2FZVA

Crystal structure of an apo form of a flavin-binding protein from shigella flexneri
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
235
structure length
235
Chain Sequence
NAMRLRHLSDPDSLPALDKSFAIERPALGLAPDAPPVRILLLYGSLRARSFSRLAVEEAARLLQFFGAETRIFDPSDLPLPDQVQSDDHPAVKELRALSEWSEGQVWCSPERHGQITSVMKAQIDHLPLEMAGIRPTQGRTLAVMQVSGGSQSFNAVNTLRLLGRWMRMFTIPNQSSIAKAFQEFDAAGRMKPSPYYDRIADVMEELVRFTALVRPHREALTDRYSERKAAGHVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an apo form of Shigella flexneri ArsH protein with an NADPH-dependent FMN reductase activity
pubmed doi rcsb
source organism Shigella flexneri 2a
molecule tags Structural genomics, unknown function
molecule keywords putative arsenical resistance protein
total genus 85
structure length 235
sequence length 235
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fzvA00
4QOFA 1YCFA 2X2PA 4ESEA 3NHKA 5FUQA 5EA2A 2B3DA 1D4AA 2Z9BA 3FJOA 4ZVKA 1J9ZA 3NFRA 1CZRA 1RCFA 3FX2A 1CZOA 1AKRA 1BVYF 1FTGA 2KLBA 3KEGA 3NHSA 1SG0A 2Q9UA 4Y9UA 5LBUA 3B6JA 1AKVA 1QR2A 1D04A 4PTYA 4U7HA 3N3BC 1TIKA 1OBOA 1CZNA 1X77A 3FNIA 3NHYA 5LVAA 2FZVA 1WSBA 3O73A 4QOHA 4XDGA 5EMNA 5F12A 5B3LA 4M0CA 5LMCA 2QMZA 1J9GA 1RLIA 4LTNA 2ARKA 3TE7A 2F1OA 3B6IA 4H6PA 4Y9RA 3F6RA 2HPVA 4C0WA 1DXQA 4H2DA 1XI2A 3GFRA 4U7FA 3NHPA 1KBOA 4NULA 4ZVMA 4DIKA 4N9QA 3HR4A 2XOEA 3SVLA 2QWXA 4PTZA 4FX2A 1I1OA 3W77A 3LCMA 4GR9A 3W7AA 1YKGA 1RTTA 3B6MA 5ULLA 5LJIA 1YRHA 2V5VA 3U7IA 4OXXA 1ZWLA 2Z98A 3UXHA 2GSWA 1AMOA 1FUEA 1H66A 2BZSA 1C7EA 2QX9A 3HLYA 2WC1A 3OWXA 4QOGA 1D03A 1J9EA 1ZWKA 2BN4A 4FGLA 4S24A 5F4BA 5F51A 4C14A 1AG9A 1FVXA 1CZHA 3QE2A 4N65A 1TLLA 3ESYA 2V9CA 4LA4A 1KBQA 1QHEA 1AKTA 3FW1A 4YAFA 3W78A 2QX4A 3F90A 4HEQA 3N3AC 4QODA 4J8PA 3G5MA 5B3KA 1CZLA 3S2YA 3OX3A 4CF6A 1YCHA 2FDXA 5NLLA 2FCRA 3OWHA 4QOJA 1OFVA 1T5BA 2BMVA 1JA1A 3OJWA 1XYYA 3OX1A 2MTBA 1J8QA 2RG1A 1XYVA 4YAWA 3F6SA 3TEMA 3K1YA 4PU0A 2V5UA 1F4PA 4ICIA 3FVWA 2QX6A 5LJLA 2M6RA 3QFCA 4YAOA 1DX9A 4C0XA 5BUCA 2MOKA 3NHLA 3R6WA 2ZKIA 2OYSA 3QFRA 3NHUA 4YQEA 5EAIA 2BPOA 2Q62A 3OVMA 4HS4A 5A4KA 4BMOB 4C76A 2QX8A 1DXOA 2FZ5A 2W5UA 3HA2A 3L9XA 3N39C 4Y7CA 3KLBA 5FA6A 1FLDA 3L9WA 2AMJA 2HNAA 2R97A 2KQUA 1QBGA 5NULA 1CZUA 1VMEA 2XODA 3NHFA 1AKWA 2MWMA 3ESZA 3OJXA 2Z9DA 3O2NA 5TGZA 4D02A 3GAMA 1YOBA 3ES9A 1OBVA 1H69A 3GFSA 2FAXA 2QMYA 3OX2A 6NULA 5LBTA 3NHWA 3UXEA 4NLLA 2BF4A 1T0IA 1AKUA 1BU5A 2MT9A 3EYWA 4DILA 3ESXA 1FLAA 1AZLA 3NLLA 1V4BA 2X2OA 2FVXA 2N1MA 3TZBA 2D5IA 2HNBA 1B1CA 4BMPB 1QRDA 1GG5A 4QOEA 2FX2A 2OHHA 2OHJA 2A5LA 3F2VA 3U7RA 1ZX1A 4YAUA 1JA0A 4LAFA 5FX2A 4LTDA 4QOIA 5LLDA 3EDOA 4FGJA 1WSWA 4YALA 1AKQA 4XDHA 3B6KA 1FLNA 1C7FA 1SQSA 4ZVLA 4FGKA 3W79A 4DY4A 3JSXA 3NHJA 1FX1A 4N82A 4U7GA 4ZVNA 1E5DA 1RLJA 4GI5A 3ZHOA 3RPEA 1YDGA 1AHNA 3LT5A 3K20A 4R81A 1YCGA 4LTMA 4F8YA 2FLVA 2FOXA 1NNI1 2QR2A 4GQIA 4CETA 3KAPA 3GFQA 3NHRA 3P0RA 5JROA 1XT6A 2OHIA 3KAQA 1FLVA 2R96A 1CZKA 3D7NA 2Z9CA 2M6SA
chains in the Genus database with same CATH superfamily
4DMRA 1XJCA 2GUGA 1JSRA 3ZE1B 2R6GA 3OF2A 4OSEA 1HE2A 4NYJQ 1UFKA 1NMZA 2E37A 1ESCA 1ILWA 2FP3A 2YRXA 4IZHA 2RHGB 3QPUA 1UDBA 5ETJA 3O3MB 4DIBA 2ZROA 3OZBA 1QVRA 3PLNA 2XF8A 5C53B 3VHXA 5TQ0A 421PA 4DA8A 2PRZA 3KKNA 3BJMA 4U4AA 3ETCA 1R6VA 1ICIA 2QD4A 2Z2XA 4ZP1A 3KJFA 4F96A 1SD2A 2JFGA 2PSEA 5ANRB 3TE6A 4YMHA 3UUWA 1YDHA 3KYDB 4GDFA 1OKKD 3LCMA 3EH2A 5IW8A 5JSKA 2YJZA 2Y1CA 1IHOA 4QUDA 1GLNA 3MM4A 3WGUA 2XAUA 3UC5A 5FUYA 1U2ZA 1Y6FA 1QYCA 1QAQA 2FG6C 5KOYA 1GRVA 4UAVA 4U0JA 1G3MA 2FZLA 3M6AA 4RD4A 5M3BA 1R9NA 1MBZA 4UVIA 4AG5A 5AI8A 4B0PA 3KVYA 3QW2A 2R60A 1QH8B 2H54A 3EMBA 3TTYA 5JLJA 3RUHA 4A8JC 4Z53A 2IU3A 2O3JA 4FYMA 3GLIE 1G8KA 4PO1A 5E7MA 3ZCQA 4BWFB 4Q05A 3JWIA 2OBNA 2KW5A 2OK7A 1LUAA 4MMXB 3PWSA 4HN4B 4LWZA 1X19A 3KQMA 3CF0A 3NTVA 4B46A 3PPWA 4C0XA 3B60A 3QMVA 2MOKA 3R6WA 3QU4A 1W5AA 4PLZA 4X3CA 2ESRA 3ZE2B 4RHEA 1WBBA 2PGIA 3WB1A 4RSRA 3AZQA 1CSEE 2WHYA 1XB2A 5DYWA 1Y4UA 2VP2A 3T06B 1C2YA 2BJHA 4MV5A 4B8ZA 1QH9A 3VNUA 3JATA 3HEBA 4WOPA 5CDFE 2G6BA 4DGSA 2QYHA 4ZYWA 3K0AA 3M4YA 1QH0A 1W5BA 2Q1SA 3GT0A 4FFMA 1I1HA 1OBVA 2LDBA 4L4YA 1KEPA 2J3MA 2GXQA 4MAFA 1VMDA 2UU9B 1RZ3A 1NX9A 2JDID 3JQ9C 4Q4JB 5FORA 2O2GA 1MIOA 2ORED 5CIWA 4DIDA 2PKQP 3K9BA 1U3FA 3HXPA 3R3ZA 2CGEA 4HN9A 4EF6A 4F3KA 2LGJA 2EBUA 4WZZA 1XZAA 4ATNA 4B6FA 4DCSA 1KIAA 1UMKA 2Q1UA 1G3UA 2PS0A 4WV3A 2NPFA 4PAGA 1O9HA 1YGPA 3B6KA 5EHXA 2YHUA 3VO1A 2QSJA 5AW7A 3KK0A 2O3SA 1YZLA 3G1WA 4PZUA 3S44A 3AFOA 2BGGA 2VJQA 3OEEA 4CIDA 1JHOA 5IDWA 3BXZA 4MS4B 2AOWA 4Q7LA 4MS1A 5IAEA 4CMEC 4RK6A 1T3HA 1G0OA 5G4KB 3KJIA 1W4LA 4MWOA 4DC1A 4QGSA 3IE1A 3DW1X 4DLXA 2AOVA 1XZFA 4BDTA 4ENSA 1YZVA 1NQXA 5G1OA 3ROPA 3D5TA 5C2JB 2YUTA 2ZOSA 5IJ9A 4TWAA 1CFJA 3GG9A 4JY7A 3WKDA 5F52A 4RYDA 1B15A 2D2VA 4QASA 3KQTA 1EK5A 3HACA 1ZVMA 1JHZA 2EL9A 2H18A 1UZAA 4ZZIA 1HLGA 3D2CA 3V7UA 4DQ0A 1UBHS 5A3VA 3WKAA 5KTRA 2X0NA 5TJ9A 1WSDA 3AESA 1PZNA 1FB5A 2A0XA 4QPPA 3OJ0A 4BN5A 2JIDA 5K9ZA 5LMCA 3JQGA 3UK0A 4LTNA 1Y3DE 5GJVC 5LQNA 4TKZA 2IY9A 2AR9A 1CS0B 1DQPA 4IVRA 4ZU1X 1ZJ4A 4KQHA 3DHWC 1QO7A 4YBRA 3QMPA 1SPBS 1ULUA 1VHLA 3BDVA 4D81A 2MSDB 2WWHA 3FOZA 2D2IA 1QP0A 4H7PA 4LGVA 3JQBA 4KYTA 4GECA 4XQ9A 1BA2A 3TTTA 2CLLB 2OCIA 3EC2A 2WF9A 4I3GA 1NSTA 5ALNA 4IHKA 5CBPB 3TNLA 2FWMX 1DSSG 3QE4A 1Q20A 4WKNA 1YR3A 3ZQ4A 2R6ZA 1NDHA 3Q6NA 5CCEA 4LQCA 1CUWA 1Y80A 1E1KA 2PH3A 3AP1A 1KIFA 1YRWA 3NTRA 3SHFA 3UK1A 1TM3E 1G42A 3HB0A 2YY7A 2YJNA 4OA5A 2IOFK 4X92A 5DTMA 2QAJA 1GPDG 2DGDA 5IF9A 5KDDA 1V1JA 2C4HA 1P19A 1UBKS 2ZJ7A 2FCRA 1JLLB 5DX8A 3OICA 2HYIC 2R8PA 2XQIA 4PFQA 2FE4A 2ZRBA 4FTWA 3U26A 2ILTA 5ALUA 2BMJA 3PXDA 2Z4TA 4XGKA 2FXIA 3DYIA 2XCIA 4DR3B 2Y77A 5J9FA 3V4SA 3OM0A 1DX9A 3UM9A 2WV7A 3ROEA 1E3WB 3QFRA 3UWSA 1MRSA 2QVLA 4GP7A 1AGXA 4NZPA 3L6BA 2YVUA 3WV5A 1C29B 4M87A 4M9CA 2B36A 4Y1FA 3SNKA 4KUHA 3BGSA 2VYVD 3WWDA 3LMKA 1U3GA 3BVPA 2QMEA 2JPDA 1I01A 4BMCA 4DA7A 1JTFA 2QP9X 1YQGA 1EM8A 2BH2A 4G5RA 1CIPA 5AW2A 1WPGA 1E1YA 2O48X 2VCEA 3G0CA 5JU6A 5C37A 1E1DA 1IEWA 3TCXB 2CD9A 1XEAA 1OF1A 3NHWA 5IN5A 2V45A 3FDZA 1HE8B 3H9EO 3KQHA 3A1EA 3A1UA 1R7RA 1NVUQ 1VHTA 4ND7A 2ACEA 4TGLA 9ATCA 5JDCA 2CLCX 2CLHB 2J59A 2JIQA 3A2LA 1B0PA 3BULA 3NG1A 2Z2IA 1GM5A 1Y5LA 1X87A 2FN8A 3VSAA 3LIPA 1SIOA 1IN6A 1YU6A 2V7XA 4QFDA 3BHJA 5ITWA 5F7ZA 1NW4A 1TA4A 3EDOA 3K4QA 2BMAA 3G3EA 2VT7A 1JLKA 2W8BA 5M2QA 2Z57A 2GAOA 3I1JA 1LFAA 2D3WA 3NRJA 2QN6A 3DO5A 1I4TD 3ONNA 2O07A 3B89A 1ORVA 3DD1A 2OUIA 3WZMA 5EJIA 2W4IA 4XVCA 2R1ZA 5K8JB 3KETA 3QVSA 2Q49A 3P9ZA 1N1GA 1VYTA 3R7WA 2QR2A 4R8KA 3TM5A 1S7CA 1TZJA 1ISFA 1ND6A 3W5BA 3ZLVA 1AUVA 1W8IA 1MV5A 3KDAA 4QHSA 1X7XB 2VZ9A 4RFVA 1G55A 3BL5A 4KFRA 3RR2A 5I4BA 4GOOD 5KTMA 2R6AA 4IGKA 2ZETA 2XVMA 1FK8A 2PX6A 4F5WA 3SJCA 3AEKA 4L4ZA 4MS1B 5HTOA 4EUFA 4C30A 1Q91A 1XVTA 3HN2A 3JQ8B 2GJ4A 2OAGA 1JXOA 4V1CI 2YXNA 4X85A 2VKTA 2JW5A 4MJXA 5ARDA 3TRIA 4ZJYA 2DSTA 1JXAA 1VFNA 1O77A 5DHPA 5A4IS 3WNBA 2HD4A 2O20A 2V54A 1FFSA 3ZGVA 5KOJA 2QZJA 5DXAA 5L51A 1E77A 1G59A 1RJEA 1XF1A 4MR8B 5ESDA 3RSCA 3RV4A 1QH1A 2QUHA 1FFWA 1W2WB 4D9KA 5BXQC 3JZDA 1P4SA 2PIAA 2RGUA 4NMMA 4EVQA 1HE5A 4EOGA 3EZGA 4RAOA 3ZU5A 4P81A 5ITSA 1OAKA 5HVNA 3W2IA 1XMQB 1F2UA 2ZYRA 4N76A 1JVBA 2IEDA 4Y2RA 1PV2A 4Q01A 5HDBB 4BP1A 2EJUA 3J81k 4LYGA 4DQDA 3CBGA 4I5EA 5JXJA 3W5IA 4AN0A 2C9DA 3QVJA 4HN2A 4UEJA 2C7BA 2Y27A 3HI6A 4JLAA 3VQTA 3W8RA 2BFBA 4B79A 3EPKA 2GT1A 4ZU6X 3D6JA 1QHEA 4ZANA 4JOSA 3NOVA 4AQDA 3GD5A 3THXB 1ZK3A 2VUIB 4W5NA 1B6GA 1TKCA 1PVDA 3AY3A 3HJGA 3L3BA 4NU8X 3TQTA 1GO2A 2WJ4A 2CUTA 3TQQA 2VK4A 1LBSA 3CKKA 4MV6A 1VCMA 3GARA 2YN4A 1ONOA 3LQ1A 4DC9A 1I5RA 3QU9A 5C4IA 1F4PA 3HDQA 3ZH2A 1ZM2A 1HFJA 4PVDA 1OA1A 1FNCA 3LQYA 4F86A 2ZFUA 3FF1A 4RL4A 1AQJA 4B32A 5EPEA 5GOZA 2OM2A 2V7TA 5G53C 3G5LA 3MAAC 3DQPA 4KBFA 1PRYA 3X44A 1VG9B 1SB8A 2XNJA 3C3EA 2AL7A 3V3TA 5JG7A 1DAEA 4OHYA 2WP8J 4RHXA 1HDIA 4LZOA 3UG6A 2ZLBA 1GAXA 3H17A 2ZRIA 3O2NA 1IBLB 1IZ0A 4FOPA 1CUCA 2A2ZA 3RASA 1PWYE 2A9FA 3H9CA 5CFZA 1E6EA 4BB0A 4ALJA 1XIVA 3N58A 2PZGA 4G4IA 4TT3D 4WASA 4ND1A 2WIBA 1CF4A 1GL3A 1BO6A 4TLCA 4B43A 3WO1A 4KTVE 2VP5A 3WQHA 2FPOA 3BJIC 4OI2A 1I7QB 4YJ2A 3FPAA 1EXDA 2Y2VA 3N2LA 3VPFA 1PUJA 3NBXX 4PXAA 3U7RA 3HKDB 3N0VA 3MGKA 4I9HA 2QI9C 1M2HA 3B51X 1PTJA 1SN7A 1SUSA 1SWVA 2GM4A 4JUBA 1R0XA 1PTKA 4W5RA 3K8ZA 1NR5A 2DG2A 2ZUUA 5AK0A 1L3CA 4CODB 4ZV7A 1BRMA 3O4FA 3D7RA 4H7HA 1VDMA 3H86A 5BQPA 2HDOA 3JQRA 4EZEA 4KB5A 3V8VA 4Q47A 1HL7A 2PX0A 4ZA2A 1KQGA 2O1EA 1WL8A 3I58A 4KAFA 1T9HA 1E5XA 3T3PB 3S8EA 3OTGA 3M70A 3DUFB 3OLZA 3OQJA 3QX9A 2Z1DA 4H59A 4KL8S 2WWVD 3UYLA 4DDTA 4ZDJA 4R9VA 4JL8A 2GBLC 2CHEA 4UHBA 1RYDA 1B76A 2Y6UA 3AQ4A 3C16C 3IEXA 4LRSB 4LYHA 5HWSA 1QK5A 2O1WA 3CINA 1DJPA 3MJRA 4ZVSA 2WFMA 2WIKA 5GAJA 4XVUA 4GPZA 5JPIA 3C6MA 3EIUA 3OCYA 3DLTA 4LJ5A 3U7EB 5KKAA 3QU5A 1MOSA 4R2LA 4CM4B 5E0OA 4P1ZA 5BN1A 1X1AA 4JQOA 3EIFA 4CF5A 1HI9A 1MH9A 1W76A 3ETGA 1W0JA 1WB9A 9LDBA 1TJ4A 4HZUA 2QEQA 3FLAA 1Q84A 3QPAA 3N6XA 3OPMA 4P5EA 3BXPA 2HADA 1ISIA 1JJFA 1U2QA 1ZZGA 3OZUA 1WZEA 1RQ7A 3MB5A 4HS9A 3ZZTA 3IVAA 3RS8A 3DEFA 3FUUA 4PG5A 4X64B 5JBQA 4HJXA 5CNMA 2PH1A 1DCTA 4FYIA 3WSWA 1QH1B 1YQXA 3OWXA 2EP8A 1T3GA 3EIOA 1A9TA 2Q3FA 3E4DA 3SXJA 5K0BA 4OIFA 2ROQA 4RPGA 2WMOB 5CNIA 4J1NA 4IICA 4DDWA 1FBNA 4H7IA 2D4AA 5F78A 3ZXYA 1N1DA 1FRFS 3M4XA 2IS2A 5L7YA 1VKZA 3UPDA 2HWKA 1BROA 1UQUA 1UK8A 2IYXA 3IPAA 4QODA 4ZT7A 3R3JA 4WZAE 3OQOA 3FPLA 1ONSA 1J2JA 3URMA 4W1PA 1T5BA 1T9KA 3II6X 2C07A 3NEJA 4GW3A 1GSAA 4GOXA 3IOCA 5JAUA 3JAWA 4M0PA 3TG2A 4JLJA 1F1BA 2I7XA 3R3UA 2CN1A 4WIAA 1YACA 2QT1A 3PEVA 2AOTB 4CM7A 3LUKA 2OXFA 1CUFA 3ND9A 3QK7A 3FE2A 1M33A 5IJ9B 1HLFA 5K09A 5CCBA 1WS6A 3N2YA 4FYPA 2Z8YM 4QNMA 3G89A 1FDRA 2OXCA 3CEPB 4P7JA 2NXEA 1SA0A 2IYTA 2LCFA 5CH8A 4CIXA 1HNNA 2RHMA 4KOAA 5LP6C 1FLDA 4UXIA 1F5NA 5CFPA 4UU1A 2BEWB 3IAFA 3OU6A 2QP4A 2XGGA 3I04A 1QBGA 4HWSA 4O2AA 3WLKX 9ABPA 1CUYA 1HDCA 1T36A 1N2JA 1R8JA 2ZP1A 4ARIA 1M6NA 3OC0A 2E4YA 4GPTA 2R68A 5EP4A 3OM9A 3HVRA 4DF3A 4I55A 3VX3A 1XQYA 1C7ZA 2YMPA 4ZO7A 2FF7A 5KYTA 4R1PA 4C6SA 1BX3A 3AKDA 3D6AA 4M55A 2JFBA 3RIEA 3C6ZA 3TAHA 3DXXA 3B5EA 1K66A 1SNYA 1VHJA 3FROA 1EIWA 3H9BA 4P35A 4DYVA 4Q19A 1M1NB 5AVSA 2NLOA 1HNWB 4PQFA 5KREA 2A5GA 2IHUA 2TMDA 3ICQB 4AKIA 2P9GA 2HIAA 2HJRA 2PKWA 3KOXA 4RAQA 5HUJA 4TMTA 2RGEA 3IP1A 2WSIA 4LX0A 5AT1A 2PZ8A 4HTFA 3H8JA 1E60A 2A5DA 4EAQA 4PYLA 2C2KA 3DNFA 2XRMA 4EEXA 2A8YA 3IUSA 3I0NA 5KO2A 1KC1A 3EVNA 4Q4AB 4RYLA 1U90A 1JIXA 4F8YA 2IW1A 3D2BA 3LA8A 1YZHA 4FB5A 1RR6A 1ISHA 3E70C 3V4LA 1H2AS 1LLDA 3VR2D 4ZHQB 1E1QD 1TM7E 4X93A 5CVJA 5JNTA 4BFWA 3ZD6A 3RRFA 3ZV7A 5J2UB 4C5CA 3PLAE 3VZPA 3Q7EA 4JVNA 1CJKC 2B3DA 3AF2A 3UMSA 2I99A 3MEQA 5FOSA 2CLDX 5FA5A 4A16A 4WN3A 4XWAA 3QKWA 1OPRA 4WADA 4LZLA 3KFLA 4L51A 4LHVA 4Y6SA 1FYFA 2D2XA 1WKBA 4IFTA 1VC2A 2F48A 5JSQA 3K0CC 3L1KA 5A2QA 2JLRA 3E1KA 2GGSA 3BWVA 1PR9A 2R8OA 4YMSA 5KTNA 3IP9A 1MORA 1SXJD 1JIIA 1JEYB 5JIBA 1YO6A 1W8DA 1DO2A 4QNNA 2X58A 4O1HA 2CV1A 1TEVA 1C50A 2VH5R 1U6IA 2NZVG 1XI2A 3LGAA 3LLUA 4JT9A 1PD1A 3EIXA 2Z1MA 1QIGA 1T3SA 3A3PA 3B8EA 1U2RA 4B48A 1TVKB 3RU3A 4Q9AA 3PIRA 3MJSA 4ED9A 4YLEA 2NUTA 1OMOA 1Y7IA 3EQ9A 1AUPA 1YDMA 3U7IA 1AN0A 5CEFA 2OESA 5AOBA 1RKBA 4RQAA 1UT8A 2FPPA 3TJMA 3LBAA 1A3CA 4B9AA 3NEAA 2NP6A 3CG4A 1SEVA 5C1IA 3AR5A 1PLLA 4GR4A 4AP6A 5DSZA 3C3JA 4IV5A 3TXXA 4LF4B 4ENVA 1TCBA 1JDBC 3B5JA 3SYNA 4XSGA 2FWBA 2IZOA 1M6HA 1MA3A 3TZQA 2OP0A 1U0HC 5KWSA 4HAIA 1VLQA 1YV9A 2VKQA 2X19A 3MWFA 4NK4A 4EVSA 1O5TA 4CFSA 3DTYA 1Y3HA 2A3NA 4EJFA 4ETMA 7YASA 3HV0A 2QTNA 4RTMA 1UBSB 4DZZA 5K0FA 1QU2A 1NBOA 1H23A 2O59A 2MYTA 2RKOA 3UAZA 4AY6A 4MXDA 1V48A 2E3JA 3JYNA 2PT6A 4HNRA 4O8ZA 3OPXA 2VYNA 4FHEA 2PBFA 4IBOA 4UUMA 4ZAWA 4BKMA 2NO0A 1UC5B 2H4JA 5A3JA 1IN4A 4JUIA 3CJTA 4JMPA 5LWHA 5DPMA 3QVWA 2AEJA 3R5TA 3PNVA 4C3ZA 1XP5A 1PJ3A 2F43A 3JQAA 4ZYZA 3A37A 5MF6A 3D4IA 4JI3B 4BX2A 3L05A 1VECA 5TPWB 2DT5A 3HJCA 1Z6ZA 3S0JA 5I4KA 1A88A 1OV6A 3V33A 3VVMA 4GRDA 1Y1TA 1BFKA 3VUFA 3WDLA 3MTIA 2Y1WA 2XMSA 3MJVA 1T0IA 1V95A 3QUQA 4J6FA 5DXFA 1F7UA 2Q5JA 1Z3IX 3MINB 3IPRA 1GRNA 5H8WA 3V4VB 1DB3A 1DARA 3FNRA 2YL2A 3BQMB 4PG6A 5C1DA 4O4JA 5HM6A 5JXIA 4FFOA 3CONA 1DBSA 2VOEA 2VAXA 3I30X 2AR0A 5TQ0B 1NQ5A 5TT0A 5K6TA 3RVQA 5HCNA 1CIJA 1DWPA 1XDDA 3QHPA 3VNSA 3G13A 3AEQA 2QN9A 1ZH6A 2ZYIA 3MRSA 3T9FA 1N9KA 3BE8A 3KD2A 3JZFA 4RZXA 2REXB 2YHIA 1UPTA 3MJ4A 1DIHA 5LU9A 5KNCH 2BFBB 3EJWA 3GL9A 4CM6A 2FHPA 1VLJA 4ZI7B 4PYKA 3N53A 3HM2A 4J03A 2I78A 1O4WA 3HVKA 3KP1A 1QQAA 2QE6A 4Z1MD 1FJXA 3MW8A 3WK5A 5GQSA 1C9MA 1GAJA 4DSOA 4JP8A 1G20A 2CY0A 1IHUA 2VTKA 1LI7A 2YV4A 3GQBB 1CRWG 4TT3A 3QYAA 3GA0A 3HC7A 4NABA 1L4UA 4MJ3A 5AXAA 3AYZB 1EX6A 2QZ4A 1US8B 4RZIA 3UIEA 5LN1A 4B47A 1NP3A 1QLHA 3SJ7A 4OQQA 2VWGA 1XO1A 3DFMA 2QPLA 1PDWA 1NF8A 2QT0A 2HLDD 3OX4A 3X2SA 2PYDA 2QE7D 2YW9A 2IZ5A 1F0KA 4DT1B 2WJVA 3CH4B 5DYTA 3D4OA 3NNSA 1EAMA 1TUGA 3PC8C 1WHTB 2ANCA 4PINA 2WB2A 1M6WA 2YZ2A 4TRRA 4WLFA 4JLWA 2WA2A 4NH4A 5I9TA 1IC6A 1X8LA 2E4WA 4JBYA 3SVLA 3RQIA 2W98A 4DIKA 4NSNA 1F3OA 1SO8A 2EBFX 3H6KA 3S1LA 2C8JA 3W5CA 2H2WA 2OCPA 2I66A 2FR0A 2V0NA 1L4FA 2Y0EA 3OZRA 2QM7A 2VK8A 5D7NA 3RQSA 4LMAA 3LQKA 3SEQA 3TFWA 1RU3A 3VYSB 2O8CA 3KEFA 5K6AC 3LWZA 4ITUA 3TNYA 3HLYA 3C7CB 1M67A 4I1UA 2CHUA 4JSRA 3R3SA 4WOCA 4OHFA 3RC1A 1QIEA 3FKJA 4YRNA 3EF3A 2FWPA 4OXNA 1KS2A 1YZTA 4HB4A 1EQUA 2I03A 4KI7A 1WXGA 4TS1A 4L2IB 1RJWA 3DAOA 3GUZA 4L9WA 2AE1A 3P1JA 2UUAB 4ZYLA 4PS1A 1K63A 4DCCA 4PF1A 2IPOA 2QUKA 4TV8B 5BWNA 3UJHA 821PA 2B20A 4RNDB 3FNFA 1XELA 4TQAA 3NORA 4WGFA 1BX1A 1QFYA 3G2QA 3LD9A 1R64A 4FR5A 4YAOA 4QGBA 2MINA 5LMUB 2BMFA 3V32A 4IVNA 1ICEA 4MMZB 4BFXA 3ZNNA 4WBNF 3J7TA 3WHLA 5JS7A 5FFMA 1SHJA 5KNBH 1NF3A 3DKRA 4DEYA 5DHRA 5ALKA 6LDHA 1XL0A 1QWSA 3K0EA 1M75A 4C76A 1ZL2A 3TYXA 1DO0A 5JHHB 4M8SA 1ETHA 1PVOA 2GJSA 4O4LF 3MMNA 1VI5A 1QSGA 4EB6A 1G63A 5JC1A 1P0QA 2JIZD 3OY7A 1VXRA 3PNYA 4QD3A 1DS6A 1GL6A 1UEXC 3A9TA 3QFFA 2ZIEA 2FPKA 1JKMA 5AM3A 2JA2A 1XMPA 2FEAA 3G2KA 1XTRA 2IF2A 2OQVA 1EU1A 1M2VB 2B21A 2JKYA 4G84A 4Z8XA 2A88A 2ZCUA 1FFBA 3H2ZA 4TTIA 4IUYA 1QIKA 2FB9A 4HFJA 1QDEA 3N2KB 4QKQA 1EGHA 2CLOB 3LYAA 1E5LA 3PQ2A 4MVYA 3RODA 4O4IF 2IEYA 4G0OA 3W6NA 3L93A 4AKTA 3QFSA 3UF0A 1T1IA 3GJYA 4ZO4A 2CUZA 4GGPA 4NOJA 4E09A 5CXXA 1SOWA 1KJWA 1OREA 1KJNA 2OAEA 2EDAA 4BB5A 4CLEA 2XUPA 3HBNA 3S8YA 3MINA 1MT3A 4B87A 5FLEX 4FWTA 1Q74A 1BE0A 2I4IA 1O94A 4N82A 4JSTA 5CURA 4EBFA 3PR3A 4B09A 3LXMA 4PYNA 1U8CB 1X9GA 1ZFNA 3OCUA 4Q02A 4BRWA 1QYDA 1GQYA 2DFNA 2ZQ5A 4R7GA 1I3MA 4M1MA 2AFHE 3TI7A 4EL0A 5E0KB 3KZOA 1Y6ZA 1ZMXA 4G86A 4F21A 4HT3B 3AR4A 3GMTA 3NWPA 1JQ3A 3RC8A 1VP9A 1AN9A 1IHXA 2ZVJA 4AFNA 2OD7A 4FM9A 4AB1A 2HRBA 3TQRA 3VHQA 2TS1A 1J9ZA 4RHUA 5KNCA 3OWHA 4C0AC 4Z9AA 3ASYA 1ZGGA 2QYOA 2UZIR 4X5OA 3AZOA 4R7ZA 3SHOA 2F8LA 3F47A 4P5PA 1QYRA 5KC9A 4WCDA 1G5TA 3R8XA 2G8NA 2GN4A 2GD0A 4II3A 5K51A 4F6RA 2ZBDA 1M0WA 4B6JA 4HC4A 1DTEA 3MS4A 2PWPA 3PWZA 4F3TA 1PQUA 3C8ZA 8ADHA 3OF3A 2VHTA 3HFSA 1E1RA 3WQQA 4GYYA 1KBOA 2PX2A 2Q7OE 3HR4A 1VG8A 1TLTA 2WYVA 3MMXA 4FKMA 4XX0A 5ULLA 1WMDA 3WJ7A 5FNZA 5DWQA 2PLNA 2QW1A 1N0VC 3GBVA 4UPDA 1VZ2A 5FBHA 1V35A 4PCVA 2EFJA 1FUEA 1AURA 3UJDA 2BKAA 4PBTA 3SY8A 1S01A 3ZE9A 4UZEA 4DDUA 5C46F 4QAJA 4Z8YA 4YMIA 5SYNA 4N65A 4J16A 2BEUA 4OGWA 3OOEA 4WKOA 1EX7A 1T9DA 4NE9A 4W9MC 1ISPA 2P30A 1H5QA 4EZIA 3E2PA 3M5CA 3MLEA 3SIXA 5ED4A 3FDXA 2IZZA 2PSDA 2YMQA 3FWPA 3N76A 4FDTA 4L9AA 1JLSA 4MRMA 3UKOA 3HCRA 1Z2DA 3R75A 4B4UA 3IELA 1M2EA 1T4DA 2XNKA 1E6MA 2XGOA 4G0UA 2AJTA 2WF5A 2C59A 2BL4A 1E18A 2FPUA 1Y98A 2J5KA 3CNHA 3DCJA 4HWPA 4FYHA 4LMRA 4V0ME 4RPLA 4YXWA 1P2UA 3PZBA 3UG7A 4BZXA 4EJ0A 3H6HA 2CDRA 4EKGA 5EXDA 5DM60 4F6LA 3IOEA 1CUGA 2HIHA 4KDEA 4R84A 1CLEA 1E3DA 1TUBA 2GBLA 3L9XA 3PEWA 3VYUB 3WL3A 2QL9A 3MCZA 3QVGA 3KJZA 3OT5A 3RTGA 3SDBA 5AUPB 4DJFC 2XCQA 5KTYA 1E0JA 3A1VA 4RCZA 3NDBB 1D1QA 5I6DA 1P0PA 5CT4A 1JAXA 1BS9A 5HJEA 4PZ9A 4TTAA 1JI3A 3CFYA 2VUUA 1XN4A 4Z3OA 4LJ4A 3ZEIA 3ZCUA 1JKXA 4OKIA 2Q7XA 2WSBA 3BB1A 4X7MA 2B61A 4YJGA 3ROXA 4BTEA 1JDUA 2MDTA 2HNBA 2QDKA 3ZWNA 1B1CA 1IFXA 4PAOA 4RANA 3LNTA 1G64A 1TC1A 1RHMA 2B6NA 2NQ8A 5EZQA 1JSZA 4EG6A 2P4QA 4Y6OA 1NMXA 2C5BA 3O8OB 1T2UA 2BSQA 1G4AE 1SVSA 2FPRA 3KJXA 2HKIA 3HI4A 3DV0A 4URUR 1YS7A 5K2MA 4BTVA 3HSYA 3UPTA 1T5LA 1JIJA 2UVPB 3BWDD 2JFFA 1WVGA 1MH1A 4D5GA 2FPXA 2VDQB 1Z2EA 5EKTA 2NGRA 3BWCA 1Z9BA 5AVZA 5EJGA 2ZRCA 4REMA 4TN1A 1DUVG 1RKXA 3RC2A 2G5CA 1BQ3A 1RPNA 1KL7A 2Q2VA 5CPFA 1QIIA 4MVXA 5CX4A 1JYSA 3IAAA 3Q88A 3JYLA 4PM4A 4I1YA 3QRWA 3NW9A 1DADA 1P91A 2VQ3A 1SIBE 3L0OA 4ZOLF 1AVTA 5LDDC 2I8AA 2DB3A 5F9MA 1YS9A 3TBFA 4BFZA 5FI3A 3B38A 5ELLA 2H1RA 2V4MA 4MIYA 5CFNA 3BFJA 3KEGA 4CKBB 4ZYXA 4N5LA 1ZXLA 2JCYA 1HR0B 4JB8A 5T67A 3DWGA 4RK7A 1G5PA 2IL1A 1GG8A 3A9UA 4UHFA 1D1PA 1MA0A 3NZEA 4UQOA 5TPWA 1SAYA 1E9RA 1H6DA 1OWPA 3RRJA 1YZFA 4C21A 4CKEB 2V0CA 4E21A 1XTQA 4EKNB 4F5YA 4UTRA 4O4LB 4BPBA 1PK9A 4FN5A 4DUPA 3PA6A 2K5UA 2HMSA 3LTEA 1XRMA 3JYOA 4J1TA 4R1NA 4ZKEA 3TOXA 5IC6A 1Z4OA 3N1UA 5CFMA 3COSA 1OHHD 3OLCX 3U4HA 2I33A 4PHCA 1K68A 1ZUIA 3OE7A 4MUAA 5JI2E 1RKVA 2CBXA 3GRVA 4UBLA 1E0DA 1Q19A 2XKKA 4IJ5A 3TAUA 1WPXA 2XB9A 1RFLA 3VISA 2FQWA 2EX4A 1II0A 2AG1A 2HSEA 3KVVA 4MVJI 4DUGA 1J5EB 1QMPA 2EGGA 4XUCA 3RF6A 2V7GA 1CJMA 5DF1A 3VGJA 3WB9A 2GF9A 1Z36A 3A1CA 4B83A 3CC8A 2X76A 1LTQA 4HDKA 4KEAA 2AV6A 5BQFA 3MD9A 2WUDA 4W4TA 4WFIA 2BOVA 4A5OA 4BO8A 4LF5B 2XMDA 4I08A 2NYVA 3N5CA 2B37A 2M6RA 2WZBA 3FRHA 4BWYA 4D74A 4M54A 1KYYA 4CIVA 2W2TA 4Y9SA 5CK5A 2IIBA 3Q9NA 5LZ9A 1S3IA 3KPVA 1ZOPA 5CH5A 1IY9A 2P3OA 3ITNA 4BNMA 1TT5B 1ZNWA 4G37A 4NCIA 5F5XA 5IBRA 3T15A 1XKLA 1WW2A 5COQA 3GH3A 4PG4A 2FRVA 2W70A 2XCUA 1SY7A 1O6ZA 2DUJA 2HK7A 2JNWA 2NO4A 2ORIA 3OT1B 3BK2A 4FDUA 4LISA 1G38A 5AW8A 3BOSA 3U19A 1DAMA 4NBUA 3QE3A 3QE0A 4E88A 4Q82A 4JVMA 4UULA 1EJ0A 2B1GA 5KVQA 2IUYA 1DEOA 4AX8A 4XWGA 3ILVA 1K2VN 4F12A 1OWNA 3V00A 4FXPA 1O58A 1KGDA 1MP0A 1B7GO 5C3UA 1YDWA 3EFEA 3FVRA 3GEPA 3VU9A 4BMYA 2BRUC 4PPQA 4S1WA 2OAQ1 4L5CA 3ZY5A 3H4MA 1WAMA 5A2GA 2KJQA 1SQSA 3C74A 2DKFA 3HDTA 4ZRNA 2DHCA 5TQJA 3CLSD 3O4IA 1RXUA 1ARZA 2E4AA 3LPCA 4KZKA 4JGBA 3FRJA 1I2ZA 3T4XA 4BS9A 1NY5A 4U9HS 4D97A 5JNRA 4PIMA 2NNLD 1XD2A 3DZBA 5YASA 1PX2A 2Q6KA 1HTBA 2QAGC 5JAOA 1KOFA 4JJFA 4LWPA 3E84A 1PEAA 2C04A 4JC0A 4P84A 1UF9A 1YFLA 4M1QA 3C7AA 4UE6A 2UVPA 4DBZA 4B4KA 2EBWA 4X84A 5BV8A 5LYYA 2PH5A 2XVZA 3NTUA 4QTXA 4FR0A 5DX1A 2NNWB 2OV8A 1THZA 5GY7A 2BEVA 4F2WA 3OBBA 2XB8A 5EL0A 2LUOA 3TZLA 1XWIA 3N6RA 4LS3A 2W48A 4ERXA 4F2PA 4OLBA 1UBOS 1U1EA 1YB1A 2OD9A 3QPVA 4TV9F 4ZREA 5EHQA 4PCLA 5IH3A 3ESQA 1OPXA 2OPBA 1ZSNA 2VL7A 3NHYA 5E4TA 3S29A 3MERA 1G7CA 5JS1A 4V0NA 4A2QA 3I1YA 2WUGA 4XEHA 4PNEA 1UP4A 4GWLA 1KI4A 3V7NA 1X74A 3C1OA 4QGFA 1XDSA 4WLUA 4C04A 4YAGA 3R0VA 5MDHA 3SZUA 1U7XA 1LX6A 2LCIA 2XE6A 1KY2A 3NIWA 5E6UB 4HXGA 4ARUA 1FZTA 2WIAA 4QREA 3HY6A 3U4IA 4Y18A 3ZW9A 2OV1A 2QNIA 3T7TA 2CWWA 2WA1A 2J8ZA 1H2FA 3CZ9A 1F38A 4RF3A 3GUCA 4X65B 2ODQA 2CVHA 1Q12A 1KYZA 3AIKA 3WAKA 5HR5A 1B3BA 1N0IA 2ZSEA 2RGGA 1PS9A 1WXXA 3O92A 2CZCA 1XVIA 2YHIB 2CD7A 3BK7A 1DEAA 3AW8A 4FIZA 1POXA 4PX5A 4JQSA 3U4MA 4YFVA 1S8AA 4BZPA 1U7TA 4G0VA 5JRJA 4P4GA 1N6OA 2JCBA 1PZEA 1LNSA 4R31A 4P6VF 3NKLA 3PJGA 3CPSA 4RJJA 4GP9A 1IULA 1FE8A 1K9SA 1QHHB 2JHGA 4NBRA 2CK3D 4X00A 4TUYF 4C0LA 2ADMA 4B71A 3EVCA 4OGGA 3NEPX 4X95A 2QROA 1JDNA 2XTAA 3MLAA 3RBAA 3SQWA 1AH2A 1NQVA 2B8TA 4M7RA 3KHUA 2NTVA 1M76A 4HS4A 1UMCB 4EPYA 2HWXA 5ITZB 2XE8A 2XMGA 2ZJ1A 1DP4A 3O1LA 4I50A 3GRKA 5DBHX 3A4IA 4TMKA 2P68A 3U3RA 5AW4A 5HW0A 1ZMBA 2JJ2D 3D1LA 4NEGA 1LDMA 4X8HA 1HEUA 2JLSA 3TW8A 3LGXA 3UZUA 3UY4A 1REQA 1U5CA 2IIPA 6GPBA 4QG3A 1I3OA 4GOKA 3DVAB 3MTBA 1IAQA 4OTZA 2ZRGA 2GN6A 3E2IA 5A5EA 1K1EA 2G4LA 3ONFA 2FFAA 1RCTE 1HTWA 1GLGA 1RRVA 2J3DA 3FKSA 2VK2A 2ZRHA 4H3SA 2CNKA 1Q0SA 5CTJA 1P17A 1KY5A 3PGJA 3FR7A 1GP2A 3OJFA 3RREA 3IALA 1SIWA 1JT2A 1KPHA 2NXWA 4Q9LA 4RLHA 2D54A 3BB4A 3VKFA 4AS2A 4B9EA 2P1DA 5CCXA 1CP3A 1XK7A 3H16A 3IA2A 1JIVA 1X1TA 1PZFA 1W19A 3B1YA 2H5EA 4FGZA 1X8KA 2EFCB 1SH7A 2NW6A 2OZVA 3CZMA 3VTAA 5EMHA 1MFZA 2ZYGA 1ISGA 1FDSA 3IFSA 4P2GA 2BRUA 4O4JF 4RABA 3BBPA 4BRZA 5K0CA 4H35A 5DNEA 5ALQA 1RE1A 5IVIA 3S40A 4E5KA 1QQ7A 5CM2Z 5G1PA 2PMEA 3G0HA 1F7VA 4X6LA 5F77A 2GPJA 3ZDCA 3H04A 3C5EA 1KFEB 1C0IA 4U39A 1ZM4A 2DHEA 2Y0DA 3IQFA 2X2PA 3OZAA 1XVLA 1A8HA 2SKDA 4IFEA 4MRSA 3ERCA 3IUNA 4QXMA 2GYVA 4EY5A 3Q2OA 3R74A 4CLOA 5EI5A 5J5AA 1FX0B 3GGCA 3NM6B 2WVHA 4G9GA 4FFBB 4PZCA 2ORVA 3AG6A 3VR6D 3CZ4A 3ILSA 3OJLA 1RP1A 4OYLA 5TARA 5CB4A 4UBKA 4QXRA 2ZZNA 2HLHA 1MEOA 1A96A 4HGNA 1WOMA 2X22A 4G23A 3AEUA 3K70B 1QGYA 3I6QA 2VHCA 5DNWA 4QFCA 3OZEA 1IBMB 3G85A 1OI7A 3O31A 4K05A 1KGSA 3DWEX 4E3WA 1JJIA 2J46A 2EATA 3H0KA 1AQIA 1THMA 4OV6B 5BMVB 1L1FA 1JGTA 1IJBA 1JMVA 1JLRA 1PCXA 1FNDA 2UUPA 1EK0A 1HEIA 2RONA 3PNQA 5JE8A 3RC7A 1XBTA 3EGXA 3AM1A 4AECA 5JR3A 3WFJA 3ZN2A 4FFPA 1XMXA 3D4PA 3CUEF 1IOLA 2C29D 5B6IA 4IJUA 5AJYA 3O8QA 1HSZA 4IRUB 3ZE7A 4IOMA 1AZTA 2X77A 3TLXA 3S1SA 1P2VA 1I4LD 2ONZA 3FBTA 5G41A 1LI5A 3UTDA 2PKQO 1B00A 2WDPA 3S8MA 1PS0A 2BMVA 3GJ7A 1R50A 1M7GA 1AHPA 3CH7A 3QG1A 3WWCA 4F7WA 1R0SA 2HK9A 5EJEA 3SVZA 5KWEA 3CMCO 4LQ4A 1C9YA 1XMSA 2JG3A 2ACVA 3EGEA 3MXOA 3CLRD 4NZMA 4LZAA 3AHEA 3JWJA 2XHZA 3F6EX 2ZIAA 3RVMA 3E5HA 2M2IA 3GRCA 3O9ZA 1V8DA 3UGTA 2F90A 2I2BA 1RQPA 3A3KA 4PANA 4CIYA 4Q34A 1EBFA 1C80A 4JK3A 4PGMA 3ISJA 4US0R 3ODPA 2JGAA 3IR6A 5AK5A 3TRFA 3V8MA 5KHLB 4H6XA 7MHTA 1TADA 4BN0A 1EGMB 5JNSA 3F3YA 2CWDA 1JDSA 1GPJA 1UPAA 4FSDA 4RF2A 4UAUA 4LFBB 3O75A 1XDGA 2IA5A 3AEYA 2A9VA 1ZEMA 4B81A 2G7MC 2WBLC 2ZT8A 1TIPA 5SV2A 3MOIA 1KHHA 1Y5NA 2H4XA 2XNHA 5CH3A 4HXFB 1KQ3A 1RPAA 3FM9A 3KQVA 4I81A 1HYHA 3QI2A 3B48A 2AOUA 3G2PA 2FN4A 4N03A 3RT9A 3SSAA 1NJFA 3NDIA 5J4VA 4QBIA 1TM5E 3JRWA 4CQNA 4XWYA 5DASA 1UWCA 4FGKA 1MQ8B 2R86A 1E3SA 2A84A 4V2IA 3BA6A 1TUEA 2NTEA 1Z18A 4FNOA 3PHJA 1E58A 3NPAA 1QKIA 4JXZA 2I91A 3F98A 1NE2A 3OIFA 3Q9LA 2HU8A 4WDRA 1SKUA 4X97A 4P53A 3T0GA 5EFOA 3PICA 2DWUA 4HI0E 3EBLA 4D8XA 4GQIA 3PNLA 4EMUA 4UMDA 3AI7A 3F8TA 1P5FA 4OHRA 4KPGA 2XJ9A 4RADA 4OEHA 1LCIA 1O6FA 1JLHA 3EPJA 1JG6A 1UFRA 2F3TA 2RHOA 2O8BB 4GUDA 4RE5A 1E3TA 2NVUA 3ZUPA 2FY8A 1AV6A 1T3LA 3NVAA 4G0NA 1PHPA 1ZNZA 2HXGA 3EVFA 1ZHFA 2HMVA 2X7XA 3F97A 1I36A 3NBMA 1X92A 5THQA 1ZGBA 4WKGA 3AWIA 3R09A 1C1XB 4YC7A 5J4LA 2DCMA 4QOHA 2X8WA 3AF0A 3CF4G 1H05A 5LNK6 4LRUA 3DBLA 3L43A 1QRUA 3PNKA 3C3DA 3ZS9A 2YJ3A 3Q3GE 2PUWA 4MVJD 3VRHA 5JVDF 4U2DA 5FTLA 1SCUB 3N2GB 1VRCA 1Z5VA 3WC4A 1NZJA 2G09A 2P9TA 2PSJA 2PRJA 2Z3WA 3N2EA 3FJ1A 3QVVA 4P8RA 4KQXA 4RVUA 1ORDA 2D8AA 3C8UA 3JPYA 5DM1A 1D7AA 2HY7A 2P78A 2E1RA 2MYUA 1QHFA 1N5MA 5HK9A 1RI3A 1XRRA 3AB8A 5BQ3A 1IXKA 3EZ9A 5JJKA 1R9GA 1ATZA 1H2RS 1Z62A 2J33A 1PSZA 5IUJC 3UANA 4JYZA 2GNAA 1OR8A 3Q7SA 3PUVA 1U0RA 4ETIA 2ERYA 5P21A 2B4QA 4BV8A 4WBXC 1E3WA 2ZVQX 2WWGA 1THGA 2BMWA 3EXG2 3ROKA 1Z6TA 2ZRFA 3DYBA 2VNSA 1XRLA 4WY5A 4U7PB 1DUSA 2IQIA 4YR7A 2HRQA 3BGIA 3AVYA 4PLGA 3PI6A 1ODKA 4Z9BA 1DZIA 3ZNOA 5ERGB 1K0UA 3B53X 4UDOA 5FEUA 8GPBA 2K4MA 1K5PA 2F67A 4D46A 2GD6A 1DI0A 3M2PA 3UMMA 1TRHA 3S55A 1SBIA 2WVGA 4NNOA 4CKBA 1SCNE 4BMOB 1JE0A 3MGAA 5IJ0B 4KO4S 4CEIA 2OMEA 3HN6A 4H1WA 3P0FA 3BZWA 3SOZA 5A4AA 5B2EA 2IPAB 1G8GA 5LNK1 1S8OA 2J3LA 1E20A 1R0BA 3OT4A 2HIGA 3U3KA 3ZR4B 5KYWA 1R37A 3GGDA 2WQ6A 2PZJA 4RBNA 4CKCB 2D13A 4MYCA 3MD0A 3AHHA 5CA0B 2EKDA 3E5MA 1HGXA 2YJGA 3FOCA 1FLAA 4Y9DA 1OZHA 1ECPA 5EJ7A 1S0UA 4N9WA 5DWDA 5K03A 5F3WB 1L7AA 4IIGA 4P08A 4RVCA 1R6DA 4LYYA 2AJDA 4DMMA 1BMQA 3Q85A 1U0NA 1PNOA 3EAQA 4U8GA 3Q8LA 4M4SA 1SK9A 1M2OA 3T9CA 5KQPA 3HY3A 3ESDA 3TD6A 4M6WA 3VYTB 3W79A 1IU9A 4HUJA 3GZJA 2D7CA 4HXEB 1I0LA 1YS6A 3M2TA 3EDCA 4BIIA 2G8LA 3OD5A 1T4BA 2GLUA 1ENYA 2PGAA 4OKNA 3TBHA 3UB4A 1Y8RB 5C9ZA 1DDGA 1PUXA 2P67A 1JQ5A 4XVHA 4EW2A 3PE3A 4KR2A 1A7UA 3NHRA 5CFQA 4BE9A 3E5RA 3UFXA 1FDOA 2XAAA 3DAFA 2IE0A 3INYA 2IEBA 5DP1A 4NX2A 1PEKE 4AG3A 1N3IA 4K9DA 4XIIA 4ALKA 3NFYA 1Z0SA 2YRFA 3ICOA 5AJWA 5DBFA 2ZWOA 4P4UA 3VHLB 5AVUA 2VDVE 2VHXA 3JZAA 3DZ8A 1P7ZA 2R79A 2ACWA 1IRXA 4JS0A 2QRVB 3TW4A 3USES 4Y6QA 2O7VA 4N0EA 1NJSA 4D3XA 1D6SA 2H0RA 4D9FA 3LYLA 4I1SA 1WMFA 4X1YA 3V1UA 1GGJA 3CV3A 3DVAA 4BLOA 4NCBA 1D1SA 2B94A 5AYVA 4MYHA 4AU1A 1L5ZA 2P41A 4JCOA 1SHZA 3PC6A 3QITA 4H0NA 3TIFA 4BFYA 4ZDIA 1V37A 1XQ9A 1YQTA 1UDWA 3TD9A 4OK5A 2VJMB 2XUAA 1IEXA 3TQFA 4BGVA 2QTMA 2MIIA 4XCVA 3E7FA 4CGZA 3DC2A 4QRHA 2JFNA 4S35A 3AB7A 1PFWA 3HU5A 4MICA 1HURA 2IYWA 4ARAA 4HSEA 5DM0A 1DRJA 3CPJB 2UV8A 1P6QA 2H48A 4K26A 2RI0A 4EI7A 4F2DA 4IDFA 5AJTA 4D0LB 3BA1A 1I10A 2HK6A 3PZRA 1Q57A 3T95A 1JBKA 1G21E 2PX3A 1X7WB 2VCHA 2FP4B 2ZWPA 1OU0A 4FBLA 5H4HA 1VJCA 2X15A 3RFXA 3BTOA 3RI3A 2OOSA 4CV1A 3KL2A 4ZKDA 3U62A 3WYGA 3BBLA 4B7XA 1XYVA 1UJ4A 5G0VA 1DPGA 4HQLA 1YHYA 2GN2A 4RESA 3ZQ6A 4AJJA 2QLBA 2IS6A 3N07A 5J23A 5TRTA 2QQ5A 3T0FA 3VZSA 1NUTA 2VXYA 1UZUA 1GZ5A 1KNQA 3GN2A 1GFSA 3GA7A 1K8XB 1XCOA 1UBNA 2ECOA 2ZS7A 2GCPA 1OLOA 1YI0A 1OUMA 3LZCA 1TOAA 2YNMD 4JEIA 2QMUA 1DXOA 1KAHA 1UEJA 4YB8A 1VRWA 2EFGA 3S2IA 3AXSA 1QVVA 2ZBQA 3HU1A 1WDLA 2R97A 3SFZA 7ADHA 4OMFG 5IMSA 4YJDA 1I2AA 1IQ0A 4R2WA 1A2BA 3AEUB 3AFMA 4B3IA 3RTDA 1T8PA 1WB6A 3CPEA 3HQ4O 1LNQA 2CFSA 3WKEA 5ALLA 3AL0C 1TCCA 2H16A 5DNAA 3HO1A 3K09C 5ESRA 3ONWA 4IP0A 3LOUA 5LQRA 4UPVA 4OH1A 3BT7A 4Q6BA 2FG5A 1U4OA 1E2LA 4O2AF 5GV7A 1I7LA 1PO7A 3KOWA 2B3TA 1V8FA 4EH1A 2OLEA 1V9CA 2ZTHA 2EZUA 5KS2A 3L4EA 2QPAA 2ET6A 2ZE6A 4LVNA 1EZ4A 3ULKA 4IQGA 5K20A 5KSPA 1XCBA 1UZMA 4F4FA 1MEJA 3KJEA 3BIOA 2ERCA 4GI5A 1PDVA 5FWXB 1KAOA 2JBAA 1M2WA 1VSVA 4Z1OA 4HNUA 5H81A 2W0SA 3W6ZA 3QEKA 3FWHA 4Q3BA 2PUDA 4YRMA 1E4EB 5BN3A 4G5GA 4AG6A 4J2OA 4FOLA 2B69A 2NZ8A 4CT4B 2AX3A 4CUKA 5JJLA 4JOQA 1Z7EA 2XNDD 3A14A 3I1IA 4FHZA 1JAYA 4V0MA 2PKEA 5G0TA 3RH0A 4DMLA 4ZI7A 2H2GA 2LCQA 4IAOA 1R6AA 1UOOA 3BGVA 4IMIB 1QG4A 4LOLA 2VWHA 5EJ9A 4X3PA 3UGKA 2HWWA 3VH3A 3WMWA 4UHCA 3ZGNA 3HUEA 3Q0EA 1PJ8A 5KPDA 4RXMA 1MQAA 1C1YA 1EVQA 2AN1A 3FPFA 4ZVRA 5JXHA 1O5IA 1LPBB 2HW8A 2FZKA 1UJNA 3HP7A 1GKYA 2XUGA 3BYZA 3C24A 5EMNA 4YA6A 5AHXA 4CM9D 4OL9A 1Z82A 3P32A 3WYFA 1AD2A 1YH3A 2V8BA 2V7UA 3A0RB 3P0JA 2WD9A 4FLFA 3EOAI 3Q3VA 3D5QA 2IEIA 3WADA 2BGWA 3REQA 3GXOA 2QLNA 4CDMA 3JQFC 2QRVA 4TL6A 2WYIA 4BU0A 3I9FA 1JEEA 3AMVA 2PVCA 3WK4A 3LWDA 2I55A 2QDXA 2VZ0A 1M5TA 2O8VA 3DDZX 2RHBA 4OXXA 4EG3A 4X44A 1EFLA 3I2KA 1C7EA 3ETHA 3P7MA 3HADA 3RC3A 3WIDA 2RB5A 2Z2ZA 4DUGD 3WMRA 3F7OA 2CFOA 5DDIP 1GCAA 3U7JA 2BR4A 5C8XA 4HATA 4YCLA 5H02A 2C3UA 2W42A 4TKUB 1KBQA 5BSFA 2EX0A 1VMKA 2AOTA 2C5HA 1P8JA 2YQ4A 4HEQA 2VWPA 1YL6A 4YREA 5GZ3A 2CLSA 3DYVA 3PQFA 3DE5X 1Q7RA 1FP7A 1KO5A 2AMFA 2OBMA 2Q9BA 2I0FA 3FFBA 3H6GA 1PZMA 4MGYR 3WL4A 1U5BA 4M8NE 2ETVA 2FMKA 1JHMA 4LSMA 2DYKA 1W25A 1EK1A 3GCZA 4QBKA 2OYCA 3E35A 4HGQA 3NRBA 2B2NA 3AILA 4K46A 5ES3A 3UW3A 1MJNA 3GR6A 3T7JA 2WTAA 1JSCA 1UAGA 3PQDA 3O8LA 2NOAA 2YN2A 4NPAA 5FI0B 4LFCB 3CNEA 5M34A 1BG6A 1QFMA 2W0MA 3K2EA 3CY6A 3ISVA 3M3PA 1U9IA 3NYWA 5FPQA 4TV8A 1SBCA 1ECLA 1I6LA 1ZAYA 5FOXA 3AVXA 1XC7A 2ONCA 2BI4A 3I83A 2DLNA 2QM3A 2HMAA 2OZEA 4JP1A 1EGVB 2RGNC 1GQ2A 4NJEA 1Q7GA 4ND8B 2WU3A 5C7IO 2YV1A 3KRTA 4HAYA 4AIIA 1BGWA 1JSXA 5F33A 5JDCC 5JSFA 1XPUA 1O8CA 4B4DA 2Z4SA 1Z0FA 4DILA 3U3MA 2XIJA 1FYWA 4YX9A 5CXQA 5A9SA 2RI6A 3GPBA 2PSHA 3DZCA 2AQ8A 3PDCA 2B5WA 1N9ZA 3DOEA 3P9QA 1MZVA 1XVUA 4GM0A 5CUQA 4ESVA 2IHVA 1U7ZA 2AH5A 2PY6A 4TZ6A 4QX6A 5DW0A 3R3YA 4LY6A 4YDHB 4N3GA 1KRHA 3W1WA 3A9WA 3RW9A 4ML3A 4MS3A 3ZW8A 4KGXA 4H1UA 1IM2A 1S3FA 3H13A 5CHYA 1OXTA 2G7ZA 2I2WA 3NVMB 4BFUA 4I4NA 2OXRA 1ZYUA 1SG6A 3K53A 1U1FA 3L18A 5JXWA 1UJMA 5FO1A 3KZKA 1VG1A 2HT6A 3UATA 3FLBA 1JQJC 3VH2A 4LF8B 2FUG6 3M6WA 1U3CA 4Q21A 3FGOA 1JXQA 4EHAA 3PUKA 7REQB 2Q0HA 4H7FA 1X42A 3MGCA 5COBA 5TDHA 1U1DA 1KO4A 1Q1GA 3G7SA 4Q1BA 2WT9A 1ACMA 2VPXA 4HAOA 1C0KA 2VSXA 3Q8WA 2KE5A 5A6VA 4GL2A 1QUEA 4U2EA 3T7CA 1CVIA 3NHSA 5LZ2A 5L6LB 2V4ZA 3VYWA 1KETA 5GM1A 2RGCA 3AC0A 2OHXA 2H07A 2X1VA 4E2YA 5KHOC 3LUAA 2NV0A 3B78A 1T15A 3KIPA 3SIRA 5BUSA 3MELA 2FSVC 5HRCA 3D2LA 4H16A 2QVYX 4X7BA 3C7KA 4EHHA 3R2JA 4CUJA 3LA6A 5HFAA 4F06A 2CLEB 2E4VA 2WHPA 5F3DA 1KERA 5BWBA 5IH7A 3Q8KA 1N36B 3CW9A 4KSCA 1O94C 3QA9A 4GZ3A 4ABYA 2UZ4A 1TD1A 2IODA 1MO6A 8AT1A 4C0JA 4JLVA 1QOPB 2PU7A 4UEQA 1E9SA 3MS2A 3OZXA 1VI6A 1XU4A 1ZI6A 1K08A 3D8UA 3FYUB 4M8IA 5EMLA 1LDYA 1S2IA 2GWHA 1FY2A 2CB9A 4FLEA 3A31A 4KN6A 1CR0A 3EX7C 4BNJA 1XLTA 3IP6A 3RRXA 3SWWA 3L1UA 3R7AA 2J6HA 1GN8A 3KXDA 1KPGA 2VDJA 4WN9B 3E3NA 2VBGA 3TM4A 3BMQB 1ULTA 4RMHA 4HF7A 2C78A 3UH0A 1E2BA 4D3ZA 4H31A 4PLFA 3TLJA 3ZS8A 4KAAA 5ALXA 1EG2A 5AW9A 1SULA 3UHAA 1CDOA 2EERA 5KMGA 4IYRA 4RTNA 3CUUA 4GXTA 2F43B 4ESHA 2BW0A 5DX0A 4HNTA 2DMRA 3KG2A 3GEMA 2FWAA 2Q5CA 2C9BA 3QKTA 4AM8A 3FZNA 4KVFA 2JHPA 5L9AA 1FYXA 1ZR4A 4IR7A 4FGWA 4XM1A 2CNBA 2HZ7A 3NC1C 3JPWA 3H8SA 2CFRA 1UJCA 1KI6A 4OHCA 4B3XA 5JSZB 4G01B 3QLVC 2YYAA 3D7SA 1ZIXA 5JH7A 2WJWA 4CQMA 1S2MA 2G1AA 4Q66C 1Z4PX 5EQTA 1GNPA 1ACJA 2B1QA 2C94A 1KORA 4IM7A 5JWHA 1KKLA 1E3IA 4ZAZA 5HIKA 4J94A 3DL4A 1XXLA 4L7VA 1RRGA 3PL5A 1D1TA 3WLLA 3FUVA 3LL4A 3QOFA 3U2QA 1XV5A 4YCJA 1NVGA 1BE6A 3L2OB 4ZRDA 1DVRA 1UJBA 2CK3A 1KVSA 2OCYC 3ZV5A 2TMYA 3TLCA 1V4BA 1FZQA 4JQYA 1U7WA 2JFYA 2P91A 4L4UA 2B82A 2DKOA 4BNKA 3UVEA 3KYCB 2NSLA 1NFRA 1MX1A 2OHHA 3LDFA 4HWGA 4LSWA 4A8JA 3W0LB 1N9GB 1Q11A 3KPJA 3QU7A 3RBZA 5FX2A 1N6LA 3DT9A 4PX2A 3R5HA 5AKIA 2EFEB 3GQBA 4PZ0A 4WQMA 4BE4A 3P2MA 3PGVA 1X15A 1IPEA 4MQLA 1T0PA 4BUZA 3KVRA 3L7DA 5IEBA 5IKOA 1ZL0A 3FNBA 1JNXX 1QHGA 3EY9A 3CYFA 3CWQA 2B4AA 1M1UA 1YR1A 4OMCA 2OFWA 1I24A 4Q00A 4TWBA 3TRKA 1SC9A 4NMLA 1XTBA 1W5FA 3INNA 2ZJ3A 4NAVA 1S9DA 4EG0A 2PAFA 5DK4A 1SCAA 2WU8A 2W93A 2Z83A 4HAUA 5EVCA 4F8JA 4E70A 1ZRMA 3BXEA 1N2IA 5D3MB 2QW0X 3AUFA 2X4DA 1GNSA 3H4VA 3ZJ4A 5K3EA 3ZWWA 1WU8A 2ZBFA 1J0CA 1F2DA 2JVKA 4O33A 3QNWA 5GJCA 5DCUA 3H5NA 1JECA 2ZWIA 3RIGA 2ZR8A 2ADFA 2YUIA 4UBIA 2DVMA 4OO3A 1TI7A 3DMDA 3A06A 3N28A 2C3YA 5K5EA 1U6KA 3DZJA 3KAKA 3RD5A 5AHWA 5EWJA 4LK3A 2KB0A 4J7XA 3RSFA 3CZAA 4R8RA 2J9RA 1AE1A 1PG2A 2N75A 4MVJF 5GM2A 5HKKD 1VM6A 3TWOA 1N2CB 1SC1A 2QY9A 1WG8A 2F8SA 2WT8A 1JKJB 1EESA 1TRKA 3K1JA 4GLBA 4L8WB 1SU4A 3UA3A 4MYSA 5AI5A 1E6LA 2O50A 1W6RA 4WFJA 2WHPB 4DCNA 1DRUA 3ESAA 3VR3D 4D42A 5C80A 1D2MA 2NADA 4QOSA 1JDBB 1Z06A 2H5JA 3VPBA 5D5QA 3DE0X 1VSTA 1VIYA 3M7IA 4FUTA 3O82A 2W2VA 3FYUA 2H0AA 4RVGA 4QGGA 1N1EA 3MXTA 2I2FA 2JCVA 2DWQA 3RAJA 1V7QA 1KARA 3I76A 1UXHA 3IRVA 4JNCA 1KAQA 4IH4A 1FTQA 5TB5A 3REGA 5LDHA 3HXQA 5AVQA 2DR0A 1ZO8A 1FU4A 3G2NA 3UCEA 1Y7TA 4ZT3A 1X38A 1MTZA 2NYAA 4RD3A 4C4ZA 1EHIA 3OE7D 4LY3A 5L3SB 3WRXA 4MW0A 2G28A 1BD3A 1ZUNB 4XUEA 1C14A 4ZN6A 1G6Q1 4MQUA 1F0YA 1LPNA 1N3YA 4GKVA 1B4DA 1X8JA 2P0YA 2QQ0A 4Q9NA 1Q95A 2DWCA 4LJ9A 3T3GA 3JVDA 3EAGA 1GYRA 4TZKA 2V7PA 1N57A 4L3WA 4TYMA 5EGNA 4YRPA 1C7IA 1Z4JA 2QVCA 2C98A 1M34E 2VEOA 5FLKA 4JQCA 5FUXA 2VAWA 3KWMA 3ROFA 4YRSA 1YHZA 5JQGB 2X2FA 1L1QA 2RH8A 2W2OA 4BRUA 4NQZA 5B58C 1EP9A 2Y71A 4ALLA 2YQZA 3T54A 1WCIB 4GI2A 1E3LA 2J0VA 1GRCA 5JARA 2ZUSA 1VSUA 2ZUWA 2AZDA 3I8OA 1J0DA 1EVKA 4LBWA 4LJ8A 4PCAA 4ZPXA 4ZARA 5G1NA 2ZSIA 3QVOA 1DJNA 4GPAA 5CX1A 4KRFA 3CZ5A 4MR9B 1JU4A 3NONA 4R1TA 3VM6A 1VBFA 1OIVA 4WW0A 4GSKA 3UA4A 4B33A 1WO8A 1N7GA 4CQMB 1A97A 2EXXA 4TYNA 3DLHA 1AXRA 3C70A 1HRKA 4AY4A 5AI4A 1T1JA 3FMIA 1L4NA 4EMBA 3GCDA 3PD1A 3DL7A 2ZRPA 3F5FA 3KKQA 4PRKA 4QOEA 3LLVA 2GK4A 4YRGA 2C2MA 5K4GA 4RTPA 3FOFC 4MUNA 1N6PA 4I9UA 1XTSA 4DXDA 3D6NB 3NWJA 2O5CA 1USIA 2C82A 1OXMA 1ZLYA 3SR4A 1C7QA 2P7HA 1BN7A 2LWIA 2OGUA 4R9SA 2MSCB 1OZFA 4OLJA 3N59A 5IRCD 4S2UA 1NKTA 2RHJA 3Q87B 3H11B 5ALOA 2GTIA 1CQXA 2R8XA 1K7CA 1F8YA 1TO6A 1U8AA 3KJQA 4JR0A 4Q18A 1UKAA 5EKDA 3LUGA 4IHAA 3GLIB 1LNZA 2Q5LA 1DWUA 3AR3A 1QNLA 2ODTX 5JANA 3LIIA 4RZSA 4B3DA 4J3FA 4M2LA 1S5PA 1OLUA 1IVYA 2P5UA 2H52A 1MU0A 2BMEA 3K9GA 4HQOA 1JEAA 1DQNA 1YBAA 1CNEA 1D9XA 2ZQYA 4YAEA 1QO0A 5DV9A 3RSOA 2H29A 1PJAA 1QGDA 3LT1A 1Z17A 2HDHA 4MWTA 1IXSB 4MWBA 1YHNA 6Q21A 5EFZA 3LDHA 3ZVMA 1XLWA 3G68A 4ZK6A 1P60A 1UOEA 3BWEA 4LC9A 1U04A 3RRMA 1Z7WA 2F1OA 2P62A 4UM7A 2IPNA 3VZDA 5A4MS 5IAOA 1HSOA 4NCJA 3UENA 1M34B 2Y1OA 3DMYA 3CEAA 3IP8A 4LV6A 4QO8A 3EEFA 1IONA 3C48A 1G2OA 3L0IB 3IAEA 2QTVB 2ZJ5A 5EE9A 3I53A 4G8DA 2EQBA 4ZCPA 4IFBA 121PA 3TSOA 1JDTA 2DTEA 3GK3A 1DAOA 2XB4A 1KHTA 3H4TA 4XUGB 2OUKA 3UT6A 4GVLA 2CZGA 4K1XA 3THSA 6AT1A 1IQRA 3COVA 2ID9A 3EGVA 3OZTA 2RGYA 5EE1A 3RIMA 4QOGA 2D5CA 4MRMB 3A05A 2GYWA 4IZIA 3VV2A 1FTSA 3GRZA 2FMUA 4N1AA 1T6ZA 3Q11A 2I65A 2DE0X 1A9RA 1TLLA 2IRWA 2R6R1 2V9CA 1CT9A 3Q5EA 3NU1A 1I4OA 3F0TA 1VGRA 4MB6A 4MB2A 1BEUB 2X5NA 2PUGA 4DBLE 4RD1A 3X1KA 2OC4A 1Q0QA 3WNZA 1DJMA 3H9GA 1LS1A 1EGAA 2GTHA 3LS2A 1U9JA 3DKKA 3IXQA 4GGMX 4JBHA 4LJ7A 4B0OA 3T3MB 3EPLA 2XDQB 4PWYA 1CX9B 3ZI0A 3TRHA 3U7HB 4RHCA 1ECBA 5FR2A 3KEMA 2OCKA 2PO5A 4YQFA 2AZ4A 4D41A 4HAXA 2IXFA 5J2TF 1GKUB 2J0UB 1LBHA 3AP3A 2BFFA 4IDGA 2NUPB 4GEKA 3ZVRA 1A9XA 1QV6A 2D7DA 4ODIA 3JQ8A 5A4KA 3SXUB 4BPRA 3CRRA 1GPKA 3GROA 1IBCA 1H0HA 1UC4B 3QXSA 4C03A 4CIBA 3CEHA 2OKCA 2EJCA 3HB5X 2YMMA 3DDCA 4TL8A 3HKEA 1Z37A 3FUXA 4ZWNA 5L4SA 4J0DA 2E0IA 4IH9A 3QW4B 1BE1A 3IIEA 2YJ4A 5BSEA 3D6FA 3LKDA 4FJ0A 4CXMA 2HA2A 4Z99A 1GYPA 1C30A 2G88A 3E9CA 1NXWA 4FFSA 1QGZA 1Y3IA 3C1TA 4BZWA 5AHOA 2AI3A 2FE1A 5LDGA 3EWSA 1KQPA 2OZLB 3PR1A 4W8HA 4B1FA 1GU1A 4MV9A 5GGXA 5IKXA 1AKEA 1TT7A 1SHUX 2Q5QA 521PA 1O95A 3NDRA 3SMQA 2AZXA 2WKPA 4QDXA 5FFNA 1QRDA 2RGRA 3K2QA 1BW9A 1RYFA 1EYZA 4A4DA 3NI2A 4ISCA 3V5NA 2G04A 4CMEA 4EO9A 1U65A 5LLDA 1PYOA 3SKVA 4YALA 3W06A 2PN1A 1B8UA 3M6FA 1RRFA 1MHTA 4KQ9A 1A4RA 4NDAA 3Q6MA 5JT1A 4GRAA 4ZC1A 2C7QA 3MGBA 3CNOA 2P2GA 5KYKA 3V4OA 2XTZA 3PWTA 2WKSA 2BFAA 3F3MA 3LNCA 3W5JA 4ZQEA 3B20A 4M22A 3UN1A 2VNHA 5FTJA 4MLDA 2VVTA 3UTCA 3LE8A 3I61A 1QRSA 2D3TA 1IBRA 2X0KA 5H83A 5B1IA 1ZDMA 3AINA 4LGCA 2Y0PA 4DJ5X 2XECA 4JFAA 5E2BA 4BV2A 1WCYA 1IEQA 3CR7A 3LC1O 1BMFD 1MF7A 1X8XA 1Y7HA 2DUMA 1QVAA 5JSHA 2J45A 2VG8A 3F49S 3OP1A 4X91A 3STWA 4CR7A 2PVPA 3AL3A 1KO8A 2ZAGA 1LEHA 3DDHA 3NAMA 5B3AA 3C3XA 3CVOA 2JH8A 4NIMA 2UZ1A 3UJ8A 4MKXA 3OFSA 3MOSA 1OAOA 1HRDA 4R3UC 2YWRA 4JX9A 3Q8XB 4BNYA 4DTIA 1H22A 3AO0B 1H5NA 2R7KA 1GCGA 4FC7A 1V8PA 2O57A 2PMKA 2DM6A 4FNAA 4GICA 1A5TA 1L8XA 2OB2A 3D54D 4WGGA 4D3DA 3AVWA 5KSWB 2GEDA 3DMPA 3K9HA 2H17A 3L6DA 4MVJG 3PHCA 4EKDA 4FHDA 2V1UA 4IYJA 2VF5X 1FA9A 2JBHA 1VDZA 4AN1A 3ZVLA 4UM5A 2XWQA 2I9PA 3CEJA 3KYCA 5JBNA 3HKDA 5D87A 1A82A 4PZPA 3C3CA 3O3CA 5JJCA 3IQHX 2WVJA 1YMQA 3HBMA 3SJBA 2R2AA 3QSGA 1TMOA 1NT4A 4B40A 2YC4C 2XKAA 4YMVA 2GN0A 5LYJA 4BECA 2Q1XA 3MB8A 3IQEA 5BPHA 1QU3A 5EZ5A 5TEVA 5KUTA 1Y4SA 4HLQB 4C7MA 2YMLA 3IV6A 5HM8A 1LDEA 2I9KA 4ZODA 3WIUA 4EPTA 5H70A 2F1KA 4AMBA 1N75A 2PKRA 5HX7A 1AQNA 1HX7A 1ZOOA 3R9WA 3W34A 3IODA 1JHYA 3OHSX 2HO4A 1E99A 1WCV1 1GCOA 5K2OA 1R4AA 3IRUA 1PK7A 1BYIA 1JQDA 2GS9A 3INGA 3TTUA 3EFOB 5BOSA 4UNSA 2WTNA 1YZ3A 3U1TA 4KHZA 2GO1A 2OCBA 5FBKA 4DAEA 2EJTA 2A4KA 2PUTA 1TO2E 4YCAA 1PR0A 4X0EA 2HF2A 3LQ4A 2J5XA 1Q1BA 3W8EA 3PDIB 1YB2A 2BUBA 4C4OA 2GXUA 1O03A 2GYYA 1LZKA 3I32A 4XD2A 3SC4A 3VH4A 1RHJA 3WICA 3U4QB 3T99A 2IPXA 3GIWA 3HDGA 4YCNA 3W5AA 1Y3AA 1N5RA 2QVGA 5E6RA 1HO3A 1NURA 1WMAA 1GIAA 3GWZA 3SQNA 1KI2A 4F72A 4N0MA 4D8UA 2J31A 3NLLA 4P86A 1L0BA 5D3ZA 2NZJA 4O02B 1I14A 3C6XA 2WP0A 1YVUA 3CGGA 3QY0A 1HF3A 4KR0A 4KK3A 4P3OA 2IQ5A 1QZZA 1E98A 1DIAA 2RKWA 3EVGA 4O5AA 2OZLA 4PPFA 4Q16A 3EIHA 4R68A 3A9SA 2IDJA 2EHDA 4OUKX 2H7VA 3GHHA 4U7GA 5E4FA 1R00A 2L42A 4KITB 5TS3A 3T1OA 3RSGA 1YDGA 4F7DA 1MABB 1UCFA 4ZV9A 1VYUA 1D8AA 3VR3A 1QB7A 4CMCA 1C4WA 4IIUA 4KFUA 5C51B 1U81A 2I7CA 3I9MA 3WGGA 1QCZA 4QEZA 4DARA 4G0WA 1D07A 2R47A 3FPJA 3JRXA 4DCJA 2CL7X 1RBQA 1RS0A 4LPSA 4RCVA 4DMKA 3LQ2A 3MMPA 2W6PA 4FKBA 4IJ6A 3P9SA 1XKXA 3GI1A 2C92A 1BXKA 3K05A 3ZDQA 3WYBA 3GEIA 3NQ41 4OI4A 5I9SA 1LY1A 4RKRA 5CDSA 3UJ9A 2H2FA 5IFKA 3FCSB 2O54A 2GMWA 5TS2A 4KPUA 2YZMA 2PRYA 1J25A 3VKGA 5EZYF 3P8ZA 3A4LA 3QTBA 4R3WA 3ZE6A 4K86A 4MQFA 4TT8A 1XAJA 4RGBA 4IX9A 1WVIA 5CA1F 3NAZA 4P2BA 2V4UA 2O2CA 2QTAA 2WE7A 2WJIA 2VJPA 3I01A 4IHJB 5AKGA 3I23A 1EJ2A 3I42A 3JD0A 3TZCA 3TZHA 4DB2A 1V8OA 2UZ1B 1IM8A 2NIPA 1Q50A 2V59A 1DBWA 2VUTA 3K1TA 1CUVA 2WF8A 3Q7PA 3SDZA 1PW7A 4V0SA 3UGJA 1NXVA 1AZSC 3IUJA 2ZR0A 1FTYA 1KYXA 4KH1A 1YR9A 1OXSC 1WOYA 4DB4A 1PSWA 4TS9A 1WXQA 1P8AA 4GQBA 2I3ZA 4DN6A 2Y4NA 1YIOA 4J0FA 5UKDA 2RHLA 4CKWB 3LBFA 1PN3A 1NYRA 1B6RA 1GUAA 3V2UA 1VFPA 3VR4A 5J4KA 2PS3A 3V4FA 4FDLA 1K6MA 3COJA 4JLBA 4UTPA 3IT1A 4ALIA 3PSHA 3DDOA 5DNUA 4Q3LA 3LK6A 4V0KA 3A1NA 4M60A 3NJ8A 5LQUA 4QZVA 2PX5A 2HA7A 4HQFA 4ARVA 3WAGA 4HL6A 2XT0A 2FUCA 2M1XA 1USGA 1YASA 1P1BA 1R18A 3PFCA 1W5TA 1TW2A 2B30A 3H2BA 4KIGA 1TD9A 3IMGA 1KKMA 4MYRA 3RU2A 3A3NA 4IDCA 1QO9A 4ZO6A 3UMFA 2ZUTA 1KZ9A 2GHQA 4BWVA 3TSYA 4XD7D 4EB8A 5ES4B 2R6JA 2BI7A 4J75A 1Z75A 4UNRA 1UPUA 1QG6A 2WZCA 3SS9X 2DJ5A 3CLTD 2VJLA 3PWKA 4M1WA 3UMVA 1MRZA 4XB1A 3GA5A 3C3BA 3H05A 3HUTA 2HI0A 4J0HA 4Y67A 3KSBC 2IYYA 3H1GA 3D9QX 4DWVA 5IVHA 4CEIB 2CXQA 3ZY4A 1II8B 2GN1A 5BR1A 1N8KA 1F48A 1RXSA 1WP4A 3H99A 3KQQA 3P96A 3QPDA 2HYDA 1KWKA 1YR7A 1GQQA 2AF4C 2NMVA 1ZJJA 2P1ZA 2O8CB 1QBKC 3ZY2A 3LX4A 1S4MA 1L5QA 3TINA 3TQOA 1KR2A 2VDMB 3OE5A 4K9LA 4V0QA 3IT0A 2H1OA 5EY5B 1OFIA 1XZEA 2FJ0A 2A9JA 4ND3A 4NENA 3RLIA 1RZUA 3VMFA 1RBZA 2XYQA 1SU6A 4Z51A 4AQYB 1RWWA 2VPQA 1GL9B 5ERYA 3LX5A 3W78A 5FJIA 4KYIB 3ZBTA 3ISTA 4PRLA 1IJEA 1HDRA 4LMPA 3WRYA 4E22A 1RPTA 3ELBA 2AQHA 4DLUA 2DPMA 1PNVA 2ORYA 3U17A 1S4QA 3L41A 1FFXA 4CWAA 2R6CA 3LRPA 3E5NA 2O8FB 3R77A 1JR2A 1E7YA 2QT9A 1OT3A 4HPWA 5T4BA 4A3SA 3EVDA 5AD1A 4KXQA 2GXAA 1IJFA 3AHCA 1E94E 1A9XB 3U4DA 3AVTA 1EIZA 1L8QA 1E62A 1QRRA 3FDFA 3HA7A 4KMSA 3S1AA 5EIHA 1D2CA 1H3NA 3I8SA 3PC3A 4JP5A 2IGTA 4ZQIA 1DC7A 3C85A 1QF6A 1V41E 1OB5A 3NXKA 1PJZA 1SHKA 5EQFA 2F8TA 1X0VA 2VDWB 2WINI 2VA9A 4L07A 3CLHA 2AFVA 3HNPA 1QOQB 4O2BA 3ILHA 1E2QA 1E9FA 3UW1A 2A4MA 3N75A 1Q5PA 3P2IA 5ED0A 4RXTA 3GOQA 2A86A 3RVNA 1P7PA 2X42A 2ZIZA 1JXMA 3BHNA 4HPJB 5AWFC 3M3DA 1AMNA 2C03A 1JIQA 2FJPA 4AO8A 2Y1LA 4O4JB 2D1YA 4JROA 4NKRA 1SUBA 3JWGA 4R83A 3S2GA 3HO6A 3DEJA 4D4LA 5AUOB 5B4UA 5B1DA 5LUAA 1CULC 1ZWKA 2B2XA 4Y2UA 4B4VA 5ISMA 2PUEA 1WRBA 3LW8A 2O8DB 3GLGE 1EVIA 2PX4A 1PNTA 4G9BA 4RJ2A 1GXSB 2C5SA 4A0QA 2F55A 3N7TA 1I2MA 1Z0IA 2RG7A 2OORC 4IMJB 3WYCA 3KKKA 4PSAA 3AUXA 1K3FA 2VH1A 4AXBA 2B8NA 3LGSA 2CVZA 3BS4A 1M8PA 3K8YA 1B2LA 3IAM1 1CWUA 3Q3IA 4X63A 3KC2A 4WCFA 4BO1A 4YMLA 1Y3BE 2CMFA 3TOVA 1W88A 4HRXA 4PR0A 4EUNA 2D2FA 3F1KA 1MEEA 3N0TA 4JYCA 4YP6A 4MARA 5FL3A 5DMXA 2ZEJA 1NDQA 5I4CA 1UDXA 1XRJA 1Q7TA 3E03A 4GP6A 4HEA6 3PUXA 5K8LA 1IDN1 2ZDGA 2PUAA 1V3TA 4RIEA 2B0CA 5D00A 3SBDA 4F8EA 3P0IA 2B1JA 3HRKA 2O4UX 1USUA 5FA6A 1L5MA 2JFQA 1KDRA 4URHA 3THRA 1GNTA 3QENA 2AA3A 3L49A 1EFVB 4DLWA 2ZDHA 4AMUA 1D2AA 4KGVA 3VHXB 3BF8A 5L95A 2B4KA 1M2KA 4CG3A 5GONB 2HAEA 1M34A 4XIGS 5A6SA 1UXIA 4M9UA 1RAFA 3PXEA 4N7MA 3U48A 4BO6A 4URXR 1FFCA 3O3NB 4ER5A 3JX9A 3PGMA 2UYOA 4JI5B 1AS2A 1JJ7A 4O1MA 5C7YA 4RIGA 4NCXA 3VTZA 1NBMD 4KVZA 3OCXA 3WLPA 5KOHB 2VN8A 2XEXA 3LQQA 4FGSA 1LTKA 4QTZA 3FB1A 2ODEA 2DPYA 3A3OA 5CT6A 1PJ4A 1D2EA 4IIBA 3ICCA 1GVHA 1W94A 3FOEC 1NBMA 3BC1A 4JLDA 4IS3A 2CLMB 3I9V1 1DTWB 4L8GA 4MW9A 2VRWA 4MDHA 4BKPA 4EJSB 2O8BA 3D3WB 4IDQA 4FBGA 4UOZA 2PWYA 5AESA 2BWJA 4EB0A 3K7EA 3OURA 2ZTLA 1NTOA 2JH3A 1TYCA 4PC6A 3FOBA 3H9QA 4BYGA 4CI9A 2G5PA 4JB0A 4MX8A 4ZFNA 2VJDA 3WI7A 3OZGA 1XDWA 1SRRA 3BXHA 3ZDRA 3OI7A 1N6RA 4K6KA 1YRQA 4KXFB 4NYJR 4YRLA 1G6KA 3HMKA 2GEKA 3EFOA 3BH6A 4HB0A 4EFKA 5BOSB 3DSRA 3O83A 5CNJA 5JSUA 3O8RA 4JI7B 1YJ5A 4E7PA 5C5CA 1PQYA 4GE3A 4HVLA 5IBCA 1U2EA 2JI8A 4B2IA 2RIRA 3HSSA 4AYTA 1L7MA 3RTEA 4HB3A 3PDIA 3EHDA 1T5DX 3H0EA 3ZXIA 3IULA 3E9YA 2WJGA 5JDIA 4QDZA 4A23A 3O4HA 3A7DA 5BWMA 5LZ5A 2O2EA 2XZPA 3ZK9A 2PJRA 5AVJA 2FPGB 1S6YA 1QANA 2P35A 4AP5A 4N9QA 3IPXA 2JJ1A 2WM3A 2YOHA 3H1EA 1U28A 1RI4A 2WICA 3FTEA 1M10A 4UREA 2GNPA 1ZNQO 2XB6A 4L28A 4WLOA 3ZJYA 1XNHA 3QKSA 1KPIA 2GM5A 3KJNA 4LNUA 2B78A 3WNQA 2AG8A 2QYTA 4UD6A 2JI7A 3JWEA 2C0QA 4PNZA 1U4NA 3L0DA 3FDJA 4K9QA 5DP2A 4UVDA 1R4MA 2W11A 3HN7A 4G4SO 3MLBA 1W47A 1AX9A 4W9RA 1UL1X 1JHDA 3A9RA 1GGMA 1WSAA 1PFVA 3A1DA 5K0ZA 3ABSB 5EE5B 3A6KA 4NS1A 1RVDA 4HKTA 5IHXA 1GDTA 2BM9A 2OM6A 4AO7A 1LJ8A 1GLVA 2B35A 2AK2A 3KL4A 4QECA 2IYOA 5FWDA 5I9MA 4TTJA 1E2PA 4AJ4A 4RZUA 4AC9A 1XVAA 3DZFA 4LMBA 2WJHA 3HUFA 4WK4B 2AD5A 1X3SA 2Y6VA 2G71A 1F6WA 4RMNA 4NY1A 5BRAA 1TKRA 4Z2YA 4DJJA 4Z4GA 3CTPA 3SBEA 1HG0A 3PLRA 4G09A 5TQ2A 1F9AA 4U6SA 3CR8A 2HBZA 1VJRA 4IWYA 4P22A 1W88B 2Z6UA 3L7MA 1CFZA 4MWDA 5K3FB 1EWRA 1VMEA 4HQ0A 3AVUA 2FSHA 4M83A 2UXCB 4LBZA 4X1KA 2C3MA 1A9YA 3C7TA 4B6GA 2QGZA 1WM1A 3OFJA 2XNDA 4O4LA 1E0SA 4U2CA 4D9CA 1PZHA 3OZ7A 4UQLA 2FRXA 3K0HA 3DPUA 3OQ1A 4AX4A 2WSSD 3I12A 3LW7A 4LXHA 1QHYA 1TIBA 4ZCIA 4Y1GA 3RBXA 1KEZA 3PQEA 5IZCC 1DXYA 1N2OA 1BHQ1 3F2VA 5EMMA 3QVTA 3OOHA 4BBZA 4LTDA 3NHAA 4U2FA 4CM1A 2J5RA 3P9IA 5LQKA 1GFWA 1G20B 1U80A 2WE8A 5BN4A 1RP7A 1WTAA 3H2YA 4G1VA 5B55A 4K6HA 4QM7A 1BDBA 2G40A 2IUFA 1QH8A 3VNBA 2SICE 1Q14A 2Y67A 3ZHOA 4BJ1A 3OKAA 2RGBA 2JJYA 4RY0A 1OE0A 1OH5A 4B7CA 3EGOA 2L2QA 4Q3AA 2DQZA 2FX5A 4PXYA 4DSTA 4WI1A 1FUYB 4MI6A 3MTDA 1MAHA 2I8LA