2FZVA

Crystal structure of an apo form of a flavin-binding protein from shigella flexneri
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
235
structure length
235
Chain Sequence
NAMRLRHLSDPDSLPALDKSFAIERPALGLAPDAPPVRILLLYGSLRARSFSRLAVEEAARLLQFFGAETRIFDPSDLPLPDQVQSDDHPAVKELRALSEWSEGQVWCSPERHGQITSVMKAQIDHLPLEMAGIRPTQGRTLAVMQVSGGSQSFNAVNTLRLLGRWMRMFTIPNQSSIAKAFQEFDAAGRMKPSPYYDRIADVMEELVRFTALVRPHREALTDRYSERKAAGHVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative arsenical resistance protein
publication title Crystal structure of an apo form of Shigella flexneri ArsH protein with an NADPH-dependent FMN reductase activity
pubmed doi rcsb
source organism Shigella flexneri 2a
molecule tags Structural genomics, unknown function
total genus 85
structure length 235
sequence length 235
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fzvA00
1KBOA 2ZKIA 1V4BA 1GG5A 1I1OA 3NHJA 1OBOA 1CZHA 3NFRA 5A4KA 1QBGA 4U7GA 1YCGA 2HNAA 1XYYA 4N65A 3K1YA 1CZRA 2GSWA 5LBUA 5B3KA 4LTMA 5LLDA 1FUEA 1ZWKA 4HS4A 4NULA 4BMOB 2Z9BA 2FVXA 2FOXA 2MWMA 4H6PA 3F6RA 4PU0A 3HA2A 3GFSA 3SVLA 3ESYA 3O73A 2OYSA 1NNI1 4S24A 2Q9UA 2M6SA 1CZKA 1XI2A 1J9GA 4QOGA 1C7FA 2QMZA 3G5MA 3N3AC 2OHJA 2ARKA 3TEMA 2HPVA 2MTBA 4GI5A 4YAOA 4ZVLA 3B6JA 1X77A 2R97A 4BMPB 2M6RA 5FUQA 3OX2A 1T0IA 3KLBA 1J9ZA 1JA1A 5F12A 1TLLA 1RLJA 5LJLA 3U7IA 4U7FA 1D04A 6NULA 3QE2A 2HNBA 4LAFA 1C7EA 2MOKA 2BMVA 2FX2A 4DY4A 3S2YA 3OWHA 2QX4A 1AG9A 4YQEA 4QOFA 1ZX1A 1OBVA 4CF6A 1AZLA 2FZ5A 4YAWA 2BPOA 1BVYF 4XDGA 1YOBA 1VMEA 1KBQA 2V9CA 2D5IA 2QX9A 5EMNA 3QFCA 3HR4A 4GQIA 1FLNA 2QX6A 3NHFA 4Y7CA 1D03A 2R96A 3KAPA 4C14A 4CETA 4Y9UA 3B6MA 3OX1A 3ESZA 4DIKA 4F8YA 1AKWA 5LBTA 1YDGA 2N1MA 2FCRA 3KAQA 1CZLA 3O2NA 4D02A 4N82A 1YKGA 2B3DA 3FJOA 1XT6A 3GFQA 3RPEA 2FZVA 1AKQA 2F1OA 1QRDA 1FLAA 2Q62A 3D7NA 5FX2A 1AMOA 1FLVA 1WSWA 3ES9A 4NLLA 4ZVNA 1CZUA 1XYVA 2RG1A 1AKUA 3KEGA 5F4BA 3HLYA 1F4PA 4H2DA 4C76A 5F51A 4PTYA 4OXXA 1YCFA 1OFVA 1FLDA 1T5BA 4M0CA 5NLLA 2AMJA 3UXHA 3R6WA 1AHNA 1ZWLA 1FX1A 3F90A 3NHPA 3NHRA 1H69A 1DXQA 2QR2A 3W77A 1DX9A 3OJWA 3W79A 2X2PA 3OX3A 5NULA 3TE7A 2KLBA 1FTGA 1AKVA 3QFRA 2W5UA 1RTTA 4LTNA 5LVAA 3NHSA 4ZVKA 1AKRA 1YRHA 5LMCA 4GR9A 3NHLA 3P0RA 2OHHA 2BF4A 2Z9CA 2X2OA 2KQUA 1BU5A 4QOIA 1D4AA 3ESXA 1RCFA 4LA4A 2FLVA 3FW1A 5TGZA 4FGJA 4C0XA 1QHEA 5B3LA 1QR2A 3F2VA 4XDHA 1J8QA 3JSXA 4QOJA 3LT5A 3OJXA 2FDXA 3F6SA 4FX2A 1H66A 1AKTA 3TZBA 3L9XA 2V5VA 3OWXA 4YALA 3N3BC 3U7RA 3GAMA 3EYWA 1DXOA 2XODA 3B6IA 3FVWA 3W78A 2BN4A 4QOHA 4QODA 1JA0A 2V5UA 3FX2A 5FA6A 5EAIA 5ULLA 4C0WA 5EA2A 4N9QA 1FVXA 3UXEA 2QWXA 4ZVMA 4HEQA 2A5LA 2FAXA 4FGLA 2MT9A 2BZSA 1CZNA 2Z98A 3N39C 1RLIA 2Z9DA 4ESEA 3L9WA 4DILA 5LJIA 3B6KA 3NHUA 3LCMA 4Y9RA 1SQSA 4FGKA 1WSBA 4U7HA 4YAUA 2QX8A 3NHWA 5JROA 3NHKA 4PTZA 3FNIA 4LTDA 1YCHA 4YAFA 4ICIA 2WC1A 4J8PA 3ZHOA 3GFRA 4QOEA 1B1CA 1J9EA 2QMYA 3K20A 2OHIA 1CZOA 1TIKA 1SG0A 3EDOA 3W7AA 3OVMA 5BUCA 3NHYA 3NLLA 1E5DA 2XOEA 4R81A
chains in the Genus database with same CATH superfamily
3IALA 1KBOA 1PZGA 2PS0A 2ZKIA 1V4BA 3HMKA 3KCQA 3NRCA 3SJZA 5EKUA 1QE3A 4CTMA 3RC2A 1GPWB 3S2ZA 4AWAA 5MDHA 4L02A 4UW9A 4HXGA 5KWSA 3G7NA 1TTQB 2VQ3A 4MITA 1GN8A 3SM9A 2DFVA 5GADl 2ZSEA 5D1HA 3WKBA 3FHTA 1Z6XA 7GPBA 3H16A 5EMKA 3V1MA 2RK4A 3GGJA 4XAQA 2O8DB 4D4GA 2IPXA 1A82A 3WJ1A 3FHLA 4BNJA 5BWCA 4UPVA 3K1YA 4WFIA 1ZUWA 3DZJA 4X9XA 4LXGA 3NGLA 5T4FA 3OHSX 2GCOA 2R79A 4A8HA 4JWTA 4AY4A 4P34A 3A4TA 1J1ZA 1EGVB 2ZVQX 2B2NA 2GJ9A 3MLAA 3NIDB 3GA0A 3SMQA 1JL3A 1QCDA 4M1MA 5EJIA 3SS8A 2HSJA 1SELA 1SU8A 1K7EB 1Y3AA 3HBMA 2WYUA 5AM0A 1ZAKA 2OPBA 1QO9A 3VU9A 1G19A 1Q0ZA 4EPVA 5IKPA 4G0UA 1NR1A 2FSVA 1I3KA 4G85A 5BQFA 1E0DA 2VLIA 3A0UA 4HXYA 1ND6A 1X7YA 3INYA 5ALIA 1S2LA 2Q1SA 3NALA 4C0JA 1JU3A 2CGEA 3ABSB 5BQ5A 5MF6A 1JAXA 4Z4HA 3A11A 1G4HA 5LZ8A 2CE2X 4MVWA 3B9BA 3FSJX 3G8BA 1JGTA 1ZK0A 4PU0A 4K6HA 3NVMB 2R9VA 1C9MA 3D8SA 4OXIA 1HL3A 1TEHA 5DI9A 3GDOA 2H9IA 1DCKA 4MAFA 3RJ9A 3BJEA 3BA6A 4DSAA 1QH8B 2TMGA 4MPDA 4M0MA 4CDNA 4E11A 1MX9A 4FW9A 2MSWA 2WWIA 2JGAA 3AEUA 2ZUFA 2FWNA 3ESAA 4GNKA 3R3YA 4JB3A 2Q6IA 4L28A 1RJ9B 4K9PA 5JYBA 3ADOA 3JASB 4HTFB 1GZVA 1JLLB 4KVAA 3V55A 2HRQA 4J0FA 1Q7TA 3H1GA 5JTUA 2E7ZA 1AQUA 1P60A 1Y1TA 5A0TA 3GRUA 2E5WA 1LNQA 3G5MA 4WXHA 3W2GA 4IMJB 4I3HA 5IJ0B 3AJAA 3LOQA 3WO1A 1Q1EA 2ATXA 1FB5A 1FTSA 1RAAA 2WMNB 2AJBA 2VSNA 3I04M 2PLWA 3MZ0A 1V8OA 1L5MA 2FPRA 2IK8A 2PGDA 2XUAA 3AUXA 2EZUA 3GFFA 3SFTA 5CDSA 4I4TF 2C7OA 4KV7A 3WLJA 5JE8A 1R88A 3I23A 1E99A 1Y80A 2V7TA 2YFYA 1P4SA 3MOIA 3SIXA 2HA2A 5G4KA 1YB4A 1C81A 2VTBA 1PTJC 1USVA 2JFBA 2ISSD 3ANXA 3FZNA 2DB3A 3PTAA 1K0UA 1QS0B 1WDWB 2VPXA 3D4OA 3KAKA 4MW2A 4Y2QA 3RYIA 1DTSA 2JKYA 3V8VA 1IVNA 2QP4A 1DUSA 1EWVA 1PR1A 2HK7A 4DV3B 3ZE9A 2DHRA 2BGKA 1DOAA 2PV7A 5E7JA 3GXBA 4BN4A 3K9NA 2CZGA 2YWXA 3K70D 5BNIA 1QJ4A 3F9RA 3WRYC 1IXRC 3K9GA 4U2CA 5KDLA 1RLJA 1CUUA 2AKAB 3UUWA 2XUHA 5IVHA 2IDKA 1J7JA 4UUMA 1UJ6A 2FFAA 5ICGA 1ZD5A 4NK5A 2G9NA 4IGFA 2TECE 5JAUA 4Y1RA 4KFSA 4MVJD 2ZATA 4N6GA 1FC0A 2HNBA 3ZZ0A 3L1HA 4QLOA 3R7WB 4KFTA 3MHTA 1EGMB 2QMOA 1QVAA 2BM9A 2MOKA 2XOKA 1N1GA 3C7TA 4RHFA 2VRBA 5IDYA 3WFIA 4F5DA 1FDOA 3HY4A 4XM2A 3MFYA 3OHMA 5HKBA 1UFKA 4LRWA 2ZK7A 1UMKA 2QTWB 5DNEA 1XD9A 4HWGA 3WGKA 3G0CA 3SF0A 1Y6FA 4CG2A 4JC4A 1W85A 4N48A 2WA1A 5C5IA 2HLNA 1CUGA 3MTAA 5E3HA 4ISBA 2YV4A 3WNVA 2YXBA 3C6YA 4F6LA 2ZJ2A 5FWDA 1BRMA 1M2GA 3JVEA 3D3EA 1AU9A 1KFJB 1VLHA 3ASZA 4V39A 4RK5A 4RD1A 4OH1A 2YY5A 4GRIA 4X44A 1DXHA 1NI4A 2QM0A 3NBAA 1WVMA 1RRVA 4AJEA 1B73A 1QC5B 5KAMA 4COKA 3FTFA 3NAMA 5I4CA 4IKEA 2QG9A 5LOVA 1VGRA 1MABB 4EOGA 2H7VA 2VSYA 1FA9A 2WUGA 1NLYA 4ID9A 4KBGA 4R0VA 3SYLA 5CHEA 5KNLA 2BKVA 1GHTA 1ZQ9A 5EEHA 5FUVA 4K05A 5HZMA 2IP4A 1UXHA 3PFWO 3V4RA 2B4KA 2DEUA 3VX3A 2PUDA 3ACBA 4DIKA 4JUAA 1MH9A 4EG3A 1UMBB 2JZOA 3KKEA 2E4YA 4PTLA 1QIKA 3ENKA 4PPQA 2DX7A 4QTYA 1YE3A 3RK0A 1M2HA 3IODA 4X95A 4QFCA 2EX4A 2JGEA 4BCCA 1O8BA 4LK3A 1VPDA 2I6XA 2BFOA 4N7JA 3UOWA 2X14A 2JFGA 4QFBA 5C9ZA 5F2NA 1XZGA 1KYIA 1GJRA 2HPZA 2RH4A 2VDWB 4P3OA 4AJ2A 4AP6A 3UKJA 5J4HA 5FOWA 2JJMA 1XKQA 3DMDA 3PHCA 2B8NA 4FSXA 5E1DA 5L3QB 4TV9B 3WL4A 4D4LA 2MMGA 3C14C 1OVMA 2F1OA 2AE1A 2PNFA 3QVXA 1W93A 1WCIB 5CH8A 1XZIA 4V0LA 1T5HX 4YPFA 3VR5D 4AJHA 2XB6A 4X41A 3CX8A 3IUJA 4GI2A 4U39A 2GCPA 4FZJA 1NUUA 1ZD8A 1MB2A 2H7CA 1OPXA 2PL5A 4I8DA 1H1LB 2BM8A 16PKA 4WZZA 1ENOA 2BE7A 4IXTA 3WMFA 3MXOA 3OTGA 3T8YA 3B1VA 3U3MA 3TR6A 3RSLA 3GJZA 4X24A 4DR6B 5AVXA 4AKIA 2ERXA 2Y76A 1A9YA 1TIBA 3KTFA 4F3KA 1R8SA 5IVPA 3QOFA 5IH3A 3QNMA 1I24A 1FYXA 3QVGA 4GM4A 2NPFA 1DZIA 2H4WA 1LPBB 2EIXA 2P2ZA 4PYRA 5DBGA 5DM1A 1W5EA 4PBRA 4AJ1A 4QWMA 2CDNA 1JWLA 5NLLA 3G0IA 3LZ6A 4MB0A 4Q66C 4TZTA 2QRUA 5EHNA 3SVZA 2C00A 4FCTA 2B25A 4K3UA 2QMQA 4BBAA 1IHOA 5BR1A 3RF7A 3ZGOA 3ADBA 4TV8F 5DYNA 4F4IA 4RVDA 1D0SA 1LLQA 3QV2A 3IIJA 4E46A 1FX1A 1T13A 1YQDA 3AB7A 4QAQA 3MINA 1E66A 1PWEA 1FDRA 4BZZA 2GD1O 4IXMA 1XLTC 4N39A 1K3UB 2AG8A 2FPXA 1OXBB 4DANA 3LQYA 2VOJA 5I5GA 4BJ1A 4RTMA 4J3NA 1P33A 3KD2A 4V1CA 4JUIA 4PLWA 5DM4A 3M3DA 1VIYA 4HVCA 1AQYA 2C99A 3OJWA 4W5JA 5A6SB 5EHGA 1X39A 4WCFC 2XVZA 2CY0A 1D07A 1L8LA 1Y1QA 2OZKA 2RH8A 4IWYA 3W8RA 1QFZA 3ZNNA 4DXDA 5BWOA 3WLTA 2QUHA 4ZO4A 1Q0SA 3TR0A 3W7BA 2LCQA 3D3QA 1TA0A 2TRSB 4HMOA 4LQLA 3DBHA 1RFGE 2XMRA 3M6MD 3JRWA 4CQLA 2CV0A 5I48A 4Z4IA 1Q3TA 2CBGA 3KQQA 1PNRA 5IAJA 1WUTA 1Q22A 2JEZA 4NRDA 1HDOA 3GLQA 1KDZA 1QFSA 4MVCA 3CONA 4UVEA 4KQHA 4MW9A 5LWQA 2W5UA 4PLHA 4NCAA 5FQNA 4AY3A 4E33A 2IRWA 3VR5H 1CJTC 3EX7C 1KJJA 1SUSA 1I7NA 1W1WA 4OAOA 4KO2S 3D6MA 2CMHA 3IX7A 5FOQA 2XIJA 5EE1A 4WTOA 2OV8A 3QYPA 2ENUA 2PTHA 2Z30A 5JD6A 5HFNA 2J3LA 5EIAA 1VKOA 3DP9A 1RKBA 4YONB 1DFIA 4FWIB 3WLFA 1E0SA 1YVEI 2G1JA 4MUGA 3BT7A 2BUCA 1DINA 5JCXA 2ATEA 4MRPA 5SZHB 4MDEA 4NEQA 2YNMC 3PXCX 4UXJA 5COQA 4C7JA 2YOHA 4Y2VA 4K9OA 1R8QA 4IIJA 4GVPA 1HBJA 4RK0A 4LVOA 4YMSA 1XAJA 5I5EA 3OQMA 3GG9A 1DC7A 4V0RA 1L4MA 3SF8A 1DLIA 2D1SA 2QD5A 3ZDAA 1BU5A 4QOIA 4H27A 5BMOA 4Z8YA 3U1VA 1T1EA 4LDAA 3ZI7A 1V4VA 3BPSA 4ZHQB 1LKZA 4X65B 4IICA 4MQFB 5HGXA 3KQOA 4EECA 2CLHB 1VECA 1W36B 3QVMA 3KHKA 3SQXA 1DFHA 1SIBE 2ZAYA 3VJRA 5A06A 3PRHA 4F5ZA 3ZYZA 1W5FA 3TSOA 5JMOA 3ZH2A 2GZ1A 2G7ZA 1ZM2A 5TGZA 4JENA 1SG9A 4IH1A 3FWKA 3NTOA 1P61B 1SEVA 2XWSA 3JQGB 3QLVC 2ZUWA 1S3FA 3HWWA 4GE3A 1OOEA 3VJKA 2QRJA 3HDHA 1DPFA 1JFFB 1GLVA 4KKXB 3KOUA 3L8DA 4DOMA 1E7WA 5AW0A 3BXXA 5DXFA 1CE8A 3DVRX 4HX9A 4HQNA 3K71B 3RVOA 3AEQB 3RBZA 3OJXA 3IQGX 2OTCA 2ZIGA 2BGTA 3F6SA 1EB9A 4N0PA 3VTFA 3RHTA 3DT9A 5DXJA 2R25B 1W29A 3L0BA 1B6GA 3MCVA 4FX2A 3TL6A 1P2TA 1AK2A 3JZDA 3MVEA 4K46A 3ZDRA 3AFMA 3HDTA 3STUA 5AJXA 1ITZA 5K2MA 4NXMB 2BBSA 2IE8A 3ZZTA 2C7QA 4KFUA 4RJIA 1F2VA 4U5XA 3R0ZA 5ETJA 1ZXBA 4MLZA 4MJLA 4DMRA 2H1RA 2Z83A 4BQQA 5F9HA 2O19A 5DM0A 4W5NA 3C15C 2A1IA 2H4XA 1IU9A 2VJBA 4HH0A 4B46A 3KYDA 4QT0A 2ZSUA 3DFIA 3TQTA 3K2QA 1TCVA 3ADDA 3OCWA 4KH1A 3B6IA 1MR3F 3FH0A 1TZMA 3BYZA 2XB9A 4JC0A 4Q3EA 2D00A 3W78A 4F46A 1EIWA 1CWUA 3TSCA 3EDYA 2NT3A 5BYKA 1OFUX 1ZW6A 4TX1A 5CT8A 1FTNA 2BMEA 3PIRA 3QOWA 4MWGA 5JSYA 4HV4A 1XWFA 2GN1A 4Z4GA 1NQOA 1D2GA 4RTQA 3ONVA 3AVWA 4GOXA 4MPJA 2XMQA 2G5GX 3PGVA 1J0EA 1BKYA 1T9KA 3AI7A 4NU6A 5EAIA 2M98A 1DEAA 4CPDA 5I47A 5DLYA 5BWNA 5EA2A 3I6BA 3DTVB 3T1NA 4LF6B 2XUDA 2O8FB 1XJCA 1N7HA 1NUPA 3REGA 3WYBA 1SU6A 2GEBA 3BIXA 1K6EA 1P0QA 5DBOA 1Q15A 5ARBA 2B78A 1SO8A 3PT9A 4LGVA 5CCBA 1RRMA 1FJXA 3G88A 4MKXA 4N8EA 5TB5A 1GQQA 3RJZA 1CZNA 2Z1NA 4K9NA 4C5AA 5IVKA 3E03A 1KJWA 1NW4A 2XCIA 4OU5A 2WD8A 2VK8A 4W1SA 3AXTA 3F7TA 1UJ5A 1U0NA 3ZVRA 3EXHC 4EVSA 3OUZA 5AWFC 1Q7GA 2RGRA 1X80A 2DRIA 2VSXA 3I1JA 3KO8A 1Y9JA 3H0CA 3BXPA 2OZVA 5A2GA 5HTOA 3S68A 3L8CA 4YGXB 3LCJA 2IV7A 5BUQA 3A37A 3QPUA 3CVVA 2F64A 5CB6A 1JNXX 1LQ2A 4HEA6 1EEHA 1DOZA 2JATA 3PX2A 2HWUA 5F1OA 5HILA 2VT2A 1RWKA 3KZMA 2OV6A 1Z26A 4IQ0A 2XF8A 3VTZA 2DY0A 2GRAA 4BTEA 3L4KA 4A15A 1XTQA 1BEUB 1U8EA 3L6UA 4HTAA 2WLTA 4Q47A 3KT8A 4XM0A 2HQRA 1YFLA 4MR9A 1ZRSA 5CGZA 3D59A 3ONDA 2DPXA 2GA8A 2CLOB 2GETA 4I99A 4NH0A 1OHHA 3MTGA 4ZT4A 4PLPA 4R3UC 2J33A 3R3JA 1OC2A 4MICA 1GAQA 2PGNA 4EMUA 5EXEA 4UTZA 5F7ZA 4J9VA 3ABZA 2R6R1 3IPLA 2NPIA 5J1TB 3ZU4A 3X3HA 1JHPA 3CY6A 3IJEB 1X1TA 4DLWA 1DEXA 5DCWA 4ZCTA 1U8YA 1I8TA 3LQQA 3UAYA 3ER9A 3H8JA 3IPRA 1TIKA 5H3HA 4ZFNA 5E6RA 3VTAA 1JEAA 4AROA 3MRXA 1TYAE 3LHKA 2YASA 1P8AA 3LE8A 2WHPA 5GJBA 1Z06A 3UW1A 3WWZA 4P4SB 2I3BA 4PLGA 5DM2A 2AH5A 1QG0A 3E2IA 3O2JA 2W22A 3BWEA 3H1TA 4JDPA 1HSOA 1TGVA 2PZAA 2FWAA 1V71A 2PJZA 3PENA 4FK8A 3ZVMA 2I2XB 2HA4A 5C4MA 3O21A 2P7HA 4MO2A 4UNPA 3SLGA 4AF6A 5JJBA 3O8NA 1UM9B 4R8MA 1TLFA 1FY2A 3RADC 1I1OA 3B7WA 2A59A 3MBKA 1XOIA 2C5EA 4KU4A 4BLUA 2EQBA 4BBJA 1G5FA 1UH5A 3PKZA 3RYHA 2X7JA 2F9FA 3PNOA 4Y2XA 4Q7EA 1I0LA 221PA 4TRNA 5HBRA 1L7AA 4AMBA 3QXCA 5KYXA 2BFBA 5CFNA 3I4CA 1DIRA 2H6EA 1DIGA 3A05A 3DH0A 3TB4A 4N65A 3V1UA 2OB2A 3QELB 3EBLA 2HWXA 1KPGA 2XGMA 3JTEA 1DMRA 2WICA 3NJ4A 3QXXA 4Q3OA 5LQRA 1Y5IA 1ONOA 7YASA 3CC8A 5CBPA 3WJ2A 4PG6A 2JJQA 4DB4A 4ZQEA 1URPA 4OFWA 2X1HA 5LXTF 4DDWA 2X0FA 1E1RD 3ICCA 3KE8A 4KQFA 1DAMA 3KHSA 3L0PA 4X1IA 3OTOB 3KT6A 1A7UA 4IQFA 4WNYA 1QGOA 2JHCA 2HEGA 1C1YA 4FDMA 4G1MB 4HAXA 4OMCA 3FR8A 3LTEA 4PSUA 2C3UA 2H92A 6Q21A 1KEWA 1T34A 2W0SA 4LG1A 1S9DA 4YA6A 1ZEJA 3F73A 1QGUA 3TLBA 4K5QA 1YO6A 1EFRD 3LIIA 3ZWBA 1YZQA 4Q3LA 1NNEA 1JR2A 1IN4A 5EYPB 1TVKA 2EV9A 5K8CA 1V5IA 2MSKA 2Q4RA 2IHKA 3I4LA 4R2MA 4NI5A 2F55A 1KARA 1YQ9A 2O8VA 4M7RA 5C3MA 4TUYA 1D9ZA 4BE9A 3GFSA 2H1LA 5EMLA 1R10A 1MEEA 2EBWA 2G72A 4YJ3A 1FP7A 2V8BA 4PWYA 4MRSA 5EWLA 3SOPA 1H2FA 2QHXA 1C1DA 1CJUC 4NDNE 3RFFA 5J4LA 4CEJB 1UK6A 2PL9A 1UT6A 2DBVO 2RGUA 4X61A 1ZW1A 2WF5A 1QHHB 2JIZA 3X1ZA 2AW5A 4HX2A 1VBMA 3K1AB 2P2SA 2WZQA 3DAOA 3LO5A 4S24A 1R0SA 2Q9UA 3U4QB 4ZRNA 3P4UA 1CVRA 1MPTA 1NVUQ 1BYIA 3O4HA 1XI2A 3MMXA 4D26A 1R6VA 4EO9A 3ADCA 3B1ZA 3RV4A 4GXNA 3JQAB 4OYRA 3EGWA 1NN1A 3T1TA 3S4YA 4DMUB 3TFOA 5EIWA 1BN6A 5DGHA 2ACKA 4PHGA 5ALLA 2PX5A 5A62A 4J1SA 2IY8A 1QTIA 2ARKA 1NBME 3QEAZ 3ZHCA 5KNDD 4JBHA 5AJHA 1DO2A 2FEKA 4WCDA 3B7PA 2J0QA 1L1QA 2NPOA 1ONPA 2C9DA 2OBLA 4M8IA 4UVDA 1PL7A 2ZREA 2RB4A 4Q05A 1LVGA 1WF3A 4MP6A 4BFYA 1E8NA 2DETA 2UXDB 2PLRA 3JWHA 1PJRA 4D99A 5FUXA 3DLBA 4G0XA 5HJ5A 4AS2A 4OHUA 2Q1WA 4EZIA 3UJ8A 2PJDA 3DW1X 3WRYA 4IHJB 2I2FA 2XUKA 1BVHA 1OPRA 3T99A 1CUIA 3TO5A 2BHTA 3DGFC 3ROTA 2V3VA 4EX7A 3TD9A 4FMDF 3V8QA 1J9ZA 4J75A 2F67A 3AESA 4BP3A 3PHBE 5IJAA 2QJWA 2CLCX 2ZZMA 2YZKA 4IM7A 4XYBA 4B2LA 3L4BA 3GNQA 1Y0BA 2QORA 2FX3A 3OKFA 4UM7A 4ENRA 5LR6A 2PUBA 4IINA 3U7IA 4L3OA 3NORA 1JQDA 1NKTA 2ZUUA 4MGYR 3NGMA 5DI3B 3THWB 3CA8A 4RMIA 1K88A 4AIRA 3BILA 2V9ZA 4HDAA 2Y27A 4QT4A 5TT1A 4Z4QA 4IIBA 3EMBA 4ABYA 5IZ4A 3U31A 4O0LA 2IHZA 1T2FA 1BXRA 1ZC4A 2C4VA 5HCNA 3S3TA 4HB4A 2ANCA 3L06A 3TFWA 4EHAA 2JBHA 4JUFA 3HB0A 4BIIA 2CVQA 2H2WA 2ZANA 3GF4A 6REQA 3F7NA 1SOWA 3AUFA 1YRBA 3G2PA 1R5NA 1YR2A 2HBYA 4IVNA 4ARZB 5HQ3A 2WWRA 2YWDA 1YRQA 3FB1A 3REFA 2QX4A 2QB5A 3UAXA 1Q0UA 1U9IC 3IP1A 4FEGA 1SHLA 1E4OA 4UFPA 1OBVA 3H42B 3PDIA 1JQBA 4GBGA 2IY7A 1FMTA 4LYDA 1VP3A 2NXJA 1BMDA 2PAAA 3JATA 4W9RA 4Q0MA 1EK1A 4MR7B 1Y5RA 2C2YA 3PUXA 4XDGA 1CEXA 1CKEA 5CB4B 1GL3A 2PRZA 5IYZB 2HHHB 4YK7A 2BHRA 2Y1EA 1MA0A 3DDOA 4JLSA 1DHRA 3JPYA 4G86A 3AU9A 1I80A 2OCAA 1YK1A 1ZIPA 1VIVA 2VTEA 2P91A 4GXTA 1JIKA 1OKKD 1TKAA 1N2CA 1OMOA 2DM6A 2HRCA 4IBOA 4UD2A 4XFDA 3R5XA 1QKIA 1ZUNB 2G5TA 1D03A 5FTKA 1XR3A 2XRYA 3HPRA 1L4UA 1Q7EA 1TYCA 3HP7A 3UMRA 2VRWA 3I2GA 3Q7SA 4YI3A 4UNRA 1ZOLA 1KKUA 1MHPA 1NW7A 3M3HA 1QMGA 5EJ8A 4EY8A 3QHPA 1AKWA 1OA0A 2YDYA 5FIUA 1MRSA 1CLEA 1E5QA 2ZROA 3FB4A 2DR2A 2CMGA 4TZ6A 1X0VA 4M6WA 1ACJA 3OZ7A 1EXWA 5REQB 3RSQA 3BGSA 1J4AA 1HT0A 1WB6A 1X7DA 1QXSA 1L7QA 3FNHA 4WWHA 1L4GA 2GNOA 3WLAA 1SD2A 3A26A 1ZY2A 5CM2Z 4QUAA 3Q12A 3KOZA 5B1HA 1DQYA 2GCGA 2A14A 2VQDA 2CCJA 1DADA 2YC4C 4A0RA 3AF6A 2B99A 2JLVA 3I09A 2GLXA 4F84A 4PX3A 1PG0A 4JC8A 2HMVA 1QRDA 3T7DA 3C97A 2G76A 3PQ3A 3RVQA 5E0OA 1L8OA 1JDVA 3B52X 4FSDA 5K05A 3ZIDA 4NS4A 2H85A 1G5HA 5EGSA 2E89A 2UYGA 1GQSA 3DQZA 4J9UE 5FX2A 3PB3A 5GINE 1WSWA 1RP7A 1M2KA 4ARIA 4AZVA 1D6SA 2RBGA 2VHUA 4RAOA 4GLJA 4G67A 1BGWA 2XCTB 1L5YA 2KE5A 2RG1A 5KVQA 3VISA 1GCGA 1ULTA 1G3IA 3QVOA 4TUYF 2R8EA 2LCIA 1ODLA 4RA9A 1RLOA 4RKWA 5WRFA 1O97C 3AJ9A 3OY2A 4JLKA 4L27A 3QU7A 4JBNA 4FONA 5CLLA 2J46A 4PTYA 3R8XA 4OI0A 1R0WA 4EY4A 1YCFA 4UXIA 1WMEA 5CK5A 2R60A 3M2PA 5I4KA 1KC3A 4C7OB 4BMYA 2OVFA 5A02A 4QQNA 3UHAA 2ZYTX 4EUEA 1RIFA 4CBVA 4EB6B 1OLXB 1UKEA 1XLTA 2VF5X 3TSZA 1M2OB 3C5CA 4JLDA 4UATA 3T0IA 4OK3A 4UD6A 4P98A 1TMKA 1EFUA 2IU4A 3FFWA 3WHKA 1K9SA 4F3YA 4FLEA 4F71A 4KI0A 5AD1A 1R6TA 3F5DA 4RIIA 2E6UX 4ZOLA 4JLPA 4ZQIA 4DAEA 3UPTA 4M55A 4FXPA 3SHFA 4YMUA 5AYVA 4WCFA 1PGOA 4FN4A 3P32A 3UF0A 1P91A 5BN5B 1H22A 4ARVA 4AF8A 1KI2A 3LHSA 1D0IA 5GGYA 1GT91 2B36A 3SGLA 4C3UA 1YOVB 1MC1A 1NYLA 2LBPA 5GTDA 3FZEA 4S1WA 3WYEA 1DEOA 4HH3C 4GMDA 5CG1A 2FJPA 1O03A 3D1VA 5AVJA 4IIGA 4NNJA 4D57A 1O9GA 2OFPA 1XA0A 2JFHA 3Q9SA 2VBGA 5AXBA 3C7DB 4AUEA 4PSDA 5EKTA 3R3XA 3MW8A 4TMXA 4V24A 5EZ6B 5B7PA 4RUKA 4JLUA 4IJ5A 3VH4A 1N77A 1BX0A 4NONA 4CMKA 2C4TA 1ATZA 2JAPA 3EGXA 1XHEA 5LN1A 1BA3A 3NXSA 4LQCA 5IT0A 2YIDA 1QWOA 2A1UA 2FI1A 3G13A 1GFSA 3D0KA 4OQLA 4WZBE 3H5RA 2ZRQA 4L5BA 2GEFA 1FRZA 5ALFA 1W34A 1KI3A 3OHPA 4KIUA 1WZUA 3PNKA 2JGDB 3G2MA 1ZU4A 5K3CA 1QO7A 1GR0A 1S8AA 1ZGGA 2IDZA 2NT4A 3LM8A 4U0KA 3UAVA 1G7RA 4OL0A 3KR2A 4OA5A 1W581 3KEFA 5ICFA 4B4KA 2W6ID 4X64B 1IZ7A 2FSIA 3ZWKA 4KHZA 2YNMA 4NX2A 4YJDA 3GLTA 4N5IX 3TPZA 3GAFA 4WW0A 1IN8A 4FCVA 1OB5A 4Y9DA 3EVCA 4XR4A 4DFDA 1GAWA 4NYMR 4AJPA 1X1SA 4OHVA 3VZQA 4H1TA 2H57A 4BHTA 2I6FA 2OHHA 1TZ2A 2V6JA 3PC7A 5GY7A 4EYEA 1A8HA 1BHO1 5DO9A 2WG1A 3EZGA 4Z3DA 2QRVA 1H23A 2R84A 2Z2IA 3TYXA 5LLSA 4EA6A 3ZTWA 3VNRA 4ZGBA 4ZXPA 1G20E 3PLNA 4M2LA 5H9WA 2VP2A 2VP5A 4XWTA 5JJCA 2GO1A 1EXDA 3FDJA 2WJYA 1IBSA 1D5WA 1J90A 3O26A 3O9ZA 4JP2A 3BFPA 5FFMA 3PP8A 1O77A 3QLVA 1HLPA 4XTRA 5FR1A 4CQMB 4BO8A 5JO0A 4LHYA 3W06A 1WVGA 4CUJA 2YS7A 1SQ5A 1U2RA 2DR3A 2C54A 4RY8A 3FCSB 3KKOA 1V1MB 3OF2A 2XKAA 4UBKA 1XF9A 2CV1A 2YFQA 3PDHA 5C5DA 3TCKA 3VPHA 2AI2A 1V96A 4GMHA 4UXHA 1TADA 1ODCA 3OZXA 2W71A 2NQ2C 2HIGA 2V59A 1L3BA 2BKAA 4B5KA 2PWPA 2F90A 4M22A 4B33A 4KI7A 4B8WA 4YP1A 1N6IA 1OY1A 3AFIA 4HFMA 2Z5VA 2WWXA 5BSWA 1UOOA 1W25A 3DBRB 2PFKA 4CF4A 3TTSA 4G0MA 3UMMA 3DCYA 2ZVDA 4QVKA 5KSZA 2O3QA 2G04A 4O3MA 2QZSA 3PI6A 4BNWA 4DWOA 1UWLA 1N34B 3N2GA 1LQUA 1YNOA 3C3CA 2XA9A 3O0TA 1AGYA 5ENDA 2QQ0A 1Y5NA 4YDQA 3CEAA 2W2QA 4DWVA 1WV1A 1UDRA 4PYMA 3EG9A 3PC6A 4EYOA 2R8OA 2A3RA 5JS7A 1Q2XA 2IPMA 2O7NA 3CUKA 3WYAA 4KQWA 1Y37A 1ZHOA 2HUPA 3DDWA 3UGTA 1A95A 3NIBA 1BE6A 1LPAB 3CZCA 3OY7A 3VC7A 5KTYA 1VBFA 1C8BA 5FORA 3SQWA 4EUKA 3RVPA 2WSYB 3FX2A 5I9NA 3QEMB 2ODTX 3SYRA 1EFVB 1PUJA 2DPMA 2YYZA 3A25A 4UHJA 1COWA 2HQBA 4HAZA 1ZRNA 4HG2A 4MDHA 3T7JA 4BO7A 4BRWA 5F2OA 4BUCA 1RXVA 3PKJA 4IVQA 4FB4A 5B4TA 4O3FA 4C0WA 1U80A 2XB4A 2J6IA 3ANNA 3PZRA 5K3DA 3B9PA 3FPKA 5K1ZA 4RTLA 2XNDD 2P0YA 3G2LA 3PHLA 2X9QA 5T6MA 3STVA 3DD5A 2H1HA 2VP6A 4TL7A 3TUZC 3T1YB 4AUKA 1DKQA 1CS0A 3PTLA 4IDCA 3E8SA 2WV9A 1QTQA 3NU1A 1JPJA 1J42A 3UB2A 4Q37A 5AM2A 5DEIA 1N0WA 3H4MA 1GNRA 2PX4A 2OAEA 5P21A 4JK3A 3EXHA 3O1HB 4FPXA 3H2ZA 5LU9A 5MGBA 3DE4X 1HEIA 2FW0A 3MJHA 3ELUA 2A0KA 1XJ0A 3BBPA 3PBKA 3RNLA 2WQZA 4PR3A 2H2IA 2O9JA 5JV5A 5GONB 1SUDA 3UUEA 1GPH1 1PT7A 4ND7A 3QHQA 4OBBA 3MWYW 4ZOLF 3ZOZA 3HO6A 1MFPA 3NTQA 3DBVO 1U4OA 1CPYA 4R7ZA 1AQLA 1S02A 1WMSA 2BT4A 3V7FA 1LWNA 5BMVB 1TW2A 5D7NA 4CKCB 2E18A 1EUQA 3ZDEA 1XU7A 4JASB 4LF7B 2W6JA 3DOIA 3EZFA 3RSOA 2J0UB 4ACAA 1QJCA 3TBKA 1FMFA 3QXGA 1XNJA 3IKTA 3A70A 5BN4A 3LCMA 1WDLA 2W11A 4A8PA 4IJQA 1OU4A 1K2WA 1DTEA 1E62A 2H9YA 3LH5A 2P69A 3NHMA 4DCTA 2YYSA 4GZLA 4DMLA 3JAMA 1I3LA 1FX0B 2QX8A 3OJ0A 1ISGA 3Q9LA 5TJ9A 4WBSA 5AMXA 1K8ZB 4TXHA 5E38A 1JTEA 4ZVTA 1EYZA 1SRRA 2GVDC 1SCUB 2HA3A 3I9NA 1AHHA 2JJ1D 4LTDA 4MEJA 4S35A 5SYAA 3ZH9B 1PVDA 3NWJA 2HRRA 5TF4A 1Q0TA 4E7PA 1X7ZA 3VSBA 4XIYA 3HBNA 4YAFA 2YIJA 1R12A 4V2IA 3GO4A 3ELYA 2NU8A 2Q2OA 4MUIA 5K3AA 1G20B 1U3VA 1XTSA 2HZBA 2VBFA 1B1CA 2QMYA 3CNEA 3K0KA 3D2CA 3WICA 4GM1A 4AJKA 3UATA 3WGQA 3M1YA 1W2GA 4LZZA 4A8JA 3NHZA 4TKUB 1EMDA 1DBWA 4FIZA 4UHCA 1QUFA 3CJTA 3ZQ4A 2EW2A 4FS3A 3QEJA 1RCTE 1TM5E 2VA9A 1MRZA 2SICE 3W3AD 3EN0A 1A9RA 1E6CA 1HE2A 3VYUB 2JF0A 2I6SA 2DFDA 2FPUA 3W0LB 5DTEA 3SI7A 3V80A 3EXIA 2PA0A 2J3HA 4W82A 5FNVA 2IYZA 2J0SA 1RSZA 1RS0A 5JQGB 1QRAA 4LYHA 3LSTA 1WV0A 3T54A 3QX9A 3EFBA 5KKNB 3FDZB 3MCUA 4RVHA 2GN0A 1YXMA 3DXXA 3OMWA 4G09A 1EB8A 1GPKA 1RPNA 5DJ5A 4OUKX 4B4OA 3H2HA 3SOZA 2R6GA 4HH4A 2YXLA 3HCDA 4JI8B 2WVHA 1C3OB 5E3IA 2W42A 4ADSG 4UQPA 3N2EA 2C9YA 3FZYA 2WFZA 2WJIA 3DMGA 2CBZA 1Y63A 2Y1FA 2C95A 3KRTA 1SC9A 2JIMA 3MBOA 2VHCA 3N8IA 2BONA 2IEIA 3IAXA 5FLYA 3ZJTA 3D8BA 3FMGA 2XI4A 3O6VA 2DERA 2JKZA 4XCVA 2ZRJA 1YS1X 3BWYA 4OHOA 1OXSC 1BE1A 3EVBA 4M9RA 3V32A 3ON5A 4G1VA 1Q3HA 4N18A 2O3JA 4PC2A 4Q7LA 3SC3A 4DEVA 3T35A 4ZV9A 1WSAA 4CQNA 3LW8A 3H99A 4X84A 2P9JA 1FNNA 3A6HA 1QZXA 5H82A 5KPDA 4GECA 2YN0A 3EAQA 4J1QA 4QNNA 2ADMA 1VIMA 2K6GA 3SJUA 5HKKD 3D8HA 3A7EA 1T9GR 5CH3A 4YT2A 4I1PA 1CY1A 3SBOA 4JA2A 1BA2A 2Z04A 5TQ0B 1LW6E 3ND8A 4C43A 1DEKA 5KTKA 2ZQZA 1PK9A 3DL0A 3HCOA 2HV9A 5TLSA 2FOXA 3PCTA 2W4QA 4DPLA 3DLHA 2WIBA 3E9CA 2OD7A 3EZ2A 3K31A 5DM70 4BLWA 4H7PA 4G97A 5BUZA 4JP8A 5FTLA 1I5EA 2FPGB 2GXUA 2P2GA 3HVRA 2JLYA 1O96A 5ITSA 2A7XA 3AIMA 2PMDA 3HZOA 4M76B 4PAQA 4CFYA 3KQLA 2RE8A 5DTQA 5EZSA 4ZT6A 4B7CA 5FA5A 3PD0A 3TKAA 3H04A 1PGQA 5FAKA 2OYSA 4GKVA 3GFGA 3SZUA 4ZDWA 1Z4PX 3BRWD 5JPIA 4L8GA 5HW0A 2HTFA 4LRUA 5JATA 1GGMA 1TAQA 3QP9A 1O6FA 3PE4A 3U7QB 3JAKA 4OHRA 1H3FA 2H2HA 3HWX1 1U0GA 5JNTA 2XX3A 3B20A 3ONNA 2DFLA 2PUCA 1MJNA 2G1UA 3BX1A 3GXOA 3ZWPA 3L7KA 1SKBA 4RS3A 4BFWA 1MAUA 3ASYA 2PHZA 4ZT2A 3KD3A 4DSTA 3NVKI 3DBLA 4HYQA 1GV1A 4OMDA 2FW6A 2J67A 3F71A 4MAAA 1PT5A 3ZI0A 3A9VA 2ZPUA 2G80A 3KQPA 4IMRA 4RFSB 5EGNA 2NAFA 2RKOA 4ALNA 2JFQA 4WZAE 3U5TA 2ZCUA 1X7XA 1TZJA 2OCYC 3NGXA 4EELA 1TF2A 4Q4AB 1OD6A 4C2TA 1X42A 2E0IA 3EG5A 4RZXA 2O4CA 3KSDO 1T3SA 1TF5A 4F96A 5KDDA 2VH1A 5E8RA 1E3JA 2GJKA 5BQ3A 3GEPA 2P77A 2RHWA 4MVJA 1L7OA 2OESA 2W2TA 2FZEA 2XJ9A 1FFBA 4IDEA 3RSSA 4KPYA 3MWDB 3DLPX 4ALIA 4RXTA 4PLTA 1JVBA 2IUYA 3IA7A 3NKFA 4B9EA 1XRMA 4EHNA 1PD0A 1EIZA 2PKEA 3REQA 3K4QA 5B58T 2ZIEA 4MCJA 2RAUA 3RRFA 3CRMA 1V5EA 5TDHA 1CNFA 3T52A 4EY5A 4CIWA 5KEIA 2QQFA 4C04A 2MIIA 2PMKA 1ZG3A 4H35A 2ZIWB 3KUDA 5AM5A 3SSAA 5LQMA 9MHTA 1HRKA 1U9IA 2GYYA 1QH9A 1R18A 1NMQA 3B36A 3E9YA 3PDUA 1Z12A 3N05A 1F51E 5FLXA 1ZJZA 2R8XA 4M1WA 1OH5A 3UMSA 3W6NA 1R74A 1AG9A 3AVQA 3G8DA 3DGEC 4ESOA 3H9CA 4D45A 3K32A 5TT0A 5HM8A 1AZLA 4QEKA 1H05A 3FOBA 4RPHA 1F8FA 1UMDB 1DRVA 3EZNA 3ZLVA 4GLFA 4HNRA 3RG8A 4R4JA 1TEZA 3JYHA 4IIEA 4CEHA 3AIKA 1BG6A 1RNLA 1JWAB 1YFKA 3P0JA 4PG7A 5IMBA 3Q3EA 1PJTA 1A8PA 1QIHA 2CYCA 1OZFA 2IPLA 3JWGA 2V9CA 3EK2A 4BAGA 1KQ3A 1WXHA 2ZDQA 3R7DA 1ORWA 1IIBA 3FNRA 2J6CA 4X20B 4KDCA 3GLUA 2W83A 5DCLA 1M6NA 4R8KA 1TU3A 3T3DA 4CV1A 2WNHA 4I4TB 2P9GA 4QUGA 2JLUA 2EKZA 3C8DA 2BZGA 3NHFA 2XLBA 5KJ1A 2YZNA 5DX0A 1DELA 2OE2A 4CM3A 2IYYA 4F4FA 4LBZA 3ZEIA 4C07A 3OPVA 3WMGA 4CETA 5IRCD 4DJ5X 3LU1A 4FNAA 1T5LA 1VG0B 1U8CB 3RYCB 1JHRA 5BV2P 1HYHA 2W2MA 5L4LA 3SXUB 4KHPB 2ET6A 5H3LA 1BIFA 4Q4DA 2I2WA 5CXSA 2QD3A 4AG6A 3T15A 5B2FA 1XDBA 3VSCA 2JLBA 3KQMA 4FYKA 3CW8X 4D02A 2NXWA 1C9DB 1H2EA 2JARA 1J0CA 1RVV1 3VC2A 4JUDX 4BLVA 4YIHA 2VAVA 1PGJA 2WFLA 4R8VA 4UJ5A 1QE0A 3VR5A 4D6PA 1GL7A 2GVNA 2IC5A 3IEXA 3IP7A 4RD0A 2VYQA 1IQUA 3IIIA 1REQA 4MS4A 4UBJA 5ESDA 1R16A 2JJ8A 3HNPA 1BE8A 1F2DA 3PNLA 4KWCA 4MUJA 4WMLA 2FE1A 3E22B 3UT0A 5BW6B 1PZMA 5JXGA 1NATA 1O95D 2Q62A 1XZKA 4GXQA 1RYMA 4HBZA 2IS2A 3EWNA 1SUFA 2WMOB 5EQFA 3I76A 4YRMA 2QG4A 1RRPA 3OD5A 3DKRA 3L1JA 2XKKA 3QVTA 1Y6ZA 1NI3A 5A4MS 1BD4A 2DBYA 2GTPA 3CPEA 2B1RA 4DA7A 3TRKA 1IXYA 3LWZA 2H06A 1CZUA 2QL6A 3C0KA 3EZYA 2WUVA 3IB6A 3M4XA 4KNVA 4OP2A 4QSMA 4JOQA 5K09A 3OCXA 3QNWA 3HXTA 5K8VA 4QBGB 3GW8A 2FXVA 2WJPA 2C0QA 5DYIA 2WRZA 4WN3A 1L7BA 4QEZA 4QDUA 4BV8A 1OFIA 3DKVA 2EDAA 2I3AA 2XE4A 5KOJA 2DFNA 3H9EO 4UMDA 1RCUA 1YJ5A 2FCAA 4WKCA 1JF8A 5ECWA 4P9NA 5LIRA 3CX7A 3N2IA 4IPTA 2QT9A 3DC2A 1ONSA 3DVLA 3LZDA 1Y4DE 1HG0A 2ZT8A 2CWDA 5MFPA 2R11A 3C87A 3LPDA 4FTWA 3RODA 3I1YA 3W7VA 2C8KA 3QG1A 2IYFA 5BT9A 3T5CA 3IUQA 2C5LA 3V3KA 4ER5A 2PVCA 3U48A 3SDZA 1P77A 1UF9A 1UJ4A 1C3VA 1V8PA 1Z07A 3MGAA 4LDQA 4KNWA 1PKEA 2R5NA 4MH0R 8LDHA 2LP4Y 1W9HA 1NMXA 1G8PA 2A78A 3IKVA 3ULKA 5IJXA 5BQXA 1WCWA 4C78A 3DV0A 4QELA 4LGYA 1N6HA 4TVSA 5ALZA 3CLTD 4MV4A 3A3YA 4Q9LA 1BWSA 3D3NA 3H0EA 1SJ9A 4KAAA 5AVOA 1L5VA 4IDHA 3GA5A 4XRGA 5JRJA 3QPCA 4I1RA 4QHTA 4Z4EA 1GYRA 2HREA 3SEAA 2X7HA 4GPAA 1V8FA 4PZAA 5JDCC 1P5RA 2GN2A 1AKVA 4QICA 5IP5A 3TNFA 5ECYA 5LP6F 1KFBB 3O3NB 1NVFA 2CB9A 2WTUA 3N5KA 3NPMA 1FDTA 2AYYA 2HSZA 4QXPA 2I03A 4IL5A 4JUCA 1HEUA 2D3TA 1UMCB 4E22A 3HJGA 3MNFA 5EUQB 4ARSA 2N1BA 1JQJC 3FMPB 4IGKA 3E3MA 3S5UA 4QJ3A 4O2BA 1YS6A 2FOLA 1HDRA 1ND5A 4B3SB 1KSFX 2QK4A 2XGGA 2YICA 1P45A 1HT1E 1SHTX 4YRRA 1VFNA 1GEGA 5EVCA 2CHFA 1FYEA 4PO3X 5SZIA 2J3JA 1G5QA 3T7SA 1L5OA 4UARA 3LRTA 2P30A 1C9KA 1Z6GA 1YMUA 4ZTBA 1TC2A 1E6WA 1KYTA 2GBFA 3SYNA 1I7QB 3U56A 2EOAA 1YKSA 2GZ2A 3ZUPA 5CK4A 2KQUA 3VAAA 1SN7A 2QYOA 3UWDA 4Z9YA 1JKJA 5BPFA 3UUGA 1NBHA 4ZQGA 5JAOA 3FFAA 2RGXA 3L7AA 2DVMA 4D96A 3UJNA 4TXNA 5B12A 1HXHA 1U9CA 1EFAA 3A6LA 1E6KA 3C5EA 4PCAA 3OA2A 4OY3A 1W8DA 1BWQA 3SXPA 1CFJA 2B0JA 2YMLA 2AQKA 3EIFA 3VUEA 3ZVLA 2H16A 1U1CA 1OV4A 2P3SA 5ANRB 2UXBB 2A5GA 1RWWA 1O7JA 5GWXA 3H1PA 1B8PA 2ZI7A 1PEYA 3NNNA 3UICA 5BVHB 4C0XA 5BYAA 4W5OA 3BWCA 1AHIA 5B3LA 1CR6A 4QBTA 4GZMA 3HU3A 4G8JA 1FYWA 4TS3A 3CBQA 4QOJA 2OFWA 3WGVA 4BP9A 4RW0A 4EPRA 2R85A 1NBOA 4DC1A 4E07A 3CNBA 3PL1A 5AI6A 3HB4X 3WISA 2NO7A 1DKUA 3U37A 4EX6A 1IIRA 5FUYA 4YAGA 2HU5A 2JCVA 4DREA 5JAHA 1QPGA 1ZXLA 3ET4A 3LNCA 3MMZA 4IH4A 3TRIA 3SCZA 1LPNA 5H0IA 1Z36A 2QGNA 3I9KA 1YZHA 5FYDA 3T5AA 4Y2SA 5DF1A 5KQSA 3JARB 1QYDA 1T3GA 1UEJA 4ALLA 1L9XA 3RVRA 4LE2A 4EF4A 5A04A 1K66A 1NQXA 1K4KA 4QQRA 4OMFG 1TVEA 1NE7A 2D0DA 2R1ZA 2Y6UA 1FQOA 3DYBA 2IIVA 1NW3A 1X9HA 1JHQA 5JS6A 1M74A 3NNSA 3OE4A 1DBIA 1KJ9A 4OM7A 5EVJA 1L1FA 1U5CA 4Q16A 1SVIA 1NVVQ 2HEIA 3H3JA 4KBYA 5COAA 3RS8A 3WIUA 3E8MA 3SKYA 2ODNA 4X7RA 2CFCA 1GU1A 3WGTA 1E79D 3MM4A 2VCYA 5E6SB 5AVVA 3IBCA 3QEKA 3IEIA 4JD5A 4L3VA 2UUCB 1W85B 4NFLA 4JVSB 3R8CA 1ILEA 4XYGA 4CU5A 5E4FA 4L75A 1BXZA 2CXNA 5ADVA 2C2KA 2JGRA 1T9DA 1VSQA 4XD2A 1EM8A 1ZITA 3WMWA 2VEDA 5DYWA 4B31A 5K3OA 1AGRA 1P6XA 3SZMA 1LPOA 2VCHA 4U4AA 4UEOA 2WTAA 2ZAGA 3P9XA 3AY0A 4EEXA 5BQOA 3EWAA 4DY6A 3WGGA 3BDIA 2YXEA 2J6BA 1UKBA 1BD3A 4RDHA 3ROQA 1BTOA 2I7CA 2I8LA 3HM2A 4NU0A 1I1HA 4RH3A 2NUTB 4I50F 3P9CA 2RHMA 3GLFB 3RVBA 3EQ8A 2C4MA 1K89A 2JL1A 4X3CA 4B75A 1GUBA 4Q39A 1OX4B 1Z7EA 3EXEB 4MEAA 2ON6A 4S1VA 5E2IA 4XI9A 4NCIA 5A3VA 2FGJA 3WDLA 4BBZA 4YUZA 4RWZA 3E7FA 1XTPA 2HYDA 2IQIA 4NBLA 3E3NA 5KMGA 1KDTA 4RV9A 5KJ6A 3JYQA 1TTTA 3VKHA 3HZHA 3R40A 1F48A 1C2YA 3K05A 5KYTA 4OI4A 3FI9A 2C9ZA 1Y1LA 4I4LA 3H13A 4HYEA 3U13A 1T1GA 1QBKC 1UC9A 2OBMA 4B3CA 1OVGA 1OAOC 2BBOA 3ODPA 1NVXQ 1MOZA 2A92A 2PQ0A 3E7XA 1IM8A 4L2IB 5TQVA 3UJHA 3GMTA 3Q8MA 3NIWA 3BREA 5J5AA 3UH1A 4PPYA 1QCCA 2Q6OA 2XPCA 2C9MA 2BEWA 3RS2A 3GJ0A 3Q10A 1THZA 1T91A 4L76A 1LTKA 3EDRA 5KNBH 1VC2A 3TQRA 2ZXUA 4YEDA 4YRQA 2W0MA 1HDEA 1XVIA 4HAIA 1A5TA 4ALMA 4QFDA 2QL9A 4FW8A 3EGCA 4ONEA 1U9YA 3GP8A 1MGOA 1LZLA 3NM5A 4XIIA 5EXXA 3T06B 4BASA 1IG3A 1QV9A 1YAHA 5DIZA 3RFUA 4A5OA 4BB5A 4BMVA 4C0SA 4KGZA 1GGNA 3THXA 1NU6A 2HJGA 2RKWA 3OP1A 3LQ1A 1A5SB 4TLDA 4EUHA 4MVJP 3OMXA 3O8CA 5E0KB 3A3OA 1GTL1 5T7BA 2QDXA 1LLFA 3OLQA 4XD7D 1Y3CE 4E88A 3TZ6A 2JB9A 3NKVA 1MAHA 1PSDA 5I45A 4M0EA 5ERGB 1Z08A 1FTQA 2VUSA 3NPAA 1WTCA 1IXZA 2BFPA 1YKFA 3OZAA 3JW8A 4URWR 5DBHX 1EJ0A 3LA6A 3ZPXA 2I2DA 3KLNA 3QPVA 4UVIA 3GHYA 2QRKA 1WB5A 1T8RA 3TFQA 4U7GA 3OZTA 1B0AA 4WAUA 2COEA 1JI0A 2LRHA 3ZZNA 1BXKA 3IHWA 2DBZA 3WLPA 4AJLA 4OTZA 2J9FB 1E1RA 2AX3A 4WL0A 3V7NA 1XYYA 1IK6A 2JZNA 3RAGA 3ECAA 4JR2A 2PUWA 2EP5A 3LGSA 5I9MA 2VDUE 4W6ZA 3ZVNA 2SCUB 1E0JA 2IYVA 2WTNA 2WP8J 5KAPA 1LVHA 2AOUB 3RANA 5L51A 5HUJA 5LWHA 2XCSB 1Y8CA 3AR3A 3OE7D 1R5JA 2C9CA 1EFRA 2JGIA 1Y9DA 1JFVA 4AUNA 2AB0A 4H4DA 4HGZA 5LLDA 2O8BA 2QAGC 1XTVA 1N1EA 1IMOA 1CY6A 1H4VB 1SVOA 1D7AA 2HTEA 3F96A 3KSRA 2YOGA 4ND4A 3GJXC 4ERXA 4GL4A 5HWSA 2JGNA 1PQ4A 3DEHA 3TLAA 2DU8A 2X15A 3DZHA 3VKVA 4E5YA 4B47A 4BLPA 1FL9A 1FPQA 2XHEA 2DH6A 2VFAA 2Z3WA 2GXQA 2Y3IA 4ABTA 2GO7A 4RKQA 3M6UA 4JQSA 4K9SA 1PUIA 1X19A 1LU9A 1UC4B 4GIBA 2GGSA 5J4YA 5C4IA 2AS0A 2Y4NA 3NT5A 2PT6A 3S27A 3W5BA 2J31A 4M1SA 1NAIA 1PVOA 3G5LA 5B5SA 3U3KA 3CVUA 1UXKA 3PRYA 3LG2A 3RRJA 3ADPA 4H7HA 2O1SA 1J00A 1EU1A 3R6GA 5PNTA 1EWYA 1ZA2A 2B5VA 1N6KA 5HUHA 5HUQA 2H63A 3WKDA 1YBFA 3B12A 1XO1A 3EIQA 4G5FA 1JDJA 4IEFB 4M9CA 2IXGA 4MO9A 4Z86A 5A05A 3VR4D 4AMGA 4EG4A 3F7MA 3RTBA 3BFKA 4ZO7A 3UENA 3AHIA 1BFUA 4GMFA 4OK6A 2FEWB 3NYIA 5SZJA 1QPZA 1U2TA 4DKJA 4RYDA 5BW5A 5KNDA 1E7RA 2WVAA 1KC1A 1ZH6A 4GYWA 4D9CA 3K96A 3SWWA 1KJNA 2HJHA 3MWEA 2FP3A 3ETDA 5IVIA 2YVUA 2BFFA 2Z2ZA 3HJRA 4OXQA 2MINA 5B58C 3UWSA 1BQ3A 3KKPA 2L17A 3EGDA 1WETA 1AGXA 3VNVA 1M0TA 3TEMA 2A9FA 2HPVA 4ZA2A 3B5EA 3AKDA 3EHDA 5FH9A 1C9JA 4NECA 4OSEA 4N6NA 3L93A 1LS6A 1GXSA 4AN4A 5FBKA 2J4CA 1CY2A 1AXGA 1JLKA 2PS3A 4LV6A 4TS9A 5CLHA 4E2FA 4NU8X 2N75A 2Y1WA 5JBNA 1UFRA 2AFIA 3GFBA 2AFVA 2QY9A 4M1EA 5D7BA 3HUEA 4YV7A 1ST3A 4DRZA 3ZR4B 5LXTB 1GZ3A 5JC1A 3IEPA 3GJTA 5GM1A 2EBUA 1KRHA 2FR8A 3KVOA 5JPCA 2LKCA 2CUKA 2RJNA 3DVQX 4X92A 2B6NA 4B3BA 5BNWA 2R00C 3QY9A 3FTEA 1IN5A 1CQIA 4PCUA 4S1TA 1GL6A 3GFVA 3SC2B 4A91A 2C7RA 2JRLA 3NBZC 1V1RA 4QREA 1PDOA 4V1CB 1QE5A 3CU5A 1NLMA 4NZMA 1UBFA 2VJAA 3KQVA 4XPZA 2VUTA 4DQLA 2X6QA 4C1BA 3IGFA 4C4ZA 2ECQA 4R54A 2H00A 4JP1A 4NZZA 3N86A 3KYDB 1A9PA 4QHSA 1GCAA 2H07A 3FUCA 1NG9A 1E1NA 2J5BA 5AVYA 4EO4A 4CTKA 4RU1A 2NG1A 4PLFA 3LA8A 3QMVA 1E20A 1NVGA 3PDCA 5EZQA 5FNZA 4ETIA 3A7DA 2O3SA 2PRJA 1K3FA 4WHMA 1CR2A 5BOSA 1RPJA 2A4KA 1EVYA 3TW4A 3HXQA 3HXOA 1A04A 2GK4A 3O1IC 1EGAA 5FBQB 4DZTA 3PQ4A 2C77A 1B76A 1LV7A 2PKXA 4FILA 5JSFA 2EL7A 4H1HA 1TZBA 3RROA 5F98A 5H4GA 4L7QA 1UR5A 1U2PA 1OKKA 4K8RB 2WU1A 4B7UA 3MWGA 5EERA 4G24A 1L5HB 2O48X 5BSRA 2VVTA 2DQ4A 3MWJA 5EN4A 2AN5A 4OXRA 3T1OA 2YV2A 4CMJA 2J07A 3L8EA 3A32A 3D1JA 4XXHA 4CT4B 2EJWA 3HVHA 4KXMA 1LDMA 1K5DA 4G1BA 4REQA 2ZTMA 1WMAA 4J1NA 4Y7CA 2R86A 3PUVA 1U63A 3ZD9A 1XCLA 3K5WA 3LC7O 1JAYA 5CVJA 4TTTS 1P9WA 3U6BA 2FPPA 1LI4A 3G8YA 3CISA 4AJ9A 3QKSB 3VFDA 1E3WB 3JR3A 3TKLA 5FEUA 4D41A 2QIPA 1NP6A 3ZK9A 2BFCB 1BU8A 3D8UA 4MTLA 4PRZA 4YCAA 4B3XA 5IABA 4RZHA 3BXGA 1GQRA 4HQRA 4FMDB 4HUQA 4P80A 4U1RA 4INZA 1DKMA 1YIDA 2I1LA 1SC3A 2YWGA 4EVRA 1A9XB 1SK9A 1L9KA 3C43A 1RYHA 1SWWA 3P9SA 3R09A 3NCHA 5U4QA 1Y6JA 4PAGA 2ODQA 2VT3A 4M1KA 5JBQA 4R16A 3U7FB 2JFOA 3IUNA 1KI9A 3PITA 2XDAA 1CIPA 2PU5A 3KT0A 3NT4A 4IDDA 3TVDA 4B6QA 3KB6A 4YAKA 1JR6A 5I7RA 1O95C 4CWAA 1AKQA 1B74A 1MJ5A 1C8LA 1QO0D 1VIAA 3E2MA 1PJ4A 2FY8A 4MR9B 2QI9C 5F3WB 3AIOA 4FMCF 4N5MA 1SR8A 4MPTA 4MARA 4CEIA 4Q7KA 2PUEA 1JIVA 1DRUA 3HN2A 3ONEA 3CCCA 3CCFA 2ZB3A 5IU6A 2V8OA 1J2JA 1I51A 1NOJA 2IOYA 4I1YA 3QWIA 4L73A 1RWBA 3RV3A 1E7SA 1EVZA 2PXCA 3EXAA 4WXRA 1QFMA 3FBTA 4H9GA 3CF0A 3ITKA 3L49A 1E6EA 1OREA 2EZTA 1W4BA 3OCYA 3FCXA 3PUWA 2YV5A 1PBNA 1AO3A 1PBTA 2CKDA 3P9QA 4FMBB 1IWPB 5F4BA 1KDYA 3L0DA 3NP9A 2YQ5A 1UXJA 4LJKA 2IYOA 4GWKA 5HMLA 2CC2A 3TI7A 3OOJA 2MJLA 3K4HA 2MMCA 4N4AA 1FFXB 2GF9A 2ZXEA 3ZCUA 4BRUA 2UYOA 4KWTA 2OV4A 1JHZA 4P4UA 1FLDA 4FD2A 4XDYA 2W48A 1N2EA 4UUAA 4XUGB 4N3BA 1RWXA 1TFRA 4P2GA 4B7AA 2JS7A 3ENQA 4MLDA 1HQYE 1M34E 2WAOA 1XCMA 4HVTA 1N6RA 4NBKA 4U8GA 4URFA 2WYWA 5EIHA 4KR2A 2ACVA 1NDUA 1IHDA 4JT4A 1DIOB 1WCXA 5F76A 5CFLA 4DIOA 4TS4A 1LJ8A 4YI5A 4I14A 2P2NA 1R37A 1NRIA 3TZEA 4AY2A 1PV1A 5CAEB 3MT0A 1MENA 1G3RA 2JAWA 2TS1A 3FZQA 4GWLA 1A2BA 4KW7A 3HZZA 3WGOA 4D3DA 2BFBB 3I39X 2JFNA 4RPLA 2BUBA 4MKZA 1FNSA 1F3OA 1ULBA 4RVCA 2OA0A 1OT3A 3QPBA 2ZJYA 1R0ZA 4U2FA 1L5ZA 2B61A 3EUWA 5CHYA 3MC1A 2ZIFA 5J4KA 5JDCA 1E9FA 1QRUA 2PE5A 2QRHA 5DGTA 2PMWB 2R68A 3ACDA 4RWEA 4BFCA 4HQLA 2RI1A 1E32A 3ITNA 2WYHA 5EZYA 3ST7A 4C89A 3BKXA 2QTRA 3GVHA 5BNFA 3PPIA 2ZI4A 1QONA 2W6IA 1FVOA 3CWZA 4LC0A 2Y8EA 2ZJ8A 3RRXA 5HPYB 5D86A 2OHFA 2GAAA 1P5ZB 1P1HA 3H6GA 4H60A 2QR3A 3KYCA 3H19A 4KE9A 3WG9A 3EFOA 4F4UA 1BDHA 2FMFA 3BHMA 3QM1A 3EXFA 3HKCA 1M1YA 3FUVA 5D5QA 3NASA 2PUGA 2VDVE 4JEUA 4TUYB 3ZXSA 1BEZA 1EXMA 2WD9A 1ZMXA 1K86A 2GB4A 4LMPA 1JA9A 2F48A 4GYYA 4ISCA 4OLAA 3VAYA 3AZOA 4J4TA 2PZFA 3R77A 4W9NC 5GJWC 2I80A 3BSYA 1O4WA 3WFZA 2BYTA 1MC8A 3NCTA 2Q27A 3WTCA 4Q48A 2PL1A 2XVYA 3M5DA 5AUPB 2PO7A 3L6CA 1H2YA 3BB3A 1OAKA 3OPYI 1R0CA 5HJ7A 5KTOA 1X1BA 4B45A 3H86A 2FDRA 4FEEA 3UT5B 1DG9A 2Z4SA 4C4AA 5F7JA 4C03A 2IW1A 4DKXA 1FK8A 2LVBA 4WNIA 4RK4A 1CUBA 2ZU0C 3HB5X 3JS5A 3KSMA 1WHSA 1KAMA 3NYQA 4G5OA 4UEQA 1SXPA 4FR2A 2PUJA 1FUUA 3PWKA 4JQYA 3V8BA 1ZD4A 3B9QA 2PKQO 3GT7A 4H3SA 2ZQYA 4F4DA 2FLVA 2JVKA 3D0QA 4QOSA 1ESZA 1ENPA 2J1LA 2QM8A 3KALA 3UIEA 1MDFA 4GP6A 5CFQA 2XTNA 3QYAA 4LJSA 4WBNA 5HS4A 1GVHA 5JH7F 4EHIA 4P08A 1UBUS 3UK6A 1H93A 2PZLA 3TWOA 3F2VA 5P8WA 4CFSA 4FKBA 4JX8A 3LS2A 2Q3DA 1XLVA 3CH4B 1KORA 2XCUA 3JSXA 4EVIA 2O59A 4XWAA 2VTVA 4WEOA 1DE0A 3GDGA 4UOEA 4K2AA 3CLKA 3L41A 2B2CA 2AW3A 5DGXA 2AR7A 2ZIUB 4LRYA 4QAJA 2VP3A 5DTJA 4AURA 2H7XA 3G9ZA 2V6MA 4FI3F 1US8B 2H18A 4FP9A 3L0OA 5DZSA 2P0EA 4YJ2F 1I1QB 3PFIA 1WPGA 2ECOA 1AKTA 3ICPA 1V37A 1RYEA 3MMSA 2CJWB 3W4JA 3W5AA 4G0OA 1F8XA 2RG7A 2ROQA 5JADA 3A27A 4UU0A 1E2LA 3PFCA 4UUQA 2I54A 4G0NA 5EUBA 4E31A 4EI8A 3I92A 2WKQA 1JYFA 5HG0A 3GAZA 1D4ZA 4ZJPA 2NYVA 3GVCA 1L8QA 4XQ0A 2RIRA 4QARA 1B7GO 3A2NA 4LYJA 1KBZA 3CVWA 1DXOA 4GM0A 3LMKA 2IDJA 4BCDA 4LCEA 2II6A 4NFSA 2AD1A 4J43A 3UXMA 2RB5A 4DARA 1M34B 4Q4JA 3KUXA 2NUPA 5TE9A 2V5UA 2PBZA 2PBFA 1V48A 3OLXA 5F2KA 4GPTA 3BMQB 4QKQA 1F38A 1IHYA 1R4MB 2CXUA 4P3KA 4BLTA 1AS3A 4CKYA 4EARA 2IYTA 1G8MA 2CLIB 2IYRA 4B80A 4YHHB 4N6OA 5C2JB 5ESWA 4D3ZA 1OWOA 3DL4A 3DPSA 2GM4A 4NCBA 2YY6A 3HFSA 3ZHVA 1B15A 3TLGB 4DV1B 3RIGA 3BICA 1KY5A 2RGGA 3FPEA 3DA8A 3VKUA 2QNBA 4W5TA 1JHMA 3UUFA 3KUCA 3T3MB 4QQKA 2PO5A 4LIPD 1YBVA 2IHBA 2MT9A 4KVGA 3H1BA 1BHSA 4P8RA 1RVDA 2O0MA 4MRMA 3V9AA 2NUBA 1BEEA 3A1NA 4J7UA 5EWMA 4E0BA 3U19A 1L5FA 3N7UA 4AQYB 4RLSA 1DBSA 4J3JA 3KCNA 4Q12A 1W94A 3NFYA 5KWVA 1PI3A 3AILA 4AXXA 2IHNA 3OM8A 1R6BX 2I2CA 2Z95A 1V11A 1XD2B 4GPEA 4HB3A 4JCCA 4MV5A 1P1RA 3C3MA 4N12A 4NJEA 2GX6A 4FINA 2H2AA 5CU7A 3LAWA 4V0MA 2A7QA 2AE2A 1OAOA 3IVAA 3GT3A 5IUKC 1Y89A 3LDUA 2X4DA 2VS1A 1MLDA 2G5PA 5CT9A 3ETNA 1WMBA 4GGOA 1CUHA 1NW5A 2JJ1A 3BMOB 1OU0A 4Z9AA 5CA0A 4LJRA 5D3MB 4NARA 4Y98A 3MOSA 1DQPA 2FSSA 1BN7A 2I65A 2R1VA 3SIPA 1FF9A 1ULHA 3A1VA 4EA8A 2GESA 2D74A 4B85A 4RHEA 3PGMA 4Q3AA 2ZJOA 5EZYF 9ATCA 2WTEA 4LWOA 1EDBA 4GICA 1T1RA 1Z0FA 5FFFA 3ZWQA 1AXRA 2JGKA 2F62A 2XQGA 3F1KA 2QSUA 2PEYA 1HQDA 2GKSA 3MRVA 3E4DA 4PNPA 3RHSA 3GWZA 4U9HS 4CKWA 1HKUA 1JBEA 1NYQA 4TSKA 1FP6A 1KMIY 1U8FO 4AQ7A 3GJ3A 4EGFA 1Q17A 1Z5ZA 3PWZA 5DMXA 5E7MA 3UJ9A 5HQTA 4KLZA 4PAOA 2ZIXA 4M7OA 4G9GA 3W3AA 4Q9AA 1PFVA 2RJOA 3AO0B 2A6PA 5J5CA 2K2QB 3LT0A 1F9AA 4GKKB 3AV0B 3K94A 2L0XA 2GAOA 4UZSA 1NE2A 2P6MA 3BRQA 3K9BA 5DTIA 5IVDA 1OSNA 1AV6A 1BE0A 2H4FA 2IS6A 2UUPA 2WB4A 5C5CA 2IV2X 3CMCO 5CCXA 3WYGA 1XEFA 3SHTA 8GPBA 2IUFA 2IWRA 4RY2A 1AHPA 3UJ6A 4WLFA 4BRZA 2MR6A 2C3MA 2EZ8A 1M54A 1S01A 2ZUBA 1VYHA 3D6AA 4PHTA 4UQLA 1JE0A 4N5DA 1DGQA 4GVXA 3BD8A 3A1WA 2MSDB 3MEQA 3MQ2A 1CG6A 4FEYA 4B2IA 1KI7A 1LJLA 1G63A 1OX6A 3NHJA 3BF8A 3DNFA 1CZHA 3ICEA 1NZFA 2IEDA 5AKJA 3VDMA 5B1IA 3O95A 2WILA 3E58A 4S1NA 3ND5A 2BD0A 4ZOLB 3PX7A 2NTVA 3AF1A 4RJKA 1ADFA 1OCEA 1QIIA 2W90A 5CXXA 2C3YA 1RZRD 3EFHA 3Q7RA 1Z0UA 2OD9A 4CDMA 4S04A 4PGAA 4U6SA 4DMHA 1P1IA 3EWSA 4KPUB 2NP6A 5L7WA 2O8NA 1HV8A 3AM4A 3P96A 1LSOA 4EFMA 2YVKA 4GYJA 3EEYA 1C0LA 4W5HA 2C07A 1CZRA 2X5OA 4HN4B 5LD2B 1S9HA 3H83A 4C4XA 2ID8A 2C3OA 2QAGA 1HLGA 2JCXA 2ZTVA 4JI6B 2ISQA 5H7XA 2YINC 5HKKA 5IFLA 4EVQA 4AZ0A 1TZKA 1DQRA 1YS7A 4IDGA 4MUFA 3W1EA 4WACA 4BOYA 1IL0A 3WYNA 3RJ5A 4Q9NA 2IEYA 1PNTA 2HA0A 4HK4A 3NXKA 4RSMA 4UASA 4L8WB 4HVLA 4Q1FA 1H0RA 4XEHA 4PRYA 4KPFC 5C53B 3V2UA 3D7MA 1O2DA 2D2IA 4IV8A 3A2LA 2WM2A 2J41A 4BUZA 3TS1A 4BMOB 4OK5A 4JLAA 5EQDA 5IT4A 4XASA 1AK9A 4CW7A 2RHCA 2G9QA 1G18A 3JWIA 2IHTA 2Z2XA 5JMPA 1PR3A 1H8ED 1Q20A 2VDKB 2CNWD 4MIEA 3KAJA 4KXNA 1BKSB 4C7BA 2MWMA 1VPTA 2O2CA 1MOQA 1EVJA 1RWVA 3F6RA 4IP0A 4MP3A 4B73A 4CHTA 4J0EA 4LBWA 3M9LA 3OQIB 4E5MA 5JSQA 1KYZA 2V7BA 1Z2PX 3IT2A 4GMXA 2WUEA 4PNZA 3BRWA 3MGCA 5HGJA 5C3UA 5LKRA 2F8SA 5LNK1 2QU7A 3LUBA 2DWUA 4NJMB 4FJ2A 1EX7A 2VYVA 2IPNA 4U2BA 3ZU2A 2BMDA 4L95C 1KMHB 4H17A 5LYJF 3GPIA 5ISMA 4KXWA 3PS9A 4LECA 4YREA 3TW8A 4D9MA 3SHQA 2Z4TA 2M6SA 1OTHA 2JANA 2NTNA 2XKBA 4LNUB 4ROTA 1GO2A 3T95A 4JWKA 4NDZA 3JCZA 2G6TA 4XVHA 5DHPA 2BFDB 2NWQA 3G9UA 1NR5A 3QRWA 4Q93A 3RKUA 3TG2A 4R1MA 4CLOA 2JLZA 1KZ7B 1WS6A 2LE0A 3CZ4A 3AERA 4AUMA 1XC7A 1YS2X 1ACMA 2BHSA 2LGJA 3EOBI 3PNSA 2G0NA 1VHWA 3MPUA 4FE7A 3GRZA 5KTPA 4ZVLA 3B6JA 3T5BA 1Z33A 1JQ3A 5C1DA 3O8LA 1DLJA 5CYPA 5JNUA 4UZEA 5CLFA 4C4PA 4DCJA 1M2VA 1QYCA 1N4AA 4YRIA 1FMCA 5FLKA 4D9HA 1VJ0A 3D1LA 1SBIA 3ZJVA 4JI7B 2JCGA 2R00A 5L6MB 2QTVA 2W2LD 1XNGA 2HUNA 3D8NA 3OZBA 4HP8A 1WZIA 3DOFA 2X9LA 5JVDF 1JA1A 2EP7A 2ZRKA 1C9YA 3BK7A 4GHWA 1IJBA 1CFZA 5ER9A 5F12A 3RS0A 3GRKA 5U9CA 1XMJA 4BU0A 1J07A 1LX7A 1QKJA 2IHJA 4O2AA 4RY0A 1MH1A 4X7MA 3IFSA 4PE5B 1UT5A 2W8BA 4HN2A 3Q7EA 4IGEA 1H0SA 3LPLA 3OZSA 4OHMA 3LXMA 3P9IA 1EE2A 3ITEA 3HS3A 3QE2A 2AYZA 2NMVA 3PWSA 1HE1C 4LOKA 1IUNA 1GD1O 1HE8B 1BX3A 1RRGA 2W2KB 4AXBA 1IPFA 2C2ZA 3LP6A 4FYMA 1K92A 3KU1A 2Z1DA 4RK7A 2BMVA 4QYXA 3WQSB 2XAUA 4WBXC 4QHYA 3GVIA 4UBOA 2B4YA 3Q8XB 2D2VA 3T5GA 1VCIA 2QJFA 2QN7A 1Z0KA 1GITA 1P74A 1G42A 3BGDA 5KYGA 3HYLA 2OORC 4RSHA 5JW6A 4DR7B 4H77A 3JQ7B 3NATA 4OREX 1ZZEA 2WSMA 1VJ5A 3DAFA 3DS8A 4M8NE 4V0SA 1NP7A 1TQ6A 4R8SA 1WE2A 2OMKA 4Z2YA 3SHOA 1IM2A 3K2IA 4YAWA 4W9MC 2PMEA 1ZD2P 2RK3A 3KOXA 3C7CB 5TIIA 4LF9B 6ABPA 4GSKA 2F8MA 1ID8A 4KVFA 3GCDA 4L9RA 2EC5A 3CPHA 1H0HA 3PKIA 3ZS8A 2X0NA 2C2HA 4XVRA 1JIIA 3U09A 4F86A 3I9V1 4MRNA 2C2GA 5JNLA 3ZBUA 2DKOA 3K35A 1TMOA 1SOVA 5LB4A 2P5SA 1FMLA 4RD4A 3DLTA 1SKQA 2IXDA 3EZ6A 3QBDA 3DCNA 1PZHA 3GIDA 3HSSA 5LQAA 5LQSA 2GPAA 3FOAA 4IDPA 4B7XA 1N2ZA 1XVAA 3X0DA 5AIBA 5JAPA 2B7BA 4OOFA 4R9SA 2VPIA 2X5JO 3KTAB 1IBKB 3PNYA 4DADA 3LBAA 3DXFA 3HEMA 4B17A 1EUDA 1UC5B 2Q3EA 4OFXA 4BXOB 3KAQA 1OFHA 3Q5DA 1H8HA 3OIDA 2NVBA 1E5VA 4H4EA 1PU2A 5TSDA 2DWPA 4BVJA 5LP1A 1O95A 4IHAA 4E2ZA 3BAFA 4ID3A 4NENA 3ILXA 1HI9A 1PZFA 2BMJA 2QMUA 3GT4A 4O0MA 4ZAWA 1A9ZA 1Q0QA 1C4XA 2B1JA 1F4VA 4G9EA 1USUA 2PZGA 1TPYA 3G2OA 1Z83A 4IZ6A 4XH9B 4CCYB 1S8OA 3CGGA 1QQAA 1FLAA 1U0BB 2VHVA 1VJCA 4LC9A 4PQYA 5LCXA 5T4HA 3SLRA 4C6HA 1XTJA 1T9GS 3EY9A 2Z6VA 4M21A 3L1VA 3ZY6A 2FUG1 3INTA 2R65A 1IUKA 4IAOA 2WAYA 5B36A 1WCV1 2EDCA 5CEEA 5EPEA 4W1QA 2A9JA 3FSGD 3HHPA 5C31A 1D7OA 3EIHA 2G28A 3BTVA 3KLMX 3HCNA 4MQ4A 4NQZA 3RFVA 5HP4A 1XAHA 1NC1A 5JAQA 3UMGA 2HMAA 1QTRA 1DTWA 3HACA 4KRYA 3SZLA 4KPEC 2PRIA 3GPCA 4DCPA 1JAHA 3G49A 1RXSA 3SHWA 1PR6A 5B6JA 5TF0A 4KITB 1JHYA 4RZUA 1N5JA 3RG2A 4CMAA 4IFEA 2G88A 1PJZA 1QYXA 2OZPA 3DAHA 3OJLA 3Q40A 3ZNQA 2P6RA 1SUIA 4Z9XA 3R4CA 1JH8A 1KERA 1NY5A 2G9ZA 2WIGA 4Y2PA 2Q5CA 4UE6A 4ZT5A 1SK8A 1P7WA 1UDXA 3CNLA 4YQZA 2HV8A 4XB2A 3T7TA 4F85A 2PSDA 4KUHA 1J20A 2DULA 3H3FA 4C29A 4C4TA 1SZPA 1Q3KA 5CMLA 4EPXA 2RGBA 3GLHA 3ADKA 2IA5A 1I5RA 4L4UA 3T5MA 3NTRA 1PNVA 4I4CA 1AHNA 1W4ZA 2QLMA 4KXVA 2H65A 4WZ6A 1NSTA 1YFJA 5I7OA 4WDRA 2CEAA 1SA0A 2P2YA 2X41A 3G2IA 3IA2A 1XZHA 3FPBA 4B4DA 2QSYA 1C0KA 1UINA 1VKHA 1M67A 3Q6NA 3PNQA 3QVWA 2P9YA 3E1KA 1UFVA 5ITZB 4BLOA 2A0YA 4TMTA 4W1PA 3O8BA 3W79A 3QWAA 3ZX4A 1FNBA 2XNJA 4WY5A 1UBKS 1RQ7A 3Q88A 3UG6A 1DJOA 2I4OA 3TSAA 3TTUA 4CYMA 5LNK6 1II8A 4ZZIA 1JDBB 5CA1A 1WU8A 4ZV4A 3LKBA 4D92A 5B1SA 4G63A 1H9BA 3MTEA 1GPAA 4P4NA 121PA 2BSXA 1OGJA 3DMTC 2FUCA 1D8AA 3LUJA 3V42A 3F5MA 4QA9A 3WV4A 5I8WA 1AUXA 2WWHA 5ICEA 2RHLA 5HVNA 1SCKA 4LI3X 1FTGA 4EF6A 4ILEA 4URHA 1FFCA 2OL4A 5IN4A 1CR1A 2B34A 3DE6X 5LC1A 3AFNA 4ECEA 3CHYA 4LFCB 1CJVC 2FSPA 2NVUB 5AJWA 4PYOA 3IURA 3E9EA 5GGXA 3W90A 1YL7A 3LUAA 3P7MA 4G1CA 4G8BA 4I2VA 3TLMA 3DFKA 3IAEA 1U7TA 3OPXA 4Q5IA 3KKQA 1GRQA 4V0NA 1VMDA 3S99A 4CKBB 4ECAA 1D6JA 3PXUA 5K8UA 4ZVPA 4W9NA 4UUNA 3C85A 4EFKA 3HJFA 1NC3A 1OLOA 5K3BA 3BMNB 3WOHA 4LVCA 1X7HA 3MT9A 4TLCA 2Y6VA 3L6EA 4JBGA 2QZZA 3RKSA 4US2R 1E2DA 3RBXA 2H3HA 3B1WA 3FNQA 1U3TA 1AN9A 3UGKA 1ZHHA 2ZTUA 4LYAA 4A2QA 3BTUA 3QV1A 1UAGA 3IERA 4QUKA 4D3YA 4D8UA 1SXGA 2QJTA 3QUAA 4CTOA 1SKMA 5ECDA 4WIAA 2LWIA 3SN6A 1DKRA 4CM4A 1TUBA 3FOFC 3NOVA 5DP1A 1XMPA 4UQOA 4KACA 3RFCA 1E5XA 1X86B 2FZWA 1XDSA 4A73A 3FPLA 4A27A 1Z5OA 3BRSA 1M6HA 4CIXA 3D6NB 3KB1A 2WHQA 4FMPA 5CDUA 3OIGA 2ZP1A 1E6MA 4B5LA 3HABA 2XGOA 3PHGA 1U3UA 2HFJA 2HDWA 1OJLA 3S2FA 3TIFA 1PV4A 2PZKA 2F8TA 2HZ7A 1S1MA 1DKPA 5LQKA 4OB7A 3GLGA 1CD5A 4NEHB 5ALXA 4ZJUA 2BSAA 1LB1B 1FFEA 3F4BA 4PZCA 4JDUA 4YRSA 3OZVA 3ZWOA 1JEQA 1ZCFA 1G8SA 4FC6A 4H0NA 1C1XB 1T4BA 2C8JA 1NA5A 1J0AA 1THMA 4BC1A 2HRDA 4BVHA 2FDXA 2H4HA 1PAUA 3NIFB 5D6NA 4KQ1A 1MCZA 1YZFA 4J49A 4A03A 4F2GA 1PEDA 3AKYA 1F8YA 4Z0HO 1I4TD 1L4FA 4F11A 5LP6B 3ACCA 3L84A 2J08A 3VSEA 5DHFA 1YIAA 5KX5F 3U80A 2PIDA 2CN1A 1JT2A 5FJIA 1Z4MA 4RMHA 5JZSA 4OHBA 2H3EA 1A4UA 1W9MA 2AK3A 2BVNA 1GNTA 1PT6A 2DF8A 1TO6A 1QAQA 5AKGA 3F6PA 5HR5A 1A97A 3BMXA 4R5MA 4IDBA 5DRTA 4MDYA 3LI2A 2CEKA 1E79A 3EW9A 4LHEA 4WK2B 5E95A 3H97A 3ET5A 5FFNA 3BG5A 1JSCA 1JLHA 4OJYA 3T1VA 3WBFA 5MFZA 4TYNA 3GZNB 1ZNXA 3DQQA 4FFSA 4DCGA 3HP1A 3DQPA 2HGZA 2BN4A 3M7IA 1Z9BA 3EBOA 4DRXB 3PJGA 2WQ6A 1NPDA 3N7TA 3N2KB 4DLKA 5A3JA 4DDHA 4B82A 1SCNE 3IDOA 1OXUA 4D0SA 2W93A 2Z8XA 5CH5A 3WLIA 4EJFA 3FVRA 5AW9A 3FD8A 1FNDA 1R6AA 3IVRA 1WR8A 4OCZA 4YR7A 3MAAC 2INGX 4Z8XA 5FOSA 3O1JC 2IS1A 5C7LO 4LYEA 3UXEA 1VE5A 3M4NA 3R41A 3IAFA 4O63O 5B6PA 2LDXA 2YWRA 1E1QD 3W9UA 3EYAA 5J2TA 1U11A 3DWFA 5C7IO 2I71A 2QRNA 3E5HA 1ZIDA 1UXGA 3F5QA 3RB8A 5MN5A 1E89A 4BPRA 4NAVA 1EFLA 3EVFA 1ZOPA 3BIOA 4K6MA 5U1PA 1CW2B 1CR4A 2W4MA 5C37A 2FUG6 4EGAA 4AYXA 2VSOA 5IN5A 2VNSA 4FUQA 1QWSA 1WBJB 3DFMA 1BZYA 1DFGA 1MXFA 1ZLYA 4JP3A 3T9DA 4JYMA 4HY3A 4RPJA 3BDAA 1KE2A 4O8ZA 4ETWA 2EZ9A 3L0CA 4F4HA 1MDBA 1Z28A 4ESVA 3T6KA 2UVPB 1NVAA 2VJMB 3AJ8A 3RC3A 4EG5A 1A96A 1SKUA 2WOJA 3GHHA 1VCHA 3IDSA 3QITA 4D9JA 4F2DA 2F43A 1PS8A 4PNEA 5AR1A 3EPLA 4KXYA 4OB6A 3KV3O 4XB6B 4UHDA 4Z0PA 1U3WA 3ZV7A 3HL4A 3OCJA 3OT1A 2WY2D 1EKXA 4U7DA 1JKIA 3KVNA 4NV3A 3V8MA 3PF9A 1CY4A 1Q57A 4UEKA 4Y9TA 5FV7A 1U3DA 1VTKA 1T9BA 3KWMA 1IAVA 1PZNA 4WNCA 1EG7A 4X91A 4ZOEA 4YAUA 5CB8A 1GUAA 1XWIA 1XU4A 3ZDYB 1IOLA 4WOKA 3RS3A 5K2OA 2QN2A 3G2HA 4D56A 2Y1GA 4BE7B 2C78A 3D6JA 4LBYA 4Y30A 1VPLA 3V8EA 4YJGB 2Z8YA 2ZI6A 1LBQA 1YBAA 2ZJ7A 4HOYA 1SPXA 2FEMA 3HJUA 3UO8B 3THOA 4KLNA 2ZJ0A 4DCMA 4N5LA 5D3KA 4XPIB 1OLSA 1ISMA 1W2HA 1TK9A 2O7RA 1N0IA 3BL5A 4MUKA 1FU7A 3VU1A 4M9QA 3VYSB 2I87A 4MWZA 1QKKA 4EUSA 1E2KA 4RPKA 2FN9A 3BMCA 2Q0XA 5BSEA 4G0VA 2UUAB 3EWIA 4BJ3