2FZ0A

Identification of yeast r-snare nyv1p as a novel longin domain protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
149
structure length
149
Chain Sequence
b'MKRFNVSYVEVIKNGETISSCFQPFQKNENYGTITSANEQITPVIFHNLIMDMVLPKVVPIKGNKVTKMSMNLIDGFDCFYSTDDHDPKTVYVCFTLVDIPKILPIRILSGLQEYESNATNELLSSHVGQILDSFHEELVEYRNQTLNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords v-SNARE component of the vacuolar SNARE complex involved in
molecule tags Membrane protein
source organism Saccharomyces cerevisiae
publication title Identification of the Yeast R-SNARE Nyv1p as a Novel Longin Domain-containing Protein
pubmed doi rcsb
total genus 24
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09426 Nyv1_N Vacuolar R-SNARE Nyv1 N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.230 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2fz0A00
2FZ0A
chains in the Genus database with same CATH superfamily
3H7WA 1MBLA 4LRZE 4WBGA 3PHYA 3C30A 3F1OB 1KE3A 4QJGA 4E04A 3O87A 3MZFA 4WEKA 1YLTA 3O5YA 5FA7A 1SKOB 5DKLA 3A0SA 1H8ZA 1K57A 1RGZA 2LB5A 2IWDA 4GOGA 3T12B 3ITBA 4L9EA 3UE1A 2H10A 1NYYA 1LSVA 4HI4A 3SS3A 1NZUA 3VFFA 4JPMA 4ZAMA 3DBAA 1P9WA 3IWQA 5FI7A 1JNUA 4K0XA 4Y7PA 1JWZA 4E3MA 4S2PA 3BLSA 3WS1A 3BFCA 2ZOIA 2W3HA 2XSSA 1EW0A 2OOLA 3MQOA 1QMFA 1ZG6A 3UPNA 3PBOA 2XA7S 3FZCA 3SH8A 1U60A 1CI8A 1HD8A 2ZQDA 3FG8A 4DN0A 3IHBA 1OT6A 4EEUA 4UA6A 1JWPA 3S1YA 4Y0TA 4LLOB 4YINA 3T1SA 1G6AA 2WZXA 2HJEA 4JKTA 1ES4A 2OLVA 1NRFA 4S2NA 3QP6A 3FV7A 2A2LA 5CECA 3IWIA 1C3BA 3ZNYA 3FKVA 1P0ZA 3ZFZA 2IWCA 5HWWA 5CGSA 1NRJA 5CEDA 2VKSA 4EBNA 5HDSA 4IHQA 4WZ5A 2Y2QA 3WWXA 1YAXA 1IKGA 3HLFA 4JXSA 4EU0A 3EOIA 1TS6A 4P6ZM 3QP2A 3TOIA 4BL2A 3KYZA 2OWJA 4U3TA 1VETA 5F83A 3R7WB 5HAPA 4HJ3A 4OOYA 3C7UA 1LSWA 1Z09A 2B5RA 1ZC2A 2BTFP 2D01A 3IS2B 5EVID 3QP5A 4B4XA 1STZA 5F69A 3P09A 3ICYA 2JKGA 4R4SA 3PBRA 1IYOA 2Z2LB 3LIFA 2P9VA 4X6TA 2JN7A 3N6IA 3ZHHA 1FCOA 4P6BA 4I3JA 2Y2LA 4BQMA 4EBPA 2PU4A 3VMAA 2L0WA 2W0NA 3VSKA 3UE3A 1HZOA 1K55A 2X71A 3LEZA 2XROA 3FYZA 2V8CA 1UWPX 1GSWA 4O0PA 5AJGA 1NLYA 4KQQA 2Y79A 4II7A 3B47A 2VGJA 3ZG5A 1QMEA 3K2NA 3GMWA 3F1OA 4MN7A 1J3WA 2HDRA 2R78A 3CPTA 5EVIB 2DCFA 4Z1WA 3HJIA 1K54C 3U2AA 2ZOHA 2PAVP 4IUHA 2INWA 2PDRA 2V8FA 4WUJA 1TD5A 4ZJ2A 3T4JA 1PYYA 3GSGA 1DJCA 2Z6CA 1K6SA 3QNBA 3PBNA 4HJ4A 2WAFA 5DTSA 3PAEA 1BTLA 3A3DA 1ZTUA 2VA0A 3NOTC 3S7QA 4E6WA 3HVFA 3LR3A 1K57C 2ZMAA 2JBFA 3LI8A 4P85A 3PBSA 1LLBA 2Y2PA 1PRQA 3BEBA 4R1GA 2O0YA 3KYQA 1KDWA 4CLCD 4KQOA 2DNSA 4KQDA 4BBVA 1PFLA 1Q2PA 2WKQA 2Q9MA 2JHEA 3NJAA 1FILA 5U47A 2O9CA 1XJ2A 4P87A 3NIAA 3T4SA 3QP8A 2W3FA 1CK3A 2I72A 1TS8A 4RX2A 2KX6A 5AQBA 2JKTM 3G4PA 5FL3A 4DJ2A 4WMCD 4OPZA 3VOZA 1T19A 3E4PA 4R3BA 3MZDA 3LFVA 3HLGA 1HTZA 4DE2A 4OQIA 3IS2A 3N8SA 2ZQ7A 1GHMA 2Y2HA 4PHTA 2V2FF 4Y13A 2J9OA 3ZQ5A 3IF6B 2P7JA 3QP1A 2ZL1B 2O9AA 4O8GA 2P9VB 4LGWA 4JGRA 4Y15A 4GLQA 1MWRA 5DJUA 2P08A 1G68A 1W79A 5DF9A 1O7EA 2WYXA 2L1MA 1CQAA 5L8MA 3HLDA 4QB8A 3OCNA 2E8IA 1G5UA 4UQIM 3G2ZA 3LCEA 4YOFA 5AVFA 1YLJA 1BZAA 3CUEC 4OQ0A 4KG5A 3PR6A 3TE8A 1XJ6A 3C7VA 2Y2NA 3VP0A 3L7HA 1TEMA 4L9FA 1OTDA 3N8RA 4OKPA 1TVFA 3O86A 3LR5A 5HAIA 2XDMA 5HDDA 3DW0A 5HW3A 4DE3A 4B88A 4MMNA 3BW6A 3HCYA 4JGPA 1SDEA 1ZG4A 1FQGA 1D06A 4N92A 3KSHA 1CEFA 1L0EA 4JGOA 4E3OA 2K2NA 1H0MA 1UGUA 3UMDA 3R4KA 4UAAA 1KDSA 1MWUA 3SZTA 2JKFA 3I7JA 4OPQA 3WRZA 3U4LP 4GD6A 3BQAA 1ERMA 3S7PA 5EOEA 2M7VA 2VV7A 2WK0A 5CHMA 4C3QA 2O9BA 5EVIA 4ESPA 4OPYA 1HVBA 3DWKA 4Y3IA 1IYQA 4NETA 3KX0X 2Y2MA 4JXVA 3UE0A 3MMHA 5EVIC 5GLDA 2NUTC 1DP8A 4IBRA 5TR7A 3O88A 4HP9A 4OVDA 2H5SA 1N9OA 3ISGA 5GLCA 3FPVA 5BOHA 1MZUA 4FCFA 1XKZA 2OSUA 3ZDJA 4LV3A 2QYBA 4BWIA 1IFQA 4EQIA 2XH9A 1PWCA 4NG2A 4I3AA 1OTEA 2ZL1A 4S2NC 4S2MA 3UNWA 5GLBA 4GNUA 4XUZA 1YLPA 3TG9A 3VP3A 1ES2A 1YPRA 1DJBA 3EGDC 3LGOA 5TJJA 2QZ6A 1J9MA 3CI6A 4CQHA 5HX9A 3P01A 4HEFA 5HAQA 5F68A 1S0WA 2GNXA 5KMWA 2W1TA 4I38A 4DE1A 4M4XA 3NECA 5CRFA 3MSHA 4MLLA 3GTCA 1S67L 3BRMA 3DTMA 4LCLA 3W2ZA 1MKIA 4C6YA 2JKRM 3ITAA 2VZWA 3BQ8A 3N7WA 3VE3A 3S4XA 4Y17A 5E43A 2BLSA 4LCMA 5FDSA 1BLPA 4HP4A 2FFYA 5I5LA 4UA9A 3VOLA 3T1RA 5JYPA 3GQZA 3OZHA 4YWZA 1W63M 5G18A 5GHZA 2O99A 3AGFA 3T4QA 1IKIA 3C5AA 4X25A 1EROA 1O07A 2BG1A 3G31A 4DXCA 1MWTA 4X56A 5A91A 3T4TA 1VETB 1IOUA 3NI9A 5HZHA 4LRYC 1PW1A 4Q0HA 3SW1A 1S66L 3F1NA 2ZC7A 2WADA 3HJKA 3MR0A 4JGQA 3W8KA 5JYOA 3MS6A 3NBLA 1D1JA 2V1BA 3OOVA 3G2YA 3ZG7B 5KSHA 2M1CA 3VV4A 5CXWA 5E2FA 1BSGA 1H8YA 1SKFA 1SZVA 4DF6A 2XR0A 5HWVA 2Z2MB 1DJAA 3C2WA 1P97A 5FAPA 4EUZA 3NOUC 3OPLA 5MC7A 1K6RA 1SDNA 5DF7A 4S2KA 3L9KA 5AQ7A 3EWKA 1L0FA 4DE0A 4WF0A 2PD8A 3B42A 1YLZA 3NDGA 3PBQA 3Q82A 4LRXC 5DVAA 2A24A 3IXGA 4UEYA 4IUKA 3NC8A 4H6JB 5CERA 3IXDA 3V3SA 3DTKA 4PM5A 4GHIA 1T1BA 1XA1A 4GCZA 2JCHA 2G2WA 4JXWA 4PM7A 1A0KA 2PR6A 4M3KA 2OAQ1 1N9LA 3KYEA 5DTTA 4GZBA 5CX7A 2JKRI 1XJ4A 4BBUA 2G2UA 1S6RA 3HUNA 3M6HA 3NDEA 2K31A 3CWFA 2QMIA 3PYPA 4X1MA 4Q0IA 3D72A 4ZJ1A 4HBTA 3AGDA 1S1ZA 3S7OA 3Q81A 3KSFA 1E25A 2C5WB 1T1AA 1VB6A 1FIKA 5AQ9A 4I39A 2WAEA 4EUVA 2Y8HA 1I2WA 3UO9A 2XQZA 3JVUA 4QD4A 3JVVA 1W8YA 3GVBA 1KVMA 4H8RA 1OPXA 2J3WA 1ALQA 5J3WA 4E3LA 1K4EA 2EWWA 2GJ3A 3ZGAB 3GV9A 1G6OA 1K54A 4KZ7A 4U0TA 3HLWA 4S2LA 1W5DA 2PU2A 3B3XA 4BBTA 3SH9A 2ZQCA 3A3FA 3ZCZA 4YFMA 1PIOA 3IBRA 3HLBA 2B95A 2J3TC 3LY3A 2NUPC 2HPBA 5IS1A 3OPHA 1AXBA 5FQQA 5HL6A 4LPZA 4GB7A 4N1XA 3LIEA 1OJGA 4X69A 2Y2GA 5GHXA 5M18A 1KGFA 4EQ1A 2X01A 2XFTA 3OBFA 4WELA 1TF1A 4HH3A 5EUAA 2ZQ8A 4Y2FA 3E0YA 3IT9A 4F3LA 3K3DA 1LI0A 2PYPA 1MXOA 1N4OA 3TSGA 4E3JA 3IWOA 5A92A 1F98A 3M2JA 3Q1FA 2B18A 2XK1A 5CGWA 2L4RA 4X53A 2QHKA 5AVEA 3UMEA 5GHYA 5FASA 4R6LA 4PAUA 2EWVA 2A3UA 3GRJA 3UPPA 1Y54A 4XT2B 3EGXC 3LIDA 4HOIA 1XJ3A 2E8JA 3C4OA 4WMCA 1YSPA 3CAXA 2EFUA 4QWOA 4P0MA 4D60A 3MQ0A 3RXXA 4RYEA 1TDLA 4R3AA 4ME4A 1PI5A 3PTEA 3W4PA 5HPIA 3VSLA 1SHVA 1SCWA 4KQRA 5G4YA 3NCKA 2XEPA 3P7NA 2HGVA 2XA7M 4ARZB 2OWHA 1S4RA 3BWLA 1L2SA 4XT2A 4NXFA 3IHAA 4Q8IA 1LSXA 3KSGA 1ZHHB 3VP4A 4PPRA 3IXHA 5HWTA 1PWGA 2BASA 2YKHA 4GDNA 5D3OA 4OONA 3JPUA 4MN6A 3LEQA 4ETZA 1IYSA 5AQAA 3KSIA 1PNEA 3CPTB 3N8LA 5TBMA 4DDYA 4KG2A 3M6BA 3E4OA 4P6ZS 2VK3A 4PKYG 1K38A 4A5RA 1D7EA 2J80A 3W4QA 5L10A 1RGYA 5K5BA 3RH8B 4S2JA 3WS2A 3F1PA 2KLIA 2ZQAA 3LI9A 1VQQA 3MXQA 4BD0A 2WZZA 2HV1A 1NJ4A 4L0LA 3ZNTA 3F1NB 4O01A 4Y0UA 3MZEA 5EM1A 3HREA 3VP1A 5FAOA 3BY8A 1UWNX 3V50A 1L3LA 4EV4A 2KOIA 3UB8A 3MBZA 2HF6A 1KGGA 4KZ8A 1I5QA 4CLCA 4HNBA 2Y4AA 1KGEA 2WKRA 4PKYA 3N4IA 1XP4A 2HP6A 5FEFA 2XD1A 2WGIA 1XGIA 2XD5A 5A93A 1W8QA 5F1FA 4MEZA 2PRFA 1TS0A 4GDBA 2WKHA 3MKEA 3IBJA 5DTKA 4H6JA 1LHYA 4NXBA 3ZG0A 2C6WB 5FATA 3IF6C 4EERA 2PHYA 5L07A 2I9VA 3P98A 2XFSA 5EECA 1OT9A 4G3WA 3NHQA 2IA2A 5HL1A 1KOUA 2WGWA 3IH8A 1ONGA 3IF6A 1WYCA 1BUEA 5FI6A 4MBKA 3T1QB 1S1YA 3OPPA 2ZD8A 5F1GA 4MN5A 5CGXA 2GX5A 3EQUA 2IWBA 1AWIA 4DDSA 3ZG8B 5L2FA 3E2LA 2Y2JA 1H8MA 3UPOA 3CUEA 1YSQA 3OCLA 4K08A 2VEAA 4Y5FA 3MFDA 5EE8A 2Y91A 3WS5A 4OQHA 3CG5A 2H0TA 3ZVWA 4PM6A 1NWZA 1FOFA 3D3OA 1GHPA 2HZ5A 1TS7A 2ZJ9A 3WS4A 4G3VA 3EEAA 3JYIA 4NXGA 3BJNA 4DMZA 2EX6A 2WKEA 4UA7A 5HPFA 3HUOA 2ZM8A 1M40A 4QPRA 4GD8A 3C8CA 5LBRA 3CHWP 3TW8A 4EW7A 3C4PA 4WN5A 1IEMA 1LL5A 4E3KA 1ES3A 1K25A 4WZ5C 4ETXA 2PYRA 4IEDA 3NY4A 1XFQA 2GDNA 1DP6A 2EX2A 3C38A 3MKFA 2HP9A 3LO7A 2ZM0A 4OLGA 5EVLA 3LIBA 1LI9A 2OAP1 1RCJA 5A8BA 4R70A 1T1CA 3EEHA 4CPKA 1OTIA 2M7UA 4EBLA 3D9YA 2J9PA 4KZBA 4WL9A 5FEGA 1HLUP 2W27A 4QHCA 3BYDA 3SS5A 2HDUA 5E2HA 4IBXA 1F2KA 1FSWA 3H7WB 1E3UD 4BD1A 2V9AA 4FSFA 4L9GA 3RJUA 4U0XA 5FI2A 4JF4A 5M1AA 4QY6A 1BULA 1K56D 5DFYA 4QY5A 1XPBA 2WGVA 1NZOA 3IX8A 4YNRA 1WA9A 1PWDA 1FR1A 1N9NA 1BLSA 1PW8A 2OV5A 2V1AA 2J3TD 2VLGA 4S2OA 2JE5A 4LFUA 3H9WA 1GSXA 1W63Q 2K7SA 1K0KA 4E6XA 4JBFA 2EXAA 3VE4A 1ODVA 4X68A 4N1HA 2UWXA 4S2IA 4K0WA 4XUXA 4OPRA 4NXEA 3LUQA 4GN2A 2HJ9C 4OLDA 3T4OA 2B02A 4PM8A 2RL3A 3OLOA 5HARA 2Y2IA 1ZKJA 2Y2KA 1GA9A 5KIZA 2VGLM 1CF0A 2V0UA 2G7UA 1KE4A 5J8XA 2XRNA 3UDXA 1P9RA 2D02A 3A0VA 1IELA 5EV0A 5M19A 1WE4A 3T1XA 4CLCC 3BECA 4R23A 3LR4A 1OJ5A 4FH4A 1M6KA 3BFGA 5F5YA 2ZM2A 3G35A 4FOFA 3UY6A 1T18A 3Q07A 3A3EA 3VFHA 3H82B 5FDHA 3G32A 2ACGA 5DF8A 1LL8A 5J7EA 1OTAA 1BLCA 4FUWA 4Z9QA 5TGFA 3ZYTA 3MFXA 2EFXA 3QHYA 5F6AA 3CJMA 3UDIA 4BL3A 3CZDA 4OOLA 1Y4OA 3HL9A 4K91A 4RVAA 1FR6A 1LT0A 5FQJA 3Q7VA 3Q7VB 4FH2A 5IU1A 2GZAA 5FQMA 3UB7A 3BFFA 4HQAA 3B33A 4X55A 2J8YA 1FCMA 3VOYA 2V20A 4RX3A 4ZDXA 4MDZA 2ZQ9A 4IJGA 3IX4A 1ACFA 5FAQA 4ZBEA 3UDFA 1MWSA 5F82A 2CC1A 5E2EA 1YQSA 3R7WA 3QNCA 1MPLA 4WZ4A 4HBUA 1MY8A 3GR2A 1ONHA 3DAVA 2Y55A 3ULFA 4XXRA 4I3IA 1L0GA 2EX9A 1TDGA 4JF5A 4GKUA 2MJ6A 5HD3A 5TBMB 4AFIA 5CHJA 4BJPA 4EXOA 2DRWA 3OC2A 3PBTA 5DKKA 4CLCE 2EX8A 1RP5A 2Z6DA 1BYWA 4EESA 2UV0E 2PBYA 3DTEA 5HDCA 4ZTKA 2XGNA 2A49A 1CI9A 4HIAA 3CMZA 2VV6A 1KE0A 3SH7A 5J4EA 3AGEA 3T50A 3V67A 3MJQA 4UQIS 4KZ9A 2KDKA 1KVLA 1YMXA 4DJ3A 4R3JA 3BY9A 4B93A 5IHVA 3IF5A 4HHDA 4OQGA 3UB5P 1XFNA 3F1PB 3QP4A 1NXYA 4D2OA 3FPWA 3FC7A 2W3DA 4IVKA 2QPNA 4GS9B 2WKPA 1E4DA 4DRTA 4WEJA 4ZRRA 1DRMA 1XX2A 1BLHA 2QJ7A 5A90A 4BENA 1YT4A 2YKFA 1VEUB 2HP5A 4G3KA 2Q9NA 3V3RA 3IXBA 3DTIA 1DP9A 3A0RA 4LV2A 3V39A 3BM6A 5DFXA 1S4SA 2ZBBA 2RCXA 4C75A 3HBRA 5FQ9A 4EEPA 1JTGA 3G34A 4KZ4A 5CHUA 3O3VA 1GCEA 1NLZA 3NOPC 4KZ3A 3BLMA 3PAGA 4OP8A 2Y2OA 3BFEA 5G4ZA 3S7NA 5KZHA 4FD8A 1ERQA 4JF6A 4BLMA 3IH9A 4LENA 1YLWA 4DKIA 1GA0A 2VGLS 4HESA 4PM9A 4RQ9A 4EETB 2XF3A 2PR5A 4CJNA 2R9WA 4QU3A 4E3IA 2H28A 3KO6A 2A24B 3CITA 3VP2A 2PT7A 1ESIA 1XGJA 1YLYA 3FKWA 1CEGA 4FTXA 3H82A 3M2KA 5KSCA 3ZG9B 1NYMA 3HLCA 5EOOA 1I2SA 3IQAA 1CJFA 4KUOA 2X02A 1GSVA 4RA7A 1JWVA 1XA7A 1SKOA 3WRTA 2VJWA 1G28A 2ZMVA 3NULA 5C5KA 3E98A 1H5XA 3RXWA 2HDSA 1XXMA 4Q0JA 4KENB 2HDQA 2JKTI 5L09A 2QWSA 1EI5A 1ESUA 5GL9A 1OTBA 1LL9A 5E2GA 5IT5A 3A3IA 1JVJA 1N9BA 4WLAA 2W3GA 3E2KA 1ES5A 1Y28A 1F5MA 5EPHA 1PZOA 3G30A 3SS4A 3PXPA 3T4KA 1YMSA 1W7FA 5FQKA 2JC7A 4HH2A 3HLEA 1EWZA 1BT5A 1V9YA 3UN7A 3BFDA 1DY6A 3CLOA 4O7DA 4DXBA 1GHIA 3A3JA 3UE6A 3EQVA 4MBHA 1JTDA 2QJ5A 2PD7A 5FQIA 4ZJ3A 3RTYA 2W1TB 1K55C 5GLAA 5TFQA 1PI4A 2Y59A 3IX3A 4N9KA 1YKDA 4B4ZA 3LY4A 3ZVTA 2VV8A 2ZC6B 2DMWA 4N9LA 3MF0A 4WM9A 5HD5A 4OP5A 2ZMFA 4IVIA 2Q0OA 1VM1A 2LB9A 3LR0A 4LV1A 1WYBA 1MKMA 4ID4A 2EA9A 1F9IA 4GW9A 3D4FA 4ARZA 1E3UA 4I5SA 3UB9A 4NEED 5EVEA 2FH5A 2W1RA 1K4FA 3UB6A 5CEBA 4JXGA 3LIAA 3K3CA 4R38A 3FWLA 5I94A 1VHMA 1MC0A 4EWFA 1VEUA 1YM1A 4B9OA 4MBFA 4F94A 2WUQA 1OMEA 4LV0A 1IYPA 2H0YA 4NK3A 2CMNA 5FSRA 3MXRA 3S22A 4CLCB 2ZC4B 4HJ6A 4GHIB 5HFOA 3SOIA 3T4LA 4R4RA 3HUMA 3G6OA 4E3NA 1V9ZA 1FCNA 2FZ0A 2WKIA 2XLNA 4OOMA 5EFWA 3LICA 5CTNA 3RFBA 3V5MA 1H3QA 4NKPA 1FSYA 1Z6FA 2VGKA 1NY0A 3TRCA 3MQQA 5EM0A 4X1LA 2V0WA 3TJZC 2QKPA 5CTMA 4PMAA 4KZAA 2P74A 4R0QA 2AVXA 3GECA 4MNRA 1PZPA 2EXBA 3LYXA 2ZC5B 4KG6A 2FFFB 2J7VA 2P04A 4Y0OA 4KUKA 2OLUA 4BMWA 3GDIA 2W3EA 1K56A 1L0DA 4HY8A 4UHUA 1X0OA 4WYYA 3DWZA 1Q2QA 2ZLYA 2PBDP 3W4OA 5DJTA 4OH0A 3Q7ZA 2ZC3B 2R9XA 3OPRA 4JLFA 3WS0A 3MXSA 4KZ6A 4GS9A 2VX8A 5HSQA 4F3LB 2WGWB 4GJ4A 2V1ZA 4KZ5A 3E4QA 4MCWA
chains in the Genus database with same CATH topology
3R7WA 4ETZA 3KX0X 3H7WA 4LRZE 3ULFA 4I3IA 3PHYA 3C30A 3MMHA 3F1OB 2NUTC 1DP8A 2MJ6A 3KSIA 5HD3A 5TBMB 4E04A 5TBMA 4AFIA 4WEKA 3O5YA 4HP9A 4BJPA 4EXOA 3E4OA 4P6ZS 5DKLA 1N9OA 3A0SA 4PKYG 3PBTA 3OC2A 1D7EA 5DKKA 4CLCE 2J80A 3FPVA 1MZUA 2Z6DA 2QYBA 4BWIA 5K5BA 1IFQA 1BYWA 2LB5A 4EESA 3RH8B 3F1PA 2KLIA 3LI9A 3MXQA 5HDCA 4L9EA 4I3AA 1OTEA 2HV1A 4L0LA 1LSVA 3F1NB 4O01A 4HI4A 4HIAA 2VV6A 3EGDC 5TJJA 3DBAA 1P9WA 3CI6A 1JNUA 4CQHA 3BY8A 1UWNX 5J4EA 3T50A 3V67A 2KOIA 3UB8A 3P01A 3MJQA 5F68A 2ZOIA 2HF6A 4UQIS 2W3HA 2XSSA 1EW0A 2GNXA 2OOLA 3MQOA 2KDKA 4CLCA 3PBOA 2W1TA 4HNBA 4DJ3A 2XA7S 3BY9A 4I38A 4B93A 2WKRA 4M4XA 4PKYA 4HHDA 3FG8A 1XFNA 4DN0A 1OT6A 3F1PB 4EEUA 3FPWA 3FC7A 2W3DA 4LLOB 1S67L 4GS9B 2WKPA 2HJEA 4WEJA 4ZRRA 1DRMA 3W2ZA 2JKRM 2VZWA 3BQ8A 3VE3A 2QJ7A 1TS0A 2YKFA 4G3KA 2A2LA 1P0ZA 5HWWA 1DP9A 1NRJA 3A0RA 4HP4A 2VKSA 5I5LA 5HDSA 3IBJA 4IHQA 4H6JA 4NXBA 5DFXA 3VOLA 1S4SA 2ZBBA 1YAXA 4YWZA 4EERA 1W63M 4EEPA 2PHYA 2O99A 2I9VA 3T4QA 1NLZA 4EU0A 3EOIA 1TS6A 3NOPC 4P6ZM 1OT9A 4G3WA 3KYZA 2OWJA 3NHQA 5G4ZA 3S7NA 2IA2A 1KOUA 3T4TA 1IOUA 3R7WB 5HZHA 4HJ3A 4LRYC 2VGLS 1LSWA 1S1YA 4Q0HA 3SW1A 1S66L 4RQ9A 3F1NA 4EETB 4MN5A 2PR5A 2D01A 3HJKA 3MR0A 3IS2B 2GX5A 3EQUA 4JGQA 2H28A 3KO6A 2A24B 2V1BA 3CITA 1H8MA 3OOVA 2PT7A 3CUEA 1YSQA 1STZA 3OCLA 5F69A 5KSHA 4K08A 2VEAA 3ICYA 2M1CA 4Y5FA 3VV4A 3PBRA 3H82A 1NWZA 3D3OA 3LIFA 4Y3IA 5HWVA 3C2WA 1P97A 2JN7A 1TS7A 4G3VA 4KUOA 3EEAA 3NOUC 4I3JA 4NXGA 3BJNA 4DMZA 5MC7A 2L0WA 2W0NA 1GSVA 3EWKA 5HPFA 3UE3A 4WF0A 2PD8A 3B42A 2VJWA 1G28A 2ZMVA 3PBQA 5C5KA 2XROA 4LRXC 2A24A 3E98A 1UWPX 1GSWA 4QPRA 4Q0JA 4O0PA 5AJGA 4UEYA 1NLYA 4IUKA 2Y79A 4II7A 3B47A 3C8CA 5LBRA 3TW8A 2JKTI 4EW7A 2QWSA 4H6JB 4GHIA 1OTBA 1T1BA 4GCZA 5IT5A 3K2NA 4WN5A 3F1OA 4MN7A 2PR6A 4WLAA 2OAQ1 2W3GA 1N9LA 2R78A 5CX7A 2JKRI 4ETXA 1XJ4A 1Y28A 4BBUA 2PYRA 1F5MA 4Z1WA 1XFQA 3HJIA 1DP6A 3U2AA 3C38A 2ZOHA 4IUHA 2INWA 2PDRA 3PXPA 4WUJA 1TD5A 3T4KA 2K31A 3T4JA 3CWFA 3PYPA 4HH2A 4Q0IA 3LIBA 3D72A 1S1ZA 3S7OA 2Z6CA 3KSFA 2OAP1 5A8BA 3PBNA 1T1CA 4HJ4A 4R70A 3EEHA 1T1AA 1V9YA 1VB6A 1ZTUA 2VA0A 3NOTC 1OTIA 2M7UA 3S7QA 4I39A 4WL9A 4EUVA 3LR3A 2Y8HA 2W27A 3CLOA 3LI8A 3PBSA 3JVUA 3UE6A 3EQVA 2O0YA 2QJ5A 3JVVA 3KYQA 2PD7A 4CLCD 3H7WB 4KQOA 1OPXA 2V9AA 4FSFA 2J3WA 4L9GA 3RTYA 2W1TB 4KQDA 5J3WA 5DFYA 4BBVA 2WKQA 2EWWA 2GJ3A 2JHEA 1WA9A 4YNRA 1G6OA 1N9NA 1YKDA 3NJAA 2V1AA 2J3TD 2VLGA 2O9CA 4BBTA 1XJ2A 3T4SA 2W3FA 3H9WA 1GSXA 2VV8A 3IBRA 2DMWA 1TS8A 1W63Q 2K7SA 3MF0A 2KX6A 5HD5A 2JKTM 2J3TC 2NUPC 2ZMFA 2LB9A 5FL3A 4DJ2A 3LR0A 5IS1A 1MKMA 2EA9A 1F9IA 4GW9A 4ARZA 1T19A 3VE4A 5HL6A 1ODVA 3E4PA 4LPZA 4I5SA 3UB9A 3LFVA 4NEED 2FH5A 3LIEA 4NXEA 2W1RA 1OJGA 3LUQA 2HJ9C 3UB6A 3LIAA 3T4OA 2B02A 4EQ1A 3K3CA 4R38A 3OLOA 3OBFA 3IS2A 4WELA 1TF1A 4HH3A 1VHMA 1MC0A 4Y2FA 3E0YA 4B9OA 4F3LA 3K3DA 4PHTA 5KIZA 2PYPA 2VGLM 2CMNA 2V0UA 2G7UA 3ZQ5A 2XRNA 2P7JA 4CLCB 1P9RA 4HJ6A 1F98A 2D02A 4GHIB 2O9AA 4O8GA 3A0VA 3T4LA 3G6OA 2B18A 4JGRA 1V9ZA 2FZ0A 2L4RA 4GLQA 2QHKA 4OOMA 5DJUA 5EFWA 3LICA 3RFBA 2P08A 4CLCC 5AVEA 3UMEA 3LR4A 1OJ5A 5DF9A 1H3QA 4R6LA 2L1MA 4NKPA 2EWVA 4PAUA 5F5YA 5L8MA 4FOFA 3OCNA 1T18A 3TRCA 4UQIM 3MQQA 4XT2B 3EGXC 3LIDA 4YOFA 5AVFA 3H82B 1XJ3A 4HOIA 2V0WA 3TJZC 2QKPA 1LL8A 5J7EA 3CUEC 1YSPA 1OTAA 3PR6A 3TE8A 1XJ6A 3CAXA 4L9FA 3GECA 3ZYTA 3MFXA 1OTDA 5F6AA 3LR5A 3MQ0A 3LYXA 4R3AA 5HDDA 4ME4A 2P04A 5HPIA 4OOLA 4KUKA 5G4YA 3P7NA 1LT0A 2HGVA 3GDIA 4MMNA 4BMWA 2W3EA 3BW6A 3HCYA 4JGPA 2XA7M 4HY8A 5IU1A 1D06A 2GZAA 1X0OA 2OWHA 3UB7A 4ARZB 3KSHA 4HQAA 3B33A 4JGOA 1S4RA 3BWLA 2K2NA 1UGUA 5DJTA 3UMDA 3R4KA 4XT2A 4NXFA 1LSXA 4MDZA 3KSGA 4IJGA 3BQAA 1ZHHB 3S7PA 2M7VA 2VV7A 5HWTA 4GS9A 2BASA 2O9BA 2VX8A 5HSQA 4F3LB 2YKHA 4GJ4A 4MN6A 3E4QA 4MCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FZ0 A; 
#chains in the Genus database with same CATH topology
 3H7W A;  1MBL A;  4LRZ E;  4WBG A;  3PHY A;  3C30 A;  3F1O B;  1KE3 A;  4QJG A;  4E04 A;  3O87 A;  3MZF A;  4WEK A;  1YLT A;  3O5Y A;  5FA7 A;  1SKO B;  5DKL A;  3A0S A;  1H8Z A;  1K57 A;  1RGZ A;  2LB5 A;  2IWD A;  4GOG A;  3T12 B;  3ITB A;  4L9E A;  3UE1 A;  2H10 A;  1NYY A;  1LSV A;  4HI4 A;  3SS3 A;  1NZU A;  3VFF A;  4JPM A;  4ZAM A;  3DBA A;  1P9W A;  3IWQ A;  5FI7 A;  1JNU A;  4K0X A;  4Y7P A;  1JWZ A;  4E3M A;  4S2P A;  3BLS A;  3WS1 A;  3BFC A;  2ZOI A;  2W3H A;  2XSS A;  1EW0 A;  2OOL A;  3MQO A;  1QMF A;  1ZG6 A;  3UPN A;  3PBO A;  2XA7 S;  3FZC A;  3SH8 A;  1U60 A;  1CI8 A;  1HD8 A;  2ZQD A;  3FG8 A;  4DN0 A;  3IHB A;  1OT6 A;  4EEU A;  4UA6 A;  1JWP A;  3S1Y A;  4Y0T A;  4LLO B;  4YIN A;  3T1S A;  1G6A A;  2WZX A;  2HJE A;  4JKT A;  1ES4 A;  2OLV A;  1NRF A;  4S2N A;  3QP6 A;  3FV7 A;  2A2L A;  5CEC A;  3IWI A;  1C3B A;  3ZNY A;  3FKV A;  1P0Z A;  3ZFZ A;  2IWC A;  5HWW A;  5CGS A;  1NRJ A;  5CED A;  2VKS A;  4EBN A;  5HDS A;  4IHQ A;  4WZ5 A;  2Y2Q A;  3WWX A;  1YAX A;  1IKG A;  3HLF A;  4JXS A;  4EU0 A;  3EOI A;  1TS6 A;  4P6Z M;  3QP2 A;  3TOI A;  4BL2 A;  3KYZ A;  2OWJ A;  4U3T A;  1VET A;  5F83 A;  3R7W B;  5HAP A;  4HJ3 A;  4OOY A;  3C7U A;  1LSW A;  1Z09 A;  2B5R A;  1ZC2 A;  2BTF P;  2D01 A;  3IS2 B;  5EVI D;  3QP5 A;  4B4X A;  1STZ A;  5F69 A;  3P09 A;  3ICY A;  2JKG A;  4R4S A;  3PBR A;  1IYO A;  2Z2L B;  3LIF A;  2P9V A;  4X6T A;  2JN7 A;  3N6I A;  3ZHH A;  1FCO A;  4P6B A;  4I3J A;  2Y2L A;  4BQM A;  4EBP A;  2PU4 A;  3VMA A;  2L0W A;  2W0N A;  3VSK A;  3UE3 A;  1HZO A;  1K55 A;  2X71 A;  3LEZ A;  2XRO A;  3FYZ A;  2V8C A;  1UWP X;  1GSW A;  4O0P A;  5AJG A;  1NLY A;  4KQQ A;  2Y79 A;  4II7 A;  3B47 A;  2VGJ A;  3ZG5 A;  1QME A;  3K2N A;  3GMW A;  3F1O A;  4MN7 A;  1J3W A;  2HDR A;  2R78 A;  3CPT A;  5EVI B;  2DCF A;  4Z1W A;  3HJI A;  1K54 C;  3U2A A;  2ZOH A;  2PAV P;  4IUH A;  2INW A;  2PDR A;  2V8F A;  4WUJ A;  1TD5 A;  4ZJ2 A;  3T4J A;  1PYY A;  3GSG A;  1DJC A;  2Z6C A;  1K6S A;  3QNB A;  3PBN A;  4HJ4 A;  2WAF A;  5DTS A;  3PAE A;  1BTL A;  3A3D A;  1ZTU A;  2VA0 A;  3NOT C;  3S7Q A;  4E6W A;  3HVF A;  3LR3 A;  1K57 C;  2ZMA A;  2JBF A;  3LI8 A;  4P85 A;  3PBS A;  1LLB A;  2Y2P A;  1PRQ A;  3BEB A;  4R1G A;  2O0Y A;  3KYQ A;  1KDW A;  4CLC D;  4KQO A;  2DNS A;  4KQD A;  4BBV A;  1PFL A;  1Q2P A;  2WKQ A;  2Q9M A;  2JHE A;  3NJA A;  1FIL A;  5U47 A;  2O9C A;  1XJ2 A;  4P87 A;  3NIA A;  3T4S A;  3QP8 A;  2W3F A;  1CK3 A;  2I72 A;  1TS8 A;  4RX2 A;  2KX6 A;  5AQB A;  2JKT M;  3G4P A;  5FL3 A;  4DJ2 A;  4WMC D;  4OPZ A;  3VOZ A;  1T19 A;  3E4P A;  4R3B A;  3MZD A;  3LFV A;  3HLG A;  1HTZ A;  4DE2 A;  4OQI A;  3IS2 A;  3N8S A;  2ZQ7 A;  1GHM A;  2Y2H A;  4PHT A;  2V2F F;  4Y13 A;  2J9O A;  3ZQ5 A;  3IF6 B;  2P7J A;  3QP1 A;  2ZL1 B;  2O9A A;  4O8G A;  2P9V B;  4LGW A;  4JGR A;  4Y15 A;  4GLQ A;  1MWR A;  5DJU A;  2P08 A;  1G68 A;  1W79 A;  5DF9 A;  1O7E A;  2WYX A;  2L1M A;  1CQA A;  5L8M A;  3HLD A;  4QB8 A;  3OCN A;  2E8I A;  1G5U A;  4UQI M;  3G2Z A;  3LCE A;  4YOF A;  5AVF A;  1YLJ A;  1BZA A;  3CUE C;  4OQ0 A;  4KG5 A;  3PR6 A;  3TE8 A;  1XJ6 A;  3C7V A;  2Y2N A;  3VP0 A;  3L7H A;  1TEM A;  4L9F A;  1OTD A;  3N8R A;  4OKP A;  1TVF A;  3O86 A;  3LR5 A;  5HAI A;  2XDM A;  5HDD A;  3DW0 A;  5HW3 A;  4DE3 A;  4B88 A;  4MMN A;  3BW6 A;  3HCY A;  4JGP A;  1SDE A;  1ZG4 A;  1FQG A;  1D06 A;  4N92 A;  3KSH A;  1CEF A;  1L0E A;  4JGO A;  4E3O A;  2K2N A;  1H0M A;  1UGU A;  3UMD A;  3R4K A;  4UAA A;  1KDS A;  1MWU A;  3SZT A;  2JKF A;  3I7J A;  4OPQ A;  3WRZ A;  3U4L P;  4GD6 A;  3BQA A;  1ERM A;  3S7P A;  5EOE A;  2M7V A;  2VV7 A;  2WK0 A;  5CHM A;  4C3Q A;  2O9B A;  5EVI A;  4ESP A;  4OPY A;  1HVB A;  3DWK A;  4Y3I A;  1IYQ A;  4NET A;  3KX0 X;  2Y2M A;  4JXV A;  3UE0 A;  3MMH A;  5EVI C;  5GLD A;  2NUT C;  1DP8 A;  4IBR A;  5TR7 A;  3O88 A;  4HP9 A;  4OVD A;  2H5S A;  1N9O A;  3ISG A;  5GLC A;  3FPV A;  5BOH A;  1MZU A;  4FCF A;  1XKZ A;  2OSU A;  3ZDJ A;  4LV3 A;  2QYB A;  4BWI A;  1IFQ A;  4EQI A;  2XH9 A;  1PWC A;  4NG2 A;  4I3A A;  1OTE A;  2ZL1 A;  4S2N C;  4S2M A;  3UNW A;  5GLB A;  4GNU A;  4XUZ A;  1YLP A;  3TG9 A;  3VP3 A;  1ES2 A;  1YPR A;  1DJB A;  3EGD C;  3LGO A;  5TJJ A;  2QZ6 A;  1J9M A;  3CI6 A;  4CQH A;  5HX9 A;  3P01 A;  4HEF A;  5HAQ A;  5F68 A;  1S0W A;  2GNX A;  5KMW A;  2W1T A;  4I38 A;  4DE1 A;  4M4X A;  3NEC A;  5CRF A;  3MSH A;  4MLL A;  3GTC A;  1S67 L;  3BRM A;  3DTM A;  4LCL A;  3W2Z A;  1MKI A;  4C6Y A;  2JKR M;  3ITA A;  2VZW A;  3BQ8 A;  3N7W A;  3VE3 A;  3S4X A;  4Y17 A;  5E43 A;  2BLS A;  4LCM A;  5FDS A;  1BLP A;  4HP4 A;  2FFY A;  5I5L A;  4UA9 A;  3VOL A;  3T1R A;  5JYP A;  3GQZ A;  3OZH A;  4YWZ A;  1W63 M;  5G18 A;  5GHZ A;  2O99 A;  3AGF A;  3T4Q A;  1IKI A;  3C5A A;  4X25 A;  1ERO A;  1O07 A;  2BG1 A;  3G31 A;  4DXC A;  1MWT A;  4X56 A;  5A91 A;  3T4T A;  1VET B;  1IOU A;  3NI9 A;  5HZH A;  4LRY C;  1PW1 A;  4Q0H A;  3SW1 A;  1S66 L;  3F1N A;  2ZC7 A;  2WAD A;  3HJK A;  3MR0 A;  4JGQ A;  3W8K A;  5JYO A;  3MS6 A;  3NBL A;  1D1J A;  2V1B A;  3OOV A;  3G2Y A;  3ZG7 B;  5KSH A;  2M1C A;  3VV4 A;  5CXW A;  5E2F A;  1BSG A;  1H8Y A;  1SKF A;  1SZV A;  4DF6 A;  2XR0 A;  5HWV A;  2Z2M B;  1DJA A;  3C2W A;  1P97 A;  5FAP A;  4EUZ A;  3NOU C;  3OPL A;  5MC7 A;  1K6R A;  1SDN A;  5DF7 A;  4S2K A;  3L9K A;  5AQ7 A;  3EWK A;  1L0F A;  4DE0 A;  4WF0 A;  2PD8 A;  3B42 A;  1YLZ A;  3NDG A;  3PBQ A;  3Q82 A;  4LRX C;  5DVA A;  2A24 A;  3IXG A;  4UEY A;  4IUK A;  3NC8 A;  4H6J B;  5CER A;  3IXD A;  3V3S A;  3DTK A;  4PM5 A;  4GHI A;  1T1B A;  1XA1 A;  4GCZ A;  2JCH A;  2G2W A;  4JXW A;  4PM7 A;  1A0K A;  2PR6 A;  4M3K A;  2OAQ 1;  1N9L A;  3KYE A;  5DTT A;  4GZB A;  5CX7 A;  2JKR I;  1XJ4 A;  4BBU A;  2G2U A;  1S6R A;  3HUN A;  3M6H A;  3NDE A;  2K31 A;  3CWF A;  2QMI A;  3PYP A;  4X1M A;  4Q0I A;  3D72 A;  4ZJ1 A;  4HBT A;  3AGD A;  1S1Z A;  3S7O A;  3Q81 A;  3KSF A;  1E25 A;  2C5W B;  1T1A A;  1VB6 A;  1FIK A;  5AQ9 A;  4I39 A;  2WAE A;  4EUV A;  2Y8H A;  1I2W A;  3UO9 A;  2XQZ A;  3JVU A;  4QD4 A;  3JVV A;  1W8Y A;  3GVB A;  1KVM A;  4H8R A;  1OPX A;  2J3W A;  1ALQ A;  5J3W A;  4E3L A;  1K4E A;  2EWW A;  2GJ3 A;  3ZGA B;  3GV9 A;  1G6O A;  1K54 A;  4KZ7 A;  4U0T A;  3HLW A;  4S2L A;  1W5D A;  2PU2 A;  3B3X A;  4BBT A;  3SH9 A;  2ZQC A;  3A3F A;  3ZCZ A;  4YFM A;  1PIO A;  3IBR A;  3HLB A;  2B95 A;  2J3T C;  3LY3 A;  2NUP C;  2HPB A;  5IS1 A;  3OPH A;  1AXB A;  5FQQ A;  5HL6 A;  4LPZ A;  4GB7 A;  4N1X A;  3LIE A;  1OJG A;  4X69 A;  2Y2G A;  5GHX A;  5M18 A;  1KGF A;  4EQ1 A;  2X01 A;  2XFT A;  3OBF A;  4WEL A;  1TF1 A;  4HH3 A;  5EUA A;  2ZQ8 A;  4Y2F A;  3E0Y A;  3IT9 A;  4F3L A;  3K3D A;  1LI0 A;  2PYP A;  1MXO A;  1N4O A;  3TSG A;  4E3J A;  3IWO A;  5A92 A;  1F98 A;  3M2J A;  3Q1F A;  2B18 A;  2XK1 A;  5CGW A;  2L4R A;  4X53 A;  2QHK A;  5AVE A;  3UME A;  5GHY A;  5FAS A;  4R6L A;  4PAU A;  2EWV A;  2A3U A;  3GRJ A;  3UPP A;  1Y54 A;  4XT2 B;  3EGX C;  3LID A;  4HOI A;  1XJ3 A;  2E8J A;  3C4O A;  4WMC A;  1YSP A;  3CAX A;  2EFU A;  4QWO A;  4P0M A;  4D60 A;  3MQ0 A;  3RXX A;  4RYE A;  1TDL A;  4R3A A;  4ME4 A;  1PI5 A;  3PTE A;  3W4P A;  5HPI A;  3VSL A;  1SHV A;  1SCW A;  4KQR A;  5G4Y A;  3NCK A;  2XEP A;  3P7N A;  2HGV A;  2XA7 M;  4ARZ B;  2OWH A;  1S4R A;  3BWL A;  1L2S A;  4XT2 A;  4NXF A;  3IHA A;  4Q8I A;  1LSX A;  3KSG A;  1ZHH B;  3VP4 A;  4PPR A;  3IXH A;  5HWT A;  1PWG A;  2BAS A;  2YKH A;  4GDN A;  5D3O A;  4OON A;  3JPU A;  4MN6 A;  3LEQ A;  4ETZ A;  1IYS A;  5AQA A;  3KSI A;  1PNE A;  3CPT B;  3N8L A;  5TBM A;  4DDY A;  4KG2 A;  3M6B A;  3E4O A;  4P6Z S;  2VK3 A;  4PKY G;  1K38 A;  4A5R A;  1D7E A;  2J80 A;  3W4Q A;  5L10 A;  1RGY A;  5K5B A;  3RH8 B;  4S2J A;  3WS2 A;  3F1P A;  2KLI A;  2ZQA A;  3LI9 A;  1VQQ A;  3MXQ A;  4BD0 A;  2WZZ A;  2HV1 A;  1NJ4 A;  4L0L A;  3ZNT A;  3F1N B;  4O01 A;  4Y0U A;  3MZE A;  5EM1 A;  3HRE A;  3VP1 A;  5FAO A;  3BY8 A;  1UWN X;  3V50 A;  1L3L A;  4EV4 A;  2KOI A;  3UB8 A;  3MBZ A;  2HF6 A;  1KGG A;  4KZ8 A;  1I5Q A;  4CLC A;  4HNB A;  2Y4A A;  1KGE A;  2WKR A;  4PKY A;  3N4I A;  1XP4 A;  2HP6 A;  5FEF A;  2XD1 A;  2WGI A;  1XGI A;  2XD5 A;  5A93 A;  1W8Q A;  5F1F A;  4MEZ A;  2PRF A;  1TS0 A;  4GDB A;  2WKH A;  3MKE A;  3IBJ A;  5DTK A;  4H6J A;  1LHY A;  4NXB A;  3ZG0 A;  2C6W B;  5FAT A;  3IF6 C;  4EER A;  2PHY A;  5L07 A;  2I9V A;  3P98 A;  2XFS A;  5EEC A;  1OT9 A;  4G3W A;  3NHQ A;  2IA2 A;  5HL1 A;  1KOU A;  2WGW A;  3IH8 A;  1ONG A;  3IF6 A;  1WYC A;  1BUE A;  5FI6 A;  4MBK A;  3T1Q B;  1S1Y A;  3OPP A;  2ZD8 A;  5F1G A;  4MN5 A;  5CGX A;  2GX5 A;  3EQU A;  2IWB A;  1AWI A;  4DDS A;  3ZG8 B;  5L2F A;  3E2L A;  2Y2J A;  1H8M A;  3UPO A;  3CUE A;  1YSQ A;  3OCL A;  4K08 A;  2VEA A;  4Y5F A;  3MFD A;  5EE8 A;  2Y91 A;  3WS5 A;  4OQH A;  3CG5 A;  2H0T A;  3ZVW A;  4PM6 A;  1NWZ A;  1FOF A;  3D3O A;  1GHP A;  2HZ5 A;  1TS7 A;  2ZJ9 A;  3WS4 A;  4G3V A;  3EEA A;  3JYI A;  4NXG A;  3BJN A;  4DMZ A;  2EX6 A;  2WKE A;  4UA7 A;  5HPF A;  3HUO A;  2ZM8 A;  1M40 A;  4QPR A;  4GD8 A;  3C8C A;  5LBR A;  3CHW P;  3TW8 A;  4EW7 A;  3C4P A;  4WN5 A;  1IEM A;  1LL5 A;  4E3K A;  1ES3 A;  1K25 A;  4WZ5 C;  4ETX A;  2PYR A;  4IED A;  3NY4 A;  1XFQ A;  2GDN A;  1DP6 A;  2EX2 A;  3C38 A;  3MKF A;  2HP9 A;  3LO7 A;  2ZM0 A;  4OLG A;  5EVL A;  3LIB A;  1LI9 A;  2OAP 1;  1RCJ A;  5A8B A;  4R70 A;  1T1C A;  3EEH A;  4CPK A;  1OTI A;  2M7U A;  4EBL A;  3D9Y A;  2J9P A;  4KZB A;  4WL9 A;  5FEG A;  1HLU P;  2W27 A;  4QHC A;  3BYD A;  3SS5 A;  2HDU A;  5E2H A;  4IBX A;  1F2K A;  1FSW A;  3H7W B;  1E3U D;  4BD1 A;  2V9A A;  4FSF A;  4L9G A;  3RJU A;  4U0X A;  5FI2 A;  4JF4 A;  5M1A A;  4QY6 A;  1BUL A;  1K56 D;  5DFY A;  4QY5 A;  1XPB A;  2WGV A;  1NZO A;  3IX8 A;  4YNR A;  1WA9 A;  1PWD A;  1FR1 A;  1N9N A;  1BLS A;  1PW8 A;  2OV5 A;  2V1A A;  2J3T D;  2VLG A;  4S2O A;  2JE5 A;  4LFU A;  3H9W A;  1GSX A;  1W63 Q;  2K7S A;  1K0K A;  4E6X A;  4JBF A;  2EXA A;  3VE4 A;  1ODV A;  4X68 A;  4N1H A;  2UWX A;  4S2I A;  4K0W A;  4XUX A;  4OPR A;  4NXE A;  3LUQ A;  4GN2 A;  2HJ9 C;  4OLD A;  3T4O A;  2B02 A;  4PM8 A;  2RL3 A;  3OLO A;  5HAR A;  2Y2I A;  1ZKJ A;  2Y2K A;  1GA9 A;  5KIZ A;  2VGL M;  1CF0 A;  2V0U A;  2G7U A;  1KE4 A;  5J8X A;  2XRN A;  3UDX A;  1P9R A;  2D02 A;  3A0V A;  1IEL A;  5EV0 A;  5M19 A;  1WE4 A;  3T1X A;  4CLC C;  3BEC A;  4R23 A;  3LR4 A;  1OJ5 A;  4FH4 A;  1M6K A;  3BFG A;  5F5Y A;  2ZM2 A;  3G35 A;  4FOF A;  3UY6 A;  1T18 A;  3Q07 A;  3A3E A;  3VFH A;  3H82 B;  5FDH A;  3G32 A;  2ACG A;  5DF8 A;  1LL8 A;  5J7E A;  1OTA A;  1BLC A;  4FUW A;  4Z9Q A;  5TGF A;  3ZYT A;  3MFX A;  2EFX A;  3QHY A;  5F6A A;  3CJM A;  3UDI A;  4BL3 A;  3CZD A;  4OOL A;  1Y4O A;  3HL9 A;  4K91 A;  4RVA A;  1FR6 A;  1LT0 A;  5FQJ A;  3Q7V A;  3Q7V B;  4FH2 A;  5IU1 A;  2GZA A;  5FQM A;  3UB7 A;  3BFF A;  4HQA A;  3B33 A;  4X55 A;  2J8Y A;  1FCM A;  3VOY A;  2V20 A;  4RX3 A;  4ZDX A;  4MDZ A;  2ZQ9 A;  4IJG A;  3IX4 A;  1ACF A;  5FAQ A;  4ZBE A;  3UDF A;  1MWS A;  5F82 A;  2CC1 A;  5E2E A;  1YQS A;  3R7W A;  3QNC A;  1MPL A;  4WZ4 A;  4HBU A;  1MY8 A;  3GR2 A;  1ONH A;  3DAV A;  2Y55 A;  3ULF A;  4XXR A;  4I3I A;  1L0G A;  2EX9 A;  1TDG A;  4JF5 A;  4GKU A;  2MJ6 A;  5HD3 A;  5TBM B;  4AFI A;  5CHJ A;  4BJP A;  4EXO A;  2DRW A;  3OC2 A;  3PBT A;  5DKK A;  4CLC E;  2EX8 A;  1RP5 A;  2Z6D A;  1BYW A;  4EES A;  2UV0 E;  2PBY A;  3DTE A;  5HDC A;  4ZTK A;  2XGN A;  2A49 A;  1CI9 A;  4HIA A;  3CMZ A;  2VV6 A;  1KE0 A;  3SH7 A;  5J4E A;  3AGE A;  3T50 A;  3V67 A;  3MJQ A;  4UQI S;  4KZ9 A;  2KDK A;  1KVL A;  1YMX A;  4DJ3 A;  4R3J A;  3BY9 A;  4B93 A;  5IHV A;  3IF5 A;  4HHD A;  4OQG A;  3UB5 P;  1XFN A;  3F1P B;  3QP4 A;  1NXY A;  4D2O A;  3FPW A;  3FC7 A;  2W3D A;  4IVK A;  2QPN A;  4GS9 B;  2WKP A;  1E4D A;  4DRT A;  4WEJ A;  4ZRR A;  1DRM A;  1XX2 A;  1BLH A;  2QJ7 A;  5A90 A;  4BEN A;  1YT4 A;  2YKF A;  1VEU B;  2HP5 A;  4G3K A;  2Q9N A;  3V3R A;  3IXB A;  3DTI A;  1DP9 A;  3A0R A;  4LV2 A;  3V39 A;  3BM6 A;  5DFX A;  1S4S A;  2ZBB A;  2RCX A;  4C75 A;  3HBR A;  5FQ9 A;  4EEP A;  1JTG A;  3G34 A;  4KZ4 A;  5CHU A;  3O3V A;  1GCE A;  1NLZ A;  3NOP C;  4KZ3 A;  3BLM A;  3PAG A;  4OP8 A;  2Y2O A;  3BFE A;  5G4Z A;  3S7N A;  5KZH A;  4FD8 A;  1ERQ A;  4JF6 A;  4BLM A;  3IH9 A;  4LEN A;  1YLW A;  4DKI A;  1GA0 A;  2VGL S;  4HES A;  4PM9 A;  4RQ9 A;  4EET B;  2XF3 A;  2PR5 A;  4CJN A;  2R9W A;  4QU3 A;  4E3I A;  2H28 A;  3KO6 A;  2A24 B;  3CIT A;  3VP2 A;  2PT7 A;  1ESI A;  1XGJ A;  1YLY A;  3FKW A;  1CEG A;  4FTX A;  3H82 A;  3M2K A;  5KSC A;  3ZG9 B;  1NYM A;  3HLC A;  5EOO A;  1I2S A;  3IQA A;  1CJF A;  4KUO A;  2X02 A;  1GSV A;  4RA7 A;  1JWV A;  1XA7 A;  1SKO A;  3WRT A;  2VJW A;  1G28 A;  2ZMV A;  3NUL A;  5C5K A;  3E98 A;  1H5X A;  3RXW A;  2HDS A;  1XXM A;  4Q0J A;  4KEN B;  2HDQ A;  2JKT I;  5L09 A;  2QWS A;  1EI5 A;  1ESU A;  5GL9 A;  1OTB A;  1LL9 A;  5E2G A;  5IT5 A;  3A3I A;  1JVJ A;  1N9B A;  4WLA A;  2W3G A;  3E2K A;  1ES5 A;  1Y28 A;  1F5M A;  5EPH A;  1PZO A;  3G30 A;  3SS4 A;  3PXP A;  3T4K A;  1YMS A;  1W7F A;  5FQK A;  2JC7 A;  4HH2 A;  3HLE A;  1EWZ A;  1BT5 A;  1V9Y A;  3UN7 A;  3BFD A;  1DY6 A;  3CLO A;  4O7D A;  4DXB A;  1GHI A;  3A3J A;  3UE6 A;  3EQV A;  4MBH A;  1JTD A;  2QJ5 A;  2PD7 A;  5FQI A;  4ZJ3 A;  3RTY A;  2W1T B;  1K55 C;  5GLA A;  5TFQ A;  1PI4 A;  2Y59 A;  3IX3 A;  4N9K A;  1YKD A;  4B4Z A;  3LY4 A;  3ZVT A;  2VV8 A;  2ZC6 B;  2DMW A;  4N9L A;  3MF0 A;  4WM9 A;  5HD5 A;  4OP5 A;  2ZMF A;  4IVI A;  2Q0O A;  1VM1 A;  2LB9 A;  3LR0 A;  4LV1 A;  1WYB A;  1MKM A;  4ID4 A;  2EA9 A;  1F9I A;  4GW9 A;  3D4F A;  4ARZ A;  1E3U A;  4I5S A;  3UB9 A;  4NEE D;  5EVE A;  2FH5 A;  2W1R A;  1K4F A;  3UB6 A;  5CEB A;  4JXG A;  3LIA A;  3K3C A;  4R38 A;  3FWL A;  5I94 A;  1VHM A;  1MC0 A;  4EWF A;  1VEU A;  1YM1 A;  4B9O A;  4MBF A;  4F94 A;  2WUQ A;  1OME A;  4LV0 A;  1IYP A;  2H0Y A;  4NK3 A;  2CMN A;  5FSR A;  3MXR A;  3S22 A;  4CLC B;  2ZC4 B;  4HJ6 A;  4GHI B;  5HFO A;  3SOI A;  3T4L A;  4R4R A;  3HUM A;  3G6O A;  4E3N A;  1V9Z A;  1FCN A;  2FZ0 A;  2WKI A;  2XLN A;  4OOM A;  5EFW A;  3LIC A;  5CTN A;  3RFB A;  3V5M A;  1H3Q A;  4NKP A;  1FSY A;  1Z6F A;  2VGK A;  1NY0 A;  3TRC A;  3MQQ A;  5EM0 A;  4X1L A;  2V0W A;  3TJZ C;  2QKP A;  5CTM A;  4PMA A;  4KZA A;  2P74 A;  4R0Q A;  2AVX A;  3GEC A;  4MNR A;  1PZP A;  2EXB A;  3LYX A;  2ZC5 B;  4KG6 A;  2FFF B;  2J7V A;  2P04 A;  4Y0O A;  4KUK A;  2OLU A;  4BMW A;  3GDI A;  2W3E A;  1K56 A;  1L0D A;  4HY8 A;  4UHU A;  1X0O A;  4WYY A;  3DWZ A;  1Q2Q A;  2ZLY A;  2PBD P;  3W4O A;  5DJT A;  4OH0 A;  3Q7Z A;  2ZC3 B;  2R9X A;  3OPR A;  4JLF A;  3WS0 A;  3MXS A;  4KZ6 A;  4GS9 A;  2VX8 A;  5HSQ A;  4F3L B;  2WGW B;  4GJ4 A;  2V1Z A;  4KZ5 A;  3E4Q A;  4MCW A; 
#chains in the Genus database with same CATH homology
 3R7W A;  4ETZ A;  3KX0 X;  3H7W A;  4LRZ E;  3ULF A;  4I3I A;  3PHY A;  3C30 A;  3MMH A;  3F1O B;  2NUT C;  1DP8 A;  2MJ6 A;  3KSI A;  5HD3 A;  5TBM B;  4E04 A;  5TBM A;  4AFI A;  4WEK A;  3O5Y A;  4HP9 A;  4BJP A;  4EXO A;  3E4O A;  4P6Z S;  5DKL A;  1N9O A;  3A0S A;  4PKY G;  3PBT A;  3OC2 A;  1D7E A;  5DKK A;  4CLC E;  2J80 A;  3FPV A;  1MZU A;  2Z6D A;  2QYB A;  4BWI A;  5K5B A;  1IFQ A;  1BYW A;  2LB5 A;  4EES A;  3RH8 B;  3F1P A;  2KLI A;  3LI9 A;  3MXQ A;  5HDC A;  4L9E A;  4I3A A;  1OTE A;  2HV1 A;  4L0L A;  1LSV A;  3F1N B;  4O01 A;  4HI4 A;  4HIA A;  2VV6 A;  3EGD C;  5TJJ A;  3DBA A;  1P9W A;  3CI6 A;  1JNU A;  4CQH A;  3BY8 A;  1UWN X;  5J4E A;  3T50 A;  3V67 A;  2KOI A;  3UB8 A;  3P01 A;  3MJQ A;  5F68 A;  2ZOI A;  2HF6 A;  4UQI S;  2W3H A;  2XSS A;  1EW0 A;  2GNX A;  2OOL A;  3MQO A;  2KDK A;  4CLC A;  3PBO A;  2W1T A;  4HNB A;  4DJ3 A;  2XA7 S;  3BY9 A;  4I38 A;  4B93 A;  2WKR A;  4M4X A;  4PKY A;  4HHD A;  3FG8 A;  1XFN A;  4DN0 A;  1OT6 A;  3F1P B;  4EEU A;  3FPW A;  3FC7 A;  2W3D A;  4LLO B;  1S67 L;  4GS9 B;  2WKP A;  2HJE A;  4WEJ A;  4ZRR A;  1DRM A;  3W2Z A;  2JKR M;  2VZW A;  3BQ8 A;  3VE3 A;  2QJ7 A;  1TS0 A;  2YKF A;  4G3K A;  2A2L A;  1P0Z A;  5HWW A;  1DP9 A;  1NRJ A;  3A0R A;  4HP4 A;  2VKS A;  5I5L A;  5HDS A;  3IBJ A;  4IHQ A;  4H6J A;  4NXB A;  5DFX A;  3VOL A;  1S4S A;  2ZBB A;  1YAX A;  4YWZ A;  4EER A;  1W63 M;  4EEP A;  2PHY A;  2O99 A;  2I9V A;  3T4Q A;  1NLZ A;  4EU0 A;  3EOI A;  1TS6 A;  3NOP C;  4P6Z M;  1OT9 A;  4G3W A;  3KYZ A;  2OWJ A;  3NHQ A;  5G4Z A;  3S7N A;  2IA2 A;  1KOU A;  3T4T A;  1IOU A;  3R7W B;  5HZH A;  4HJ3 A;  4LRY C;  2VGL S;  1LSW A;  1S1Y A;  4Q0H A;  3SW1 A;  1S66 L;  4RQ9 A;  3F1N A;  4EET B;  4MN5 A;  2PR5 A;  2D01 A;  3HJK A;  3MR0 A;  3IS2 B;  2GX5 A;  3EQU A;  4JGQ A;  2H28 A;  3KO6 A;  2A24 B;  2V1B A;  3CIT A;  1H8M A;  3OOV A;  2PT7 A;  3CUE A;  1YSQ A;  1STZ A;  3OCL A;  5F69 A;  5KSH A;  4K08 A;  2VEA A;  3ICY A;  2M1C A;  4Y5F A;  3VV4 A;  3PBR A;  3H82 A;  1NWZ A;  3D3O A;  3LIF A;  4Y3I A;  5HWV A;  3C2W A;  1P97 A;  2JN7 A;  1TS7 A;  4G3V A;  4KUO A;  3EEA A;  3NOU C;  4I3J A;  4NXG A;  3BJN A;  4DMZ A;  5MC7 A;  2L0W A;  2W0N A;  1GSV A;  3EWK A;  5HPF A;  3UE3 A;  4WF0 A;  2PD8 A;  3B42 A;  2VJW A;  1G28 A;  2ZMV A;  3PBQ A;  5C5K A;  2XRO A;  4LRX C;  2A24 A;  3E98 A;  1UWP X;  1GSW A;  4QPR A;  4Q0J A;  4O0P A;  5AJG A;  4UEY A;  1NLY A;  4IUK A;  2Y79 A;  4II7 A;  3B47 A;  3C8C A;  5LBR A;  3TW8 A;  2JKT I;  4EW7 A;  2QWS A;  4H6J B;  4GHI A;  1OTB A;  1T1B A;  4GCZ A;  5IT5 A;  3K2N A;  4WN5 A;  3F1O A;  4MN7 A;  2PR6 A;  4WLA A;  2OAQ 1;  2W3G A;  1N9L A;  2R78 A;  5CX7 A;  2JKR I;  4ETX A;  1XJ4 A;  1Y28 A;  4BBU A;  2PYR A;  1F5M A;  4Z1W A;  1XFQ A;  3HJI A;  1DP6 A;  3U2A A;  3C38 A;  2ZOH A;  4IUH A;  2INW A;  2PDR A;  3PXP A;  4WUJ A;  1TD5 A;  3T4K A;  2K31 A;  3T4J A;  3CWF A;  3PYP A;  4HH2 A;  4Q0I A;  3LIB A;  3D72 A;  1S1Z A;  3S7O A;  2Z6C A;  3KSF A;  2OAP 1;  5A8B A;  3PBN A;  1T1C A;  4HJ4 A;  4R70 A;  3EEH A;  1T1A A;  1V9Y A;  1VB6 A;  1ZTU A;  2VA0 A;  3NOT C;  1OTI A;  2M7U A;  3S7Q A;  4I39 A;  4WL9 A;  4EUV A;  3LR3 A;  2Y8H A;  2W27 A;  3CLO A;  3LI8 A;  3PBS A;  3JVU A;  3UE6 A;  3EQV A;  2O0Y A;  2QJ5 A;  3JVV A;  3KYQ A;  2PD7 A;  4CLC D;  3H7W B;  4KQO A;  1OPX A;  2V9A A;  4FSF A;  2J3W A;  4L9G A;  3RTY A;  2W1T B;  4KQD A;  5J3W A;  5DFY A;  4BBV A;  2WKQ A;  2EWW A;  2GJ3 A;  2JHE A;  1WA9 A;  4YNR A;  1G6O A;  1N9N A;  1YKD A;  3NJA A;  2V1A A;  2J3T D;  2VLG A;  2O9C A;  4BBT A;  1XJ2 A;  3T4S A;  2W3F A;  3H9W A;  1GSX A;  2VV8 A;  3IBR A;  2DMW A;  1TS8 A;  1W63 Q;  2K7S A;  3MF0 A;  2KX6 A;  5HD5 A;  2JKT M;  2J3T C;  2NUP C;  2ZMF A;  2LB9 A;  5FL3 A;  4DJ2 A;  3LR0 A;  5IS1 A;  1MKM A;  2EA9 A;  1F9I A;  4GW9 A;  4ARZ A;  1T19 A;  3VE4 A;  5HL6 A;  1ODV A;  3E4P A;  4LPZ A;  4I5S A;  3UB9 A;  3LFV A;  4NEE D;  2FH5 A;  3LIE A;  4NXE A;  2W1R A;  1OJG A;  3LUQ A;  2HJ9 C;  3UB6 A;  3LIA A;  3T4O A;  2B02 A;  4EQ1 A;  3K3C A;  4R38 A;  3OLO A;  3OBF A;  3IS2 A;  4WEL A;  1TF1 A;  4HH3 A;  1VHM A;  1MC0 A;  4Y2F A;  3E0Y A;  4B9O A;  4F3L A;  3K3D A;  4PHT A;  5KIZ A;  2PYP A;  2VGL M;  2CMN A;  2V0U A;  2G7U A;  3ZQ5 A;  2XRN A;  2P7J A;  4CLC B;  1P9R A;  4HJ6 A;  1F98 A;  2D02 A;  4GHI B;  2O9A A;  4O8G A;  3A0V A;  3T4L A;  3G6O A;  2B18 A;  4JGR A;  1V9Z A;  2FZ0 A;  2L4R A;  4GLQ A;  2QHK A;  4OOM A;  5DJU A;  5EFW A;  3LIC A;  3RFB A;  2P08 A;  4CLC C;  5AVE A;  3UME A;  3LR4 A;  1OJ5 A;  5DF9 A;  1H3Q A;  4R6L A;  2L1M A;  4NKP A;  2EWV A;  4PAU A;  5F5Y A;  5L8M A;  4FOF A;  3OCN A;  1T18 A;  3TRC A;  4UQI M;  3MQQ A;  4XT2 B;  3EGX C;  3LID A;  4YOF A;  5AVF A;  3H82 B;  1XJ3 A;  4HOI A;  2V0W A;  3TJZ C;  2QKP A;  1LL8 A;  5J7E A;  3CUE C;  1YSP A;  1OTA A;  3PR6 A;  3TE8 A;  1XJ6 A;  3CAX A;  4L9F A;  3GEC A;  3ZYT A;  3MFX A;  1OTD A;  5F6A A;  3LR5 A;  3MQ0 A;  3LYX A;  4R3A A;  5HDD A;  4ME4 A;  2P04 A;  5HPI A;  4OOL A;  4KUK A;  5G4Y A;  3P7N A;  1LT0 A;  2HGV A;  3GDI A;  4MMN A;  4BMW A;  2W3E A;  3BW6 A;  3HCY A;  4JGP A;  2XA7 M;  4HY8 A;  5IU1 A;  1D06 A;  2GZA A;  1X0O A;  2OWH A;  3UB7 A;  4ARZ B;  3KSH A;  4HQA A;  3B33 A;  4JGO A;  1S4R A;  3BWL A;  2K2N A;  1UGU A;  5DJT A;  3UMD A;  3R4K A;  4XT2 A;  4NXF A;  1LSX A;  4MDZ A;  3KSG A;  4IJG A;  3BQA A;  1ZHH B;  3S7P A;  2M7V A;  2VV7 A;  5HWT A;  4GS9 A;  2BAS A;  2O9B A;  2VX8 A;  5HSQ A;  4F3L B;  2YKH A;  4GJ4 A;  4MN6 A;  3E4Q A;  4MCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...