The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
85
|
sequence length |
235
|
structure length |
235
|
Chain Sequence |
NAMRLRHLSDPDSLPALDKSFAIERPALGLAPDAPPVRILLLYGSLRARSFSRLAVEEAARLLQFFGAETRIFDPSDLPLPDQVQSDDHPAVKELRALSEWSEGQVWCSPERHGQITSVMKAQIDHLPLEMAGIRPTQGRTLAVMQVSGGSQSFNAVNTLRLLGRWMRMFTIPNQSSIAKAFQEFDAAGRMKPSPYYDRIADVMEELVRFTALVRPHREALTDRYSERKAAGHVI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
putative arsenical resistance protein
|
| publication title |
Crystal structure of an apo form of Shigella flexneri ArsH protein with an NADPH-dependent FMN reductase activity
pubmed doi rcsb |
| source organism |
Shigella flexneri 2a
|
| molecule tags |
Structural genomics, unknown function
|
| total genus |
85
|
| structure length |
235
|
| sequence length |
235
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2006-02-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03358 | FMN_red | NADPH-dependent FMN reductase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
