2FYWA

Crystal structure of a conserved protein of unknown function from streptococcus pneumoniae
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
267
structure length
267
Chain Sequence
NAMLASEVIQAYEAFCPQEFSMEGDSRGLQIGTLDKGIQRVMVALDIREETVAEAIEKGVDLIIVKHAPIFRPIKDLLASRPQNQIYIDLIKHDIAVYVSHTNIDIVENGLNDWFCQMLGIEETTYLQETGPERGIGRIGNIQPQTFWELAQQVKQVFDLDSLRMVHYQEDDLQKPISRVAICGGSGQSFYKDALAKGADVYITGDIYYHTAQDMLSDGLLALDPGHYIEVIFVEKIAALLSQWKEDKGWSIDILPSQASTNPFHHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal structure of a conserved hypothetical protein from Streptococcus pneumoniae TIGR4
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 87
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01784 NIF3 NIF3 (NGG1p interacting factor 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1390.30 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 NIF3 (NGG1p interacting factor 3)-like 2fywA02
3.40.1390.30 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 NIF3 (NGG1p interacting factor 3)-like 2fywA01
3WSGA 4IWGA 3WSDA 1NMOA 1NMPA 4IWMA 3WSEA 2YYBA 3WSHA 3WSFA 3WSIA 2FYWA
chains in the Genus database with same CATH superfamily
2IU8A 2IUAA 3ZM6A 1E8CA 1NMOA 3WSEA 3WSIA 1NMPA 2AM2A 3EH0A 3ZM5A 4IWGA 1GG4A 2IOJA 1KNXA 4IHFA 4E79A 4ZIYA 2FYWA 4IHGA 4CVLA 4IHHA 2WTZA 4C13A 1KO7A 4QF5A 2IU9A 3L31A 4IWMA 2XJAA 4QDIA 4CVMA 3L2BA 3WSGA 4E75A 3PMOA 3WSFA 3WSDA 4CVKA 3ZL8A 2AM1A 2YYBA 3WSHA 4BUBA 3EEQA 4C12A
chains in the Genus database with same CATH topology
3WSGA 4IWGA 3WSDA 1NMOA 1NMPA 4IWMA 3WSEA 2YYBA 3WSHA 3WSFA 3WSIA 2FYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WSG A;  4IWG A;  3WSD A;  1NMO A;  1NMP A;  4IWM A;  3WSE A;  2YYB A;  3WSH A;  3WSF A;  3WSI A;  2FYW A; 
#chains in the Genus database with same CATH topology
 2IU8 A;  2IUA A;  3ZM6 A;  1E8C A;  1NMO A;  3WSE A;  3WSI A;  1NMP A;  2AM2 A;  3EH0 A;  3ZM5 A;  4IWG A;  1GG4 A;  2IOJ A;  1KNX A;  4IHF A;  4E79 A;  4ZIY A;  2FYW A;  4IHG A;  4CVL A;  4IHH A;  2WTZ A;  4C13 A;  1KO7 A;  4QF5 A;  2IU9 A;  3L31 A;  4IWM A;  2XJA A;  4QDI A;  4CVM A;  3L2B A;  3WSG A;  4E75 A;  3PMO A;  3WSF A;  3WSD A;  4CVK A;  3ZL8 A;  2AM1 A;  2YYB A;  3WSH A;  4BUB A;  3EEQ A;  4C12 A; 
#chains in the Genus database with same CATH homology
 3WSG A;  4IWG A;  3WSD A;  1NMO A;  1NMP A;  4IWM A;  3WSE A;  2YYB A;  3WSH A;  3WSF A;  3WSI A;  2FYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...