2G07A

X-ray structure of mouse pyrimidine 5'-nucleotidase type 1, phospho-enzyme intermediate analog with beryllium fluoride
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
290
Chain Sequence
b'AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITFDMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosolic 5'-nucleotidase III
publication title Structure of pyrimidine 5'-nucleotidase type 1. Insight into mechanism of action and inhibition during lead poisoning.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 98
structure length 290
sequence length 291
chains with identical sequence B
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2006-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2g07A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2g07A01
3PGVA 1Z4OA 4UATA 2RARA 3QLEA 1WVIA 1L7NA 3E58A 5AI6A 4UAVA 1T5TA 1RKQA 3U7GA 1Z4IA 1Z4LA 5AKYA 3B8EA 4CF5A 4KX3A 1NNLA 4HGNA 1J97A 4MWOA 5AIAA 5AVXA 1VJ5A 3MN1A 2DQSA 3MMZA 3MC1A 2VKQA 1RMTA 3W5AA 4HGRA 3IRUA 2HF2A 3SKXA 3WKCA 4BYGA 3WKBA 2HDOA 3ZWDA 5AKLA 1SWWA 4YIKA 3L8EA 3R09A 2OA0A 4GIBA 5AM5A 3EWIA 3W5CA 3ED5A 2MU1A 2YMPA 2YMLA 3AR3A 3QYPA 5ALTA 4AS2A 4L6CA 4OHFA 4CF4A 1TJ3A 2YMMA 2P9JA 3L8HA 3ET5A 2PKEA 1RQNA 3UM9A 5AVQA 1XPJA 2JAOA 3ZU6A 3ZUPA 3I76A 5AI5A 3A1EA 1RKVA 1YS9A 5A3SA 3M9LA 3ESRA 1WPGA 2JARA 2G1AA 3NASA 4XOUA 2R8XA 3ESQA 1RPZA 3L0BA 1TJ5A 2YN4A 2OYCA 5AM1A 4DW8A 2EAUA 1J8DA 3L7YA 4Y2JA 5AESA 3ET4A 3U7HB 4MUMA 3MPOA 3FZQA 3I1YA 3N8GA 5T41A 2G0AA 3I28A 4Y2RA 1L8LA 1L8OA 1RLOA 3F9RA 2D2VA 3NRJA 3OCZA 5AW3A 3NAMA 1YJ5A 2IOFK 4J2TA 5AI4A 3KOOA 5ALWA 4O8CA 2W43A 2I33A 2ZBFA 4KN8A 5E0OA 3P96A 3ZWKA 3NIWA 4YCMA 2ZOSA 4GXTA 4EX7A 2B1RA 2YJ6A 4BX0A 5ALJA 1WZCA 5AKHA 2W4MA 1N9KA 3IB6A 3ZTYA 5AKGA 3QXGA 3FM9A 2AUTA 3OPXA 5A3RA 2WF5A 5AI8A 4YIHA 1QH9A 2QYHA 2FUEA 3EF1A 4AP9A 4UU1A 4EEKA 1ZS9A 2CN1A 2ZBGA 3QUCA 5ALOA 4Y3UA 5AM4A 5AVYA 2ZBEA 1Z88A 4L6AA 3W5DA 2WFAA 1S8OA 5ALMA 5IT0A 4DWOA 3PDWA 1L7MA 3QU2A 3A1DA 3L8FA 1RDFA 1U02A 3CZ4A 3FPBA 2R8EA 3NUQA 2B8EA 2HI0A 2I34A 5AHXA 5FP0A 2O9JA 3WKEA 5AICA 2FPWA 2I7DA 3K1ZA 4FE3A 3NANA 3AR6A 3A3YA 3OCXA 2FPUA 3AR5A 1NF2A 4YH1A 2G09A 3WGUA 3CNHA 1QQ5A 1X42A 3IJ5A 3KBBA 3B9BA 4BBJA 4Y2SA 1ZD5A 3NALA 5ALEA 3OCYA 4UARA 1RRCA 1Z4NA 3RF6A 1Z4PX 2GHQA 2FPSA 3ZX4A 1SWVA 4UW9A 2MSNA 1YV9A 4CNQA 4BEVA 3RFUA 1RQLA 3AR7A 5AVVA 2NO5A 5ALSA 4CE6A 3WKAA 3M1YA 5ALUA 2I6XA 1Q91A 3QUBA 5AW5A 2BY4A 4F71A 4RETA 2IYEA 5ALYA 2GHTA 4UMDA 3OCVA 1LTQA 1N8NA 5AVTA 3A1CA 3ZVMA 2B82A 4UMEA 2G06A 2B1QA 2O2XA 2R8ZA 5AKXA 5JJBA 3J7TA 5AKEA 4Y2XA 1VJRA 2FEAA 1ZRMA 1JUDA 3SHQA 5AVZA 5ALZA 4JB3A 2WM8A 5ALVA 1ZJJA 5ALGA 3VAYA 5ALNA 1Y8AA 4J03A 1TE2A 4Y2UA 4XE5A 4BKMA 3FPSA 3UMCA 1AQ6A 3QNMA 4EELA 3SF0A 2I55A 4AS3A 4PNHA 3AR2A 1EK1A 1L7OA 3BWVA 5A3QA 4FFDA 4G63A 4BX3A 4F72A 4Y2PA 4Y2QA 3UMGA 1ZRNA 2I54A 5AW9A 1CQZA 1KYTA 4B6JA 5AW2A 5IT4A 2B0CA 3AR8A 2FPXA 2WF8A 2C8KA 3E81A 4FYPA 4I9GA 3L5KA 4HGQA 4KYTA 4UMVA 4UU0A 5AW6A 1O03A 4DFDA 2IA5A 1K1EA 5AVRA 1XP5A 2ZBDA 2C88A 5AVSA 3QU9A 3DDHA 3WK8A 2C9MA 3ZX5A 2B8JA 5AVUA 4OCZA 1F5SA 4EX6A 2WF6A 2C4NA 3ZVNA 2IOFA 2JAUA 5AKJA 3QUTA 5ALPA 4UMFA 3D6JA 1SU4A 1Z4MA 1CR6A 3EPRA 4KX5A 2WF7A 2YFYA 2G07A 1VFPA 1IWOA 3L0YA 2RB5A 4XPZA 1Z4QA 3ONNA 1XVIA 3FVVA 4HGOA 3R9KA 2P69A 2OM6A 2G08A 2RAVA 2HHLA 4UM7A 3L1VA 3ZTWA 1YDFA 4C4RA 3KD3A 4BEWA 1L6RA 5AM2A 3SLRA 2OBBA 4C4SA 1YNSA 4UASA 4UM5A 3N07A 3PCTA 3ZW7A 5AK5A 2EATA 1T5SA 5ALLA 4EENA 2B30A 3U13A 4IFTA 1O08A 1QYIA 2HX1A 2YMQA 3BA6A 2C8LA 4HGPA 1FEZA 5ALIA 4NABA 2AGVA 1T9ZA 3B9RA 2NO4A 3KDPA 4QQFA 1Z4KA 2JGAA 2FDRA 2WHEA 4G9BA 4E88A 4NFLA 2EARA 3WK7A 3N28A 3SD7A 5AM3A 3QU7A 1U7PA 5AW1A 5AKIA 4DCCA 1Z4JA 4Y2YA 5AW7A 4H1WA 1ZD3A 1RLTA 5AVWA 1EK2A 2WF9A 3SKYA 2CFRA 2YY6A 1ZD2P 2RBKA 2BDUA 4CF3A 4NWIA 3KZXA 2GO7A 1LVHA 2Q4TA 2YJ4A 2W11A 5AKKA 1RC8A 5AW0A 3KC2A 1U2TA 4ZEXA 2HCFA 5ALHA 2YJ3A 4BX2A 3OCUA 5AK4A 1WR8A 2AMYA 3U7FB 3WK5A 3E8MA 2HF7A 3UMBA 3I6BA 4BNDB 3U19A 4YCLA 5AKZA 2PQ0A 1U2SA 3E84A 3WK6A 3U7EB 2ZXEA 5AIBA 1Z5UA 3DV9A 3L1UA 4OD0A 5AW4A 5ALXA 3N1UA 1PW5A 3HYCA 3OTQA 1Z5GA 2P27A 2GMWA 5AI9A 3EF0A 5AI0A 3W5BA 1U7OA 3S6JA 2NYVA 3AR9A 3PGLA 2FPRA 3WKDA 5ALQA 2R8YA 4I9FA 4L57A 1YMQA 1RKUA 2IOHA 3OCWA 2AH5A 1S2OA 2CFSA 4EZEA 3WGVA 4YCNA 3SMVA 1Q92A 3QU4A 2X4DA 2FUCA 3L0CA 2P11A 1MH9A 4Y2TA 4BNDA 5AM0A 4C4TA 3QX7A 2G80A 3DAOA 2HO4A 3U26A 2BDEA 4NV0A 1QQ7A 2Q5EA 1TA0A 1ZOLA 3WK9A 5ALFA 3DNPA 4XQ0A 1RMQA 2CFTA 4RESA 4QJBA 1ZD4A 5ALRA 4OFZA 3QU5A 4Y2VA 3ZI4A 3HLTA 2HSZA 3N5KA 2ODAA 3QUQA 4NAVA 4KNWA 1L7PA 5ALKA 4ZEVA 1QQ6A 3R4CA 4HAIA 3TLMA 2GFHA 2Q4RA 3ZVLA 2YBDA 5IS2A 2FI1A 4IG4A 3QGMA 4HYTA 3AR4A 3WK4A 3GYGA 4KNVA 4UAUA 2HEGA 2PR7A 3FGOA 2QLTA 5AK6A 3L8GA 4YGYA 1NRWA 2JAWA 5AW8A 1RLMA 2ZG6A 1RMYA 2YJ5A 1TJ4A 4JDPA 2HOQA 4ZEWA 5AK3A 5ALDA
chains in the Genus database with same CATH superfamily
3SZRA 1T36B 5LC1A 3N8KA 3COWA 1P5FA 1B0UA 3DOOA 3JZDA 4HFRA 2E55A 2PVSA 1KZ4A 1KF0A 5HKKD 4TXHA 3I9LA 1NK5A 2XUKA 2BP7B 4O4IA 2XV1A 1DKMA 4D8WA 2X3UA 4EEYA 4MVJM 3H1EA 3FSEA 5GWXA 2BYTA 2IYRA 1RQ2A 3CINA 4DCPA 2ZSIA 2H8KA 4NARA 3UB2A 3KKMA 4OSEA 2B1JA 3CMMA 4FEEA 2JEJA 1QTNA 1IMJA 1S7CA 4BVAA 2DETA 5M5BA 2ESEA 4QYMA 2W2KA 5C1PA 3AUAA 2LW7A 2AD1A 3RFAA 1G4AE 4NJ8A 5K8CA 3TB6A 4IKEA 4P7FA 4TQAA 4B8YA 1UFKA 3LCJA 3WYAA 1EAYA 3QA9A 4PYMA 4AYXA 3HE3A 4MDYA 2J5BA 4KPFC 4RHFA 4X90A 2O2IA 4JQYA 1NVMB 1N2BA 2HZBA 3E1KA 1HH4A 4ECXA 4OAOA 4B7XA 1QYWA 4YRNA 4A8HA 5L3SB 1EXVA 4X45A 2ZBEA 1HYHA 1R4NA 5J2HA 2O8CA 1CZOA 1K3FA 1L5NA 2YWEA 3OKAA 4LNUA 3QE3A 4JP1A 4GVXA 3L84A 2O9JA 2O48X 3OF3A 3ZZTA 1XJCA 3GG2A 1SIWA 4F3OA 1XVVA 3NALA 5EMLA 1UXOA 1JT2A 3S2YA 3WHLA 1X19A 1KGSA 2A86A 3UHOA 2XCIA 1DGJA 4IS2A 4KTTE 5FWXA 2W2VA 5EFOA 5DBFA 1HT2E 4L22A 4HP8A 2P2GA 3RC9A 3HVUA 3THXA 3NHKA 4R7GA 4HQKA 3GL9A 3AJAA 2X0EA 1UMCA 5IUKC 2VSOA 2DYKA 1UQTA 2FX3A 1YR1A 3ZOZA 1FX0A 3O8NA 4AG6A 3ZWYA 1TC1A 1ZNQO 3AHDA 3C24A 4NYMR 5A3QA 4ZOLA 2VIXA 1OAAA 4ARUA 4Q47A 3KZOA 1C14A 2O5VA 4IQFA 1WMDA 2BHSA 1P0PA 4GECA 4DWIA 2BZ0A 1PWYE 2W9AA 3SFVA 2N47A 5AOVA 3ZNNA 5GV7A 1ODIA 3U3KA 1EDOA 2V7PA 3LKBA 4QJFB 5CK5A 5JDCA 1FYVA 1JLLB 4J9VA 3DOJA 3V9PA 1TVKA 4YDHB 3ZHRA 4YNBA 2CYCA 1M8FA 2CVQA 1VE1A 2AGVA 4BQSA 1C0IA 4LRWA 4TYNA 5EE5B 2OUIA 3G2QA 3PUVA 3HN6A 1NR7A 3O75A 4LDPA 1B22A 1ZD2P 1SBNE 4D9NA 2AHOA 2BRUC 4FW8A 5IWAB 4DMCA 2P66A 4DV0B 2PZAA 4AMZA 1B6TA 2JAHA 2GPNA 4ZQFA 3WZ2A 1RR6A 4N1AA 1W93A 3ERCA 3E9MA 4NCXA 1I8TA 3A4MA 4RNCA 2Q4DA 1JZSA 2R00A 3OF2A 5EKUA 4I3GA 3O31A 3ZXUB 5ENVA 5ED0A 2QNIA 2AI2A 3RIMA 3Q40A 1B7GO 3AF5A 3QPDA 1T0UA 4P93A 4ADSG 1TAGA 3DMNA 3USZA 3E9RA 4CV3A 4TV9B 2ZI9A 4K2HA 4F93B 4BQRA 4N8EA 2Y1IA 1NHGA 4Q37A 2CK3D 2EGGA 1GQOA 3RE1A 4RS3A 1H8EA 3KSMA 4FW9A 2BLLA 4F06A 2PL3A 4KPUA 1L3SA 4P3YA 2EGHA 1Y1PA 4QASA 3ZD9A 2XDQA 2Q7OE 2CEKA 2Y66A 2OL4A 3GZFA 4F5YA 4C5CA 1D03A 3N5KA 3TAPA 2DT5A 4CF6A 1G21B 4E30A 4UEQA 4KNVA 1X7WA 2BEVA 4GL4A 1GGVA 1OX4A 1GTMA 1ZQNA 3B60A 2PXHA 2PMZF 3NJRA 2WT9A 2DC1A 1TMOA 2I6TA 4HDMA 5K3FB 1SG0A 4PICA 1GAEO 3PWSA 3EZGA 3D6NB 3VAAA 9ICGA 1ENOA 3INYA 4TRRA 5KFDA 1VOTA 3VR0A 2F1IA 3PT9A 2VZ0A 3VDQA 4GLJA 4WOCA 3NDPA 5JFOA 3A36A 5KMGB 2WEKA 5MF6A 3BJMA 1P33A 3U60B 4QOFA 2GUWA 3ZDQA 3BZUA 1T8WA 2FHSA 4UB2A 1YS2X 8OHMA 3IP8A 5FPHA 3TD6A 3HP4A 3NXSA 2LKYA 4GQBA 2Q3DA 5M2QA 1U2GA 3I1YA 4H1UA 3N8GA 4BY9E 4XRHA 3NONA 1V0JA 4RUAA 3WMFA 1WMAA 2D8CA 2E37A 4XGIA 1MABA 1NZDA 5EKDA 1XTTA 1LFAA 1XEWY 1M2VA 5FL3A 5F33A 3ZTYA 1CU1A 2FPGA 5IBCA 4XYEA 4QWBA 4FD2A 2O8NA 5F52A 3OE5A 2V7QA 5F23A 2QE6A 1EJBA 4YJ3A 3OHSX 4MQUA 1S9FA 3TVTA 2WY2D 3Q5EA 5JU6A 3L93A 1GNTA 1WCWA 4BP3A 3EA4A 4U2KA 4LZGA 2G09A 2KNJA 3I4LA 1NM5C 2ID8A 1SIJA 1IRXA 4MVJE 3W8NA 2NUAB 1J5PA 3TI9A 2EFHB 4EW2A 2XRZA 2KS6A 3ZWAA 4RTLA 5HBGA 4JC0A 2Z2JA 2ZXIA 4K86A 4UMEA 2QTVB 3FVQA 3GFTA 1VJCA 5T6MA 3F53A 2ERYA 3O8QA 4RH0A 1NKCA 3HYSA 1ZJJA 4EWLA 4Q3NA 3PUKA 4M1SA 3OBIA 5AUPB 1DV2A 4UDOA 2A8YA 2F7SA 2XUPA 2HRCA 2GCNA 1SUEA 3JPSA 3K8YA 3W4IA 2H8GA 4YUAA 5HCUA 5KOYA 2W58A 1EWQA 4U9HS 2LR0A 1P2TA 1BCSB 1SG6A 2PWZA 2C3PA 1ATIA 2VTEA 4CKCA 3I5MA 2DWQA 4XXHA 2H1OA 2FWNA 2M6LA 2OBMA 2XKAA 3NH6A 3QELA 2YFKA 2FK8A 4KV9A 2BFCB 1O6CA 3NTLA 1ZQ9A 2W7TA 2YH2A 4NBVA 3AINA 1MV8A 1EGVB 4NXNB 2BE9A 4I4TF 5JJCA 3AUKA 3GNLA 2CXXA 5J3JA 3TX2A 3BQ0A 1G8YA 2G5TA 2WWIA 3I9V6 5HK8A 3Q2IA 1I1QB 1U2SA 1A8PA 4EHIA 4JK3A 3ER8A 4QYWA 4J2OA 2WNHA 2GARA 4C87A 4QWCA 2YFQA 1N2XA 1PI3A 2CMKA 4WK4B 3WHPA 1CB0A 2PDAA 3KYIB 2LDXA 5AP9A 2GPYA 4PSAA 3WQSB 2IZ7A 1LKYA 5DM2A 4E13A 2YCBA 3JASB 2XF2A 3K2QA 3MWGA 5JWRA 2GI4A 5DKWA 4HKTA 4UE2A 3AT1A 1MC5A 2OM2A 4IOLA 4H1TA 3ZY5A 2YL2A 3V4LA 2PRKA 1Y33E 3M6UA 1T4CB 1TQ8A 4O2AA 2PSEA 5A4AA 2MSKA 3TZKA 2VK8A 4ZEVA 4HAIA 3PGA1 5AK6A 1Z26A 2G6BA 1AO0A 3OZIA 5LQJA 3BQMB 2DPXA 3L43A 3B3GA 2YV1A 3DMTC 2RARA 1EP9A 2HOIA 1U3TA 4ETMA 4R83A 1A50B 2W2PA 3MTIA 3PJEA 4TXNA 3RASA 1VLVA 2E8PA 3HDHA 5D01A 3MMZA 1OVGA 5FI3A 5A9RA 4E5KA 3HB1A 4J9QA 3SXUA 5AKLA 5IIKA 3SQLA 2VXBA 5GPBA 1JROA 4D45A 2HLHA 5K45A 3EXEA 1J9EA 1QHSA 1MW9X 2X0FA 1JA0A 5IKMA 2A0FA 3LZCA 3TFSA 2YN4A 2WVJA 4AYBF 2OEHA 5J2TB 2Q6TA 3PVZA 4S1TA 5EHZA 2XB2A 1Q11A 2FYTA 3OMWA 5JI3E 1VHJA 1WDWB 4I50F 1E96A 3A27A 4BB6A 2IYLD 2JIMA 1GDHA 1ESDA 5D5QA 1H6DA 2H5JA 1VIVA 4C2BA 1JI0A 5DQHA 3VOTA 1RHRA 4RJLA 4L6AA 2PV7A 1CQPA 5F9NA 2W2NA 2C7RA 3DOUA 5C0YA 4QWWA 3K94A 1L0BA 4NBWA 3BXFA 2J6HA 5HS6A 5IYZF 4HK4A 1GSHA 4EFDA 2VPTA 3FHCB 2D2FA 1XE3A 3SNHA 2X5OA 2CFCA 2HM7A 5E38A 2WK1A 5DLGA 3AY7A 1LNZA 5J5AA 4TWBA 3S44A 3IR7A 1YUNA 1J5XA 2VWPA 3PY8A 5JPDA 1URJA 5TGTA 4QPCA 1VKOA 5E9AA 1MB0A 4GMHA 3MHPA 3PQ8A 1TKDA 4F4JA 1QANA 1W2WB 2CMDA 2WYHA 5TT1A 1WUYA 2I1VB 4ECTA 1RYZA 4YHHB 3KQWA 4EM6A 4XD7A 1N5MA 1HOXA 4EKEA 1NBWB 3E9CA 4KYIB 3C70A 3H2BA 3F9IA 1W30A 2JAUA 4B3IA 1CNFA 1JFSA 2QTBA 2WILA 4RPIA 3HX0A 1CDOA 1N4DA 5L40A 4M1MA 3H75A 4I6GA 2QPAA 4B3JA 1T4GA 4MAAA 2I2CA 4KK4A 3PTLA 1Q15A 4HVTA 3T3OA 2AC2A 1JMKC 2ZULA 3KM0A 4ID9A 4Y6GB 4EECA 5C81A 1AKMA 4D46A 2O8EA 1UBSB 1VL5A 3VOBA 3IRVA 1AF4A 2BFOA 2JI6A 2ZWIA 2EVWX 5SYAA 4AW9A 2IXGA 1VMAA 2GERA 1O4WA 5AW7A 2W03A 3HVJA 5D85A 4D0LB 3O74A 5E6RB 2OAQ1 1QHNA 2Q49A 2J3JA 4US2R 1XZEA 2G9RA 3MTGA 2KQUA 3ZCQA 1PEKE 3G9XA 4GW3A 1C0LA 1CY1A 2BBSA 3DLAA 4ECWA 4F4FA 3LV8A 4BNKA 3PW7A 1P75A 3NVDA 1TLFA 1GUAA 3L05A 2CNDA 2W6ZA 3Q12A 4PLFA 3LHDA 4FBTA 3PSIA 2GMWA 1FLVA 1CJUC 4BJ3A 1AROP 4GL2A 4CIYA 2AIRA 2H85A 4EI2A 4GLBA 2FE1A 1UL1X 6Q21A 3A6KA 1MEEA 4QU8A 3KB8A 2NYUA 1D04A 1JU9A 3HJTA 3ILVA 3D7SA 1MC8A 4Q19A 3KXPA 5IN4A 4L8FA 1HMPA 1NVBA 1PFVA 1ST2A 4UFOA 1QZZA 1K7XB 3CY6A 1ZINA 1M10A 3FH0A 2ODTX 1PV2A 1BO6A 1GT91 1SC9A 3E53A 4Q4HA 2BSQA 5CDGA 2ZWAA 2XNJA 3LC7O 3AXSA 4MMYB 1K8ZB 3I3SR 3CU5A 1Z4LA 3GAFA 1CR0A 3UFBA 4IUYA 1L3UA 2B94A 1M2HA 3OHPA 1T5DX 4FI3F 4ASUA 4OQEA 2NSYA 5IULC 3TQCA 3LBNA 4HWGA 1R18A 1GGHA 1KBZA 2EQBA 2A1IA 2MU1A 2PRIA 4A36A 1X2BA 4OHFA 1L5RA 3M6IA 4DEVA 4R9NA 4JY7A 5CW1A 4R2IA 1C81A 2IP1A 1YS9A 2B5OA 4JIMA 2NZ2A 4KPGA 4MR8B 4DDHA 3RHFA 2ZBUA 4RD3A 1F6DA 3U7HB 4PAOA 5DHTA 2HEIA 2P4UA 4YMGA 4IDOA 1TECE 1ZI6A 4RNOA 3GLUA 3GRKA 3T3EA 3R7WB 5HSGA 3FKJA 4RDIA 5EYPB 1ZI8A 5CMLA 5B12A 3MR6A 1JLKA 1EUZA 4IEEA 1ICEA 3JPPA 2RBEA 1F6BA 3NNDA 1Z25A 5JBIA 2EEPA 1KTQA 4BNVA 1LPAB 1FRFS 3N2YA 4HGYA 3L7BA 4K6MA 1ZCAA 3VNAA 3OU2A 3UMYA 2FMPA 3B3JA 3T35A 1OI4A 2QJFA 4FCCA 3RVJA 4NFHA 3NVAA 1ZQOA 3EQ6A 4BQEA 1GXSA 1K1QA 4OMFG 3FWYA 5BT9A 1IZ0A 4IRMA 3WRYC 2DKZA 3PCRB 1JA1A 1ZZEA 4Y2HA 1MMFB 1DKUA 5GJBA 4ZT6A 5FOXA 3KUKA 1TXGA 2Y4OA 3RADC 3A2KA 1TM5E 1G8HA 1GR1A 1Y9AA 1WDLA 4EG0A 4A0SA 2L2QA 4P22A 3QWAA 3KQNA 2XXAB 3TLEA 2I6SA 4WBNF 3GIMA 1B8PA 2JD1A 2C31A 4HMOA 5KKAA 3BGOS 2I3ZA 3HSKA 1PS0A 5KU7A 3UJNA 4LZDA 4M1YA 1VA5A 3BZWA 5FHQA 1KE1A 3T7AA 2PWBA 2PZEA 2QSUA 4F92B 4XH9B 4ZCPA 2NRWA 1SZJG 2BSAA 1KYTA 1DBPA 4XCVA 2J3KA 4PM4A 4Z6DA 3QXJA 4L7QA 3JQ8A 2H3VA 2NTEA 2G1UA 4ECUA 5JAQA 4RA6B 1WMBA 3UJ3X 3NHAA 2SKCA 2IEAA 1E59A 1TCCA 5K8TA 1DAGA 1JFFB 2WSMA 4CMIB 3G9TA 4EHAA 5LJLA 5EL0A 1TIKA 1W44A 4HLQB 4URUR 4E3WA 3BA1A 1DCTA 1CNMA 4S1VA 2A14A 4CFYA 3QUSA 5DKFA 2W7OA 3CVXA 3LVWA 1PK3A 3WY9A 2MTBA 3K73O 8ICZA 3WJ7A 1EFLA 2IDJA 2HA4A 2DHQA 1G8FA 2R86A 4I4TA 1RYSA 1POXA 2A1JB 3SSMA 3M8RA 2HREA 1KQQA 2ANBA 5D1HA 2OC9A 3STYA 4BFUA 4W9NA 3D8RA 2H1IA 3Q0EA 1E4EB 3JQGB 3KUDA 4ZKDA 1TNDA 3PR2B 5IXJA 3GUVA 3PO5A 4L3VA 5JH7B 4DOBA 4QELA 1VMIA 2C9ZA 1NULA 3E5NA 2XZTA 3KTQA 4PZYA 4DR5B 2NU8B 1F06A 1V1RB 2AH5A 2RKOA 3U7JA 1DBWA 1P2BA 1DIHA 2IXAA 1FJ2A 5C1OA 3N8DA 5LA6B 2WU1A 5K7SA 2QRJA 1W25A 3WSTA 3AN1A 3N7TA 1UXGA 4EITA 3SKVA 3U1TA 3ZQJA 5E9JA 5CX4A 5EEHA 3O38A 4Q3CA 3TUJC 5IIIA 1ZDMA 3U0VA 2YBDA 4FZMA 3AP1A 3WFIA 1BE0A 4GNKA 2JAWA 1QTRA 2OQRA 3GN2A 4DM4A 3SHVA 2YB4A 1KAHA 4OGGA 3N7AA 4R7ZA 4KPEC 3L8DA 4LOJA 1T5TA 2HU5A 3N86A 5FI1B 3K1AB 1ZKDA 1IXRC 4MB0A 4GC7A 3W5UA 3KKAA 1NATA 2G77B 2AJLI 1KNQA 2VNIA 4HDNA 5F76A 1R8SA 1Y6GA 3VYRB 4RE6A 1P9NA 1IHXA 3MYYA 4MB2A 1TQ6A 1S4QA 3PC3A 2GZHA 2I4MA 4Q4AA 2IEIA 4ZC1A 1V8BA 3KQTA 4E2ZA 2ZIEA 1YVDA 4G85A 4W4TA 1DC6A 2X8BA 1H2XA 4NFYA 4DL5A 4Z7JA 3K5PA 3ORQA 2EQAA 4I50A 2OXIA 1MU0A 3VC3A 2IELA 3AL0B 5G5HA 3EXFA 4G56A 3ASUA 2ZWOA 1PVPA 3V1KA 3C1UA 1Y9EA 1YO6A 1NLMA 2XNSA 4S2UA 1F3OA 4BP1A 2MMGA 5IYZA 3B53X 4LCBA 3HK2A 2MSDB 3H2JA 2I6UA 3Q98A 3TF5A 3W8FA 3RVOA 4A2CA 5DBHX 4EKIA 3GP8A 2FEXA 4DO9A 1PDWA 3FR8A 1OT3A 1KTVA 2PLNA 2QMHA 1R4ZA 2C42A 1O1YA 1UFVA 1YR2A 2F4NA 4GPIB 3RF6A 4M1EA 5JU5A 2D7DA 4OJMX 4OHCA 1SC3A 1OKKD 3HZOA 1PDOA 1HRKA 3K2BA 5CDYA 2O7SA 3V42A 3PUJA 1JHXA 2RJOA 4FOPA 3NI2A 2XW6A 1LQTA 4R84A 3SHQA 2QX9A 2CLMB 2NOAA 3HO1A 3UW3A 1Y8AA 1IVSA 4CN8A 5K1ZA 3DCIA 4P38A 4QZFA 4KLUA 4LAFA 1MG0A 2P2LA 5FYQA 4FFDA 3TR6A 2OKCA 2B2CA 2R84A 2GCIA 5ADWA 3Q3CA 3F49S 3C14C 5BMOA 5CEFA 5JZVA 1MHTA 3STWA 1NBIA 2PQ6A 5FV7A 4B48A 1EXMA 1V95A 1KRXA 2DFPA 1IC6A 4TM8A 4RQTA 1BS2A 1JNXX 4W5HA 4ZVTA 2IPMA 2J48A 1XSLA 2ZR0A 4TS4A 3NTVA 1QYIA 1R4MB 2JAQA 1H4QA 5EUBA 5ALIA 1NOMA 4S05A 2NZUG 1TQ2A 4O8ZA 9ICJA 4E1BA 4D3YA 3Q6MA 5D51S 4IHJF 1DC7A 1XTIA 2CLFB 3PHIA 4YT4A 2VJMA 1L4LA 4IM7A 5EEGA 1X1AA 1KZYC 5JVDB 3LWNA 1A4UA 4ROSA 1NU6A 5B7GA 2VLBA 4NZPA 4LYAA 5HRAA 5KFQA 4BB5A 4QFCA 1AM4D 3QV1A 4M0CA 1J42A 2RGYA 3LHKA 4OJLA 2AFRA 3QF7A 2WUDA 3AEQB 4EQ6B 4LHYA 4G36A 1XEWX 1G6OA 5INTA 3MCUA 1UBRS 4X1OA 4B9LA 3KFXA 3MELA 2ET6A 3CT4A 3R5TA 4LZAA 2HO4A 1KZGB 1OFTA 2G5GX 1YU9A 1JECA 5K3OA 3I30X 1YR7A 2D3WA 4B45A 1Y6RA 3OFNA 4O4JA 5DGCA 4EUKA 1GYQA 2C5FA 2R8RA 5KNCD 2C1XA 3MDCA 3QGMA 2D2XA 4I8XA 1J99A 5IEJA 4B6GA 3AUOA 1OWPA 3MOIA 3QEJA 5DBBA 3NIFB 1RXCA 3V8NA 2O0LA 3I45A 4ZHSA 2BKVA 3PNPA 3SBEA 1Z4IA 5J47A 4CF5A 5AJHA 1MX3A 5IMSA 2TS1A 4KN4A 1PJZA 3AKDA 3VR6A 2DQSA 4OUDA 2I2WA 2JGNA 5KG1A 1GVNB 2QP4A 4LX0A 4CR6A 2OA0A 1N0WA 3RT1A 1FUUA 3ZY2A 5FOSA 4MVJD 4RQ2A 1VKHA 2R87A 5BQFA 1Z74A 1NW3A 3Q5GA 2FK7A 1DAOA 3SN6A 1G3MA 3C21A 1AKRA 3I76A 3A1EA 2PHZA 4RPGA 1T8UA 1IB6A 1GNQA 3ND6A 1ZUNB 3EXIB 5BURA 4FINA 3KLMX 3I5XA 4H6WA 3PPVA 3FAKA 4TLLB 1CR2A 1NQXA 3HKZF 4A8JC 1X92A 1Y8RB 2XVAA 4ZAZA 8ICSA 2QD2A 1FSFA 3JWPA 1UKAA 2LYAA 3L1JA 4WLNA 4BUJA 1TOAA 4BO7A 1ZQRA 2AUTA 2F59A 4G09A 5A3RA 3I9NA 4Z6CA 4R3WA 3WL8A 2G83A 1L1EA 3W3AH 1WP9A 1M9NA 1KIAA 3FPBA 5IVDA 1BGWA 2P2YA 2UYYA 4YMHA 1EJ6A 3PKZA 2GEKA 2Q1UA 2R3SA 3TVDA 2LCQA 4B4WA 1TK0A 1L7VC 4X97A 3I6IA 1GAJA 3LX8A 3QKRA 2GD0A 5A3JA 2R62A 4F4UA 1T9HA 5FWYA 5KT5A 4EY5A 4HXFB 1Q16A 4WBNA 3ZVMA 1OIXA 4ZJZA 1X6JA 1ZXBA 2PIAA 5B37A 4MJXA 2GLTA 4MKRA 2XUDA 4ZT2A 3GJXC 4P7BA 4FEYA 4X7BA 4BKMA 3BWEA 1TV9A 1A2KC 4XEUA 5CA1F 3SF0A 4C4AA 2AF3C 3QBTA 3CN9A 2DFDA 1RLIA 5ICSA 4MUYA 2W9BA 3A26A 4FZVA 3SE0A 4ABTA 3AIOA 2ODNA 1K06A 1M73E 3OH8A 4G0YA 4DBLE 4EBFA 1J2NA 2ECKA 4EW1A 3ZY6A 1ZY2A 4LOKA 5SYNA 5HE8A 2IOYA 2Z5FA 3AV0B 2Z3ZA 2XQIA 3TLXA 3NW9A 2P69A 2YWRA 1K7CA 3UN1A 2O5RA 3AU9A 2VVTA 4RJIA 3HCNA 3L0ZA 3F3MA 2JRZA 1LDNA 4A5SA 4I9UA 3TANA 1O08A 4R41A 1D9FA 4A82A 4R98A 4KE6A 3H9QA 5KTPA 2TRSB 3FCAA 2ZTDA 1UMDB 5AUOB 3IIEA 3A3PA 5DM4A 3U16A 2I67A 2P2NA 3DXZA 2P7HA 4NE2A 1C3OA 3T3DA 4E5VA 3HHPA 4LYGA 4YEDA 4KHZA 3H8VA 2IFTA 3DMHA 4DR1B 1XG5A 2RK3A 1YB2A 2QB0A 3TXXA 4B6SA 2BHTA 2N3ZA 3WQQA 1M6VA 1EVIA 4IG9A 2YOFA 4QODA 3GG9A 4D9JA 2NSDA 4K9LA 2HQSA 2WWYA 2EBHX 4WT7A 4FWBA 1WTCA 1T2FA 4MW2A 5AXAA 3PENA 3GVHA 3V32A 2H63A 1SXHA 1JG7A 5D1NA 2HU7A 5JDIC 4MQEB 3F96A 3W2HA 2GT1A 2HQ1A 3E48A 8ADHA 1Q7GA 1P80A 4G67A 1ISHA 4LOIA 5REQB 1HORA 3AV3A 2FW0A 5DZSA 1QIGA 1AV7A 3GDHA 1R5NA 1KI2A 3ZDAA 3WZLA 1JJVA 1DK2A 2CBXA 3EFBA 1GG5A 2GFQA 5CM8B 4DCMA 4I9HA 1U80A 1YB5A 5G1OA 3D6AA 1ISJA 2XKKA 5JZBA 4L16A 3V97A 3NYRA 1XWFA 2FJ6A 4F46A 1VE3A 3IPYA 1Z6ZA 3FFXA 3EEOA 2FLKA 5FQNA 1U6IA 4BJ6A 2GWSA 4P3XA 4O1HA 2EZYA 5AIAA 5CDFE 2UUBB 2NO9A 4QX6A 1WB9A 3LWDA 3MGIA 2QQEA 3QTBA 1VE9A 3NBQA 2QZSA 4B35A 1QHXA 1BWSA 2NPOA 3ESDA 4PZZA 3NVKI 3BD6A 2OV4A 1ZN8A 4ER7A 2O3UA 5DBGA 3SJUA 2IXTA 1IIBA 4LWPA 1E0DA 1IDN1 2WG1A 4GP9A 5JEDA 3F9RA 4H3VA 3NDJA 3AEKA 4M8KA 3KOOA 3PVCA 2QQ0A 5E95A 2WJJA 4DY4A 5IJ9B 3BKXA 1U49A 1VA4A 5HKLA 5KQMA 4Q66C 4E5NA 4WGFA 1GZ3A 3MR3A 3E3OA 1RYDA 3QXGA 4IV5A 2F1JA 1GO3F 1IWBB 3KWFA 3GV0A 1XR3A 2BOVA 5HUQA 1JEJA 4DSUA 1A9QA 2H2IA 1XQXA 4DGQA 1AJEA 4Z1MA 1QF9A 4HNHA 1W5FA 3DBLA 1ML3A 4CEHB 2BZFA 4FMPA 1U28A 3LWMA 2Q2WA 3BE5A 5SICE 5KDLA 2CKMA 2UYQA 1Z4NA 1U99A 3IODA 3UNXA 1TYBE 4UM8B 2B34A 4HDCA 2WV7A 4C43A 3G59A 3RTEA 3OT1B 1UADA 4Q1BA 2PUEA 2EZ4A 4I55F 3AESB 4YR9A 3M1LA 1A8HA 1FFBA 4CLXA 1QMPA 1NVVQ 3STHA 1I4WA 3AP3A 4WXMA 3GLHB 3T1TA 1H6AA 1A8IA 5DNAA 5K4GA 3GUCA 1GG8A 1ZR2A 1K75A 1KC3A 2B5WA 5FV4A 3K53A 4G63A 3NKVA 5IK2A 3PHBE 1CF2O 1D4ZA 5KYWB 4UHDA 3WBFA 2ZRKA 4RQUA 2C3YA 1XDWA 2ZIVA 3WK8A 5KNIA 1C50A 1ISGA 1T2EA 4ZO4A 3ECCA 4PSCA 1EHIA 1LB2B 2GR9A 3W34A 4F4HA 3V2UA 1N34B 2ONYA 1E5DA 4NSNA 2N1BA 2GRUA 3KAPA 4MS3A 5GONA 3EIOA 3E9YA 2V4ZA 3FPJA 3IBYA 4B1FA 4R01A 4URWR 1BKYA 4QEKA 2XOKA 4A03A 1NK0A 2Q0QA 3AC0A 1RYBA 4OSOA 2OY0A 2HXYA 4RLQA 1UJ4A 3L8YA 3K9WA 7ICNA 2C1EA 4IHJA 4XVUA 3KFLA 5AVWA 1A71A 2OHOA 2H2HA 2SHKA 2RHDA 4IUDS 5ELLA 1OYWA 3UA4A 3PDJA 1CUSA 1J09A 2KIWA 2EHJA 1FDUA 1QHEA 3RT9A 3QMMA 1NJGA 1N62A 1XD8A 2C0CA 1R6XA 3C5EA 2H4JA 2ORIA 4XQGA 3G7NA 5HR5A 3RS5A 3JQ9C 2WVGA 3PC8C 4PG8A 1EBBA 1ZQWA 5KC9A 4RF4A 3NKLA 1H66A 2QBYA 1TJNA 4A2QA 3E4DA 3MQ2A 4QZ9A 4KG7A 2JF0A 3VC2A 2IA6A 2Y1EA 4I4IA 1AQIA 2ZS8A 3THOA 5IAKA 1G5RA 3L0CA 3SS7X 2I8AA 1X9MA 3UHAA 4XGRA 4PLVA 3H4TA 3UQ2A 2C3OA 5FORA 2VHCA 1FYDA 4Q24A 4LRTB 3TECE 1JIQA 2DBQA 5D84A 3B9JA 2VSYA 2WW8A 2ZYDA 2JFWA 4MR9A 5HM8A 2YHIB 2FTKE 2GVZC 4QD3A 4TVSA 1YQWA 1YSCA 4H31A 1HE4A 3IMGA 4HLUC 1U98A 2QLTA 4IIJF 2WTNA 3ABZA 3A6JA 2IUTA 3SY8A 3U7GA 1OVMA 1TM7E 3G2JA 3AFNA 5GAJA 4NS4A 1G7TA 4DAOA 1RYYA 2GWHA 3OETA 3ZZ0A 2XKBA 2OZPA 3TNJA 2VJQA 3CURA 3U09A 3D6TB 3IO5A 3LYHA 5KSYA 3HGQA 1PR4A 3PX4A 5ETJA 1DTWB 2JGRA 3G5UA 1XO1A 5I9MA 5ILQA 2KFZA 2K4IA 1A9SA 4MV4A 4DARA 3KOZA 2O54A 2BUBA 3HJBA 3L7YA 3E0FA 1N0IA 4C8LA 2JLBA 4IH1A 3DZDA 3BRWD 2GDZA 4J2TA 4HDKB 1U9JA 2R4QA 2C4WA 1U0JA 4WOJA 2IUYA 4MW5A 3UQ0A 4TV8B 3ZQ4A 5KNLA 1G1MA 5UKDA 3LW7A 1UXHA 1BHO1 5HDBB 4N7BA 3RC3A 2M6RA 3EBPA 1E9CA 2ZUUA 4HHEA 1AGXA 3MMPA 3U7IA 3NUZA 2G4VA 4WLUA 5BW8A 4TSKA 1FPMA 3TPFA 3SDZA 3LGSA 4OM7A 1TT5B 1PYGA 2YIVX 3CW2C 2HJGA 3I83A 3IXLA 5HFNA 1QOZA 2A5FA 3GUYA 2FPSA 4AZWA 2NO7A 2DF4B 2WSBA 1K5HA 5J2KA 1NVEA 1F2VA 2QOEA 4KO4S 4XJXA 2H0QA 5LJIA 2VQSA 3CLVA 2IIPA 4IJMA 2I29A 1W88B 4PAGA 1PR3A 1E9AA 2GCEA 1YU6A 5TXGA 3B13B 1CIJA 1FSZA 4EBDA 1QHFA 2F2TA 4XE5A 3HJRA 5CA1A 3MWDA 2QI9C 4GS5A 3GLFA 5KVSA 4OQPA 2WJ6A 2FE4A 1PJRA 2X9QA 4FFVA 4BLWA 2K2QB 1MRNA 1LDEA 4YS6A 4INAA 3D8TA 3BH6A 4PYLA 4I19A 2O3JA 5K8IA 3RHZA 3DH0A 2EG9A 5K8UA 3QVTA 3I2HA 4FGZA 3PXAA 2IOFA 1YOBA 5FTJA 3O4JA 4HEHA 2P8JA 4INZA 3QUTA 2WV9A 5IKEA 3LL4A 3FYDA 4UMFA 3SJZA 2PLAA 3AF1A 1SPBS 4OTZA 1VIYA 5L53A 1U81A 1E66A 3ABRB 3CTMA 4QREA 2G08A 3K4GA 2Y2UA 3RAQA 1LBTA 1K68A 4Q8EA 1NTRA 5D86A 3MBOA 4X24A 1TZBA 3EDOA 1PFYA 1WPXA 4YC7A 2XY5A 3CWCA 5DV9A 2AQ4A 2H18A 3G0IA 1Z36A 3IAUA 5KVQA 1IL0A 1L5OA 2V4MA 2N1RA 1FQJA 4BJ1A 3KAQA 4OI0A 3VOSA 1E9SA 2W83A 4PTLA 2BVNA 2ONJA 1P6UA 2R8BA 4BVKA 4YXJA 3PSHA 4ZQGA 1Z6XA 3Q9SA 3HEAA 1JBQA 5J0PA 4FYKA 1U9LA 4WOPA 3MUFA 3MWKA 5A62A 4CXMA 1JSRA 4DG8A 4GQAA 4ZTBA 2FCAA 2NXWA 1P0IA 4UQGA 4GXRA 3SVZA 4HVLA 1NFFA 4TTRA 1RKUA 2EW8A 1HQCA 5G0VA 1Y4UA 4QPPA 1ZHHA 4CIBA 3WYNA 2M32A 5E3HA 3PZPA 3WDKA 4LF8B 3QBJA 3UXOA 2OB2A 3SM3A 4BVEA 3ZHQA 1QU3A 4CTKA 2GGSA 1VCMA 2VBCA 3V48A 2CFIA 1CK4A 3HA7A 2CL6X 2ANCA 2W6OA 1UJNA 1OZ0A 4L9RA 4C4PA 5FA6A 3FTDA 3GH1A 3O3NB 2Z5VA 3GJTA 3G6XA 2MYNA 1ENPA 5COAA 4EFLA 4O4HA 2CNOA 2W9CB 5LDHA 1UKBA 3NEAA 3U4DA 1EVLA 2YTUA 3OZ7A 4DKJA 3H5TA 3FDXA 5DHPA 4ILKA 4HGRA 1UMBB 2AOUB 4HWRA 3ZWDA 1EEHA 5HGXA 4MOWA 3NHRA 3H11B 2Q3EA 5EQFA 2WAQF 1OXUA 2NXNA 3H6HA 1ZESA 1BNPA 1PVDA 3CRXA 2P9ZA 2QN2A 3DDNA 1TJ3A 2EFGA 2BIFA 3OY7A 3ZD7A 2VRBA 3ABSB 2PGJA 1Y8ZA 2RHRA 4ZT7A 1DKRA 4QM6A 5ICFA 2ZJOA 1ODJA 4PVCA 5HUHA 3D81A 4MUMA 1U2PA 3AEVA 5KYNA 1PV1A 1SKYB 4X20B 5DB4A 2Z9BA 1CG6A 4JT9A 2QYSA 3D0RA 2ABWA 4JODA 3M6ZA 4ZV9A 3SFTA 4L75A 4DSEA 5CRXA 3KKKA 4M49A 5EMJA 2JFQA 5KO2A 5FH9A 2F48A 1Z17A 1R6UA 4ZU3A 2HMUA 9ICTA 4DLYA 2QRNA 4N47A 4ALIA 3QLTA 4RNNA 4R4JA 2QK4A 4IXTA 2JZBB 1XJQA 1MIHA 3REQA 3EDYA 3WLMA 3IAS1 3PF9A 4ZAVA 1F48A 2JLVA 5I9SA 3EFEA 1C7JA 4REQB 4YLEA 3H9CA 2BFEA 2AOWA 1KI7A 2ZB2A 4L95C 2JFNA 3WGGA 4GSKA 2VDLB 4HNAB 1V3UA 5JSYA 3ROZA 5CDSA 2YHBA 3DZIA 2IW1A 4WZBE 1Z4PX 4Q9IA 4LXIA 2I87A 3KSZO 4NL4H 2HTEA 3AOEA 1R2QA 1C0PA 3MWEB 5DGDA 1GTSA 2WUGA 4J0HA 2HW3A 4KLDA 4JGIA 1KFKB 4FQ7A 4CRXA 3EDMA 4CLRB 3VNBA 4TT3D 3QW2A 4IMIB 2I4OA 2CLOB 1ESCA 3JQRA 5J0RA 1T8RA 3AVTA 3RU9A 2CDCA 4BCCA 3ISJA 2CYBA 5SZJA 2C84A 1SBCA 4RQMA 1ST3A 1T0JB 4YJGA 2A7XA 4DFKA 5TF0A 5AW9A 4EYHB 2PGLA 1XMXA 3V2HA 1BG6A 5G41A 1AX9A 5CBKA 1NSTA 4IF6A 2FSGA 2V7WA 4M76B 2J6IA 2YWDA 3VH2A 1MTZA 3UFXB 2FG7C 1D1QA 4N39A 3BH7A 1JHZA 4G2TA 2KSQA 1G5TA 1TK2A 1JAXA 4E32A 4FZ5A 4KMOB 2A67A 1EFUA 3UKJA 5A5GA 2Q1YA 2IIBA 3ISCA 3IAFA 3BAFA 2WSYB 4BDPA 1NUSA 4TTPA 3IVRA 3ISBA 2CBGA 4XWYA 5BN1A 4MH0R 1T3QA 3VH4A 3DKPA 3CW9A 2FSIA 5HIJA 1FJHA 5T14A 2QAGC 4K5QA 6LDHA 4RF5A 3GWZA 4G0ZA 1QF6A 2NP6A 3L04A 1UK8A 1GT6A 1YKFA 3RTGA 2ZI7A 3EGXA 2NV2B 2A5LA 3D6MA 1ZQFA 3II6X 1T5LA 3AP2A 1NVDA 3OD5A 1GRCA 1R8QA 3KQVA 2VAWA 4NV3A 2JLCA 3K15A 4U0KA 1N25A 3T3PB 3KEOA 1HLDA 3CVUA 4HCJA 4CQMA 2DUUA 2VUHB 4GMXA 4OJ6A 1ISIA 2X86A 3F78A 1BTOA 1YRQA 1AK2A 1RJDA 4QQKA 3IKLA 3MLAA 4K9SA 4Q93A 4DIDA 2PPVA 1MA7A 1GPMA 3EZLA 2P0AA 2FLWA 3GU3A 4L5IA 1KMHA 1ZL2A 4RIGA 4TMTA 3W2GA 4X95A 4AJIA 4QDUA 3L18A 4RAOA 4ETWA 4FCWA 1EP1B 2DF8A 5K4AA 4KUEA 4QDKA 3CKMA 5D87A 4LZLA 5BN5B 1HE5A 4JJFA 2Q0SA 4BJQA 1SXPA 1EDBA 3EG9A 1M1UA 4F04A 1XHLA 4ZH4A 4U7JA 5CFMA 3VSDA 4NYIQ 2RB4A 4DMMA 1VJ5A 5BWNA 4NH0A 1HEKA 4YAOA 3P5SA 3D1LA 3X1MA 1PL6A 2DTEA 4PX9A 4GC6A 2HWYA 1XFDA 3JALB 4WESA 4UPEA 5KYXA 3VDNB 1LTKA 1S2GA 3OZSA 4QTXA 1PQWA 4CHGA 4KVAA 3CUTA 1CJTC 3RVRA 2J3MA 2Y0BA 4RACA 1QGOA 1KAGA 4LZPA 5BQXA 1VBMA 1J6UA 1TCVA 1Q5PA 4FR2A 4PLZA 3KS9A 5DOZA 3E7WA 4Y9UA 3KSRA 5M34A 2HPVA 2PUFA 2QJTA 3WLIA 3V7NA 1NX9A 3D4LA 1ZSNA 3E2IA 1EXWA 1ML4A 3TVYA 4C0QC 1DCKA 4HS9A 3RTCA 2PYDA 3KQPA 3G9ZA 2QP3A 4B8ZA 1NZPA 9ICLA 3TOZA 3F6BX 3FCYA 4X60A 3OUUA 5AI8A 2XGQA 4NLBA 5JQGB 5EOZA 1MNAA 4BO9A 3I5UA 2TECE 3KQOA 1FUYB 5K0EA 2X5JO 2WFAA 5IP5A 1L2TA 3RAEC 4PQRA 5DG9A 4JENA 2R7KA 4XYMA 1C1DB 2VJDA 4B3HA 4EVRA 4WGGA 1I3OA 2H48A 1XA0A 3HKEB 4ENTA 2IVZA 3PRJA 2WWHA 4KC0A 3EW9A 1DRKA 1JVNA 2PGNA 1GFZA 2FG6C 3GOQA 2W9MA 3R77A 3X44A 4LJKA 4HRXA 1QXSA 5G0WA 2GNOA 1F7VA 1FFAA 1DNPA 4KP7A 3M0EA 4UUMA 5BR4A 5EUQB 3SIPA 3ESYA 2C4HA 3GIJA 1PEAA 2OFOA 2OZKA 4GWKA 2ZSFA 3KQYA 3Q7RA 4LDRA 4PLYA 2QN9A 4PRZA 4BZWA 1AGYA 4HQLA 4D44A 1KEVA 5LBTA 3NRBA 4X41A 2CL7X 2ZI3A 3OJCA 3EFHA 4L4ZA 1TVEA 1UC9A 2I66A 3WGKA 1KPGA 3AKYA 2YDXA 4Q6WA 5TPZA 2CT8A 2BF7A 3EEIA 1KEWA 4BFLA 3EC1A 5AMXA 5D3KA 3O21A 3CHYA 2C8KA 2B99A 2JG3A 3GJ5A 1I80A 1PLKA 2V6JA 1PK9A 3PQCA 2FFQA 2NU7B 3HNOA 3R0XA 1UBFA 4K0RA 1O57A 1OLSB 2BR0A 3AF2A 2OKGA 1XPRA 3NIDB 1XJWA 1T3ZA 2G07A 3EK2A 5LQKA 2BBOA 3IIKA 1PT8A 4WKOA 1JHYA 3WGNA 2RAFA 3F8TA 2PZ8A 2W8KA 5L1KA 4FS3A 5BW4A 1J22A 1JSXA 4MQMA 4URXR 1Z1BA 1IVNA 3QWHA 2HBKA 4GNRA 1E5VA 4OL0A 2Z8ZA 3WO1A 3AYZB 3TTVA 2V1XA 2XUHA 3G0GA 1E6WA 3N28A 4IIFA 4XYLA 7MDHA 4OHKA 4RJKA 3LVRE 1G5HA 4CKBB 5CB4F 4X6YA 4BS9A 3F5EA 5KFYA 1ADBA 3ZHZA 4J0JA 4PPGA 1AQNA 1R37A 4ZYXA 3FLEA 1WR8A 5ITWA 1G64A 2F55A 3GFFA 1PNRA 2RQ5A 1XZQA 4XWGA 2VJNA 4U6SA 1Z5UA 4JLVA 4D1YA 4H3HB 3F3YA 2J0QA 3O2JA 3B2NA 3CN7A 1J2YA 2VC2B 3ZWMA 1ZGGA 4U2GA 2EX0A 3OFKA 4L57A 5KKCA 1Z8HA 1RT9A 3LA6A 2NSJA 4QATA 4NOMA 3DAPA 3TQOA 5G0SA 3DYVA 3RBAA 1XJ5A 2VJOA 4NCNA 4BZXA 2OO5C 3VRHA 1UT6A 1N32B 4QNMA 4L2IB 2R751 2FWMX 3FMIA 3L6EA 2OXEA 4R8SA 2F8SA 1ORTA 2QORA 3ZI4A 2AYZA 3FUTA 4DQKA 5ALKA 3DA8A 3OZVA 4I28A 4UVHA 3SSOA 5TQ0A 3COVA 1RYFA 4AU1A 2XNDD 4AN4A 9ICAA 3IP4B 4XLZA 5FBVB 1I36A 1N2EA 5J2DA 1YJQA 1HC7A 1NI4B 5THQA 3FOEC 1P7CA 2PBRA 5TDHA 1TUIA 3IEPA 2P4QA 3WS7A 4DBLC 1SKQA 1YDWA 1D6SA 3FKSA 5F5NA 3ROEA 1MO4A 4D3XA 1HNWB 3LBIA 1Q1GA 3CPJB 4B9UA 2GPTA 1VSTA 1RAAA 4FOOA 4G65A 1U5BA 1ODKA 3CR3C 3IA7A 2NZWA 3IAS6 3EZ7A 3HKCA 4ZTUB 3UH1A 3H3JA 1TCUA 2AKYA 2PKEA 1WU8A 3TSOA 3ZUPA 5KG3A 2X4LA 3ROQA 4DHWA 4UE6A 1QVWA 5FEMA 5FB3A 2FN7A 4M6WA 3DDCA 8ICRA 3QK7A 1MRSA 3C3XA 3V4VB 3ZVKA 2JIRA 2FMUA 2A0XA 4BWJA 1DAHA 3LDFA 5E7MA 2WWWA 2Q4BA 1KFEB 1NXOA 4DLNA 2Y1LA 4ARSA 3Q9NA 1J1UA 3TE6A 4ER5A 1FU4A 1T4DA 2ZCJA 3E27A 5EJFA 1K98A 3FNGA 1Q77A 1U1EA 3TPZA 2RI0A 4C2AA 2P9CA 2C2XA 3EUFA 2GLUA 3PDWA 2WSIA 4K9QA 4AIRA 2PZJA 2O6HA 1RWXA 4YAJA 3GMTA 4L4UA 1FVFA 2CDNA 2QTRA 4HTAA 1CDEA 1L4HA 4QGAA 1C7ZA 3PXCX 4ZOCA 2R66A 4DL3A 3W04A 5CB8A 4EYEA 4OXXA 3EIFA 2XT6A 1T6ZA 2ZIXB 2M6SA 2UV8A 3EWAA 1D9ZA 4ZGBA 4BFZA 3FNBA 4MLZA 2FUNB 3Q8PB 2RRDA 1RACA 4QZBA 2DBZA 3J7TA 1UEXC 4F4ZA 3KU1A 2KW5A 1AF7A 4TLDA 2VANA 3D6FA 1SXIA 1GTZA 1ORHA 1ZVQA 5BYJA 5E0KB 1XDBA 3ZK7A 4UNQA 5LXTB 1JALA 1SV0A 1OWLA 3N7PD 3D0OA 4BB0A 3BMQA 4K9RA 1EFKA 1N0UA 2IDZA 3AZPA 4PO1A 1EX1A 2JXJA 1Z07A 4IQGA 4TYPA 4WY8A 2CE2X 2J5KA 3EGOA 3EGWA 2C9OA 2WA2A 1HT1E 2JI7A 4TWRA 1EUDB 1IH8A 1I4EB 1VECA 4Q4CA 2YKGA 4OQQA 3V8RA 1Q1AA 3BWYA 2ZRCA 4K6GA 3VFDA 3IQIX 1JDNA 4N76A 4MP3A 4ALNA 5WRFA 2X7JA 1WVMA 4ZO6A 1NE2A 1DDOA 5LYJF 3KZIU 3WGHA 2E4YA 2B30A 2QAIA 3WLLA 1UA1A 4R1OA 2FP4A 2I91A 3BMCB 3K6SB 3SBOA 4FFSA 4NZYA 1Z4KA 2E4ZA 3HYTA 1FS4A 5FRDA 2GF0A 2JHCA 4Y2YA 4A8JB 1KERA 1K6IA 1T1IA 2WVHA 4MWDA 1NZFA 3ITNA 1WE2A 3DEAA 4W1PA 4JI5B 2GO7A 2YJ4A 3T7DA 2N1MA 3NHMA 1WAMA 5HQJA 2H7CA 3NNNA 1JL3A 5CFRA 3G5AA 3CUWA 3UV6A 4CKWA 4E5DA 3A2MA 1NI5A 1XZ8A 1M74A 3THYB 3DO5A 5AW4A 3ZCRA 3O4FA 3TTUA 1B14A 4I4NA 1ZM9A 2BUAA 3QNUA 2AXNA 4DRXB 4G0PA 3RQIA 1TM3E 1PGNA 1MJHA 4PHPA 1E3LA 3BQ2A 1JLRA 1KFJB 4QRDA 2DSNA 3DLCA 2RKBA 2GN6A 4TXJA 4WLFA 3JSAA 3UKDA 2V7GA 3K92A 3RIHA 1LRKA 1J25A 3FWKA 2J6CA 1EXDA 1RIFA 3ESXA 4A2WA 2IV2X 4G4IA 3RK4A 1C4OA 4RXTA 5H70A 3DLBA 3AVOA 3RH6A 3MILA 1GZ6A 4EYIB 2GXQA 2HHXA 3ETEA 1V3VA 1E7WA 3QJYA 5A5EA 4PN7A 4JCOA 3QUAA 4AJ4A 1JEYB 1L5SA 1UXJA 2WD7A 4CM9D 4I5EA 5BMVB 3D3WB 2IUEA 4KX3A 4LV6A 1ZGHA 5CEJA 4BMDA 4UNNA 3Q7SA 5JSHA 1IB0A 4MKXA 4US9A 4DAEA 4OJOA 1XVLA 5YASA 4MWCA 2V9WA 1GPWB 4MVXA 5AFSA 2WLTA 1FNCA 3PEFA 1AKTA 2L19A 2HJWA 1R6AA 3IUBA 3K32A 2QLBA 3IUYA 3ZWOA 3VHQA 3W06A 3H1AA 5EFZA 5KQRA 1JRPA 2OQ2A 3KYCB 1PZMA 2YTZA 4GKKB 4AZ3A 4JZKA 3DE0X 2BZ1A 4HRAA 3UWDA 3COYA 1SUPA 4LE1A 2P1DA 1DQPA 3NASA 3C74A 1V7PC 1AIPA 4Y2JA 2JCGA 1NQTA 1PW7A 4NU6A 1E0JA 3ROXA 1ZW1A 4F5NA 4M0KA 2ZWPA 3V1TC 1WF3A 4UNSA 4EG8A 3P0JA 4LQDA 4DLPA 1GUBA 2YJGA 4R7TA 4LWQA 4Z4EA 3FDSA 5K6AA 3ZV3A 5M3BA 4DLTA 4YWJA 4KPYA 2OBXA 4XUCA 2EZ9A 4TKLA 1ZHOA 1FMFA 5EJ9A 4NLZA 5EXDA 1A9TA 2IP4A 3MWYW 4CBVA 3P0EA 3NEJA 3VSCA 4O2BF 4RLSA 3WB9A 4RK5A 1BPYA 1NW4A 2PFKA 1XD2A 5DHFA 1DBQA 2KWIA 2NX2A 1Z8NA 1V85A 1Q44A 5A9SB 4D79A 5DDIP 3BXXA 2VPWA 5JPIA 3V2GA 1UM8A 6REQA 1ZA1A 5ERYA 2YRXA 5EI5A 3EEFA 1U63A 3PJDA 5JLJA 2ZJ3A 4PCLA 4QDZA 2QE7A 4RQ0A 1YV9A 4C9BA 4WK0B 1VDZA 2REXB 1GPNA 2UU9B 4BVFA 5K05A 2CXQA 5D2CA 4UAWA 3K0FA 4R9VA 2IDKA 5THKA 3TZCA 5K8LA 1K7YA 1VRVA 3R3VA 1V8PA 2WSSD 1UA0A 5TR9A 2F77X 3P32A 1FQWA 4A6PA 3JVUA 5KPJA 4LZOA 3ITDA 1NTOA 2AVNA 4JQZA 5L6LB 4II2A 4B7CA 4RQ5A 1PGQA 4V02A 4OHUA 4DLUA 4MHTA 2IY9A 1PUZA 2AE2A 3IJPA 2J87A 2YV3A 3IH5A 2CMFA 3W0LB 2OYYA 4OHPA 1EDDA 3J81j 1PHRA 4MZDA 2QUZA 3HADA 1G66A 4Z4GA 3P52A 4NPHA 1QOQB 5DRYA 1DXQA 1Y42X 3ACDA 2HA7A 3ELBA 4V0RA 4HYKA 4OOEA 3F90A 2AA3A 3PR4A 4MRAA 4DLLA 2ZBPA 3AG5A 4KSCA 4R31A 1S3IA 4I2HA 3DKIA 3UBMA 5CB4A 1YRBA 1GL9B 2NSHA 1PKXA 4ZALA 2YY5A 4K26A 3SAGA 2HW8A 4MJ3A 1H9AA 5C80A 2H3EA 1ORIA 1MVNA 1WB6A 2JIZA 2JLQA 3A4VA 4DFPA 1FUKA 1U3DA 1P4RA 4JB8A 3DJYA 2K7FA 4IHKA 4AY6A 5KQSA 4RQNA 4EVIA 1EE1A 4UD6A 1M67A 2VNKA 4ZVKA 1KORA 1I4OA 1DVRA 1M34A 4Z53A 1ZC4A 2WTEA 2ZYTX 2KIVA 2QWXA 5BSTA 2YINC 3BMOB 1XAGA 4M99A 4O6VA 5BUSA 1A9XA 4MDFA 4BNDA 1QDUA 3QVMA 3V7FA 2ZYRA 4FFPA 3NETA 3H2YA 4A8EA 3QZ7A 3DDWA 4AS1A 1SB8A 2I3GA 1W9HA 3GYGA 4MAFA 3JWHA 1L3CA 1NRWA 2IHVA 4ARIA 2DFVA 4RCVA 3QVGA 1N6HA 2OO3A 2Q3MA 3SAJA 1YASA 3FWPA 3U3DA 1K7EB 1D2CA 1UIMA 3B1XA 3F5FA 5L7WA 4IRUB 2V0CA 5DOVA 4MWOA 3V72A 5A4MS 3OLYA 4BMCA 1ZGCA 2WKSA 2YYSA 2ZETA 3VHLB 2XZDA 3HO6A 1P61B 1ZK3A 2PNFA 3EZ5A 3KHTA 4D96A 3R6WA 4ZHQB 2A78A 3JV7A 4CTJA 4JC4A 1Y5IA 2NU6B 1MEOA 3O4IA 1SUFA 3V6KA 4BC0A 3Q8MA 1FB5A 1QAQA 5LP6F 1JA9A 4F3NA 2HF8A 1D1TA 5CNJA 1NYLA 3CISA 1CE8B 4AJKA 3JARA 1JTFA 3Q3VA 1KRHA 1CUKA 3RABA 2QLFA 2YOHA 3L4KA 1DOZA 3BQ7A 1FFXB 2V7QD 4I2VA 1EFVB 2TMGA 3HMQA 1BNOA 2IPXA 4TYWA 3UT6A 1ZRHA 3I52A 4FKBA 4YCMA 3C16C 1QFSA 2QRLA 2YWGA 4EF4A 2VTBB 1K8XB 1L5GB 4RPJA 3DO8A 3P20A 1KOGA 2HA0A 5CIYA 1EGMB 4R8KA 3ZLVA 2PL5A 1PQPA 5JV5A 3KYDA 2ZM5A 1L3TA 1NW9B 1Z0AA 4I27A 4WK2B 2CN1A 4RH1A 2Y0SC 4EDFA 5I7AA 5TQ2B 3BE4A 4GFJA 1ULHA 2OCLA 4PXSA 2W8BA 2OZEA 2QVGA 4KAAA 4CIXA 2IEGA 4BE4A 2A3VA 3LE8A 4HDSB 1EAMA 4K2AA 2ZZKA 3RVLA 5C52B 3FNEA 4DTCA 4HUQB 4AMUA 3RUCA 3KBBA 1EE2A 2OMEA 3TLZA 3JVEA 4WH0A 4Z0HO 3UT5A 4LXUA 1JX4A 4ND6A 1S02A 1XMOB 5T57A 1Z2PX 3F7MA 4EY7A 2AOTA 2JCXA 2BHLA 1WV1A 4TQRA 2B36A 3OZXA 4D0NA 2R8ZA 1BWRA 1Y80A 3M9OB 4OGLA 3ADKA 4R16A 4PTYA 4J9OA 2R00C 4FTWA 1UK6A 1W4LA 2O23A 3DL0A 1WDKA 5EHXA 4LSZA 4LY6A 2Z2YA 4W7IA 4HQOA 1Z3CA 4QSMA 1E8MA 5LDDC 4BNZA 2XAUA 1P6XA 2PKWA 4PLWA 3SXJA 1WM1A 4P3PA 5HTKA 3OHBA 4WZAA 5EHGA 4EX6A 1PNOA 1WDMA 3FSGD 3AX6A 3WWZA 2PUWA 4CEJA 1DIOB 2BM1A 2L18A 3GJSA 3IKVA 4IO0A 2WHRA 2I7CA 4COKA 4JLSA 1E9FA 3WI7A 4I66A 4HUTA 3C1OA 5IM4F 1IOLA 1QKIA 5AM2A 3IIMA 5LYJA 1MJNA 1LW7A 3T5AA 2BJHA 2RGEA 1L9XA 3I42A 1PD1A 3HM9A 4NABA 2CBZA 1ADFA 2Z6UA 3VR6H 4QQFA 4G1MB 1RP1A 3AEUA 1BE6A 2PANA 4PR0A 1XZMA 5EIFA 4BAGA 1NDQA 3W2FA 3VX4A 2VAPA 5HFAA 1AS3A 1Q1ZA 2EJUA 1WG8A 3H9JA 5CH3A 2IXBA 3N6XA 3MS2A 1V8DA 3LNTA 2H0AA 1CY6A 5J0TA 1PSDA 1T3TA 3ABOB 3PD7A 1VLHA 4EMSA 1L7RA 1OZHA 5L3QA 2ZR9A 2OOKA 1G6KA 2Z1MA 1SOUA 5HJ7A 4KI0A 1A5SB 4P4UA 3MPUA 2QARA 5DXFA 3L2OB 1QKKA 5K5EA 2ENWA 4BQOA 2VBGA 4CG0A 1JEDA 5F3WB 3DBIA 3H9GA 5CAEA 3V7WA 4PS0A 5K09A 3Q85A 3HZHA 4OQMA 2ODAA 3FWHA 1C3VA 3CSSA 1QQ6A 2VZ8A 1KO4A 2CXSA 3TTWA 3ZHYA 5J1TB 4ND2A 2FFAA 4WA7A 5SY4A 5FQOA 2EKLA 2D1SA 2AI1A 1UODA 4YAWA 4AMBA 3RJZA 4KQJA 4J49A 3PUHA 1GDDA 1JILA 4MS1A 4K4HA 2YQZA 1HUZA 2GJ8A 2EP8A 3FZEA 5TLSA 3PG5A 3EOZA 1EDEA 2WA1A 1XA4A 3N97B 1WA5A 1K86A 1W59A 3RR7A 2QYOA 1Z22A 2H4FA 4DABA 4X7PA 2MSEB 1H6CA 5U9CA 3BBLA 2UVRA 1V5WA 2WMDA 5KTNA 1FTWA 4XDGA 5D5PA 1KEJA 3BJEA 4HV4A 1SB9A 5HJEA 1Q1EA 2UAGA 2Z6VA 4H60A 1O0SA 1K08A 5JNTA 1EVQA 3X2SA 3M8KA 2OYSA 1JQ5A 3A6LA 4Z4CA 4H9GA 1YZ3A 2X7HA 4NM1A 4KGXA 4RK1A 3IEUA 3MGBA 3RSCA 1NZJA 1YKSA 2GASA 2W2LD 1CZRA 4J3NA 4R2WA 1VB5A 4HLNA 3ZJVA 2VXOA 1FTGA 2CXNA 1KZ6A 4LV8B 1C9YA 1E4OA 2ZXHA 2JLZA 2WJHA 2FPWA 1TUBB 3A10A 3T9FA 3NANA 121PA 2CE7A 4IHAA 2J9YB 2E85A 4ITVA 2PGIA 3BS5A 3IELA 1G20E 7ICFA 4AFNA 3HVRA 3ZX4A 1E1CB 3JY6A 4DA4A 1EGAA 3D59A 3QBDA 4MEAA 3JD1A 4ALKA 1KQNA 5JRJA 4DV5B 2R1TA 4KFTA 2YYAA 4MVYA 1E89A 421PA 3AW9A 2X15A 3WYBA 1ZIYA 1JRLA 3ONWA 2ZRGA 4D8TA 1M54A 4PZNA 4DJAA 5CIWA 1TE2A 3WGZA 2ZS7A 1NSYA 3IUJA 2ADMA 3CO0S 3VZCA 4QOHA 1IZ7A 3RS4A 3X3HA 4B9AA 1NXSA 3GELA 2F8MA 5A7HA 4BNWA 1WL8A 1BW9A 8GPBA 2QR2A 1T24A 3HLYA 4JLKA 3ZVNA 2OGWA 2HFKA 3CEJA 5B57C 5DYTA 2GXAA 1V96A 3NYQA 3CEPB 4DLGA 2ZDHA 4TMYA 1EFHA 4H77A 3WO0A 2OBBA 4TLCA 2OEPA 3EQ9A 5EWMA 4BMXA 1UDCA 4Q1AA 2JR5A 1VLLA 3OKCA 2VTKA 2Z58A 4EYKA 1NC3A 1IM4A 4IIUA 2K6GA 4QZGA 1XQ9A 3PUXA 3TWOA 5KNDA 1MQAA 3QHQA 5BQPA 2C2DA 5LQCA 3G1WA 4OU4A 1KVQA 2V9CA 3I6MA 2HHHB 3DQPA 2HR1A 5K01A 2JL1A 5H68A 1U0NA 4UNPA 2W2TA 4DNFA 1DXSA 2H2AA 4RJ2A 3MERA 1CY2A 1HL3A 2OLJA 4X00A 2WHPB 1NHWA 5C1IA 3M1AA 1ZYUA 2IOHA 1A1SA 3HM2A 3RI3A 3FZYA 3WGVA 3SMVA 1JG4A 1CQXA 3K3PA 2QMOA 4O25A 3GRYA 1H8HA 2EWWA 4EPYA 3N39C 3CGWA 4RGYA 1E1MA 2C2RA 1RWNA 3AF4A 2Q5HA 3FJOA 4FX2A 4I2AA 4KTVE 1YFJA 4YBRA 2PTHA 3HBFA 3CZCA 1ZJZA 4UAUA 2IHJA 5JMTA 2XDAA 2EJBA 1WXGA 4DV2B 3MWFA 3O93A 1AUPA 5E2AA 3JAWA 3R5SA 3DAGA 5D3ZA 4YO7A 1CR4A 2FXVA 2IYPA 1W6UA 1MO3A 1AS0A 3HU5A 3DOHA 3QPUA 4JFRA 3PQDA 2IITA 3K96A 4O9MA 5BR8B 3VR1A 4HPJB 3OPQA 4EG7A 5LP6A 1P4SA 4EGJA 3MRSA 3TSCA 5DTQA 1HZZC 4PPQA 4F7DA 4EUSA 2X9LA 2E8MA 1CUCA 3GP5A 4EPTA 2IHUA 2QAGB 2X1MA 2WQZA 1TRHA 1Z6YA 5D6NA 4OF4A 4QDJA 4GKJB 1EG2A 4FYVA 3UHFA 5I9BA 3KPVA 2XYVA 3BJRA 5ALOA 4QVIA 5J2EA 3T5DA 2YNMD 2XE7A 3VM6A 1G8JA 4I8DA 2PWYA 1KGDA 3CA8A 4Z3KA 3ELWA 2IZ5A 2PUBA 1OWMA 2R8EA 4ZCQA 4PBTA 3P9CA 4LG1A 4JL8A 3AEZA 2BMAA 2KOBA 5AHKA 1TU4A 3NMUF 1QYVA 5JLAA 3OQJA 1ADYA 1SHLA 2R9VA 1HQKA 4MQBA 1QCYA 1K8QA 4AWXA 3LO8A 2BCRA 4RD1A 2VSXA 4X3PA 2PSHA 3UUWA 2PK3A 4YG2A 3OSNA 5K0ZA 4BWGA 5ALYA 3OM0A 4WJZA 2ACKA 3EVTA 1NU8A 1WSBA 1Q84A 4AO8A 2VHJA 1IFXA 1SCUB 1QVRA 1XHFA 2ZJZA 1COZA 1BQ4A 4ZPJA 1E2FA 2PX4A 4BO3A 1Z62A 1PR6A 1M0SA 2X8AA 1D2HA 4QNRA 3OPNA 2F00A 4NYJR 1EG7A 5FKJA 1S2NA 4G5RA 1L5HA 3G5TA 1K1EA 3WIDA 1IBRA 2JEOA 3HJHA 5CLIA 4LTMA 5DDYA 5L7TA 5CFNA 1SU4A 1HE3A 2GK6A 1PFUA 4DLAA 4AUEA 1FYXA 3UJBA 1F14A 4W5QA 1QX4A 3Q8WA 4NNOA 1U7ZA 4LJ4A 2H1SA 4BEWA 1QE0A 3CRZA 1YXMA 4CTOA 1BVUA 1ZGZA 3KZNA 1E1RA 1UBTS 3JYQA 5A04A 1RTKA 1C30A 5IAAA 3TBFA 3P9KA 1M1YA 4WXHA 2ZQZA 1GPYA 4QO8A 3KKZA 3DD1A 3FRJA 1XEXB 4CLEA 2BDUA 1YDMA 1PWXA 1J49A 4YRLA 3JPTA 4MHOA 1O9HA 3WK5A 2P3QA 2P5UA 4YJFB 4EPWA 4ZCSA 3IV6A 4ISBA 3EGIA 4J2HA 5BWCA 3PFWO 3U7EB 2V6FA 4YDSA 2PRYA 1RAEA 3HKBA 1GPAA 3L4JA 1BWQA 3E0QA 5CXXA 5BR7A 1KARA 5DASA 4IDAA 1DL5A 4GZ6A 1YCFA 1LBHA 4DL2A 2C2EA 3OCWA 2QMYA 3AHGA 5JUWA 1RFGE 2HRRA 4AY4A 2QUBA 1UZUA 3K6RA 2DOKA 4KLOA 1A4RA 1UQUA 4KMSA 4KLRA 4R64A 4OHRA 1CWUA 1VKJA 3DNPA 3W5IA 2KJ5A 3GVXA 3DGEC 3VR2A 4BASA 3L1IA 4CV2A 1H2RS 2PLWA 4KNWA 5JI2E 1QH8B 2F76X 2CGEA 1KQGA 3QKIA 4YXWD 1TAUA 2I65A 4QLOA 3C43A 1T8EA 3GZTB 4PX2A 2Y1DA 4KAJA 3W8RA 3I0MA 1ZWKA 4G1CA 1TL7C 1KFSA 2YNMC 3S8EA 1E5XA 3C4QA 1QRSA 3T7RA 1QPZA 2FR8A 5CEHA 1KFCB 3MN1A 5HQ3B 1N9GB 4WKNA 1DG9A 1F0NA 5FPSA 5LMNB 3JX9A 3AY0A 1P1CA 2YRFA 1JAZA 4I55A 1Z7EA 4GGPA 2YMMA 3VR3D 1L3IA 1MJFA 4N48A 4LJ9A 1DWOA 2Y27A 5DW0A 1WKVA 2IPLA 1PJ2A 3ZJ4A 3ESRA 1N61A 1A5BB 3PW2A 2EKBA 2IYYA 5FTKA 4Z6KA 5G53C 1SOMA 2GCPA 3TMAA 4LI3X 1GWNA 4K8RB 1AB6A 4OUKX 4C01A 4HDRA 1TDJA 3OEHA 4C21A 5E0OA 5I6DA 1PJBA 3B5JA 2HRDA 2YVQA 3W3AD 1G0NA 1WULS 3E3LA 1AGRA 5CP8A 3GV7B 2OXTA 3QUCA 2FPIB 3GPBA 1UXIA 4K0KB 1F51E 3FD8A 4EO7A 3SZUA 4R8VA 3RJKA 4S3MA 4LECA 1WU7A 3WWOA 1R7RA 1Q3TA 1CDDA 3TAHA 1L6NA 1Z75A 3BE6A 1YC5A 2W6JD 1B42A 2PE5A 4DC9A 4GO1A 4X3OA 4F9GA 1XPUA 1J06A 3RSOA 1X80A 1I5OA 2Q2OA 3B9BA 1KMNA 3RVBA 2ZB8A 9ICRA 3KLOA 3HDYA 1RC0A 1RRCA 5F2EA 2ENUA 3E1GA 3I9JA 3FCOA 4WN9A 1CULC 2WFLB 9ICOA 1SZHA 1TYAE 2HCRA 1ZQTA 3WQHA 5FI0B 1JXMA 2FMKA 3DHVA 2Q62A 4H35A 2CLSA 1U2DC 1EZZA 5AKXA 4RQBA 4XWAA 1NBHA 1R9MA 4KEAA 1C4KA 3T5MA 1XELA 4FNGA 3BCUA 1FS6A 4K4GA 3LFUA 3UMCA 1P4HA 2P5TB 3FPGA 3EIXA 1GLNA 1H5NA 1EK1A 1G9SA 4NU0A 2X0DA 3OMLA 3EXAA 4P8RA 1F8UA 4OL9A 5FAXA 3WRVA 4NENB 4ETNA 3QEBZ 2VG8A 4MPJA 2ALJA 3H1FA 3R9XB 3MJ4A 3IQWA 5U4QA 1GSOA 3HVHA 3V1YA 4B9VA 1M2OB 2FKNA 2I3DA 1WQ4A 1MH1A 1D6MA 4WNIA 4C2TA 1EUCA 1GQQA 2PL1A 1AN9A 4BP8A 3VNQA 3TCKA 1SC6A 2Z04A 2KLBA 4H1HA 4GEKA 3CZRA 4IIJA 2Z4TA 2Q3CA 1T29A 3DLIA 2X0JA 2ORWA 3OHMA 2EAMA 3PNLA 4HX5A 4GMKA 2Z4SA 3KKAC 5L4LA 1IHOA 2XECA 1X3SA 4IH9A 1XN4A 4DWWA 1PZHA 1PGOA 3HP7A 3OCUA 2OT3B 1NYRA 3DWIA 1RTTA 3CEHA 4IPTA 2FMIA 2H4HA 5BV2P 2AEEA 4RU9A 2AR7A 1JPJA 2JBWA 1KDYA 2HV8A 1AG9A 3JQFA 5ALXA 4AYBC 4DF3A 4Y2GA 2VZ9A 4F45A 4P98A 5DE3A 2NYVA 3SQIA 3Q3GE 2DJ5A 3OFND 1LSSA 4EKYA 3DS8A 5HEKA 2PT5A 4YQFA 1L5WA 3MWLA 5BUCA 1RPTA 2FRVA 5T8KA 2D3TA 3CNLA 4PFKA 3HEMA 4O1IA 4EFMA 4OQYA 2XRMA 3LXMA 1IN7A 8LDHA 1VHQA 1G9XA 2GN8A 3NWOA 2GTHA 3EYWA 2KX7A 5GGYA 3CB2A 4G07A 1N8KA 2IHYA 3FI0A 3UK2A 3QVLA 4DIKA 1X9GA 3O8BA 4JASB 2O8FA 2UVPB 3A0BU 1YB7A 1XZIA 1NGSA 2VNHA 1MF7A 5EZ5A 4ZVLA 3LTNC 4J0FA 3OOYA 1XVUA 2K8AA 4KQMA 1OT5A 2WU8A 3E23A 4TMWA 4KRYA 3OX4A 1G2IA 4IYJA 3BF7A 2AG6A 3IQDB 2DHEA 3EWIA 3LO5A 4TYYA 4FBMA 1C4WA 5G4KB 4RTQA 4LRUA 4DL4A 4CM5A 1GAWA 2JAOA 5DTRA 5FLEX 3GZJA 1YR6A 2ZQYA 1QHHA 4N40A 5AXBA 4ZKEA 1OV6A 1OFGA 5KQLA 5F12A 2ZDGA 4B46A 5CJ7A 1X38A 4XR9A 4Y67A 5KYUA 3ST7A 2B4QA 1ZKMA 1BNCA 3JQAA 3L77A 1Y3HA 2IEBA 1I4TD 5ALWA 2GRJA 3HB4X 1UEJA 1HOTA 3OE7D 3K20A 3V8BA 4DV4B 4HFJA 3T0IA 4FGLA 1XZPA 3RS9A 2FH5B 2LMRA 4KO3S 2WU4A 4UHKA 4QDXA 2IH4A 1SC1A 2IKSA 1QX3A 4B40A 5CHGA 1V9SA 2AEMA 3SV3A 3L46A 3Q10A 1E32A 1CR1A 1KEEB 1Q74A 2VYVA 4F0JA 4L0QA 4LDQA 2G9UA 3RSHA 1NOJA 2QJOA 2IUFA 2VCEA 1NF2A 4G0WA 1N2GA 4PO3X 3WGJA 3KRTA 4BFSA 2J9FB 2NUPB 5F21A 4KXNA 1X0XA 4DOMA 1HUQA 3VVLA 4LBVA 1LNQA 5D8DA 4AZVA 1BSVA 1YZ6A 3LPNA 3TJZA 4XRGA 2GVNA 3B6EA 3SI8A 2Q28A 2UZIR 2VT6A 5FUMA 3SJBA 3IV9A 2FVYA 1OHHA 5DN6D 3R40A 4YAUA 2XA1A 1ZO8A 4D2IA 1ZMXA 4NULA 1IE3A 1ZD8A 3QEMA 5DH9A 2F17A 3SHTA 3G0OA 1KR2A 4EEXA 1Y4ZA 1AQ6A 4J9RA 1GRVA 4UVEA 5HILA 5B3LA 3HDVA 3QLVA 5H4HA 4D02A 4HB3A 3SMQA 4IFBA 2ZRHA 1ORVA 5ENDA 1ODSA 2JBAB 1ND6A 1LS1A 3E3MA 2WF8A 1V25A 4UMVA 4IIBA 1DX4A 4LZWA 1TD1A 2YHUA 3ZX5A 3PWZA 4YJHA 3UAVA 1U8ZA 2E5SA 2FPKA 4G8JA 3GAMA 1P91A 5KX5B 3FOBA 3PJRA 4H4CA 1S97A 4W8HA 1FPQA 5J63A 1TADA 1RVDA 4FLEA 2VN8A 3JAKA 2XWJI 5ALLA 1KY5A 2QT0A 1WHSB 3NNSA 1GEEA 3EZNA 1JN0A 3NBYC 5HFJA 1PFGA 2Z9CA 3OECA 5FUBA 1I6KA 2HVHA 5ES3A 1QIKA 4G4GA 1LY1A 4BXOA 5AKIA 1YZNA 2P9FA 1X39A 4MV9A 4CW7A 1K5PA 2CFRA 2VDNB 2QGNA 4C8NA 5DNUA 4KODA 2CCKA 2J31A 4BKRA 2C92A 1DAIA 5FL7A 3NYWA 5GIOE 3TUIC 1AZTA 5C8ZA 3JWIA 4PHEA 1CHDA 3OJUA 4FFRA 5BOVA 2WM9B 1MDFA 1S3FA 4RWZA 3PX6A 3MJTA 4JR1A 3CMCO 1OJ7A 2DT8A 4PPXA 5DBAA 3T3FA 4ZU6X 1JTEA 2DR3A 4JJEA 3PQ2A 5IJXA 2CFSA 2G9NA 2I9GA 5BW6B 3RRMA 1RXVA 4TUYF 3IO3A 5C7IO 1BJTA 3O1IC 1BDBA 1V2GA 2DWUA 4NHEA 3DV0B 2CFTA 1Y4AE 3BSYA 2Y0CA 3NHZA 4HZUB 4ZMSA 1Z6PA 4UUBA 1HNNA 1QTMA 3F2VA 1Z47A 5T4EA 2P4EA 3MUEA 4P0TA 2QAJA 1LLFA 4JUIA 3EODA 1T9GS 1C1XA 5AW8A 2XYGA 4KU4A 3GEDA 3G2LA 2BZGA 2KSOB 5IWCA 4MRMA 4UBOA 3RK1A 1U4SA 4OBWA 2ASVA 3BF8A 3EEBA 4KI7A 2HMWA 1TZJA 4A73A 1H4TA 1NV9A 1UCFA 4M04A 4Y1RA 3TOXA 1S96A 4GIBA 3RANA 5EWJA 1SL0A 3UK7A 2D6FA 3N7UA 2DAPA 1FRNA 2P3OA 1RZ3A 3KJHA 2KFNA 5ICCA 1HTBA 5EERA 3KQLA 3W8EA 5CVDA 1K3UB 1WP4A 2XUAA 4DW8A 4C7OA 4U2CA 4BJ5A 5LIPA 1L8LA 4PZUA 3DBRB 1Z0FA 2Z83A 4X71A 4R8UA 1J0EA 1E1KA 4UAGA 3QENA 2KB0A 1JI3A 4AX4A 2R1VB 4Z1MD 4WUVA 4BN0A 4L78A 2C4KA 1OLXB 5AHWA 4O4IB 1DWPA 2YC4C 4YY3B 3NEYA 1NBAA 3V9AA 4H4DA 5U4XA 1PGJA 1NMEA 4F1KA 3I53A 2EFYA 3MBKA 3AQIA 4COOA 4XA8A 4LYYA 3K6JA 5I4BA 1P1KA 2AXQA 4E5MA 3GEEA 4MCJA 3N2KA 4ZOAA 4KWHA 3UPQA 2C2HA 3OZWA 1E18A 3RFXA 2W2KB 3RJFA 1FBTA 1HSOA 3OTOB 2ATIA 3BQNB 4TXLA 3SZMA 3TRJA 1C7YA 4Y18A 3LC1O 4EJFA 3ZZMA 1YOVA 1AMOA 3AETA 1G6HA 1TD9A 2CXHA 3JPOA 2YW2A 5KCZA 4U7WA 1XMIA 2PKCA 1K2VN 4IC9A 1BDJA 2V96A 5DYGA 2XUOA 2XVXA 2WD8A 4UJ5A 3Q41A 4XOIA 1ZXXA 2OYRA 3LXRA 4YRRA 2CXOA 3UJ7A 3VPFA 5KKNB 2GBLC 2WJAA 3Q9UA 1ZQ1C 5LLTA 1YE8A 1R4NB 5D7NA 3CW8X 3GP3A 5ECYA 2KZMA 2JS7A 3BWVA 4LNUB 4WQMA 1JH8A 2Q45A 1H38A 3PMLA 3A1VA 1Q3VA 4UU0A 1RHUA 3NOOA 3OLWA 4TS3A 4DCTA 2L5YA 3CP8A 3NHFA 1B0PA 3N0VA 1SCBA 1GZSA 4BNGA 4G0MA 4XASA 3VKHA 4H0FA 3R6TA 2IZ6A 4DQSA 4F2WA 2ISOA 2Q7XA 4FMDB 4AY3A 2HBRA 3QTTA 3J7AC 2CHEA 5CG1A 3M7IA 1M7HA 4C7XA 2ESRA 3SQOA 1KJ8A 5A9TA 1ZQSA 4NQZA 3THXB 2A88A 3B9QA 3B1VA 1OA1A 1X87A 5J2UF 1NY6A 1OUQA 1DEOA 5JAOA 2WHEA 1ZETA 4KQKA 2XDYA 4NJOA 5G3YA 1UR5A 4ZOLB 1BRMA 3G6VA 4Q48A 5FPPA 4ZO8A 5FPTA 4E4YA 4P1ZA 3INRA 3RSFA 3RM3A 4NESA 1SQ0A 4D7AA 4FYYA 4X94A 4R8RA 4RGBA 1P44A 4AKHA 3PDCA 4R54A 4B2IA 3P19A 2R7NA 3N76A 2J5RA 3SQWA 1HETA 3PU6A 3H84A 1MPTA 2OV2A 2XD9A 2Z9DA 1RZUA 1UFRA 4QXAA 1KO1A 2P0YA 3V6HA 5DLEA 3UJHA 2JGDA 1KI4A 4ZAYA 1H4VB 2QZ9A 4TL9A 3IT1A 1TF7A 4Z2YA 1MH9A 2C5EA 4GAEA 2Q2QA 2BMVA 3BJZA 4Q7MB 1GM5A 4DA6A 2ILTA 2JA2A 1HFJA 4ZWNA 1PNVA 1A7UA 1MORA 2AHOB 1LPSA 4KLJA 3HRIA 4CCWA 4GLLA 4F5EA 3ZGYA 1JEOA 3U9LA 2QNRA 3EGCA 3ZGNA 2DB