S5LE 3I55P 2JWAA 3SWYA 1HF9A 3KYQA 1SQVJ 1VL2A 2I8DA 3I5CA 3L74D 4NPFX 2AEMA 1PFIA 2W83C 1FZEA 2OYIA 1NTKD 1KQLA 1PIXA 3AEFC 1RH5B 1JB0J 3TYYA 3SWFA 3IR9A 4KHXA 1BE3E 2JO1A 1JY3N 2ITAA 4PJ0H 2QA4P 5KLVG 2H43A 2XU6A 3SFDC 1KYOI 4ZKPA 1ZR4A 1BGYD 3NTNA 2A45I 2R32A 3I56P 1X8YA 1UIIA 1OX3A 1H89A 3H1IJ 4XA4A 3MHVA 1USDA 2V7QH 3L75J 4C46A 2AXTE 1IC2A 3WUUA 4GODA 3L75E 2M5AA 1NU1K 2E74D 2FXPA 4NPDA 3CX5E 1K8AQ 3TDKA 1LWUA 2Y0DA 1QEXA 1A02J 3L70D 1KZUB 5KAIH 3HRNA 2WWWA 1USEA 3BRTB 1KQGB 1YQ3C 3P8CE 4EIJA 3E1IA 2Q9IA 5CJ0A 2JEEA 2YO3A 1K73Q 1DD4A 1L0NK 2Y0CA 1M90Q 1YIJP 3A2AA 3S1KA 1KILC 4PV1B 4KJMA 2PP6A 4N78D 2ZVNB 1LTJB 1PPJE 2JKVA 2J59M 3PLNA 1URQB 1L0LG 2YXQB 4ZKUA 1LTTC 5AVXB 1J2JB 2WT7A 2OYHC 1IZNB 3TSIA 2CPBA 3L71D 1E5WA 3M0DC 2YKOA 3PTZA 1VQKP 3D71A 1M57D 4L76A 1FU1A 4YXDC 1BE3D 2W6JH 3VN0A 2WPQA 1EZVG 1IFMA 1VF5B 4HH2A 3FXEA 1SQXG 3S4RA 1FZCB 3VOPA 5E79H 4D6TD 3GMAA 3H1LG 3CC7P 4U3FJ 1OIPA 4MN4C 1QVGO 5AVVB 3AEDC 2FKWB 2XDJA 3L75D 3L72G 4BWNA 2GM4A 1EDIA 1U57A 1UIXA 4XFJA 3TF5A 1J1EB 1N86A 2HODA 1ZP0C 2L5GB 3D6YA 4OH8B 3P8CD 2B87B 1P84E 1JY2O 2KZIA 5AW6B 2RN0A 5M1BA 3H1KD 2W8ZA 1GD2E 2AEFA 2KSJA 3E7KA 3LIDA 2KI7B 2IDBA 1Q81Q 2BCCG 2O01H 2A06G 3CC4P 3CCMP 3C9IA 1KQFB 4IL6E 2M3EA 4PV1D 1HBWA 3PRJA 1OW6A 1S5LH 1IFDA 1H0TB 1QGKB 2OTJP 1URQD 1PGQA 1EZVI 1N7SC 1PP9J 1RF1B 1TU3F 2FYUK 4D6TG 2GUVA 4I6MC 1PP9E 1BCCJ 1WT6A 2KOGA 1FJPA 3RL0B 5GTHH 1NTMG 4N3YB 1BCCE 1EDJA 2P1JA 4XE5B 2OYHA 4PD4E 1LTJC 2YO2A 1ZR2A 3O8ZA 1ZMEC 1S5LX 3M0DA 1GW4A 2KUBA 4I7ZB 1VF5D 4H0LC 5GTIH 3U59A 4C7NB 1JY3O 4U7JA 3OAKA 2ZAEB 5AVSB 2J5UA 2Z5HA 3H1KG 2AXTH 2H89C 2FYZA 1NAYA 3H32B 1K05A 2FFDB 1MKMA 3HTKB 2YKQA 2KB7P 1NTKK 2WPSA 2C0WA 1VQ9P 2YMYA 1T2KC 2YMKA 1J1DB 1XTGB 4HB1A 4IFFA 2LKMA 5AW9B 3H1JG 2XNDH 2QE7H 1P84D 1YTZI 3BATA 3O6QB 1SQBJ 4ASWA 1QL2A 2I1JA 1SQBE 1OWAA 1NHLA 1QL1A 1MUUA 1NU1G 1J1EC 1YHQP 5DJUB 2N1TB 1N8RQ 2N9YB 3CCLP 4WVZA 5APTA 3R2PA 2W90A 1S4XA 3G71P 5AW1B 5KJ7D 1JTHB 1PP9D 1N7SA 3LW5H 1S72P 3RL0D 2I1KA 5H2FE 1ZLLA 1G1IA 5CMZA 2J58A 3EFFK 1ZXGA 4JBZA 4PD4D 1N73B 1JNMA 1L4AC 2PAJA 1L0NG 1OXZA 1RF1C 1LTJA 2C9LY 2P67A 1URQA 3IF4A 4C7RA 1RE4C 1OW7A 1KC8Q 4R4MA 1X9VA 2HYNA 1EDLA 4O9BA 3V4WA 3WUVA 4H13B 1M8OB 5KLIB 3VMYA 5BU5A 1T3JA 1VQ5P 1CI6B 3FWNA 3BCCD 4I7ZC 1LTSC 2YIUB 3HD7B 2KLVA 3H1HE 1KFMA 5AW0B 1L0LJ 4LLHA 2Q1KA 3EWKA 1PGOA 1FZCA 1L0LE 1VQMP 4RKUJ 1G1JA 2K88A 1P84H 2FFDC 4I2LC 3MTUE 2C9NY 1M1JB 1T3UA 1NJIQ 1FZGA 2R3CA 3CWBG 5C39A 3FGAD 4IL6H 4OVNF 2IBZD 1LTBC 2K1AA 1HVVA 2N1TD 1KB9I 5TISE 1FZBA 3V6IA 2QEXP 2QVAA 3H1LJ 1BSHA 1S3JA 1EC5A 1A02F 2KS1B 3H1LE 3HE4B 3L73D 1IFNA 3ABVC 1SQQD 3L72J 1PGJA 3U1CA 1OVVA 2K3RA 1M56D 4IL6X 3L72E 4PD4H 3UIAA 2W27A 4JYBA 1SFCC 4DT0A 1SQVE 3RK3E 1EQ7A 3RK3B 2BEZF 1H0TA 1L4AA 4WWIA 2QJKB 4I1LA 1RF1A 5KKZB 3FXDA 3ITKA 5KJ7A 1HTLC 3GLMA 1RE4A 5KAFE 1GL2B 2BCCJ 2FYUG 1AVOA 1IFPA 3AEEC 4H13D 4EI2A 1PZQA 2K9YA 2BCCE 3B71A 3TGUG 4HYTB 2A06E 2YNYA 2FYNB 3VYIA 3SWKA 3HD7D 3PH0A 1SVFA 1NTZD 1NH4A 3H1HD 3H1IE 2ZXEB 3P32A 1H88A 2O1KA 4C7NA 4H13C 5KLIC 1K9MQ 2MKVA 1IK7A 1L2PA 4W80A 3RL0g 4K35A 3ZDMA 1NTMJ 1VQ8P 1Y8AA 2YIUC 3HD7C 1FBMA 1NTME 2WSFH 2P7JA 2FFDA 2NZ2A 3Q5RA 1NYHA 4L75A 2YXRB 1ZW0A 4WY4B 2E74C 4UB8E 3L74G 3USSA 2JR8A 3II6A 1LJ2A 2QM8A 1NTKG 3OJAB 3L36A 1LP1A 1S9KD 2WTYA 3W67A 3TNUB 1X0TA 1X22A 2IYOA 3D6ZA 2FXMA 4IOIH 1YJNP 1FDMA 4OGQB 3O6QA 3CXHE 5H2FH 3GF7A 2LR2A 3B8EB 2IFMA 3WU2E 1GU4A 1BGYG 3CCEP 3B5NB 3CLQA 3AECC 2WSSH 1FC2C 1VPCA 2ZT9D 1LTIC 3VP8A 4R4LA 3Q1MA 1U7MA 1SQVD 3RK3D 2CK3H 2IZ0A 1MZ9A 2IBZI 4AQRD 1SFCA 5CCHD 1HJ0A 2O3JA 1KV4A 1JTHA 2E5YA 3N4XA 3L70G 1DEEG 1GL2D 1KTMA 1OZHA 1EXJA 5K5GB 1NU1J 1HWTC 2P58A 1RHZB 4K3AA 4JPZB 1ZV8A 3TK1A 1JM0A 2K37A 3H1ID 3PHLA 4U3FE 3NXSA 1R5LA 3KXDA 3A0HE 3MZWB 1MFZA 3CX5D 2JWDA 1VQPP 5B66E 2R5BA 1SQPJ 1AQTA 2FYNC 2Y9ZA 1XTCC 5APXA 2GA1A 1HJBA 1SQPE 1CI6A 1G2CB 2B89A 1KD1Q 1L0NJ 3RK2B 3AE4C 3S9OA 3HD7A 4WY4D 3G9RA 1QX8A 2H88C 2ZYGA 2K9JB 3AEAC 5TISH 3L71G 5APWA 2Z4EA 3HE5B 1ZN5A 5APUA 1HGZA 2WSEJ 3VMZA 1BE3G 1ZRTE 4WY4C 4OGQD 1YITP 3CXHD 1AQ5A 1PPJD 4QMAA 1PGPA 3B5ND 3VMXA 5APQA 4UB6E 1CW5A 2QJPB 3CD6P 2NPSB 2QSIA 2BEQD 3EFGA 1SLQA 1JOCA 1SQBK 2B9BA 4PV1C 4BXLA 1IK9A 2W6AA 2XZRA 1HGVA 3L75G 1RE3C 2KS1A 3F5HA 3G4SP 1KYOE 1URQC 5KAFH 3HE4A 1T6AA 3AE1C 3NMDA 5AVQB 2H8PD 1VQ7P 1FDIA 1SQQK 1FJKA 3GW6A 2M0BA 2WQYC 4A7PA 1LTAC 2Q3IA 1M7LA 2WSCJ 1Q82Q 2FXOA 3PJSK 2N9BA 2H7HA 4U3FD 3MD0A 2M5AB 2Y0EA 3CX5H 3V2PA 1VF5C 2R5DA 1M1KQ 1GL2A 2KNCB 1FZCC 2C0XA 2KSEA 2O1JA 1MFTA 3G6EP 2KLUA 3KQGA 5BU8B 3WMM0 1JO5A 3W68A 1GK6A 2WPRA 2R44A 3RK2D 2P10A 4UB8H 2E76B 4GT1A 2E75B 3CCSP 1LT9B 3PP5A 5CBOA 3M9QA 3U1AA 1VQNP 2KIKA 3HUSB 1WRGA 1Q86Q 1KN7A 1NTZK 2FBWC 1NWQA 2FYUJ 5KLVJ 1FZFA 3RK2C 2FYUE 3CXHH 3TGUJ 4H44B 1R8EA 5KLVE 3CCRP 4Y99B 1L0LK 3QH9A 1OVUA 5KAIE 3WU2H 2CPSA 3TGUE 5APVA 4WY4A 3A5TA 4IFDK 2FY8A 3K5BA 5APSA 2NPSD 2OTKE 5TJHA 2OGUA 3CCVP 3BVHA 1LNQA 1BCCD 2XNXA 1OW8A 1KORA 1OFCX 1IFJA 2WITA 1RE3A 3MIWA 4JF7A 3AE7C 2G8YA 1W2BO 5KJ7C 3B5NA 2QJPC 4ZNCA 3L74J 3RL0C 4W7YA 1IO4A 3L74E 1KQSO 3IFMA 1RQVA 1FOSE 1U7JA 3M91A 2P2UA 3A0HH 5AW4B
chains in the Genus database with same CATH topology
2IBZI 1BE3J 3TGUJ 3L74J 1NTMJ 1SQXJ 3H1IJ 3CX5I 3H1JJ 1P84I 1KB9I 1SQPJ 3CXHI 1SQBJ 4U3FJ 1EZVI 3L75J 1PP9J 1BGYJ 1NTKJ 3L73J 1SQVJ 3H1LJ 1SQQJ 1L0LJ 4PD4I 3L71J 3BCCJ 2BCCJ 3H1KJ 1L0NJ 4D6TJ 3CWBJ 1BCCJ 2FYUJ 1KYOI 3L70J 5KLVJ 1NTZJ 1NU1J 3H1HJ 3L72J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBZ I;  1BE3 J;  3TGU J;  3L74 J;  1NTM J;  1SQX J;  3H1I J;  3CX5 I;  3H1J J;  1P84 I;  1KB9 I;  1SQP J;  3CXH I;  1SQB J;  4U3F J;  1EZV I;  3L75 J;  1PP9 J;  1BGY J;  1NTK J;  3L73 J;  1SQV J;  3H1L J;  1SQQ J;  1L0L J;  4PD4 I;  3L71 J;  3BCC J;  2BCC J;  3H1K J;  1L0N J;  4D6T J;  3CWB J;  1BCC J;  2FYU J;  1KYO I;  3L70 J;  5KLV J;  1NTZ J;  1NU1 J;  3H1H J;  3L72 J; 
#chains in the Genus database with same CATH topology
 4YPC A;  1SQV K;  1JCC A;  5B66 H;  3JSV C;  5APY A;  4B86 A;  2RMZ A;  3CME P;  1BGY J;  1N2D C;  1X79 B;  3LIE A;  1BGY E;  3CC2 P;  1YBK A;  2E43 A;  2HOD B;  2E76 D;  2E75 D;  1PP9 G;  5CBN A;  1JY2 P;  2QIW A;  1HUC A;  2BAS A;  2XV5 A;  1J1D C;  1SQB D;  1JCD A;  3M0A A;  1EZV E;  3F89 A;  2WSE H;  1JY2 N;  1SQX J;  4H44 D;  2OAR A;  1G2C A;  5KLV D;  1LT9 C;  1DX7 A;  3Q5P A;  1SQX E;  4LGD E;  1JUN A;  2WVR A;  1KIL E;  1KIL B;  2B87 A;  4N6J A;  4TLF A;  3G3Z A;  4KT0 J;  4L74 A;  2IFN A;  2LXB A;  2K9J A;  5AW8 B;  3H6P A;  2O01 J;  1AA0 A;  1P84 I;  3HE5 A;  2N1T C;  1CZQ A;  5CCG D;  3BCC G;  5CJ4 A;  2OYH B;  2HFE D;  2ZT9 B;  2PGD A;  3SFE C;  2A45 H;  4N78 E;  2WPV B;  1JMB A;  2IZ1 A;  1RF0 C;  1YYC A;  1QVF O;  2NPS A;  1JY3 P;  5CCG C;  2Q7C A;  3L71 J;  2KZJ A;  1N73 C;  1N7L A;  3L4F A;  2WSC H;  2ZYD A;  3L71 E;  5GTH E;  3L37 A;  1MV8 A;  2M8R A;  1BE3 J;  1KFN A;  1SQB G;  3AEG C;  3D70 A;  2PFX A;  3GHG B;  2IBZ G;  2MJZ A;  4PD4 I;  2B88 A;  3KHU A;  3KPE A;  4D6T J;  1Q90 D;  1AFO A;  1AJY A;  1L0L D;  4D6T E;  5GTI E;  1YQ4 C;  3CMA P;  3OW2 O;  3L73 G;  1SQQ G;  3H32 A;  2GUS A;  3CCU P;  4IFM A;  3HTK A;  1JMM A;  4YTP C;  2KNC A;  2JDI H;  3AEB C;  1FAV A;  4WB4 A;  3WUT A;  1H8A A;  1E79 H;  4YXW H;  1EZV D;  4GIF A;  1IJD B;  3RBX A;  1FS0 E;  3B4S A;  4Y28 J;  2Q6Q A;  1K04 A;  1SQX D;  1M1J C;  1KIL D;  3MGN A;  3Q3D A;  2QJY B;  3H1K J;  3SSU A;  4ZMD A;  1LT9 A;  3A0B E;  3NFQ A;  2LXC B;  3H1L D;  1SQP K;  1BSN A;  3H1K E;  3M9B A;  3HUS A;  2ZFC A;  1N7S B;  1DH3 A;  5AW3 B;  4JQ0 D;  4GOF A;  3V4Q A;  3L72 D;  2O01 N;  1BDD A;  4WBA A;  4Z1M H;  1FZA A;  1NTZ G;  5AW2 B;  2N1T A;  3H1H G;  3Q5S A;  1S2E A;  1OMI A;  3A7O A;  1Z56 A;  1NGM B;  3H1J J;  2KYV A;  3KDP B;  2E5T A;  1GW3 A;  3H1J E;  3V2R A;  3LW5 J;  1RF0 A;  1T8Z A;  4BRY B;  2IYP A;  3AE5 C;  4H0L B;  1Q2N A;  2ZT9 C;  4ASV A;  3A3Y B;  5CCG A;  3CL3 D;  2BCC D;  5KTB A;  2AEJ A;  3AE8 C;  3RK3 C;  1WMK A;  2A06 D;  1N73 A;  1NVO A;  5CCH C;  2QJK C;  1NU1 E;  5AVY B;  1NKN A;  2KP8 A;  5KKZ C;  4GDO A;  3T97 B;  3JCU E;  1GZL A;  1GL2 C;  1VQO P;  1KMI Z;  2POH A;  2XKM A;  3Q2Y A;  1W2E A;  1BDC A;  3GHG C;  1NKZ B;  1NTM D;  5B5E E;  3MP7 B;  1FE6 A;  4LC1 A;  2YKP A;  1KB9 E;  1L0N E;  1GK4 A;  3GF3 A;  2W6B A;  3AE9 C;  1GDT A;  3C1L A;  1SQV G;  1YJ9 P;  1Y47 A;  3IAO A;  2KK7 A;  3KZI E;  2HPC B;  2HLO A;  3CI9 A;  1M1J A;  2KXP B;  2ZVO B;  1DD3 A;  2RH0 A;  3EQ2 A;  1N7S D;  3VMA A;  1QLE D;  2Z5I A;  2IPP A;  2OYO A;  1PL5 A;  4EYY Q;  2HG5 D;  3L35 A;  2QJY C;  1LT1 A;  1VQL P;  3H1I G;  2OYI B;  1KIL A;  4OGQ C;  1L4A B;  2Y9Y A;  2ZXX A;  5KLV K;  3B5N C;  2G3A A;  3H1J D;  2Q5U A;  1PV3 A;  3CWB J;  1YJW P;  1LTG C;  4GKG A;  4HKZ H;  4H0L D;  1DEB A;  5L8R J;  3RGU A;  2E42 A;  3CWB E;  2OTL P;  2V4H A;  3V5B A;  4NPE A;  3E1R A;  1NU1 D;  5DJT B;  3V2N A;  2JJL A;  5CCH A;  4AUW A;  3IN6 A;  4OWF A;  1T2K D;  1LWU B;  2VRS A;  1S1C X;  2M3B A;  1JEK A;  3BCC J;  4PJ0 E;  5EFW B;  1PPJ G;  3MUD C;  1SQP D;  3BCC E;  1FOS F;  3OA7 A;  3AE6 C;  1FDO A;  3GHG A;  2V7Q J;  1KB9 D;  1ZOY C;  1L0N D;  3BAS A;  4DOJ A;  1Y9B A;  3P8M C;  3CCQ P;  1R5S A;  2WMM A;  4GOE A;  4L73 A;  1YTZ T;  1LP1 B;  2R3S A;  3A0B H;  4TT3 H;  3JC2 2;  1HH0 A;  1VQ6 P;  1D7M A;  4EOT A;  4M3L A;  2WSF J;  2WZ7 A;  4EDF A;  3CX5 I;  1ZRT D;  3M06 A;  1OVR A;  2D2C B;  1GU5 A;  2HR3 A;  2DW3 A;  2ZYA A;  3GG2 A;  2IBZ E;  2OQQ A;  2WT7 B;  3R4Y A;  4DJG A;  1Q7Y Q;  3AE3 C;  4U3F G;  3TNU A;  1L4A D;  1SFC B;  4RO0 A;  3AE2 C;  3L73 J;  1GMJ A;  1SQQ J;  3H25 A;  5CHX A;  2UWJ E;  1YI2 P;  2PRR A;  4JYC A;  1KYO D;  3L73 E;  1SQQ E;  1SQX K;  3FX0 A;  2IX7 C;  3VTP C;  1GTW A;  2NPS C;  1SQP G;  3CWB D;  1AV1 A;  3CXH I;  2OYI C;  4W7Z A;  1NTK J;  3M9H A;  2RKL A;  3JCU H;  1RY3 A;  1NO4 A;  5AW7 B;  1AVY A;  5AVT B;  5BVZ A;  1NTK E;  1RQU A;  1SP4 A;  2QM7 A;  2SPZ A;  2QRX A;  1NOH A;  5AVZ B;  1W5C E;  1VDF A;  2AXC A;  4BRY A;  2NRG A;  3RBZ A;  4CPG A;  2Q3E A;  2QG4 A;  5B5E H;  1NTZ J;  3QWO C;  4DCK A;  2ZJS E;  3H1H J;  1KB9 H;  3FWL A;  4HJG H;  3T97 A;  1NTZ E;  3MUD A;  5E79 E;  3BRV B;  3P7K A;  1VQ4 P;  1IFI A;  1LWU C;  2JP3 A;  5AVU B;  1LGH B;  1BCC G;  2E74 B;  3KZI H;  5AW5 B;  3CPW O;  3L70 J;  3N7N A;  3L70 E;  2A45 G;  2FYU D;  1DIP A;  2E76 C;  2E75 C;  1NAF A;  2D2C D;  1EXI A;  1CSB A;  3TGU D;  3HUS C;  3V2Q A;  5AVR B;  4UB6 H;  1EDK A;  1NTM K;  4RJT A;  1SS1 A;  5AVW B;  3CCJ P;  1S9K E;  4AYC A;  4H44 C;  4DZO A;  2HPC A;  4Y99 C;  3C8V A;  1SFC D;  1KYO H;  2D2C C;  3VP9 A;  2L91 A;  4RES B;  1S5L E;  3I55 P;  2JWA A;  3SWY A;  1HF9 A;  3KYQ A;  1SQV J;  1VL2 A;  2I8D A;  3I5C A;  3L74 D;  4NPF X;  2AEM A;  1PFI A;  2W83 C;  1FZE A;  2OYI A;  1NTK D;  1KQL A;  1PIX A;  3AEF C;  1RH5 B;  1JB0 J;  3TYY A;  3SWF A;  3IR9 A;  4KHX A;  1BE3 E;  2JO1 A;  1JY3 N;  2ITA A;  4PJ0 H;  2QA4 P;  5KLV G;  2H43 A;  2XU6 A;  3SFD C;  1KYO I;  4ZKP A;  1ZR4 A;  1BGY D;  3NTN A;  2A45 I;  2R32 A;  3I56 P;  1X8Y A;  1UII A;  1OX3 A;  1H89 A;  3H1I J;  4XA4 A;  3MHV A;  1USD A;  2V7Q H;  3L75 J;  4C46 A;  2AXT E;  1IC2 A;  3WUU A;  4GOD A;  3L75 E;  2M5A A;  1NU1 K;  2E74 D;  2FXP A;  4NPD A;  3CX5 E;  1K8A Q;  3TDK A;  1LWU A;  2Y0D A;  1QEX A;  1A02 J;  3L70 D;  1KZU B;  5KAI H;  3HRN A;  2WWW A;  1USE A;  3BRT B;  1KQG B;  1YQ3 C;  3P8C E;  4EIJ A;  3E1I A;  2Q9I A;  5CJ0 A;  2JEE A;  2YO3 A;  1K73 Q;  1DD4 A;  1L0N K;  2Y0C A;  1M90 Q;  1YIJ P;  3A2A A;  3S1K A;  1KIL C;  4PV1 B;  4KJM A;  2PP6 A;  4N78 D;  2ZVN B;  1LTJ B;  1PPJ E;  2JKV A;  2J59 M;  3PLN A;  1URQ B;  1L0L G;  2YXQ B;  4ZKU A;  1LTT C;  5AVX B;  1J2J B;  2WT7 A;  2OYH C;  1IZN B;  3TSI A;  2CPB A;  3L71 D;  1E5W A;  3M0D C;  2YKO A;  3PTZ A;  1VQK P;  3D71 A;  1M57 D;  4L76 A;  1FU1 A;  4YXD C;  1BE3 D;  2W6J H;  3VN0 A;  2WPQ A;  1EZV G;  1IFM A;  1VF5 B;  4HH2 A;  3FXE A;  1SQX G;  3S4R A;  1FZC B;  3VOP A;  5E79 H;  4D6T D;  3GMA A;  3H1L G;  3CC7 P;  4U3F J;  1OIP A;  4MN4 C;  1QVG O;  5AVV B;  3AED C;  2FKW B;  2XDJ A;  3L75 D;  3L72 G;  4BWN A;  2GM4 A;  1EDI A;  1U57 A;  1UIX A;  4XFJ A;  3TF5 A;  1J1E B;  1N86 A;  2HOD A;  1ZP0 C;  2L5G B;  3D6Y A;  4OH8 B;  3P8C D;  2B87 B;  1P84 E;  1JY2 O;  2KZI A;  5AW6 B;  2RN0 A;  5M1B A;  3H1K D;  2W8Z A;  1GD2 E;  2AEF A;  2KSJ A;  3E7K A;  3LID A;  2KI7 B;  2IDB A;  1Q81 Q;  2BCC G;  2O01 H;  2A06 G;  3CC4 P;  3CCM P;  3C9I A;  1KQF B;  4IL6 E;  2M3E A;  4PV1 D;  1HBW A;  3PRJ A;  1OW6 A;  1S5L H;  1IFD A;  1H0T B;  1QGK B;  2OTJ P;  1URQ D;  1PGQ A;  1EZV I;  1N7S C;  1PP9 J;  1RF1 B;  1TU3 F;  2FYU K;  4D6T G;  2GUV A;  4I6M C;  1PP9 E;  1BCC J;  1WT6 A;  2KOG A;  1FJP A;  3RL0 B;  5GTH H;  1NTM G;  4N3Y B;  1BCC E;  1EDJ A;  2P1J A;  4XE5 B;  2OYH A;  4PD4 E;  1LTJ C;  2YO2 A;  1ZR2 A;  3O8Z A;  1ZME C;  1S5L X;  3M0D A;  1GW4 A;  2KUB A;  4I7Z B;  1VF5 D;  4H0L C;  5GTI H;  3U59 A;  4C7N B;  1JY3 O;  4U7J A;  3OAK A;  2ZAE B;  5AVS B;  2J5U A;  2Z5H A;  3H1K G;  2AXT H;  2H89 C;  2FYZ A;  1NAY A;  3H32 B;  1K05 A;  2FFD B;  1MKM A;  3HTK B;  2YKQ A;  2KB7 P;  1NTK K;  2WPS A;  2C0W A;  1VQ9 P;  2YMY A;  1T2K C;  2YMK A;  1J1D B;  1XTG B;  4HB1 A;  4IFF A;  2LKM A;  5AW9 B;  3H1J G;  2XND H;  2QE7 H;  1P84 D;  1YTZ I;  3BAT A;  3O6Q B;  1SQB J;  4ASW A;  1QL2 A;  2I1J A;  1SQB E;  1OWA A;  1NHL A;  1QL1 A;  1MUU A;  1NU1 G;  1J1E C;  1YHQ P;  5DJU B;  2N1T B;  1N8R Q;  2N9Y B;  3CCL P;  4WVZ A;  5APT A;  3R2P A;  2W90 A;  1S4X A;  3G71 P;  5AW1 B;  5KJ7 D;  1JTH B;  1PP9 D;  1N7S A;  3LW5 H;  1S72 P;  3RL0 D;  2I1K A;  5H2F E;  1ZLL A;  1G1I A;  5CMZ A;  2J58 A;  3EFF K;  1ZXG A;  4JBZ A;  4PD4 D;  1N73 B;  1JNM A;  1L4A C;  2PAJ A;  1L0N G;  1OXZ A;  1RF1 C;  1LTJ A;  2C9L Y;  2P67 A;  1URQ A;  3IF4 A;  4C7R A;  1RE4 C;  1OW7 A;  1KC8 Q;  4R4M A;  1X9V A;  2HYN A;  1EDL A;  4O9B A;  3V4W A;  3WUV A;  4H13 B;  1M8O B;  5KLI B;  3VMY A;  5BU5 A;  1T3J A;  1VQ5 P;  1CI6 B;  3FWN A;  3BCC D;  4I7Z C;  1LTS C;  2YIU B;  3HD7 B;  2KLV A;  3H1H E;  1KFM A;  5AW0 B;  1L0L J;  4LLH A;  2Q1K A;  3EWK A;  1PGO A;  1FZC A;  1L0L E;  1VQM P;  4RKU J;  1G1J A;  2K88 A;  1P84 H;  2FFD C;  4I2L C;  3MTU E;  2C9N Y;  1M1J B;  1T3U A;  1NJI Q;  1FZG A;  2R3C A;  3CWB G;  5C39 A;  3FGA D;  4IL6 H;  4OVN F;  2IBZ D;  1LTB C;  2K1A A;  1HVV A;  2N1T D;  1KB9 I;  5TIS E;  1FZB A;  3V6I A;  2QEX P;  2QVA A;  3H1L J;  1BSH A;  1S3J A;  1EC5 A;  1A02 F;  2KS1 B;  3H1L E;  3HE4 B;  3L73 D;  1IFN A;  3ABV C;  1SQQ D;  3L72 J;  1PGJ A;  3U1C A;  1OVV A;  2K3R A;  1M56 D;  4IL6 X;  3L72 E;  4PD4 H;  3UIA A;  2W27 A;  4JYB A;  1SFC C;  4DT0 A;  1SQV E;  3RK3 E;  1EQ7 A;  3RK3 B;  2BEZ F;  1H0T A;  1L4A A;  4WWI A;  2QJK B;  4I1L A;  1RF1 A;  5KKZ B;  3FXD A;  3ITK A;  5KJ7 A;  1HTL C;  3GLM A;  1RE4 A;  5KAF E;  1GL2 B;  2BCC J;  2FYU G;  1AVO A;  1IFP A;  3AEE C;  4H13 D;  4EI2 A;  1PZQ A;  2K9Y A;  2BCC E;  3B71 A;  3TGU G;  4HYT B;  2A06 E;  2YNY A;  2FYN B;  3VYI A;  3SWK A;  3HD7 D;  3PH0 A;  1SVF A;  1NTZ D;  1NH4 A;  3H1H D;  3H1I E;  2ZXE B;  3P32 A;  1H88 A;  2O1K A;  4C7N A;  4H13 C;  5KLI C;  1K9M Q;  2MKV A;  1IK7 A;  1L2P A;  4W80 A;  3RL0 g;  4K35 A;  3ZDM A;  1NTM J;  1VQ8 P;  1Y8A A;  2YIU C;  3HD7 C;  1FBM A;  1NTM E;  2WSF H;  2P7J A;  2FFD A;  2NZ2 A;  3Q5R A;  1NYH A;  4L75 A;  2YXR B;  1ZW0 A;  4WY4 B;  2E74 C;  4UB8 E;  3L74 G;  3USS A;  2JR8 A;  3II6 A;  1LJ2 A;  2QM8 A;  1NTK G;  3OJA B;  3L36 A;  1LP1 A;  1S9K D;  2WTY A;  3W67 A;  3TNU B;  1X0T A;  1X22 A;  2IYO A;  3D6Z A;  2FXM A;  4IOI H;  1YJN P;  1FDM A;  4OGQ B;  3O6Q A;  3CXH E;  5H2F H;  3GF7 A;  2LR2 A;  3B8E B;  2IFM A;  3WU2 E;  1GU4 A;  1BGY G;  3CCE P;  3B5N B;  3CLQ A;  3AEC C;  2WSS H;  1FC2 C;  1VPC A;  2ZT9 D;  1LTI C;  3VP8 A;  4R4L A;  3Q1M A;  1U7M A;  1SQV D;  3RK3 D;  2CK3 H;  2IZ0 A;  1MZ9 A;  2IBZ I;  4AQR D;  1SFC A;  5CCH D;  1HJ0 A;  2O3J A;  1KV4 A;  1JTH A;  2E5Y A;  3N4X A;  3L70 G;  1DEE G;  1GL2 D;  1KTM A;  1OZH A;  1EXJ A;  5K5G B;  1NU1 J;  1HWT C;  2P58 A;  1RHZ B;  4K3A A;  4JPZ B;  1ZV8 A;  3TK1 A;  1JM0 A;  2K37 A;  3H1I D;  3PHL A;  4U3F E;  3NXS A;  1R5L A;  3KXD A;  3A0H E;  3MZW B;  1MFZ A;  3CX5 D;  2JWD A;  1VQP P;  5B66 E;  2R5B A;  1SQP J;  1AQT A;  2FYN C;  2Y9Z A;  1XTC C;  5APX A;  2GA1 A;  1HJB A;  1SQP E;  1CI6 A;  1G2C B;  2B89 A;  1KD1 Q;  1L0N J;  3RK2 B;  3AE4 C;  3S9O A;  3HD7 A;  4WY4 D;  3G9R A;  1QX8 A;  2H88 C;  2ZYG A;  2K9J B;  3AEA C;  5TIS H;  3L71 G;  5APW A;  2Z4E A;  3HE5 B;  1ZN5 A;  5APU A;  1HGZ A;  2WSE J;  3VMZ A;  1BE3 G;  1ZRT E;  4WY4 C;  4OGQ D;  1YIT P;  3CXH D;  1AQ5 A;  1PPJ D;  4QMA A;  1PGP A;  3B5N D;  3VMX A;  5APQ A;  4UB6 E;  1CW5 A;  2QJP B;  3CD6 P;  2NPS B;  2QSI A;  2BEQ D;  3EFG A;  1SLQ A;  1JOC A;  1SQB K;  2B9B A;  4PV1 C;  4BXL A;  1IK9 A;  2W6A A;  2XZR A;  1HGV A;  3L75 G;  1RE3 C;  2KS1 A;  3F5H A;  3G4S P;  1KYO E;  1URQ C;  5KAF H;  3HE4 A;  1T6A A;  3AE1 C;  3NMD A;  5AVQ B;  2H8P D;  1VQ7 P;  1FDI A;  1SQQ K;  1FJK A;  3GW6 A;  2M0B A;  2WQY C;  4A7P A;  1LTA C;  2Q3I A;  1M7L A;  2WSC J;  1Q82 Q;  2FXO A;  3PJS K;  2N9B A;  2H7H A;  4U3F D;  3MD0 A;  2M5A B;  2Y0E A;  3CX5 H;  3V2P A;  1VF5 C;  2R5D A;  1M1K Q;  1GL2 A;  2KNC B;  1FZC C;  2C0X A;  2KSE A;  2O1J A;  1MFT A;  3G6E P;  2KLU A;  3KQG A;  5BU8 B;  3WMM 0;  1JO5 A;  3W68 A;  1GK6 A;  2WPR A;  2R44 A;  3RK2 D;  2P10 A;  4UB8 H;  2E76 B;  4GT1 A;  2E75 B;  3CCS P;  1LT9 B;  3PP5 A;  5CBO A;  3M9Q A;  3U1A A;  1VQN P;  2KIK A;  3HUS B;  1WRG A;  1Q86 Q;  1KN7 A;  1NTZ K;  2FBW C;  1NWQ A;  2FYU J;  5KLV J;  1FZF A;  3RK2 C;  2FYU E;  3CXH H;  3TGU J;  4H44 B;  1R8E A;  5KLV E;  3CCR P;  4Y99 B;  1L0L K;  3QH9 A;  1OVU A;  5KAI E;  3WU2 H;  2CPS A;  3TGU E;  5APV A;  4WY4 A;  3A5T A;  4IFD K;  2FY8 A;  3K5B A;  5APS A;  2NPS D;  2OTK E;  5TJH A;  2OGU A;  3CCV P;  3BVH A;  1LNQ A;  1BCC D;  2XNX A;  1OW8 A;  1KOR A;  1OFC X;  1IFJ A;  2WIT A;  1RE3 A;  3MIW A;  4JF7 A;  3AE7 C;  2G8Y A;  1W2B O;  5KJ7 C;  3B5N A;  2QJP C;  4ZNC A;  3L74 J;  3RL0 C;  4W7Y A;  1IO4 A;  3L74 E;  1KQS O;  3IFM A;  1RQV A;  1FOS E;  1U7J A;  3M91 A;  2P2U A;  3A0H H;  5AW4 B; 
#chains in the Genus database with same CATH homology
 2IBZ I;  1BE3 J;  3TGU J;  3L74 J;  1NTM J;  1SQX J;  3H1I J;  3CX5 I;  3H1J J;  1P84 I;  1KB9 I;  1SQP J;  3CXH I;  1SQB J;  4U3F J;  1EZV I;  3L75 J;  1PP9 J;  1BGY J;  1NTK J;  3L73 J;  1SQV J;  3H1L J;  1SQQ J;  1L0L J;  4PD4 I;  3L71 J;  3BCC J;  2BCC J;  3H1K J;  1L0N J;  4D6T J;  3CWB J;  1BCC J;  2FYU J;  1KYO I;  3L70 J;  5KLV J;  1NTZ J;  1NU1 J;  3H1H J;  3L72 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...