2FYUJ

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
60
structure length
60
Chain Sequence
APTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 20
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 2fyuJ00
3L73J 1NTMJ 3CWBJ 1NU1J 1PP9J 1L0LJ 4PD4I 1SQBJ 3L74J 3H1IJ 3H1KJ 3L71J 4D6TJ 3H1HJ 1SQQJ 1SQVJ 2FYUJ 1P84I 1BCCJ 1BGYJ 3L75J 1KYOI 1L0NJ 3CXHI 4U3FJ 1KB9I 1SQPJ 2IBZI 3L70J 3H1LJ 3CX5I 1NTKJ 1NTZJ 1BE3J 3H1JJ 3L72J 1EZVI 3BCCJ 3TGUJ 2BCCJ 5KLVJ 1SQXJ
chains in the Genus database with same CATH superfamily
3H1KE 1GD2E 1JMMA 2ZT9D 3L71E 3B5NA 2ZYAA 1L0NG 2KS1B 1KILB 3PTZA 2P2UA 3T97A 3D6YA 4I7ZB 1SQQJ 1FZCB 2QJYB 4WY4B 1NTMG 3CWBG 2IYPA 2A06G 3PH0A 1N73A 2KXPB 1HF9A 1P84H 2B87A 2MJZA 2Z5IA 5AW1B 5AW9B 4PV1C 4GODA 3NXSA 1EZVD 1M1JB 1SFCB 1YTZI 3WUUA 3O6QA 3U1CA 1JY3N 1SS1A 2B87B 3I5CA 3A7OA 2PP6A 2YKQA 2M3BA 1JTHB 5L8RJ 1FZAA 2RN0A 3I56P 2E74B 1NTZJ 3FX0A 4UB6E 4EOTA 1LTJB 5BU8B 1LWUB 2WSCH 3G6EP 2M5AB 3HUSB 2POHA 1KD1Q 2N9BA 1JCDA 3KHUA 3RK2C 3A0BE 3KPEA 1W5CE 2E75B 1N7SC 4I2LC 5KAFE 4YTPC 1L0LJ 1VQ6P 2O1JA 2P58A 3L75E 1FDIA 1URQC 2WWWA 1GK6A 1QL1A 3H1IJ 2NPSB 4GOFA 1ZN5A 3H1KJ 3GHGB 1SQXE 1PGJA 1KB9D 1AV1A 1LT9B 1OW6A 3R2PA 2N9YB 3V2PA 1WRGA 1BDCA 4OGQB 5KLVK 1LT9A 3RK2D 2A06E 3RK3D 3H25A 3HD7A 5M1BA 1Q82Q 3VP8A 1LNQA 1VPCA 1NTZG 2D2CD 2C0WA 1KB9I 4JBZA 5CCGC 1S9KE 1W2BO 3HD7B 5CCHC 5KLIB 3LIEA 2OYOA 4YXDC 1FOSF 4GDOA 1FZCC 3N4XA 1IO4A 3IR9A 3MGNA 1BCCG 2XNDH 2O01J 1KYOD 4I6MC 4H13D 2IPPA 1JNMA 1JB0J 1VF5B 2R5BA 3L73G 3M0DC 3FGAD 4MN4C 5TJHA 1Q90D 4YPCA 5CCHD 3M06A 5GTHE 2FYNB 2IX7C 2M8RA 3H1KG 3QH9A 1S1CX 3CMAP 3TK1A 1VQ5P 2ZXEB 3D70A 2QM7A 2AXTE 1NTMJ 1OVUA 3CWBJ 1PP9J 3WU2H 2L5GB 2HODA 1YHQP 3CX5E 5KKZB 1CZQA 5AVYB 1SLQA 2OTLP 1K73Q 2CPBA 1N8RQ 2FYUJ 3PHLA 4I1LA 3RL0B 1SQQD 1T8ZA 1FDOA 3P8CE 3L71D 5CCHA 1YQ3C 1M8OB 4WVZA 2FYUD 3H1LG 5CBOA 2YIUC 1Q81Q 3VMAA 4AQRD 2Q5UA 1QVFO 1ZR4A 1NJIQ 2NPSC 1QEXA 1X79B 1EDLA 4C7RA 2HPCA 1TU3F 2IBZG 1KILC 4GKGA 1PGOA 3RBXA 2KOGA 3M0DA 2FKWB 2QVAA 1VDFA 1BE3J 2Y0DA 3OW2O 2Q9IA 2WSSH 3A3YB 1JO5A 4WB4A 4ZMDA 1YTZT 1OWAA 1LTAC 1QLED 2BCCJ 3AEEC 2OYIC 1S2EA 3CCSP 1U7MA 2IZ0A 4DOJA 1GTWA 3CX5H 1G1JA 3F89A 1SVFA 1URQD 2WQYC 3L37A 3S1KA 1SQBD 1X9VA 5H2FH 1GL2D 3P8CD 2VRSA 2B88A 3NFQA 1EDKA 4PD4I 1X8YA 3QWOC 1FS0E 1RF1B 2XNXA 3AE3C 1NOHA 2QJPC 1ZOYC 3IN6A 3RK3B 5GTHH 1NTKE 1BCCJ 1FC2C 4PD4D 4N3YB 1RE3C 2D2CB 3O8ZA 1URQA 3KZIH 1T3JA 3RBZA 2I1JA 2LR2A 3AECC 3L71G 1BE3G 3H1JE 3L72G 1KQSO 1N7SB 1K9MQ 1R8EA 4DT0A 1GW3A 1G2CB 2R44A 3CX5I 2W83C 1AVYA 1GK4A 1KYOE 2FXMA 2WPSA 3E1RA 3PJSK 4WY4A 3H1JD 3M91A 5AVSB 3JCUE 4GT1A 1Z56A 4IFMA 3TDKA 3WMM0 1BDDA 2QJKB 3G4SP 1FZCA 3OJAB 5K5GB 1SQVE 2WPRA 5AVWB 3B5NB 2Q7CA 1RE4A 3CCMP 3L73J 1QGKB 1RE4C 1Y47A 1ZV8A 2JKVA 3BCCG 3TGUG 1EZVG 2HFED 2Z4EA 3H1HD 1SQXK 2ZYGA 2B89A 3EFFK 3L73E 4L74A 2CPSA 2K9JA 1K04A 4HJGH 1X0TA 3AE4C 3VTPC 2QJPB 3A5TA 2YMYA 3GW6A 1H88A 1SQPD 1BE3E 1HUCA 3RGUA 3S4RA 1PL5A 1YBKA 2PRRA 5AVRB 1CI6B 2ZVNB 1ZR2A 1U7JA 1KQLA 1X22A 2A45G 2BCCG 2KSEA 3HE5B 1P84E 2QE7H 2WVRA 3JSVC 3H1LJ 5CBNA 2O1KA 1K8AQ 2M0BA 1OMIA 1DEEG 5TISE 3V2RA 1L4AD 3BCCJ 3TGUJ 1EC5A 3CCJP 3AEFC 3P8MC 3F5HA 1OW7A 1VQOP 3Q2YA 1FU1A 3MUDC 3PLNA 2HPCB 3CCRP 3CPWO 1VQLP 1NAYA 1OXZA 3L74D 2FFDC 1NU1D 1NTZK 5KLIC 4LLHA 1LTIC 2Q1KA 5AVVB 3RL0C 4CPGA 1NO4A 3A0HE 2W6JH 1NU1E 4D6TJ 5KLVG 1DEBA 4EDFA 3Q5PA 1IFPA 2WPQA 5AW2B 1ZMEC 4IFDK 2OGUA 5B5EH 1SFCA 3BRVB 1L4AA 1N2DC 4YXWH 1RY3A 4PV1B 1M1KQ 2OYIB 1NTKG 3AE6C 4JQ0D 4TLFA 3V4WA 2KP8A 5AW4B 1BGYD 1KILD 1NTKK 1G1IA 3VMXA 1DX7A 3L70J 2OARA 3VYIA 2P1JA 2OYHC 3CCEP 1OZHA 3P7KA 2NPSD 3CXHD 3KQGA 1BGYE 3OA7A 3TYYA 3L4FA 3EFGA 1Y8AA 2WSFJ 1CW5A 3HD7D 3L72J 3RK3C 3HUSC 4PV1D 1YIJP 1IFIA 3RK2B 2PGDA 1N7SA 2Q3EA 2YO2A 3AE2C 3L72D 2BCCD 3VMZA 4D6TG 1HJ0A 1JMBA 1MFTA 3HE4B 3MUDA 1SQXJ 1PZQA 1PP9D 3EWKA 1CI6A 1S5LX 2P67A 3TSIA 1T6AA 3II6A 1YJ9P 2H43A 2LXCB 3KYQA 4H0LD 2ZFCA 2ZXXA 1LT9C 1NKZB 3H1ID 3I55P 4M3LA 1HJBA 5B66E 2KNCA 1HTLC 1GL2C 1NTMK 1ZRTE 1NGMB 2E43A 2G8YA 2ZJSE 1GL2A 1JY2O 1JEKA 3SWFA 3HRNA 5EFWB 1MFZA 2NPSA 1NTME 3CWBE 2V7QJ 3ITKA 1J1EB 3Q5RA 2IDBA 1RH5B 1SQPJ 1P84D 1KMIZ 4H0LB 2JO1A 1FBMA 2XKMA 3P32A 2E42A 4U3FE 4R4LA 2ITAA 1QX8A 1EXIA 1BSHA 1VF5C 1SQPE 3VP9A 1SQXG 4PJ0E 1E79H 1LWUA 2B9BA 2N1TD 1L0NK 2E75D 2NRGA 1FJKA 2Y0CA 1JY3O 4NPEA 4Y99B 2KYVA 4BWNA 3AEAC 4ZKPA 3TNUA 5KLVJ 1MV8A 2GUVA 4H13B 3O6QB 3TNUB 5KKZC 1NVOA 3G71P 2RH0A 1NAFA 1S72P 1CSBA 2PAJA 1SQVD 3MZWB 1IK9A 3BRTB 4D6TD 1KB9H 3D71A 5AW5B 1NYHA 2XV5A 3W67A 1OIPA 1EDIA 2AEFA 2R3SA 2WSEJ 1GU5A 1FE6A 1L0LE 2WPVB 3NTNA 2KUBA 3SWKA 4ASVA 1PV3A 1LT1A 4ZNCA 4DZOA 1JY2P 2I1KA 2N1TA 5DJTB 1NTZE 5KAIE 1GL2B 4B86A 1H89A 3AE9C 3FWNA 3SFDC 5TISH 1D7MA 1IC2A 1NTKJ 3IFMA 2QM8A 2RMZA 4KJMA 1GU4A 1DD3A 2WITA 1OVVA 2YXQB 2OYIA 3BCCD 5CJ4A 1M1JC 3TGUD 2PFXA 4W7YA 5APUA 1OW8A 3RL0g 3N7NA 2H89C 4HB1A 3A2AA 1WMKA 5AW7B 1SQQE 1SQQK 2R5DA 2FYZA 2G3AA 3H32B 4IL6H 3FXDA 1YJNP 1IJDB 1AQTA 3A0BH 1EXJA 1PGQA 1RE3A 3L71J 2IYOA 1SQPG 4ASWA 3Q5SA 4IL6E 1LTJA 5APXA 2HYNA 1T2KC 5APQA 2ZAEB 2V7QH 3IAOA 3MP7B 5KJ7D 5CHXA 2QEXP 1H8AA 1KYOI 2K1AA 4UB6H 1M57D 1UIXA 1OVRA 2UWJE 4K3AA 4UB8E 1JY2N 3WUTA 4BXLA 3LIDA 4H44C 2Q6QA 2IBZI 3JCUH 2W6BA 2WZ7A 1VQPP 1LTSC 2FY8A 2P10A 3MHVA 1GDTA 1IFMA 4U3FG 3GHGC 1HBWA 1S3JA 2K3RA 3L70E 2C9LY 1G2CA 3L36A 2JWAA 2QJYC 4WY4C 4XA4A 2KK7A 3D6ZA 1N7LA 5KAIH 2C9NY 1GMJA 2FXOA 1VQKP 5AVTB 2JR8A 3AEBC 1KILA 3B5NC 1J1EC 3KZIE 2QG4A 4H0LC 1NU1J 1BGYG 1KORA 3SWYA 1KB9E 2K9YA 2Y9ZA 1R5SA 4LC1A 3CC2P 1SP4A 4W80A 2R32A 1JY3P 1GW4A 1AQ5A 2E74C 2WSEH 3H1HJ 3L75D 4R4MA 5CCGA 2YO3A 2AXCA 2ZT9C 1LTJC 5H2FE 1N7SD 1J1DC 3H32A 3KXDA 1YJWP 3AE5C 1PPJE 3CXHI 2O01N 2C0XA 3B8EB 2LXBA 2QIWA 5DJUB 4EYYQ 3HE4A 3B4SA 2AEJA 1PPJD 2YKPA 2YNYA 3AE7C 2AEMA 1BE3D 1RQUA 3GHGA 1SFCD 3HUSA 2YIUB 3HTKB 4C7NB 1NWQA 5C39A 3H1LE 3M9BA 4N78D 4DCKA 1H0TB 4KHXA 3H1IE 3CCLP 1KN7A 3U59A 3H1HE 3CC7P 1NHLA 3UIAA 1NKNA 3Q1MA 2KZIA 5KLVD 2BEQD 3C9IA 2Y9YA 4WWIA 4XE5B 2BCCE 1L0LK 5CMZA 1DH3A 4KT0J 3JC22 3L70G 5APYA 2AXTH 2CK3H 5CJ0A 1T2KD 2JJLA 1SQBG 1M90Q 1FZGA 2FYNC 3CXHE 3Q3DA 4U3FJ 3CCQP 4OGQD 5AW0B 1K05A 3M0AA 1EZVE 3V2NA 4HYTB 1MUUA 2L91A 5CCGD 2D2CC 3CI9A 1KTMA 4RKUJ 3H1JJ 3L35A 3CL3D 3ABVC 4O9BA 2JP3A 1JUNA 1NU1K 1A02F 3U1AA 2E74D 4L73A 5AW6B 1FZBA 1PGPA 1SQVG 3MIWA 3GF7A 3HE5A 4WBAA 5KTBA 1LTTC 2N1TB 3VOPA 1IZNB 1SQBJ 1ZLLA 1BCCE 4A7PA 2K88A 3A0HH 4AUWA 1RQVA 2ZVOB 2JEEA 1M56D 4BRYA 5KAFH 1NU1G 5KLVE 1BGYJ 3G3ZA 2FXPA 3H6PA 1KC8Q 1JTHA 2J59M 1OFCX 3V5BA 3H1HG 1YI2P 2P7JA 3SSUA 5E79E 1HGZA 1SFCC 5APTA 1M7LA 1YITP 1H0TA 2GM4A 1IFDA 1N73B 5AVXB 1FOSE 2A45I 2J5UA 2XZRA 4W7ZA 1ZW0A 1VQ8P 1LWUC 2HODB 4IOIH 1SQBK 4D6TE 2Z5HA 1AVOA 2KLVA 1YYCA 1LTBC 5APWA 4C46A 2K37A 3GF3A 3NMDA 1KQFB 5GTIH 1VQMP 1VL2A 4NPDA 5BU5A 1ZRTD 1NH4A 3HTKA 1URQB 2KSJA 2FBWC 4L76A 4C7NA 2IFNA 1LP1B 1T3UA 1USDA 1QVGO 1P84I 3LW5H 1HVVA 4NPFX 4L75A 1Q86Q 1FAVA 1L0LG 2KNCB 2N1TC 4IL6X 2FFDA 1PP9E 2KIKA 1FZFA 1XTCC 4N6JA 1LTGC 3CCUP 1A02J 4U3FD 4BRYB 3H1JG 3KDPB 1U57A 2M3EA 3L72E 4QMAA 1L4AC 1L0ND 1MKMA 2IBZE 1BSNA 3EQ2A 3HD7C 2OTJP 1KYOH 2J58A 3E1IA 2W27A 3IF4A 4LGDE 2FYUK 2WMMA 1EQ7A 3L70D 4UB8H 4Z1MH 2WT7A 1S9KD 1L2PA 2O3JA 2KLUA 4RO0A 2FFDB 1NTKD 1UIIA 3B71A 2WT7B 2SPZA 2KZJA 2A06D 3OAKA 3RK3E 4H44D 3CMEP 3BASA 1N86A 1KILE 1FDMA 1SQXD 2KB7P 2ZYDA 1IFNA 5KJ7C 2XU6A 1USEA 3MD0A 1OX3A 3CC4P 1KQGB 1AA0A 1HH0A 1XTGB 1RF0C 3L74J 2E76B 2NZ2A 3CLQA 5APSA 5GTIE 4OWFA 3ZDMA 1SQVJ 1FJPA 4RJTA 1Q2NA 2BEZF 2HR3A 3GLMA 4HH2A 4PD4H 1S5LH 3L74E 1YQ4C 5APVA 3L75J 2HG5D 5AVQB 1AJYA 2QSIA 3AEDC 1PFIA 1VF5D 1VQNP 5E79H 2FYUG 3H1LD 3GMAA 4K35A 4N78E 1PIXA 2E5YA 3BVHA 1JM0A 1KV4A 4JYBA 5AVZB 3R4YA 2OYHA 3PRJA 1JCCA 3AEGC 5AW8B 4I7ZC 3SFEC 2KS1A 5AW3B 3T97B 1KFNA 1KFMA 2IBZD 1Y9BA 4DJGA 4IFFA 1AFOA 2GA1A 2WSFH 1NTZD 2YXRB 2H88C 3S9OA 3CX5D 4RESB 4ZKUA 5KJ7A 2Y0EA 1VQ4P 3PP5A 1E5WA 1ZP0C 3RL0D 3V2QA 4EIJA 1VQ7P 2H8PD 3L75G 1S4XA 2HLOA 2ZT9B 3H1KD 4U7JA 3WUVA 3L73D 1N73C 3LW5J 3B5ND 2W6AA 3V4QA 1RF1C 1W2EA 2E76C 3AE1C 2OTKE 2QRXA 1RF1A 2K9JB 3WU2E 2JWDA 1LP1A 1J1DB 1ZXGA 4WY4D 1DIPA 4PJ0H 1L0NJ 2A45H 2Q3IA 4HKZH 3GG2A 1SQQG 4GOEA 1R5LA 2E75C 5AVUB 2XDJA 3E7KA 1L0NE 1Q7YQ 3AE8C 1MZ9A 2I8DA 1SQPK 3CXHH 2M5AA 3C1LA 2MKVA 2R3CA 4OGQC 1FZEA 3L74G 3H1IG 2OYHB 5B66H 2IZ1A 2WSCJ 2H7HA 1LGHB 2QJKC 2E5TA 4EI2A 1DD4A 2GUSA 1NTMD 3CWBD 2LKMA 1HGVA 2YKOA 1L4AB 1M1JA 1S5LE 2KI7B 2E76D 4JF7A 4PD4E 3W68A 2WTYA 1HWTC 1EDJA 2BASA 1QL2A 1BCCD 5BVZA 3CD6P 3FWLA 2W90A 2RKLA 3G9RA 4Y99C 1LJ2A 1JOCA 1RF0A 1SQBE 1GZLA 3M9HA 4JYCA 2OQQA 4AYCA 4GIFA 3BATA 2YMKA 3CCVP 3BCCE 3TGUE 4Y28J 1IFJA 1IK7A 1J2JB 2V4HA 4OVNF 3VN0A 1KZUB 4H13C 2DW3A 4JPZB 1RHZB 4OH8B 2O01H 4XFJA 3FXEA 3K5BA 3VMYA 1VQ9P 1PP9G 1EZVI 4TT3H 5B5EE 4H44B 3M9QA 3TF5A 1WT6A 2IFMA 2W8ZA 1PPJG 3USSA 3V6IA 2QA4P 1L0LD 1SQVK 3C8VA 2JDIH 3MTUE 2FYUE
chains in the Genus database with same CATH topology
3L73J 1NTMJ 3CWBJ 1NU1J 1PP9J 1L0LJ 4PD4I 1SQBJ 3L74J 3H1IJ 3H1KJ 3L71J 4D6TJ 3H1HJ 1SQQJ 1SQVJ 2FYUJ 1P84I 1BCCJ 1BGYJ 3L75J 1KYOI 1L0NJ 3CXHI 4U3FJ 1KB9I 1SQPJ 2IBZI 3L70J 3H1LJ 3CX5I 1NTKJ 1NTZJ 1BE3J 3H1JJ 3L72J 1EZVI 3BCCJ 3TGUJ 2BCCJ 5KLVJ 1SQXJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L73 J;  1NTM J;  3CWB J;  1NU1 J;  1PP9 J;  1L0L J;  4PD4 I;  1SQB J;  3L74 J;  3H1I J;  3H1K J;  3L71 J;  4D6T J;  3H1H J;  1SQQ J;  1SQV J;  2FYU J;  1P84 I;  1BCC J;  1BGY J;  3L75 J;  1KYO I;  1L0N J;  3CXH I;  4U3F J;  1KB9 I;  1SQP J;  2IBZ I;  3L70 J;  3H1L J;  3CX5 I;  1NTK J;  1NTZ J;  1BE3 J;  3H1J J;  3L72 J;  1EZV I;  3BCC J;  3TGU J;  2BCC J;  5KLV J;  1SQX J; 
#chains in the Genus database with same CATH topology
 3H1K E;  1GD2 E;  1JMM A;  2ZT9 D;  3L71 E;  3B5N A;  2ZYA A;  1L0N G;  2KS1 B;  1KIL B;  3PTZ A;  2P2U A;  3T97 A;  3D6Y A;  4I7Z B;  1SQQ J;  1FZC B;  2QJY B;  4WY4 B;  1NTM G;  3CWB G;  2IYP A;  2A06 G;  3PH0 A;  1N73 A;  2KXP B;  1HF9 A;  1P84 H;  2B87 A;  2MJZ A;  2Z5I A;  5AW1 B;  5AW9 B;  4PV1 C;  4GOD A;  3NXS A;  1EZV D;  1M1J B;  1SFC B;  1YTZ I;  3WUU A;  3O6Q A;  3U1C A;  1JY3 N;  1SS1 A;  2B87 B;  3I5C A;  3A7O A;  2PP6 A;  2YKQ A;  2M3B A;  1JTH B;  5L8R J;  1FZA A;  2RN0 A;  3I56 P;  2E74 B;  1NTZ J;  3FX0 A;  4UB6 E;  4EOT A;  1LTJ B;  5BU8 B;  1LWU B;  2WSC H;  3G6E P;  2M5A B;  3HUS B;  2POH A;  1KD1 Q;  2N9B A;  1JCD A;  3KHU A;  3RK2 C;  3A0B E;  3KPE A;  1W5C E;  2E75 B;  1N7S C;  4I2L C;  5KAF E;  4YTP C;  1L0L J;  1VQ6 P;  2O1J A;  2P58 A;  3L75 E;  1FDI A;  1URQ C;  2WWW A;  1GK6 A;  1QL1 A;  3H1I J;  2NPS B;  4GOF A;  1ZN5 A;  3H1K J;  3GHG B;  1SQX E;  1PGJ A;  1KB9 D;  1AV1 A;  1LT9 B;  1OW6 A;  3R2P A;  2N9Y B;  3V2P A;  1WRG A;  1BDC A;  4OGQ B;  5KLV K;  1LT9 A;  3RK2 D;  2A06 E;  3RK3 D;  3H25 A;  3HD7 A;  5M1B A;  1Q82 Q;  3VP8 A;  1LNQ A;  1VPC A;  1NTZ G;  2D2C D;  2C0W A;  1KB9 I;  4JBZ A;  5CCG C;  1S9K E;  1W2B O;  3HD7 B;  5CCH C;  5KLI B;  3LIE A;  2OYO A;  4YXD C;  1FOS F;  4GDO A;  1FZC C;  3N4X A;  1IO4 A;  3IR9 A;  3MGN A;  1BCC G;  2XND H;  2O01 J;  1KYO D;  4I6M C;  4H13 D;  2IPP A;  1JNM A;  1JB0 J;  1VF5 B;  2R5B A;  3L73 G;  3M0D C;  3FGA D;  4MN4 C;  5TJH A;  1Q90 D;  4YPC A;  5CCH D;  3M06 A;  5GTH E;  2FYN B;  2IX7 C;  2M8R A;  3H1K G;  3QH9 A;  1S1C X;  3CMA P;  3TK1 A;  1VQ5 P;  2ZXE B;  3D70 A;  2QM7 A;  2AXT E;  1NTM J;  1OVU A;  3CWB J;  1PP9 J;  3WU2 H;  2L5G B;  2HOD A;  1YHQ P;  3CX5 E;  5KKZ B;  1CZQ A;  5AVY B;  1SLQ A;  2OTL P;  1K73 Q;  2CPB A;  1N8R Q;  2FYU J;  3PHL A;  4I1L A;  3RL0 B;  1SQQ D;  1T8Z A;  1FDO A;  3P8C E;  3L71 D;  5CCH A;  1YQ3 C;  1M8O B;  4WVZ A;  2FYU D;  3H1L G;  5CBO A;  2YIU C;  1Q81 Q;  3VMA A;  4AQR D;  2Q5U A;  1QVF O;  1ZR4 A;  1NJI Q;  2NPS C;  1QEX A;  1X79 B;  1EDL A;  4C7R A;  2HPC A;  1TU3 F;  2IBZ G;  1KIL C;  4GKG A;  1PGO A;  3RBX A;  2KOG A;  3M0D A;  2FKW B;  2QVA A;  1VDF A;  1BE3 J;  2Y0D A;  3OW2 O;  2Q9I A;  2WSS H;  3A3Y B;  1JO5 A;  4WB4 A;  4ZMD A;  1YTZ T;  1OWA A;  1LTA C;  1QLE D;  2BCC J;  3AEE C;  2OYI C;  1S2E A;  3CCS P;  1U7M A;  2IZ0 A;  4DOJ A;  1GTW A;  3CX5 H;  1G1J A;  3F89 A;  1SVF A;  1URQ D;  2WQY C;  3L37 A;  3S1K A;  1SQB D;  1X9V A;  5H2F H;  1GL2 D;  3P8C D;  2VRS A;  2B88 A;  3NFQ A;  1EDK A;  4PD4 I;  1X8Y A;  3QWO C;  1FS0 E;  1RF1 B;  2XNX A;  3AE3 C;  1NOH A;  2QJP C;  1ZOY C;  3IN6 A;  3RK3 B;  5GTH H;  1NTK E;  1BCC J;  1FC2 C;  4PD4 D;  4N3Y B;  1RE3 C;  2D2C B;  3O8Z A;  1URQ A;  3KZI H;  1T3J A;  3RBZ A;  2I1J A;  2LR2 A;  3AEC C;  3L71 G;  1BE3 G;  3H1J E;  3L72 G;  1KQS O;  1N7S B;  1K9M Q;  1R8E A;  4DT0 A;  1GW3 A;  1G2C B;  2R44 A;  3CX5 I;  2W83 C;  1AVY A;  1GK4 A;  1KYO E;  2FXM A;  2WPS A;  3E1R A;  3PJS K;  4WY4 A;  3H1J D;  3M91 A;  5AVS B;  3JCU E;  4GT1 A;  1Z56 A;  4IFM A;  3TDK A;  3WMM 0;  1BDD A;  2QJK B;  3G4S P;  1FZC A;  3OJA B;  5K5G B;  1SQV E;  2WPR A;  5AVW B;  3B5N B;  2Q7C A;  1RE4 A;  3CCM P;  3L73 J;  1QGK B;  1RE4 C;  1Y47 A;  1ZV8 A;  2JKV A;  3BCC G;  3TGU G;  1EZV G;  2HFE D;  2Z4E A;  3H1H D;  1SQX K;  2ZYG A;  2B89 A;  3EFF K;  3L73 E;  4L74 A;  2CPS A;  2K9J A;  1K04 A;  4HJG H;  1X0T A;  3AE4 C;  3VTP C;  2QJP B;  3A5T A;  2YMY A;  3GW6 A;  1H88 A;  1SQP D;  1BE3 E;  1HUC A;  3RGU A;  3S4R A;  1PL5 A;  1YBK A;  2PRR A;  5AVR B;  1CI6 B;  2ZVN B;  1ZR2 A;  1U7J A;  1KQL A;  1X22 A;  2A45 G;  2BCC G;  2KSE A;  3HE5 B;  1P84 E;  2QE7 H;  2WVR A;  3JSV C;  3H1L J;  5CBN A;  2O1K A;  1K8A Q;  2M0B A;  1OMI A;  1DEE G;  5TIS E;  3V2R A;  1L4A D;  3BCC J;  3TGU J;  1EC5 A;  3CCJ P;  3AEF C;  3P8M C;  3F5H A;  1OW7 A;  1VQO P;  3Q2Y A;  1FU1 A;  3MUD C;  3PLN A;  2HPC B;  3CCR P;  3CPW O;  1VQL P;  1NAY A;  1OXZ A;  3L74 D;  2FFD C;  1NU1 D;  1NTZ K;  5KLI C;  4LLH A;  1LTI C;  2Q1K A;  5AVV B;  3RL0 C;  4CPG A;  1NO4 A;  3A0H E;  2W6J H;  1NU1 E;  4D6T J;  5KLV G;  1DEB A;  4EDF A;  3Q5P A;  1IFP A;  2WPQ A;  5AW2 B;  1ZME C;  4IFD K;  2OGU A;  5B5E H;  1SFC A;  3BRV B;  1L4A A;  1N2D C;  4YXW H;  1RY3 A;  4PV1 B;  1M1K Q;  2OYI B;  1NTK G;  3AE6 C;  4JQ0 D;  4TLF A;  3V4W A;  2KP8 A;  5AW4 B;  1BGY D;  1KIL D;  1NTK K;  1G1I A;  3VMX A;  1DX7 A;  3L70 J;  2OAR A;  3VYI A;  2P1J A;  2OYH C;  3CCE P;  1OZH A;  3P7K A;  2NPS D;  3CXH D;  3KQG A;  1BGY E;  3OA7 A;  3TYY A;  3L4F A;  3EFG A;  1Y8A A;  2WSF J;  1CW5 A;  3HD7 D;  3L72 J;  3RK3 C;  3HUS C;  4PV1 D;  1YIJ P;  1IFI A;  3RK2 B;  2PGD A;  1N7S A;  2Q3E A;  2YO2 A;  3AE2 C;  3L72 D;  2BCC D;  3VMZ A;  4D6T G;  1HJ0 A;  1JMB A;  1MFT A;  3HE4 B;  3MUD A;  1SQX J;  1PZQ A;  1PP9 D;  3EWK A;  1CI6 A;  1S5L X;  2P67 A;  3TSI A;  1T6A A;  3II6 A;  1YJ9 P;  2H43 A;  2LXC B;  3KYQ A;  4H0L D;  2ZFC A;  2ZXX A;  1LT9 C;  1NKZ B;  3H1I D;  3I55 P;  4M3L A;  1HJB A;  5B66 E;  2KNC A;  1HTL C;  1GL2 C;  1NTM K;  1ZRT E;  1NGM B;  2E43 A;  2G8Y A;  2ZJS E;  1GL2 A;  1JY2 O;  1JEK A;  3SWF A;  3HRN A;  5EFW B;  1MFZ A;  2NPS A;  1NTM E;  3CWB E;  2V7Q J;  3ITK A;  1J1E B;  3Q5R A;  2IDB A;  1RH5 B;  1SQP J;  1P84 D;  1KMI Z;  4H0L B;  2JO1 A;  1FBM A;  2XKM A;  3P32 A;  2E42 A;  4U3F E;  4R4L A;  2ITA A;  1QX8 A;  1EXI A;  1BSH A;  1VF5 C;  1SQP E;  3VP9 A;  1SQX G;  4PJ0 E;  1E79 H;  1LWU A;  2B9B A;  2N1T D;  1L0N K;  2E75 D;  2NRG A;  1FJK A;  2Y0C A;  1JY3 O;  4NPE A;  4Y99 B;  2KYV A;  4BWN A;  3AEA C;  4ZKP A;  3TNU A;  5KLV J;  1MV8 A;  2GUV A;  4H13 B;  3O6Q B;  3TNU B;  5KKZ C;  1NVO A;  3G71 P;  2RH0 A;  1NAF A;  1S72 P;  1CSB A;  2PAJ A;  1SQV D;  3MZW B;  1IK9 A;  3BRT B;  4D6T D;  1KB9 H;  3D71 A;  5AW5 B;  1NYH A;  2XV5 A;  3W67 A;  1OIP A;  1EDI A;  2AEF A;  2R3S A;  2WSE J;  1GU5 A;  1FE6 A;  1L0L E;  2WPV B;  3NTN A;  2KUB A;  3SWK A;  4ASV A;  1PV3 A;  1LT1 A;  4ZNC A;  4DZO A;  1JY2 P;  2I1K A;  2N1T A;  5DJT B;  1NTZ E;  5KAI E;  1GL2 B;  4B86 A;  1H89 A;  3AE9 C;  3FWN A;  3SFD C;  5TIS H;  1D7M A;  1IC2 A;  1NTK J;  3IFM A;  2QM8 A;  2RMZ A;  4KJM A;  1GU4 A;  1DD3 A;  2WIT A;  1OVV A;  2YXQ B;  2OYI A;  3BCC D;  5CJ4 A;  1M1J C;  3TGU D;  2PFX A;  4W7Y A;  5APU A;  1OW8 A;  3RL0 g;  3N7N A;  2H89 C;  4HB1 A;  3A2A A;  1WMK A;  5AW7 B;  1SQQ E;  1SQQ K;  2R5D A;  2FYZ A;  2G3A A;  3H32 B;  4IL6 H;  3FXD A;  1YJN P;  1IJD B;  1AQT A;  3A0B H;  1EXJ A;  1PGQ A;  1RE3 A;  3L71 J;  2IYO A;  1SQP G;  4ASW A;  3Q5S A;  4IL6 E;  1LTJ A;  5APX A;  2HYN A;  1T2K C;  5APQ A;  2ZAE B;  2V7Q H;  3IAO A;  3MP7 B;  5KJ7 D;  5CHX A;  2QEX P;  1H8A A;  1KYO I;  2K1A A;  4UB6 H;  1M57 D;  1UIX A;  1OVR A;  2UWJ E;  4K3A A;  4UB8 E;  1JY2 N;  3WUT A;  4BXL A;  3LID A;  4H44 C;  2Q6Q A;  2IBZ I;  3JCU H;  2W6B A;  2WZ7 A;  1VQP P;  1LTS C;  2FY8 A;  2P10 A;  3MHV A;  1GDT A;  1IFM A;  4U3F G;  3GHG C;  1HBW A;  1S3J A;  2K3R A;  3L70 E;  2C9L Y;  1G2C A;  3L36 A;  2JWA A;  2QJY C;  4WY4 C;  4XA4 A;  2KK7 A;  3D6Z A;  1N7L A;  5KAI H;  2C9N Y;  1GMJ A;  2FXO A;  1VQK P;  5AVT B;  2JR8 A;  3AEB C;  1KIL A;  3B5N C;  1J1E C;  3KZI E;  2QG4 A;  4H0L C;  1NU1 J;  1BGY G;  1KOR A;  3SWY A;  1KB9 E;  2K9Y A;  2Y9Z A;  1R5S A;  4LC1 A;  3CC2 P;  1SP4 A;  4W80 A;  2R32 A;  1JY3 P;  1GW4 A;  1AQ5 A;  2E74 C;  2WSE H;  3H1H J;  3L75 D;  4R4M A;  5CCG A;  2YO3 A;  2AXC A;  2ZT9 C;  1LTJ C;  5H2F E;  1N7S D;  1J1D C;  3H32 A;  3KXD A;  1YJW P;  3AE5 C;  1PPJ E;  3CXH I;  2O01 N;  2C0X A;  3B8E B;  2LXB A;  2QIW A;  5DJU B;  4EYY Q;  3HE4 A;  3B4S A;  2AEJ A;  1PPJ D;  2YKP A;  2YNY A;  3AE7 C;  2AEM A;  1BE3 D;  1RQU A;  3GHG A;  1SFC D;  3HUS A;  2YIU B;  3HTK B;  4C7N B;  1NWQ A;  5C39 A;  3H1L E;  3M9B A;  4N78 D;  4DCK A;  1H0T B;  4KHX A;  3H1I E;  3CCL P;  1KN7 A;  3U59 A;  3H1H E;  3CC7 P;  1NHL A;  3UIA A;  1NKN A;  3Q1M A;  2KZI A;  5KLV D;  2BEQ D;  3C9I A;  2Y9Y A;  4WWI A;  4XE5 B;  2BCC E;  1L0L K;  5CMZ A;  1DH3 A;  4KT0 J;  3JC2 2;  3L70 G;  5APY A;  2AXT H;  2CK3 H;  5CJ0 A;  1T2K D;  2JJL A;  1SQB G;  1M90 Q;  1FZG A;  2FYN C;  3CXH E;  3Q3D A;  4U3F J;  3CCQ P;  4OGQ D;  5AW0 B;  1K05 A;  3M0A A;  1EZV E;  3V2N A;  4HYT B;  1MUU A;  2L91 A;  5CCG D;  2D2C C;  3CI9 A;  1KTM A;  4RKU J;  3H1J J;  3L35 A;  3CL3 D;  3ABV C;  4O9B A;  2JP3 A;  1JUN A;  1NU1 K;  1A02 F;  3U1A A;  2E74 D;  4L73 A;  5AW6 B;  1FZB A;  1PGP A;  1SQV G;  3MIW A;  3GF7 A;  3HE5 A;  4WBA A;  5KTB A;  1LTT C;  2N1T B;  3VOP A;  1IZN B;  1SQB J;  1ZLL A;  1BCC E;  4A7P A;  2K88 A;  3A0H H;  4AUW A;  1RQV A;  2ZVO B;  2JEE A;  1M56 D;  4BRY A;  5KAF H;  1NU1 G;  5KLV E;  1BGY J;  3G3Z A;  2FXP A;  3H6P A;  1KC8 Q;  1JTH A;  2J59 M;  1OFC X;  3V5B A;  3H1H G;  1YI2 P;  2P7J A;  3SSU A;  5E79 E;  1HGZ A;  1SFC C;  5APT A;  1M7L A;  1YIT P;  1H0T A;  2GM4 A;  1IFD A;  1N73 B;  5AVX B;  1FOS E;  2A45 I;  2J5U A;  2XZR A;  4W7Z A;  1ZW0 A;  1VQ8 P;  1LWU C;  2HOD B;  4IOI H;  1SQB K;  4D6T E;  2Z5H A;  1AVO A;  2KLV A;  1YYC A;  1LTB C;  5APW A;  4C46 A;  2K37 A;  3GF3 A;  3NMD A;  1KQF B;  5GTI H;  1VQM P;  1VL2 A;  4NPD A;  5BU5 A;  1ZRT D;  1NH4 A;  3HTK A;  1URQ B;  2KSJ A;  2FBW C;  4L76 A;  4C7N A;  2IFN A;  1LP1 B;  1T3U A;  1USD A;  1QVG O;  1P84 I;  3LW5 H;  1HVV A;  4NPF X;  4L75 A;  1Q86 Q;  1FAV A;  1L0L G;  2KNC B;  2N1T C;  4IL6 X;  2FFD A;  1PP9 E;  2KIK A;  1FZF A;  1XTC C;  4N6J A;  1LTG C;  3CCU P;  1A02 J;  4U3F D;  4BRY B;  3H1J G;  3KDP B;  1U57 A;  2M3E A;  3L72 E;  4QMA A;  1L4A C;  1L0N D;  1MKM A;  2IBZ E;  1BSN A;  3EQ2 A;  3HD7 C;  2OTJ P;  1KYO H;  2J58 A;  3E1I A;  2W27 A;  3IF4 A;  4LGD E;  2FYU K;  2WMM A;  1EQ7 A;  3L70 D;  4UB8 H;  4Z1M H;  2WT7 A;  1S9K D;  1L2P A;  2O3J A;  2KLU A;  4RO0 A;  2FFD B;  1NTK D;  1UII A;  3B71 A;  2WT7 B;  2SPZ A;  2KZJ A;  2A06 D;  3OAK A;  3RK3 E;  4H44 D;  3CME P;  3BAS A;  1N86 A;  1KIL E;  1FDM A;  1SQX D;  2KB7 P;  2ZYD A;  1IFN A;  5KJ7 C;  2XU6 A;  1USE A;  3MD0 A;  1OX3 A;  3CC4 P;  1KQG B;  1AA0 A;  1HH0 A;  1XTG B;  1RF0 C;  3L74 J;  2E76 B;  2NZ2 A;  3CLQ A;  5APS A;  5GTI E;  4OWF A;  3ZDM A;  1SQV J;  1FJP A;  4RJT A;  1Q2N A;  2BEZ F;  2HR3 A;  3GLM A;  4HH2 A;  4PD4 H;  1S5L H;  3L74 E;  1YQ4 C;  5APV A;  3L75 J;  2HG5 D;  5AVQ B;  1AJY A;  2QSI A;  3AED C;  1PFI A;  1VF5 D;  1VQN P;  5E79 H;  2FYU G;  3H1L D;  3GMA A;  4K35 A;  4N78 E;  1PIX A;  2E5Y A;  3BVH A;  1JM0 A;  1KV4 A;  4JYB A;  5AVZ B;  3R4Y A;  2OYH A;  3PRJ A;  1JCC A;  3AEG C;  5AW8 B;  4I7Z C;  3SFE C;  2KS1 A;  5AW3 B;  3T97 B;  1KFN A;  1KFM A;  2IBZ D;  1Y9B A;  4DJG A;  4IFF A;  1AFO A;  2GA1 A;  2WSF H;  1NTZ D;  2YXR B;  2H88 C;  3S9O A;  3CX5 D;  4RES B;  4ZKU A;  5KJ7 A;  2Y0E A;  1VQ4 P;  3PP5 A;  1E5W A;  1ZP0 C;  3RL0 D;  3V2Q A;  4EIJ A;  1VQ7 P;  2H8P D;  3L75 G;  1S4X A;  2HLO A;  2ZT9 B;  3H1K D;  4U7J A;  3WUV A;  3L73 D;  1N73 C;  3LW5 J;  3B5N D;  2W6A A;  3V4Q A;  1RF1 C;  1W2E A;  2E76 C;  3AE1 C;  2OTK E;  2QRX A;  1RF1 A;  2K9J B;  3WU2 E;  2JWD A;  1LP1 A;  1J1D B;  1ZXG A;  4WY4 D;  1DIP A;  4PJ0 H;  1L0N J;  2A45 H;  2Q3I A;  4HKZ H;  3GG2 A;  1SQQ G;  4GOE A;  1R5L A;  2E75 C;  5AVU B;  2XDJ A;  3E7K A;  1L0N E;  1Q7Y Q;  3AE8 C;  1MZ9 A;  2I8D A;  1SQP K;  3CXH H;  2M5A A;  3C1L A;  2MKV A;  2R3C A;  4OGQ C;  1FZE A;  3L74 G;  3H1I G;  2OYH B;  5B66 H;  2IZ1 A;  2WSC J;  2H7H A;  1LGH B;  2QJK C;  2E5T A;  4EI2 A;  1DD4 A;  2GUS A;  1NTM D;  3CWB D;  2LKM A;  1HGV A;  2YKO A;  1L4A B;  1M1J A;  1S5L E;  2KI7 B;  2E76 D;  4JF7 A;  4PD4 E;  3W68 A;  2WTY A;  1HWT C;  1EDJ A;  2BAS A;  1QL2 A;  1BCC D;  5BVZ A;  3CD6 P;  3FWL A;  2W90 A;  2RKL A;  3G9R A;  4Y99 C;  1LJ2 A;  1JOC A;  1RF0 A;  1SQB E;  1GZL A;  3M9H A;  4JYC A;  2OQQ A;  4AYC A;  4GIF A;  3BAT A;  2YMK A;  3CCV P;  3BCC E;  3TGU E;  4Y28 J;  1IFJ A;  1IK7 A;  1J2J B;  2V4H A;  4OVN F;  3VN0 A;  1KZU B;  4H13 C;  2DW3 A;  4JPZ B;  1RHZ B;  4OH8 B;  2O01 H;  4XFJ A;  3FXE A;  3K5B A;  3VMY A;  1VQ9 P;  1PP9 G;  1EZV I;  4TT3 H;  5B5E E;  4H44 B;  3M9Q A;  3TF5 A;  1WT6 A;  2IFM A;  2W8Z A;  1PPJ G;  3USS A;  3V6I A;  2QA4 P;  1L0L D;  1SQV K;  3C8V A;  2JDI H;  3MTU E;  2FYU E; 
#chains in the Genus database with same CATH homology
 3L73 J;  1NTM J;  3CWB J;  1NU1 J;  1PP9 J;  1L0L J;  4PD4 I;  1SQB J;  3L74 J;  3H1I J;  3H1K J;  3L71 J;  4D6T J;  3H1H J;  1SQQ J;  1SQV J;  2FYU J;  1P84 I;  1BCC J;  1BGY J;  3L75 J;  1KYO I;  1L0N J;  3CXH I;  4U3F J;  1KB9 I;  1SQP J;  2IBZ I;  3L70 J;  3H1L J;  3CX5 I;  1NTK J;  1NTZ J;  1BE3 J;  3H1J J;  3L72 J;  1EZV I;  3BCC J;  3TGU J;  2BCC J;  5KLV J;  1SQX J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...