2G07A

X-ray structure of mouse pyrimidine 5'-nucleotidase type 1, phospho-enzyme intermediate analog with beryllium fluoride
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
290
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITFDMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of pyrimidine 5'-nucleotidase type 1. Insight into mechanism of action and inhibition during lead poisoning.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Cytosolic 5'-nucleotidase III
total genus 98
structure length 290
sequence length 291
chains with identical sequence B
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2006-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2g07A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2g07A01
3EF0A 3BA6A 4Y2JA 1AQ6A 2IOHA 3OCUA 1RRCA 4L6AA 5AW0A 3VAYA 1XPJA 3ED5A 3L8HA 5ALKA 3QUBA 5AK4A 4CE6A 5AI4A 3A1EA 3FZQA 1RMTA 4J2TA 5ALVA 3W5AA 2YMPA 3NUQA 5ALXA 4DCCA 3KC2A 3B9BA 1EK1A 4BKMA 4UMFA 2HO4A 1T5SA 5ALWA 1ZD4A 3SF0A 4KNWA 4BX2A 2I33A 4HYTA 4C4RA 3WK5A 2G1AA 4YH1A 3ONNA 5ALEA 2P11A 3HLTA 1T5TA 4I9GA 4OHFA 1YMQA 1VJ5A 2IYEA 2FPSA 2YFYA 3SD7A 3ZX5A 1K1EA 2WFAA 4Y3UA 5ALHA 2G0AA 4YGYA 5E0OA 1RDFA 2ZBGA 3L7YA 1WVIA 4BYGA 5ALSA 4YIKA 1O03A 2G80A 5AKYA 3QU9A 3SKXA 2ODAA 3OCVA 2CN1A 3L1VA 4FYPA 2ZXEA 3NANA 5AKIA 1NRWA 5AM1A 1ZRNA 3L8EA 3ET4A 4E88A 4HGPA 3AR6A 5AVXA 4ZEVA 4Y2XA 3SMVA 1IWOA 3WKEA 2YY6A 1VFPA 3U19A 2YMMA 5AHXA 1TJ4A 3ESQA 3NASA 3AR4A 3OTQA 2YBDA 5AKZA 5AIBA 4BEWA 1ZOLA 2GHTA 5AM0A 3M9LA 2HDOA 2OYCA 2HX1A 4GXTA 5AKGA 4UASA 3WK9A 4Y2SA 1VJRA 4EENA 4OCZA 4EELA 3M1YA 5AVUA 1Z4MA 1SU4A 2G07A 5AKHA 3KDPA 2FPXA 2AH5A 3WK6A 5AW6A 3ZUPA 4XE5A 3L8FA 3AR3A 5ALOA 1FEZA 4F71A 5AI8A 5ALIA 4Y2YA 5ALDA 1U2SA 5AIAA 5AVRA 3AR8A 3OPXA 2GFHA 4MWOA 4JDPA 2HHLA 3NRJA 1Z4OA 3ZX4A 5ALYA 3AR7A 3N1UA 1RC8A 1NNLA 1QYIA 4NFLA 1Z4NA 1ZD2P 2O9JA 2I34A 2Q4TA 3UMCA 2RARA 4KN8A 5AVSA 4EEKA 4O8CA 5ALLA 2I6XA 2YMQA 1QQ7A 1NF2A 4J03A 3WK8A 5AW3A 5AVVA 4AP9A 2WF7A 1J8DA 1JUDA 3WKBA 5AW4A 4CF3A 3L1UA 5AM4A 5AK5A 4G63A 2GHQA 1TJ3A 3DAOA 2PQ0A 2W11A 1Z5UA 1X42A 2B1RA 2BDEA 2I54A 4UARA 4DWOA 2HSZA 2YMLA 4L6CA 3QU5A 3ZWDA 2HOQA 3FPSA 1YNSA 3DDHA 3SKYA 3W5DA 1Q92A 5AI9A 1EK2A 3KZXA 3PGVA 2IA5A 4HAIA 3E8MA 2ZOSA 1T9ZA 1RMQA 2BY4A 3E81A 4HGNA 4PNHA 3DV9A 3OCZA 4BBJA 2HEGA 5AK6A 4UU0A 4L57A 4YCLA 2R8YA 5A3RA 2HCFA 5T41A 3WKDA 4AS2A 5AM2A 2CFSA 3AR2A 3IJ5A 5IT4A 2B8EA 2W4MA 3HYCA 4BNDB 1WPGA 1Z4LA 2RBKA 1Z88A 3MN1A 5AM5A 4EX6A 2QLTA 5ALZA 5AW2A 2WF5A 3QU4A 5AVZA 3AR9A 1LVHA 2W43A 3J7TA 4YCNA 2FI1A 2P9JA 3B9RA 2EATA 3BWVA 2WF6A 1SWVA 2CFRA 4UMEA 5IT0A 3A1CA 1U2TA 3KBBA 1Q91A 2GO7A 2HF2A 4DW8A 4C4TA 4KNVA 1YDFA 3KD3A 3OCWA 2JAWA 2EARA 4RETA 3OCXA 4QQFA 5AW8A 3ZWKA 3FVVA 1CQZA 1RLMA 2YN4A 3QLEA 1QQ5A 3R9KA 5AI0A 4YCMA 5AW1A 4UAVA 3I28A 4C4SA 2RAVA 2IOFK 2BDUA 2Q4RA 2I55A 4Y2RA 1LTQA 3I6BA 3IRUA 3ESRA 3I1YA 1L7OA 1L7MA 5ALQA 5ALGA 5AI6A 1ZRMA 3UMBA 3E84A 1O08A 2JARA 3WK4A 3K1ZA 5ALRA 2O2XA 2X4DA 3QYPA 3KOOA 3EPRA 1XP5A 1ZJJA 3L0CA 1Z4KA 2AMYA 3A1DA 2B82A 4H1WA 3CNHA 3WK7A 3WGUA 1TA0A 4ZEWA 2GMWA 2C4NA 2JAUA 3AR5A 5AW5A 3P96A 1L6RA 4XOUA 2CFTA 1RQNA 5ALTA 4CNQA 5AKXA 4EX7A 5A3QA 4NV0A 4FE3A 1RQLA 5AKEA 1WZCA 2PKEA 4MUMA 2NO4A 1L7NA 5ALNA 3QUQA 3U7FB 1ZD3A 1Z4JA 1L8LA 2P27A 4FFDA 2P69A 3MC1A 4Y2VA 1Z4QA 3ZI4A 4F72A 2FPRA 2B0CA 4UMDA 5AW9A 5JJBA 4KX3A 1ZD5A 1WR8A 1YS9A 2YJ4A 4IFTA 1PW5A 2G08A 4UMVA 3WGVA 2ZBFA 3A3YA 4JB3A 2B30A 4QJBA 2WHEA 2C9MA 3RF6A 5AKKA 5AVYA 3NIWA 4NABA 4BX0A 2WF8A 3QUCA 4NAVA 3ZVMA 5AICA 4XPZA 3UM9A 2JAOA 4UU1A 3ZTYA 2EAUA 3RFUA 3QU2A 1YV9A 2G09A 1KYTA 1QH9A 4XQ0A 1U7OA 1RKUA 3EWIA 3U7GA 2JGAA 3NAMA 3L8GA 3ZU6A 2VKQA 5ALMA 1RLOA 3ZVLA 3QX7A 2IOFA 2QYHA 3FM9A 5AVWA 4NWIA 2MU1A 4B6JA 4Y2QA 1TJ5A 1Z5GA 3N5KA 2C88A 3W5BA 4BNDA 5AI5A 4ZEXA 4Y2UA 4UAUA 2R8XA 2AGVA 3IB6A 3FGOA 3DNPA 1RMYA 3QXGA 5A3SA 5AESA 2ZG6A 5AVQA 5AKJA 3B8EA 2D2VA 2R8EA 2Q5EA 2FDRA 1U02A 2C8KA 3CZ4A 2ZBDA 2MSNA 4HGOA 4UATA 3SLRA 3WKAA 3ZW7A 3N07A 3U7EB 2FUEA 3GYGA 5ALJA 3U13A 5AM3A 2HF7A 3UMGA 3PCTA 4RESA 3PGLA 2HI0A 2YJ5A 3L0BA 1CR6A 1RKQA 4AS3A 1TE2A 3N28A 3ZVNA 3SHQA 4UM7A 1N8NA 4Y2PA 2B8JA 3L0YA 2C8LA 4OFZA 2FEAA 4GIBA 2OA0A 3S6JA 3R09A 5ALUA 4HGQA 1YJ5A 4DFDA 2WM8A 1RLTA 2NYVA 5AVTA 3TLMA 1XVIA 3OCYA 3U26A 4BEVA 1QQ6A 2ZBEA 1SWWA 4CF4A 5AW7A 4Y2TA 2I7DA 1ZS9A 4CF5A 4YIHA 2FPUA 5ALPA 4HGRA 3QNMA 1L8OA 2OBBA 4G9BA 2FPWA 3E58A 2PR7A 3I76A 3D6JA 3F9RA 2R8ZA 3ZTWA 3FPBA 2RB5A 3ET5A 4KYTA 2YJ3A 2NO5A 3NALA 1N9KA 1Z4PX 2AUTA 4OD0A 4EZEA 3W5CA 4UW9A 3R4CA 2FUCA 4I9FA 2G06A 1F5SA 4IG4A 3N8GA 5AK3A 1MH9A 1U7PA 2WF9A 1Y8AA 3PDWA 1S8OA 1S2OA 2DQSA 5AKLA 3MPOA 5ALFA 2B1QA 3QU7A 3U7HB 3WKCA 4KX5A 1L7PA 1RPZA 4BX3A 2YJ6A 5IS2A 2OM6A 1RKVA 1Z4IA 3EF1A 1J97A 3MMZA 3QUTA 3L5KA 3QGMA 5FP0A 4UM5A
chains in the Genus database with same CATH superfamily
5IYZA 2GZMA 2D2FA 3MTAA 3E2PA 4FX2A 2KJ8A 2WSSD 4FFBB 4RA6B 1IC6A 4WVFA 1VPVA 4DV6B 4WLFA 4BRSA 1YUNA 7ICOA 3FD8A 4X1IA 1LV7A 2SBTA 1OW3B 1OVMA 1HG1A 1OZGA 1UBFA 2XVMA 3DNMA 3JWHA 3KAQA 5AXCA 1RRCA 1D8LA 3LVVA 4DFJA 2H1LA 2FZLA 3QUBA 3L6CA 1D5CA 1E58A 3K9QO 5EIXA 4ND8B 2K7ZA 3OPYB 4DQLA 5G5HA 1Y7PA 1T9AA 1JQ3A 2UYOA 1V2HE 2IS2A 5ALXA 1YZYA 3VV2A 1Z38A 2E3TA 3REQA 2YZNA 4MO2A 3SIPA 3DH0A 2GRJA 3JWGA 4F8EA 5BSHA 1PQPA 3RJJA 4BKMA 2PS3A 5D00A 3SF0A 1N5MA 3SEQA 1I10A 4HMPA 2N1BA 2GX6A 2PEYA 2NRTA 1QS0B 4BP8A 2FZWA 1NXOA 3GZFA 2DT8A 2VSOA 4YH1A 1WXHA 2WQZA 4F11A 2HMSA 2RHHA 1OYYA 4UB4A 3M9WA 4OV6B 3REQB 4V0QA 3E9CA 2ODTX 1KVUA 4UUOA 2VHEA 4EJ0A 3PC6A 3NAQA 1RHMA 3LWNA 2XY6A 1YMQA 1LXCA 4KLZA 4QUGA 2KSOA 3B9JA 2XUAA 4PF1A 4OXKA 4DBLE 1E6MA 4FYXA 1Q2XA 4BDTA 3SD7A 1OZFA 3RSFA 4NJ8A 2E55A 3LY8A 3LYHA 2JHDA 4AD8A 1NHWA 4A8JC 2VH1A 3WLRA 2WI8A 4RQ6A 1ECLA 3U4CA 3L7YA 5A7FA 2VQFB 1EYZA 2VTDA 1FUUA 1N5IA 2BE9A 4PC2A 4W7IA 3TUJC 4YHHB 3TE6A 3U5TA 4ED3A 4OIMA 4L5AA 3LKZA 2A9JA 1OF1A 3U1VA 4BZWA 4R1OA 3OJUA 5A9SA 3ISDA 3CX8A 4P22A 3F78A 2HF8A 2ZWMA 3O95A 4CRXA 3ACBA 3PNOA 3U1TA 2Z8YA 5JMTA 1ENOA 3DMHA 4AXBA 4R83A 1SCKA 4HQRA 3ETJA 2E4AA 1XEXA 3A1TA 3RT1A 1K9VF 4FYPA 4PFSA 3RYIA 5HR5A 3HXQA 1TTHA 3DJYA 4I5GA 3LXRA 2VJNA 1VE3A 1P33A 1QF9A 3ET4A 2Q6TA 5GV7A 4V1CB 2WW8A 1XCMA 2QTRA 2P62A 2G5CA 2P9TA 5AOVA 2VYFA 3C6ZA 3IA7A 2ZBVA 3TZBA 3T1VA 4AX8A 2XY7A 4KXYA 5KOHA 4HKTA 2H3EA 4URWR 3QXXA 4CMBA 1XR3A 3QLVA 2AB0A 3D54D 3X1KA 5JSZA 3MB8A 3DLIA 3R23A 4QOSA 1GUFA 3TLKA 3SSOA 3S1LA 2PX2A 5A62A 5CVVA 3T3MB 4KAAA 4HLUA 4IHQA 3KZCA 4NBUA 5JDIC 4DARA 2XY5A 1QSGA 4P86A 2FMFA 3H84A 3NM4A 3QNWA 2FX3A 4D9FA 4PV7A 5FO1A 4UHEA 4EITA 5KTPA 2X7XA 4ZQFA 2ZTUA 4X64B 3EPLA 4ERNA 3BIFA 3SEIA 3HBJA 4ZTBA 5KFAA 5AKGA 1KI8A 3FFBA 5KMGB 3RAPR 2COUA 1I2BA 1WXQA 2G71A 3GLTA 5J8YC 5DP2A 5G4KB 4EARA 3GPCA 2QVCA 3M81A 5ER6A 2PD4A 3EA5A 3BQ7A 3K9WA 4G9GA 3M1YA 2MUTA 2AX3A 1Y8CA 3B7GA 4I8DA 1VJ1A 1Z35A 4TV8B 5JCJD 2FVXA 1ULTA 1UBCA 2DMRA 2AH5A 3IV7A 4Q7MB 1FSPA 5K4LA 3RAXA 2CK3D 1EGHA 3C23A 1YCDA 2ZYWX 5IC6A 2VH2A 1XK7A 1X39A 4MB2A 2I0FA 3A4NA 4E46A 5BV1A 4F84A 2MSEB 1RYYA 4Y2YA 2JGFA 1XU9A 3E23A 4MIOA 1KSFX 1N75A 3HWWA 3OIGA 4P7KA 5COBA 1SKSA 3ZTTA 2WVAA 4RF3A 1J5PA 3KKMA 3OEEA 2HMWA 2HHAA 4TWIA 1WHTA 4BGUA 3HP4A 4ZHQF 1NNEA 2VZ0A 1VCIA 3AFOA 1Q44A 4WBNF 2P5SA 3JS5A 1QSYA 4NFLA 4LHVA 1QHGA 2O9JA 1T9GR 1UZLA 4MRMB 3F49S 1KJ8A 5DIFA 2HNBA 2QN1A 3I1IA 4OQFA 4RAQA 5AQ1A 2ZZNA 3CEPB 4OMCA 1U9YA 1W29A 4HRYA 4W4TA 1E5QA 1DOHA 1F12A 1XTVA 4NENA 5JBNA 1UOEA 4H17A 3KPUA 1BKYA 2J0QA 4KMUA 2WRZA 2WF7A 1MEOA 2V45A 3AL2A 1JJAA 3FIJA 3GJZA 4MJ7A 4ED6A 1N2ZA 1YS2X 4L85A 3VHQA 5IDWA 3ZWWA 4PX9A 4QFBA 2YV4A 3JPNA 3HFJA 1XFDA 2DOKA 3ESYA 1RYSA 2Q1TA 3MABA 3QVGB 4G63A 4L0CA 4YP5A 3RTEA 1TJ3A 2CHEA 3JPRA 1M8FA 3GWZA 4G1VA 5KAIU 1KZ7B 2EHDA 2GSWA 1JDSA 2I54A 2UVQA 2C0PA 5AFSA 5K4HA 3LH5A 3N0VA 2VYQA 3UQ2A 1M5TA 2NO9A 6NULA 2UVVA 5E6RB 4L27A 4BB5A 2ATIA 1EP1B 4DL9A 2W6JD 3HCCA 3U4AA 2GKGA 1NJFA 5DH9A 1P75A 3W2FA 1JAZA 4J6EA 5BSVA 2HRDA 3GDFA 4Z49A 2Q1UA 2QY9A 3IP6A 3UGTA 2CV0A 2JGDB 3EAQA 2AHOB 2VDVE 3QA3E 3EGVA 1K3TA 2IP2A 5F5NA 4CDRA 3BKXA 1I6KA 3G9TA 2UVWA 1WQ1R 4B7CA 4EPRA 1NJXA 4AP6A 3ZJVA 5TF4A 4BQRA 4I1PA 2UVUA 2H8GA 3WZ2A 4L9WA 2JH3A 2B92A 3AGQA 4GLOA 4RVHA 1W85A 3HCNA 1X6JA 5CIWA 3OCZA 2HEGA 3CGWA 4JLUA 3UIEA 3H0KA 4QDTA 1U0NA 1E20A 2I62A 4KE8A 2I6TA 4UB6U 2VBGA 3JU3A 4E4RA 5C8YF 2L69A 4M7PA 2JLQA 3K4GA 2FN8A 2XMSA 5AM2A 4OTZA 2Y1IA 1U8ZA 4KXUA 4PLGA 2EAOA 1SKAA 4PYLA 4ND2A 2GLEA 4UEQA 2PXIA 1KA9H 5FDFA 5JQGF 4GP7A 1E2IA 1F3OA 1USIA 3JQ7A 4R0NA 5KCMA 4L4SA 5AW2A 1JR6A 5KDOA 3TXAA 3MERA 1PK7A 2A1TS 3MB5A 4GE3A 1VE7A 3QVTA 5FI5A 5BT9A 1GUDA 3STXA 2PFSA 1GGJA 1GRQA 2B4AA 2B99A 2YX1A 3FPKA 5FHQA 1XCJA 1VG1A 2H8KA 5F3WB 1GXSA 3K0HA 4EGSA 1NOJA 4FFSA 1SD5A 4ND5A 5KTYA 5HFNA 3HM2A 1SD1A 1C1XA 1J0XO 2J59A 2IIVA 1G1MA 3PSFA 2CLEB 1PFUA 2D1TA 1E96A 3MPUA 1CJKC 2W6CX 4FHDA 4JMLA 4Z6EA 2IXTA 2CBGA 4OUDB 4X6LA 3O03A 2COKA 2P30A 3T3FA 1XA4A 3EQ8A 2XKJE 5AW8A 5DWQA 3PV8A 4NYJR 2WJIA 2GDJA 4XDZA 3SOPA 4B3CA 4OXNA 1FTSA 2ZBQA 3KAKA 4GOLD 4M1KA 3E9QA 2R6DA 2ZJ3A 2QAGB 3IAM6 4O0MA 4Y6QA 3ZEAA 4NLKA 4C4SA 4QG3A 2A57A 1Y4UA 5J0UA 1KHTA 2HFKA 2VPPA 3E27A 3KQMA 3DDNA 4M46A 1I32A 4HP8A 1MZPA 2JZBB 1QSSA 4NCAA 2VNAA 2XB8A 4QGFA 1A27A 2QZ4A 3UHFA 4J9LA 3G6KA 1IV8A 3GIDA 2ZJAA 1ISSA 4I5IA 3L3FX 1KYQA 4V0SA 4Z9BA 4D41A 4BKPA 3V7LA 3EOBI 1F7UA 1A7KA 3K30A 2UDPA 3B6MA 3NV9A 5KNCH 4IY1A 4J8PA 3CVYA 4Q21A 1IAQA 3G9UA 1YFLA 1S3IA 4FW9A 4BU0A 4DF3A 4EUNA 1Q22A 3LYUA 4ELVA 1L7VC 3QYPA 1PDOA 2ERXA 2X4DA 4YLGA 4F4CA 4Q82A 2XDQA 4BQPA 3WR5A 2IYOA 3L4BC 2RHTA 4GX5A 2YXPX 2H51A 4UXHA 4ZCPA 2RHMA 3SQMA 4MKRA 2V6JA 3F6SA 4BMXA 2Z83A 1ZR2A 1Q57A 3OX4A 2GAAA 2ES4A 2DPJA 2I22A 3OCJA 2BGLA 2H4YA 5EHIA 2B82A 1F9EA 1N5OX 2O48X 3DPUA 3L7AA 5A71A 5BUQA 2AKEA 2PX0A 1J42A 3JARA 1GZ3A 3RR8A 1MT3A 2HQ1A 2FP3A 2GMWA 2OXOA 3MBKA 4N3GA 1K0UA 5J2CA 2FEOA 3AX6A 4RLQA 5F51A 4DC1A 4TZ0A 4B7UA 1H4SA 4TUPA 4X7BA 5C3UA 3BEDA 1QDUA 4YAFA 3X1JA 2BHNA 1HFEL 3O0FA 1DKLA 1ZNYA 2VP6A 3H5LA 4C07A 3NTLA 2MA1A 1TO1E 1XTZA 3KUUA 5EJAA 3Q87B 3HTXA 4BGVA 4QWCA 2GPBA 4UQGA 4ZCMA 4JI6B 3U7FB 2W83A 5JVDB 2DKXA 1JKJB 1Z08A 2Z98A 3I05A 3RRXA 4NCBA 1SVOA 1CDEA 1AH2A 2NO6A 2OV8A 3BWXA 3KYCB 4UDOA 1DXQA 2GCOB 1Z4QA 2F1OA 1P7YA 2HIHA 3ANMA 4JJKA 4N65A 3SBXA 4MRSA 4NNPA 4PG8A 5L4LA 1RJDA 1NQ5A 1E6LA 1JFRA 1UOOA 2WSSA 4PSDA 4ED7A 1VE9A 2VRCA 1YS9A 4OMDA 2CXYA 3RK0A 3OE7A 3LV8A 4GFDA 4TYPA 1E2PA 4XD2A 1OXTA 5TGTA 1Z75A 1TF7A 4RQNA 4MITA 4ZVLA 2OXTA 3WRYA 2JLSA 3OWXA 2V7UA 3NIWA 4MIEA 3BEOA 4K4IA 3QVKA 3THYA 4LYJA 2Q3LA 1QZZA 1MN6A 1M0TA 4RIGA 3ZHVA 3FDFA 3IP8A 4IEFB 3K09C 2GPNA 2ZSHA 2EAUA 1ZMXA 3K31A 5CB4A 3QEMB 5KG6A 1VMEA 2JJ8A 3WQQA 5JTTA 4INAA 1YV9A 5HBRA 3SQOA 4BKRA 2I9KA 4BVKA 1RPLA 1UEXC 1COWA 2BCUA 3LW7A 4XQ0A 4F1KA 2WIJA 2UVPB 3H19A 5K3CA 1CF2O 3TG2A 4L5CA 1JR4A 3VKGA 3ZVLA 2J9FB 2PI4A 1U45A 3LX8A 3ZQJA 4D4GA 1LWNA 3NOQA 3RBZA 3BXZA 3D81A 5HWSA 3AVXA 4M0AA 3RS7A 1N3LA 1NW4A 1QYWA 3F71A 1XYVA 3V6MA 4XIFA 4R31A 5KNCA 1Z5GA 3BJIC 1PKXA 3L7KA 3N2ZB 3KSZO 1PQ4A 1QNFA 4PU0A 4FMPA 4YONB 3U56A 2XDWA 3EZFA 4CQLA 4RQ0A 1VKZA 3IGFA 3OU6A 5KYUA 3L9WA 4LX8A 2BUCA 1XJQA 4R2WA 1QWOA 4RQ8A 1UAAA 3RVBA 2AGVA 3IB6A 5DTIA 2NAPA 3BJMA 3J81k 1CDOA 2WHQA 4KJXA 2YJGA 4BX9C 2XECA 2W6NA 1H6BA 3BN3A 1GG9A 3WA7A 2GWHA 4BWVA 3W90A 3B8EA 4BMYA 5TPZA 2O50A 2V8BA 3V8VA 4V0ME 4C0JA 1W0JD 1MQAA 1XKQA 2AOWA 3IP7A 4RZHA 5CCEA 1NSYA 1E3EA 5TIIA 4OB8A 2VL7A 5F2OA 3ZDZB 4AJ4A 1LS6A 1C80A 2HRCA 2QX9A 3I1JA 2WKQA 1ZMOA 2CVPA 1KC1A 4S1NA 1NJ1A 5J40A 4RH3A 3GP8A 5G2OA 1ZXLA 4RXMA 1SC6A 2XNHA 4XUEA 2E1RA 1OJ7A 5EVCA 1HEKA 5SV2A 5JFTA 2XYQA 1E3WB 3AUTA 1UK9A 2PYIA 3EMDA 1GL9B 4U1RA 1K97A 1QE5A 3L92A 4JA0A 3OHAA 1JQJC 3MLEA 1GGMA 3QXSA 4RT2A 3NW9A 2I3AA 4MZXA 2X19A 3FUVA 4RKWA 2J3MA 5L7TA 4FWBA 1Z07A 4TWRA 3Q12A 3VJLA 3HRDD 2WAYA 5IRCD 3LUKA 4HDSA 4GNKA 3ADBA 4D4LA 4M9LA 3E7DA 4C6HA 3WNZA 2H4HA 2AZMA 1TCUA 2K8BB 1WDLA 1AA9A 1RLTA 2NYVA 3AFGA 4G4SO 4RW0A 4R0MA 1FA9A 4KR9A 4BQOA 5I7RA 3R7LA 1VMAA 4B17A 5KO2A 5BUCA 4GOMD 2EW2A 1U49A 4PX5A 4UPVA 4BCBA 4DIEA 4D1YA 5I7OA 3ILHA 3NM6B 4JSYA 1GQOA 5EKDA 3DQQA 1JA0A 4RNCA 2A19A 1C0KA 4IRMA 3GJ5A 2E7ZA 4LXGA 1NDUA 1XROA 4M8SA 5LXTF 1BOOA 4JC0A 3RVJA 3NYQA 1NI3A 4ZEMA 5LSAA 3FIUA 1GQYA 4CMEC 1CF9A 1AN0A 5HHIA 2A5GA 3HJFA 1QP8A 2D1SA 4N54A 2AW3A 5ES4B 2HRZA 4G5RA 3MGBA 2XOKD 2JLUA 3H9CA 3KZOA 1B8NA 1P4HA 3ROXA 3W9BA 3FKSD 2VZLA 5CDHA 4Q02A 1E79A 1E5XA 4ANFA 4DWWA 3PT5A 5I9NA 1EIWA 3VISA 3C28A 3W5JA 4KJZA 5J2EA 1UPUA 2EW8A 5E9JA 1YKSA 2G04A 2E9SA 1WSDA 4D3YA 2C22A 3IYLW 2MSKA 4HWRA 4JLMA 3A32A 4G0OA 4WZAE 5CJ2A 5GINE 3ANNA 2ZK7A 4Z53A 1GFSA 2XHZA 4TN5A 4YAGA 1K3FA 1PP4A 4W99A 3RK4A 3TVTA 2JEYA 2HK7A 1C7EA 2XZTA 2AI3A 3CW8X 3SSAA 3UCEA 4O08A 1P0IA 3CSUA 3FTDA 4KLRA 3VR5D 1V0JA 4A15A 2QN6A 3D3JA 1JHPA 2JANA 3M8KA 3VOSA 4GPBA 4LF4B 3DVQX 5JZMA 5B2FA 2JKZA 2ECQA 2RJNA 3H13A 5LKAA 3WIVA 2J9GA 2RGUA 2B6GA 4GX2A 1G4HA 3DCJA 4Q12A 1E3MA 3L5KA 1QKJA 3KOUA 4JLNA 3HKDB 3PR1A 3H04A 3SBOA 6LDHA 3KKAA 3D7KA 4LDAA 4OQZA 4KWTA 3K6RA 3IKTA 3AP3A 4WNAA 1AQ6A 1G7TA 2H85A 4KVAA 3RT9A 8OHMA 1AKNA 2IX9A 2Y0PA 3CCFA 3Q8WA 3UT5A 2OHXA 4FEEA 4CL8A 3ED5A 5FAKA 2AL7A 4I36A 3JAMA 1YH3A 4HEA6 4KLFA 4G8JA 4V3CA 6Q21A 4MAMA 3WHLA 2DHRA 2E4YA 4QDOA 2C7PA 3AV0B 1OREA 2JBWA 2ZUBA 3FW1A 1QGUB 3PTZA 3RFXA 1A2KC 4PPXA 3GJ0A 1U7WA 2FV8A 1AHNA 2MMCA 2O6KA 1DKOA 3PNLA 2YV3A 3QFCA 4JHXA 4P32A 4DYDA 1I4LD 2HGZA 5M7EA 3TZHA 1NHGA 4YLYA 2E5LB 3MFQA 3M9OB 4UMFA 4ZOAA 5U4XA 5ALWA 4LY0A 2HUNA 4RHEA 3R7WB 1XMXA 1SHKA 3U4GA 5C52B 5HJ7A 1ATIA 2OFPA 1S76D 2ZQYA 3WLTA 2AOVA 4IXTA 3LK9A 1J33A 2F4NA 1WCIB 2DWQA 4QZEA 1I7SB 1TM2A 3P9IA 5JTIA 2AGOA 2K87A 3TSAA 4YUAA 4Q1AA 1JF8A 1FUIA 4LRXA 4DR1B 4Z4IA 1JDUA 2ZXHA 3C8HA 3CH4B 3FUUA 2FSHA 5ICCA 1SKQA 1GDTA 2V6IA 2G4LA 2VDQB 3TFOA 3GGCA 2AKAB 2V6BA 1FRZA 1MQ3A 3ITDA 3Q9LA 4L22A 2C20A 3I2HA 3IEUA 4KI7A 1RYZA 3ZJYA 3G2JA 6PFKA 2FFQA 4LVCA 1HO3A 5I9LA 2X4LA 1X7YB 1PT6A 1XPUA 1CQXA 2AN4A 3LTNC 3T4UA 1G98A 1NN1A 3DEZA 5JI2E 2NLOA 1XC7A 4XWAA 1QG6A 8ICAA 1H2BA 4QWDA 2FR0A 1QKIA 2OMEA 3BQTA 4JJ6A 5JRJA 3FLBA 4NCIA 1Q11A 2ZLBA 5CGQB 3IERA 4EKEA 4LBVA 4E13A 4FUTA 3GIMA 1XKXA 2B9EA 3AEZA 1KJQA 4Q93A 4A10A 821PA 2UXCB 3KQWA 4H60A 3LKDA 2PFOA 5EE5B 4AJHA 3W5BA 1E9VA 1NRWA 3GJ7A 5COAA 4LDZA 1JG3A 1KQPA 1N6RA 2RGGA 4I1IA 1RQGA 5JS1A 2DFLA 2M1ZA 3IQIX 4MINA 4UCXA 5DTMA 1US8A 3M2TA 4J9OA 4TS3A 2QXUA 2PKWA 2XGPA 1NW6A 3SMVA 2GJ4A 3ZU3A 1ZUIA 1TIBA 1NJ5A 3HZHA 3JYNA 4IKPA 5AXAA 2ODEA 4N6GA 4RKEA 2HPZA 3IUEA 2F8MA 2BCVA 1JQEA 1UL1X 3OOWA 1ZICA 4TSFD 5AH0A 3ZVKA 3HGMA 3QE2A 5EGSA 3MOIA 1E1MA 4Q1CA 3KSBC 3AR4A 1BJKA 3EAFA 4EJFA 2PUGA 2NV6A 1UKEA 2NXJA 1Z7YA 4IGIA 4ZVSA 5HOQA 4P9NA 2OORC 5G0TA 3UMMA 1J8YF 3K1RB 2OYCA 4MGIR 1E9BA 4YQYA 1WIWA 4KLHA 1F14A 2DC1A 3CA8A 3PUKA 5CB1A 2QE6A 3H75A 2W48A 2O1SA 4BKQA 3OE7D 4ZVTA 4C5BA 4YR9A 2PFPA 1N0UA 1REQA 3EIWA 3ZH2A 1YS7A 4QL3A 1Z4MA 1CR1A 5FV7A 5E6SA 2JHPA 1RD4A 3AKYA 4JT2A 3WK6A 1HSOA 1QLNA 3OFVA 4WBXC 5AJVB 3PC8C 4ECQA 3ZXYA 1X7ZB 4M9GA 2R2GA 3FLEA 3RKSA 1PDVA 1ADYA 3KQQA 4FLFA 1TU4A 3H3XA 1NX9A 4I28A 4RA9B 1G8MA 4YASA 5BURA 1U65A 2R8OA 3TYXA 2H3VA 1AF4A 4ZKEA 3EJWA 4A0RA 5ITVA 3I62A 1IUOA 1BH6A 1GUZA 2IUSA 2PG3A 2P9GA 3B7PA 2H29A 3NRCA 2OZEA 4NXZA 4MVJM 1MW9X 3RSCA 3TJRA 4LK2A 2E4VA 3A1WA 3LWLA 3A26A 1F1BA 3VZRA 1ICEA 3RHTA 4QOHA 4C7JA 4Z6KA 3CVVA 5MHTA 4ZHSA 4BGDA 5AVSA 5LQUA 3AEXA 3P5SA 2GZAA 4NZZA 4U7DA 3MQ4A 1BXKA 4MJLA 4CDNA 4FYYA 3WK8A 4R63A 5JEDA 2K7FA 2ZIEA 4OQXA 1Y1LA 2F9FA 5EKSA 4M60A 4P0QA 5J5VA 5IXSA 1FFHA 3FR8A 1KFJB 4M0LA 4TMFA 2ZYRA 4HWTA 2C2OA 4ER7A 5AM4A 4PAOA 1QO7A 2FEKA 2Z2XA 3PSHA 3GLKA 5KG1A 1CUEA 4M36A 5EMKA 4ZVRA 5L3QB 3LQFA 5JS7A 3PNBA 2JLYA 3VRHA 4YJFA 2P2YA 2FWMX 1RAFA 1KI6B 2WKRA 4IIGA 2I9PA 3PJEA 2WG1A 4PCLA 5TEVA 4MB6A 4AF8A 7AT1A 2PMZC 4LVUA 2FYTA 4NECA 2QBYB 2HSZA 4JFRA 1RI2A 4NJOA 1W7AA 1TPYA 2MOKA 5L1JA 1M33A 2HVIA 1E2EA 1WETA 3DVLA 4BFVA 1VJGA 1XPRA 2PRJA 1MC1A 2R5FA 4S3MA 3VR4D 4AI6A 1ZN9A 1Z73A 4I3FA 3Q7TA 3B1FA 3IHKA 3CZRA 4HDCA 4HPXB 3WNDA 1QFXA 2KFNA 1UJ5A 1B26A 1J1ZA 2GN4A 4JNKA 3U3MA 3EFOB 4B4OA 2Y2VA 3CH5A 1P4AA 4QYMA 1LZKA 5H9WA 3FHTA 2Z09A 3F46A 5KQPA 3DL0A 2VLIA 3LHKA 4FB4A 1YS4A 2ILTA 1T5LA 1ZQJA 3AUOA 1EJBA 1ZH6A 2Q1YA 3FNQA 2BP7A 4YRQA 2ODQA 3ZIAD 2V55B 2YYZA 4DRXB 5JOQA 2J5BA 5K05A 1BHQ1 1N9ZA 1RJ9A 1YE8A 3BIXA 3JQQA 4OHOA 2XTZA 4O3FA 4PPFA 5CYFA 3M1AA 5DCWA 2CF6A 3DW3X 2ZDGA 3IPXA 4FIZA 4TXHA 4FWIB 3PMNA 5C1PA 4QDJA 2OVFA 4PAQA 5CVEA 5T41A 1DC8A 1EP9A 2CL6X 4YFKA 4J7CA 1YR3A 2ZWVA 3FWPA 1I4EB 1NPTO 3HBFA 3W2IA 3N2KB 3TOZA 5J4KA 3COSA 4H6VA 1OTXA 4EYSA 3G17A 1FNDA 2VYNA 2Y2UA 3HKDA 2HZ7A 4KKVA 1W76A 4Q00A 2YXLA 5FUWA 4BATA 1JGTA 2Y1GA 2YR0A 3TEFA 5E6UB 2BGKA 3QU4A 5AVZA 3GIJA 1NQOA 2DZDA 3J7TA 2WU4A 4LZAA 1GA6A 2ZFUA 4ES6A 1ECGA 1S4QA 2WLSA 1XZJA 4PQEA 1H1TA 2DBYA 1Q7TA 1ZRHA 3GEEA 4F56A 3V7UA 4N9QA 1L8XA 2ATCA 2XEDA 4R4JA 4RX1A 4UOZA 1UF9A 4XFKA 4IM7A 1TIKA 3PFCA 2WIAA 3H5OA 3Q7QA 4WZ6A 4AWXA 3IR6A 3VV3A 3KD3A 2DY0A 1V11B 2JAWA 5CHEA 3TB6A 4PXAA 1UEJA 2EBUA 1R0RE 1V9PA 1OD6A 2GPTA 3QOFA 5KHAA 2OH2A 4AM8A 4MP3A 4BFUA 1JVNA 4NYJQ 4BC1A 2A4MA 4UVEA 5DLYA 1A8IA 2HREA 1YD7A 2AQKA 2GF9A 3ZNNA 2IOFK 1MTOA 1U0LA 1TAGA 2A14A 3H3JA 4G1EB 4X3OA 4DBZA 3OQPA 4M0MA 5REQB 1V85A 3UXHA 1MVNA 2YIDA 1ZRSA 1DEHA 3V7FA 1II8A 3PVSA 4JV5B 2L0XA 2OB1A 3C0KA 5AYVA 3QEJA 4ZALA 2RHCA 4R3WA 4B09A 4N41A 1STOA 4ADSG 2VHXA 3VNUA 4O63O 3DZHA 1XVUA 3JQGB 1OGYA 2M6SA 4X44A 1BHSA 1ZI8A 1IG0A 3Q4GA 4KOAA 2ZTDA 4UEOA 1O6FA 1I36A 3O90A 2JARA 2P78A 1LEHA 3ML1A 1JDBC 1LK7A 1B15A 1JEEA 5FLYA 4FZLA 2J6TA 1R0YA 1XZQA 1VCNA 2RGNA 1ZOSA 1J49A 2ZCJA 4LFAB 1RXVA 5DXAA 5ICFA 1UBOS 4KIUA 3ZR4B 1B6RA 1CIPA 4DJ5X 5I7SA 3A1DA 3JQ9A 3KEGA 4U39A 3TTXA 5KHOC 4ITUA 2IVFA 3N0RA 4U2EA 1QGED 1XG5A 3Q6MA 1NE7A 2BMFA 4CN8A 5DXFA 3GEHA 1FYXA 2F3RA 5EE1A 1FRFS 2VPIA 4GEGA 4LJLA 1CVIA 2AJ8A 2J9ZB 2WIFA 4L15A 4LXHA 3HN2A 1J0CA 4FD3A 2HH9A 4JENA 5J0XA 4UVGA 2PLFA 3AQ4A 5EZYF 1ZU5A 2VPYA 5A3QA 4W9NC 5BNZA 1XZ8A 2C00A 5K0JA 1DARA 5AKEA 2VHVA 4RNMA 2IHMA 4I2DA 2H5IA 1QS0A 2D13A 3E3LA 3G0HA 5HF8A 2VDNB 1KOGA 1P4GA 2O8FB 3QUQA 3NHZA 4BNJA 2G9NA 3AHHA 1G18A 2R5WA 3QA9A 4ZYLA 4N0EA 4Q8EA 5E1MA 1YDEA 5IJ0A 4GSKA 4EOGA 1M1YE 2DAPA 1UZUA 4R8UB 3B1WA 4R41A 4UEJA 5DLFA 1NBHA 1PTJA 4G25A 1YQQA 4HZUA 5T5QA 2KK0A 3I2GA 3GLFA 5IPFA 1VM6A 1T8SA 1NBIA 1ADCA 5F33A 5CFNA 4KX3A 1GYQA 1S0VA 1Q3TA 3AWDA 3S2ZA 1LSUA 2TRSB 5TQ0A 4ARCA 5F7ZA 1PSDA 1HXHA 2WHEA 3EPIA 4PGHA 1SKMA 3HCOA 4HDRB 2VT3A 1DUVG 4G4JA 4JLJA 1T8EA 2DP4E 1XQ9A 1W0KA 1QHFA 4R2HA 4Y6RA 1CY7A 2H48A 4QDXA 4PO1A 4YI5A 3I4CA 5JAUA 1V16A 3CX7A 1ABEA 2HLDD 1DOQA 5AICA 1G21B 1NI4A 2XHEA 3EMBA 4MR7B 5E1BA 3UXMA 3SLGA 2PL9A 4FMBB 4B3JA 3CZ9A 1I4TD 5CW1A 1BDBA 1G4AE 3RFUA 1FJXA 1P4SA 2ZM6B 2VJPA 1MMFB 3IIKA 3DBRB 3GNLA 4IDCA 3ZS9A 2NZVG 3RWBA 4C88A 1IVSA 1A77A 2LBOA 2WJPA 3MJCA 1T4BA 5CXUA 1CBUA 2JZOA 3ISBA 3DVSX 4FLEA 5DBGA 2EP8A 1HDIA 2C58A 1AF7A 3STVA 4UPDA 1LC3A 1W581 4HQLA 4CQJA 3LKVA 5B3AA 4XW2A 1EB8A 3T34A 2MU1A 1ML4A 3LO8A 4MUBA 4S2EA 4BV3A 721PA 4X6XA 3H42B 2WOJA 3WIBA 3N76A 1WD7A 1RVDA 4OK3A 3Q9SA 3F7NA 4U6NA 2VA2A 1XCOA 1D4ZA 1YDMA 3I9V1 3C29A 1QTMA 1G66A 1TKRA 5TXGA 1LFDB 1W9MA 2YV1A 2YYYA 4R8LA 4EPWA 4ENTA 3M7IA 1NXTA 4LRYA 4QYIB 2C83A 3T7TA 3WXBA 5JNUA 2L5YA 1HQCA 4EIWA 4KU4A 1V97A 2CZQA 2R00A 3NBQA 3UPUA 3T1YB 1N7JA 4R3UC 2DLDA 3JQ7B 2Z5FA 3HVIA 2G3YA 3FNHA 2QR5A 1I2DA 3SENA 2PUCA 1VP9A 5C8DA 4F7WA 4BVHA 1NJ6A 2LP4Y 5KX5F 2H1FA 3A3NA 4GF5A 3HR4A 4H31A 1NPDA 1OYVA 4WN9B 4GLXA 4B9NA 2XWQA 5ALJA 2XIJA 4MQLA 5DBIA 4A2PA 4Q0MA 5LPNA 3V2IA 5DYWA 4UNSA 4P5DA 1X2EA 5J59A 5FBRB 4PAWA 4U7CA 1QOZA 3QFRA 3PC4A 1C14A 4KO4S 4PGMA 3T0IA 1IHUA 4JT9A 1RPNA 2QMUA 4B8YA 5JY6A 1TE2A 1D6MA 1AMNA 4KXLA 3P9NA 2JIBA 1D1QA 2ECPA 3BWCA 3D2AA 4F9FA 2BP7B 4KPEC 1WHSB 2HSGA 2HHWA 1SUFA 3BH6A 4RANA 3C5FA 3M2PA 3NWJA 1Y98A 3L0YA 1C4XA 3GLQA 3RTBA 1LTKA 1EM8B 3D0QA 1U81A 1FX0A 3ICVA 1JJIA 2K89A 1MFPA 3PK0A 3MIZA 1VLQA 5CHYA 3KSUA 4D3SA 4HQFA 1J5EB 4YG2A 4QT0A 1A69A 3M4XA 4L8FA 4TSRA 2IY8A 3GFRA 2Q29A 2P5UA 4Y9SA 4K9MA 4MQ4A 1KZ9A 2VJMA 3IQHX 3DULA 4RTRA 1JROA 2ZJBA 5TSDA 2OO5C 4ZK6A 2VOJA 2Q7OE 5B7NA 4EF5A 2XODA 2PMWB 1WWUA 2VEDA 1YCHA 1NDQA 4DRZA 4MR9A 8ICTA 2P35A 1M9NA 1YBMA 1HOXA 5BV8A 2W22A 3VR5H 3SM3A 4XTRA 1OU0A 4UZEA 3OLYA 5EMHA 1LW7A 2RCYA 2AWNA 4MA4A 2ZSKA 4JUDX 4NDZA 5BSMA 1KL7A 1JW9B 2EQ5A 1RJGA 1XMJA 3CW9A 3KPVA 4NJMB 3W5IA 1L5OA 4D97A 4QZVA 1MTZA 4KDEA 1CUAA 4JBNA 4B45A 5TISU 3CUEF 4G81A 1Z2DA 4MNTA 4Q45A 2HMVA 2PS0A 1OGIA 2X76A 1THGA 2MR5A 3OZDA 3QVWA 2DGZA 3HBAA 1PO7A 4QPPA 4E5PA 5DBCA 3VNBA 1W4ZA 4X1KA 3KTAB 5F2KA 2FMIA 5IC4A 4GZMA 2C0QA 1SCBA 2BEVB 3O5AA 5K6AC 4TX1A 7ICLA 5ILGA 4KQXA 1XA0A 2P66A 1YMUA 1ZNQO 1XEFA 3Q0EA 4C0ZA 4HZUB 4O6VA 3KHGA 4WHMA 2MCFA 5U9CA 1SXQA 2IH2A 1SURA 3VJRA 3P71T 1SIJA 3DBHB 5AKLA 1YU9A 2ARKA 3OSUA 3A2LA 4QBGB 3NTRA 2CT8A 1EFAA 2CMGA 1RPZA 1BVRA 4C80A 5LB2A 1AQIA 1CY8A 2JBHA 3HSYA 4WLUA 2V1UA 3T5LA 2JAXA 2DFTA 4IILA 3AI3A 3JTMA 5EHNA 2ZTEA 3MMZA 4G4IA 4YCDA 5JPIA 4F2GA 4Q9JA 2KFZA 4EAQA 3HCFA 1Z00A 1Y3IA 3IDWA 2QQ0A 3AJDA 1SZCA 4G26A 4IQWA 3QFHA 4WINA 5FWDA 3P0FA 3S1AB 3V5NA 4ACAA 1DKNA 2ZTVA 4G2TA 4ZJPA 4US2R 2JI7A 1N6HA 3KNZA 5FOXA 1N2CE 4JBHA 1Z28A 3LFUA 1Y82A 4CEHB 5L1MA 1AY0A 1ZDMA 3UK6A 1YKGA 3DBRA 5A02A 2YN2A 4JD5A 3CSSA 5CNIA 3SJCA 4HLQB 5BN1A 4HHEA 3JQFC 1EWQA 1YB7A 1F5NA 3B6JA 3IAS6 1K1QA 3KUKA 2DSNA 2QN2A 4CT4B 3PKZA 5DTJA 3G79A 4I50B 4GC9A 8MHTA 2RHOA 1COKA 1KFSA 2YDXA 4PGXA 5SY4A 2PNJA 4KLJA 1X3SA 1X8KA 1PS8A 2FWIA 3K8YA 4TQSA 2Q0ZX 1BXGA 4RA6A 4XGIA 5LXTA 2J5RA 2G5IB 1SK9A 4BL5A 2BHRA 4KQEA 2K60A 3Q85A 4FDMA 2RB4A 3IP1A 2K4HA 2EF1A 2ZRKA 1Z3IX 1QO0D 4ERXA 4KITB 3ETLA 3BXFA 3I73A 1V6SA 2P11A 1OI4A 1JR2A 1UA1A 5LLDA 4OHVA 2AMFA 1L5RA 4IR9A 1SL1A 1XDDA 3IH5A 3T41A 4UQPA 3KUXA 4K4HA 4V0RA 5BSEA 5LNK6 1MRSA 4NPHA 4PG5A 4QZGA 3AOGA 2B7BA 3OEYA 2XAUA 2JHGA 1HORA 2W04A 1E7YA 1PAUA 1ISHA 4BV2A 1G9TA 2ZI6A 3RU9A 3PGXA 3NTUA 1K1EA 2HRRA 4EJ6A 1U2DC 1HIWA 3BS7A 4LOIA 4JOSA 2IE0A 4HXYA 3EHEA 4BNKA 2YQZA 3I72A 4EB3A 2QMQA 1VIMA 5JJLA 1MJNA 1TT5B 1Q7GA 1GWNA 2B34A 2ZREA 4WOJA 1Q16A 3TSCA 5A2GA 2QUBA 2X1MA 1H1LB 2G80A 1BKSB 1M8KA 2WNSA 3AHCA 2O23A 4K03A 1ZIOA 2ZTMA 4GO1A 2E1EA 1HL7A 2AXNA 3IJEB 1DFIA 1OI2A 3KZMA 3DC7A 3HXPA 1DXYA 1DAIA 4B4DA 1AMUA 3H6KA 2F55A 3PICA 4EJMA 3TJMA 4C08A 4P92A 2GEKA 2ESEA 2JGRA 2HNAA 2ZI4A 1QO0A 2V1XA 3A6KA 3NRZA 3EUEA 3F4KA 4Q3CA 2HW8A 4X62B 1G8PA 3SSNA 3OM1A 5IABA 3BQMB 2A67A 4C7VA 4YMOA 2GYVA 4FKZA 3KV3O 2E5WA 4UNQA 3WZMA 4P4PA 4KN4A 3A1NA 3D59A 4H4EA 4TLEA 3VUEA 1YAJA 1DQNA 2E85A 2GAIA 1FSGA 2WJZB 4JELA 4RCYA 1KE1A 3LWMA 1Z2AA 3UJAA 4BLQA 1PLJA 4JBYA 1SQSA 3DOHA 2V74B 4K9RA 5JD3A 4DEYA 2IP1A 2AG8A 4ZICA 4DMMA 2H1CA 4O3SA 5F9NA 1MVOA 1A6SA 4ZOLF 2VR1A 3PRYA 3MFIA 2WSLA 1TJ4A 2GBFA 1GQQA 2P1RA 5BO5A 4DLLA 2ATLA 4EQ6B 3NVYA 1MEJA 3SCZA 4O4HB 4RJ2A 4D8VA 2E1FA 3A6LA 3NLLA 4MYCA 4BEWA 1OFTA 5JSUA 5IUKC 1XFAA 1EG2A 5BOLA 1KFTA 1Q0PA 2HDOA 4KFUA 5DSZA 2BFDB 2EFGA 4RGVA 5BOVA 3HJBA 4D82A 1SCUB 4QRDA 1XN4A 2YHUA 4PN7A 4DV4B 4AN1A 1W36D 2JVKA 3RRMA 3TOCA 1ETHA 4KGZA 3C6MA 3LP6A 3JYHA 4F2DA 1NVXQ 2NSLA 4G8DA 4DA0A 4FKBA 3VNAA 5ABPA 3QUSA 4AYBF 2TS1A 2CMKA 1WCYA 2YFQA 4B32A 2J9XB 5ISMA 1EDEA 3AR3A 3KTFA 2OCXA 3Q2IA 3C8MA 2WU8A 3BVPA 3I2KA 3GW8A 1FEZA 4OB7A 3T5JA 1DMSA 2I6GA 5FPHA 4GU5A 4B3IA 1CZNA 4H1VA 4FPXA 4JQCA 4RF5A 5AIAA 5C8VA 2GYUA 4CFYA 2BEUA 4P5EA 2CCKA 2Y67A 1XSNA 3EZ6A 4RGBA 4WZBE 2CGEA 5EY5B 1SOMA 4JOQA 4H16A 1FDOA 1KMIY 2X0IA 3RVSA 4C3VA 4EBBA 2DERA 3NDIA 3AR7A 1RS0A 1Z4NA 2X8JB 3D6VA 2HCTA 4Q9KA 5BR4A 2D1QA 4QPJC 1VG0B 4YP7A 4TXLA 4L73A 1U0EA 1ADBA 3BFPA 3TRKA 3NXSA 1VLBA 3F5DA 2PXCA 2IHYA 3P52A 1NF2A 4DLZA 5B30A 3O9VA 4B75A 5AW3A 3RFAA 1I8TA 4ZOLA 4AP9A 3HDGA 4NYMR 2ZQ5A 1TVMA 2QRGA 2YJNA 4ZO4A 4Z6CA 5IW8A 1GPKA 1MZVA 4LMRA 5JPCA 4U2GA 2GD6A 4IVRA 4ESVA 1PJSA 3COYA 3DT8A 1BFUA 4IJQA 3RIGA 4CF3A 1M1ZA 5KG0A 1XU4A 3L1UA 3T79A 1AKVA 1AC5A 4PPQA 2ZUSA 3OFNA 5EERA 4D0RA 1SA0B 4ZCIA 3IT2A 3M6KA 3CX4A 3GRCA 4ARIA 1MJFA 1N6IA 4IXDA 4JB8A 5B6JA 2BZ1A 1Y88A 2ZT5A 2CXHA 2VJQA 4ZAFA 5IZCC 1GZ4A 5CT6A 1NYLA 4RACA 3QNUA 2B5VA 1LBSA 3AY6A 5C32A 3GRAA 3K92A 5EE9A 2AFIB 3N75A 3MYRA 1XTIA 2O8EA 1JPNA 5DCYA 1FLDA 1GZVA 2JIZA 5CU7A 5DGDA 1CJSA 1KAOA 4B82A 4KQWA 3JYPA 3KQUA 1T1SA 1CC1S 3ALRA 4ICAA 2HLDA 3M6FA 4IIYA 3T5BA 2GTIA 3TRDA 1FS5A 1XLTC 3SG0A 4I8XA 1C5KA 3HEBA 3KKAC 3ISCA 1Y0BA 2PD3A 3D6AA 4JMUA 4X41A 2R86A 1VOTA 3GMTA 4JLVA 5PNTA 4D9CA 4BE7B 1TYDE 4LBWA 4ZVOA 4B2YA 4DMGA 2XCPA 2DH5A 1MO6A 4BRWA 3A27A 7ICUA 3MVEA 1DK2A 3PR5B 3UCXA 4LOHA 1Z26A 2OEHA 2ALJA 1VFNA 2GRAA 4P36A 1LK5A 1ZHOA 5UKDA 4E3WA 3ZDCA 4F1JA 3ERCA 2IEYA 5AK6A 3A14A 1CY1A 3DHVA 2CXRA 3HY3A 4IHJB 4UU0A 4JYPA 5A4KA 5BNWA 4HJXA 5FPKA 2MTBA 2L42A 3DJFA 4IQ0A 3N87A 4M4SA 1M7HA 4X24A 1NBAA 3F6BX 4O5KA 1KK2A 2J3LA 1HKUA 3IDZA 1DFHA 3KQSA 3NI2A 4B7XA 5DSTA 4X1IB 1ZINA 1O6CA 1SM4A 3IJ5A 4TLCA 3U7IA 1OUQA 4PWZA 3HYCA 3RBXA 4BZXA 1CUBA 2XDYA 4BQSA 5LZ7A 1E5LA 3HK2A 4AWBA 1JHUA 1GKYA 1QTQA 2AOUA 3NNSA 5LM3A 1PR5A 4XQGA 3EWAA 1DVRA 4J7UA 2Q27A 3THXA 2R97A 1QPZA 3HR8A 2G70A 3FOCA 1K6IA 1YZLA 2WD7B 3O2QB 2OD9A 4Q4HA 3V2UA 2PU5A 5JWRA 4DOCA 4F6CA 4EHHA 5CDUA 5TS3A 1J99A 4W1QA 3O31A 3VAAA 5HJ5A 1XAHA 5TGDA 1HLPA 1W19A 2PSDA 3LHDA 3R3VA 2ZIGA 4DWJA 3HADA 2VG8A 2IX3A 1D6NA 3AOEC 1N1GA 3R3XA 2C61A 4N82A 1PSZA 1M1UA 4XWWA 4PRKA 3FXAA 3GD7A 4XM2A 4W5TA 5IT9A 1IZ0A 5JATA 4R2MA 4DZTA 1TAUA 1KPGA 3BSFA 1U31A 4UUPA 4TURA 4GKKB 1BNOA 4RFLA 3DXXA 4EGJA 5AI0A 4QGHA 3GJ3A 5THXA 4W9RA 1CY4A 3OQNA 3I28A 3G2KA 2RE8A 1JU3A 2Y71A 3WHKA 4Z7OB 1J56A 1GYRA 4DOMA 4LVOA 4ZREA 1SB8A 1NBEA 3RVDA 2DPIA 1DAHA 2EG9A 3HKZF 4R66A 1LTQA 3EZGA 3HACA 4YV0A 3IRUA 4I46A 2X1HA 1WLSA 4XVHA 3ZV5A 4IJUA 5IFKA 1KVSA 4BNIA 3PIRA 5DHFA 3IEIA 2BQRA 2H00A 3WDSA 4QIWC 3LC0A 4M1TA 4CIAA 3DV0B 3HO1A 1CDZA 1GRCA 4INOA 2REOA 2REQA 2WSIA 1EIZA 2FSPA 4G0MA 3RD5A 3GQBB 4Q4AB 2EJUA 2I78A 3OQIA 5GJVC 2M2IA 1XNHA 1C41A 3I01M 2CJWB 2HBZA 2PIAA 2AYZA 3WK4A 2OD2A 1EDBA 3BH0A 4MEYA 1FZQA 1GN9A 3QIAA 1GA1A 1NURA 3V8PA 1E8DA 1KZGB 4HEQA 3LT0A 1SVUA 1Z5ZA 3OZXA 3IAFA 1HZZC 3VC3A 3UT5B 1TU3A 4PS1A 4M9NA 1CUJA 1L1QA 2L82A 2BKXA 4ECZA 2DPXA 2QTVA 2Z9DA 2ZAIA 1GG5A 3ZU2A 1ID8A 4UAWA 5IK2A 1TK5A 3IB3A 4YJFB 3P5BA 2AC2A 4RD6A 2QVXX 3ZDYB 5KFSA 2Q21A 4YUVA 1JMYA 4GM4A 4E22A 2AZTA 4Y7DA 1PTJC 3NOVA 1DWOA 1DGSA 2Z4TA 3DO5A 3IBFA 1L8AA 2DFNA 4NE7A 1LX6A 2D59A 1T6YA 5C1IA 2XTNA 2J31A 3IIIA 2QTVB 3VJKA 3SX2A 2VT2A 1Y3FE 4I55F 5EP3A 4J9PA 2PQ6A 1BNPA 4QO8A 3AI7A 3DE3X 3ST7A 3PC7A 2OYRA 4JP5A 3GVIA 5IAGA 1PJQA 2V7QD 4G1UC 5TJ9A 3NC4A 2XTJA 4W5HA 1NA5A 1W87A 4DCNA 1JDBB 3TAHA 3UPQA 1BQ4A 1YGPA 3EW9A 4YDQA 2FPRA 2JZNA 4KR6A 2P9BA 1B73A 3UQ0A 3N7TA 2XCLA 1EU1A 4N7JA 3MXTA 1Z0KA 2VCHA 1OIVA 1V3TA 2BUAA 2WTXA 2WYHA 4BB9A 5K09A 1V37A 2HQSA 4YD1A 3J81j 2D0DA 1XTQA 4BPBA 3IOCA 1T0UA 1I51A 2M32A 2SCUA 4ZRDA 1ZG3A 4PLCA 1JTFA 4UPEA 3I23A 4IW3B 2I2FA 3NHPA 1KEPA 1U7HA 3GCWA 2E8OA 4UUMA 1BW9B 1SBZA 1XEWY 3D8HA 4LWQA 1RBMA 4CI0B 4U7PB 4EW1A 2OCAA 3Q8LA 2VJKA 2W8ZA 1D0IA 1UPFA 1PZEA 4FYVA 2HSJA 5C1OA 2YOFA 5H68A 4IHJA 2V7PA 2FQXA 3HU2A 1HURA 1FPMA 2PUWA 3LRXA 4YAWA 1T29A 5F73A 4ZGBA 1HE4A 4YXWD 1MPTA 5KTTA 3K0SA 1H0HA 3BZWA 4DSOA 3CO5A 4FS2A 1CRPA 1E9DA 4BN5A 5H3LA 2EGGA 2NZUG 2LM1A 1R1DA 4WXMA 2C8JA 5KDDA 2P6NA 1FLVA 5CIQA 4QPCA 3KTQA 4MPPA 5FI3A 1I30A 2ODBA 4ABTA 1P6XA 3QVGA 5DB8A 4MVJF 3IDAA 3GEBA 5C1DA 1EA5A 4D9JA 3NBKA 1DQPA 3Q8PB 4ECXA 1V8BA 2CNNA 4M1MA 4Q47A 3F74A 1J70A 1MG0A 4PQYA 4HL6A 4UBNA 3NJRA 1FMFA 1T9GS 2XCQA 2VRNA 4Y9RA 1TTPB 1Y3DE 5K1ZA 3AVWA 4ENSA 1H3FA 3T4PA 3TLGA 4BNTA 1Z8DA 5AQEA 1YF3A 1VL6A 4JBGA 3TW0A 3QYFA 2D5IA 4EGFA 3OE1A 2Q7DA 1KY5A 5FR2A 1X9SA 1DOZA 2C9OA 3L3BA 4OQPA 5EWMB 4Q43A 4BQIA 2OV6A 4U4AA 3LQRA 1DEKA 4S04A 4UUBA 2JD2A 4DLEA 1X9MA 2XKKA 2C95A 4CW7A 2AFVA 1FTNA 1EGAA 3U7EB 5AM3A 4B48A 3T5TA 1P0FA 2VJYA 3W04A 2CJPA 1ESZA 3BRQA 1E79D 2VJBA 1ZVVA 2FETA 2Z4RA 4KE9A 1FSSA 4YP3A 1MN8A 3WGMA 1J00A 1ZCZA 1ZN8A 5CITA 3M89A 4P2HA 2YXNA 3CQ9A 3M6AA 1XT6A 3NCHA 4KPGA 4XEUA 2DQNB 4UM7A 4WY8A 4LCBA 3R5XA 1ULSA 3SFTA 4BVGA 4DT1A 3OZCA 3IX7A 5FJJA 4F97A 5BW8A 3RU3A 5IMSA 3AF5A 4J9KA 2DQZA 4U00A 5DYTA 1Q3VA 3JYQA 4N7RA 4ZPXA 3SVTA 1NR5A 1HTTA 3PWSA 5IEBA 3PW4A 2INGX 3AI1A 1K5HA 1G41A 1P2VA 4EPTA 4MARA 1IHYA 4J1NA 2OCGA 2QN3A 1OH5A 1Q3KA 1UPXA 3GV8B 1L3TA 1VE5A 3TLMA 4DF4A 2ABWA 2X41A 1JFVA 2ZWIA 4BXOA 2E1PA 1YZ7A 4ON9A 4ED0A 2JVJA 4URVR 1QP0A 1AO3A 2WAXA 3KPWA 4CMCA 1GT91 3INTA 2FF5A 5MFZA 5KFOA 5LDDC 1RT9A 3QFTA 3N6XA 3AUAA 4YBZA 3KKLA 2B69A 4G67A 4NV1A 1HOTA 4XASA 1AMOA 1DUSA 1TA4A 1OKKA 3E58A 1E2FA 4HK4A 2BKLA 5KSPA 2XRYA 1QYVA 3HYLA 2XMPA 2H3ZA 2H1RA 3WNQA 2V5AA 4CIYA 4ER0A 2A33A 3FAZA 4J0DA 4EQ6A 4Q18A 1YSCA 2WU0A 4FHZA 2GS9A 2JLBA 4WNCA 1T9DA 3LHFA 3ZDFA 2CXUA 4AQDA 4OD0A 1Y7LA 3LCVB 5FOTA 3EN0A 5G3ZA 3P0JA 4XYLA 1VA5A 5ILQA 2X9QA 2R87A 4MX8A 4I9FA 2OGWA 4IWYA 3W0LB 1DDGA 5JC8A 2R65A 1TRHA 1A9XA 1ZQVA 4I2FA 2I2BA 5FFMA 3AU9A 3TQQA 2BFBB 1NMEA 2QPTA 5H8WA 4YCJA 1N9GB 2WMYA 2W2PA 3O2JA 2DQSA 3QTTA 5ALFA 1NW7A 1UKBA 2B1QA 1ZLYA 3M70A 3QVVA 2GD2A 5C0OE 4EKNB 3KPYA 3K71B 4F4HA 2MSWA 1T6NA 2RBEA 1RJ9B 2ZIAA 4A4DA 1C8VB 5IASA 5KHLB 1WB9A 3HZZA 4ICIA 2HHCA 5ICGA 3GGSA 2B6NA 3MWEA 4UTNA 4BJ3A 4RVFA 3J80A 2D2IA 1EK0A 2PXXA 1AM4D 4BO7A 4EVQA 2XH8A 3GPDG 1E59A 4ZRNA 3ZV7A 3RTAA 4BNUA 3C8UA 2OFXA 1VBNA 2DFDA 4EUKA 5IEJA 2FR8C 2CDBA 3BL8A 5KNBH 1WU7A 1XQ1A 1P9NA 4GP9A 4LGMA 1PL8A 1IOVA 4HATA 1A2BA 1PT9A 2V58A 4F5NA 1Q1EA 4KLMA 1RWBA 1C0LA 3GAMA 4MLDA 4PO3X 5TQ0B 2EU8A 3QI2A 2C07A 4DR5B 3H97A 3LWBA 1M75A 3AG6A 3NDPA 4QPNA 2PT5A 4LFCB 1SCAA 4AS1A 1RAIA 3D7SA 1XHFA 4JASB 4JSRA 4XLTA 4WDRA 1RC1A 3O75A 5CBPB 1WHSA 2HN9A 5DO9A 3UW3A 4HWKA 1L4UA 2XGSA 5D2CA 4KPUA 1U2GA 4AYBC 4NCHA 3C2KA 2D0IA 3QE4A 4Q1DA 4XEHA 2V4MA 4NOLA 4WZZA 5JNVA 2DR2A 4O4JF 1XZHA 2I33A 4Q9LA 2E6UX 1CF4A 1NQXA 1HE1C 3N8HA 3KQPA 4MVYA 2G1AA 2P75A 5F21A 4E0DA 1HFWA 4EI2A 7REQB 8ADHA 3ONNA 5HDQA 5IT5A 5KYYA 2ES6A 4MUJA 5K0EA 2Y77A 1D1TA 2PPLA 1KSGA 3ILSA 4R8UA 3PQ6A 3PTAA 5DOVA 1H66A 8ICHA 3E5MA 2BGIA 3P0IA 4POAA 5CNJA 3G6VA 4YROA 1TDJA 5IAJA 3SYTA 1B1CA 4KVZA 5K0ZA 1SHUX 1JKFA 2REBA 4LTMA 1I7QB 3VOBA 4D81A 1BPXA 4PSKA 1I3LA 2IYEA 4DBLC 2O3JA 2P90A 4GVPA 4IIXA 4LKRA 2DUNA 4A8JB 3J7AC 1Y6QA 5JMWA 3VVMA 4GOKA 2FE9A 2BELA 3VCBA 1CUCA 2IYWA 3HA5A 3LQ4A 1VRWA 3VQTA 5A5EA 4V24A 2AG0A 4NBTA 2XVZA 1UXIA 3UK0A 2G8NA 4D0GA 1WEHA 1IZ7A 5IM5A 5KG5A 2O8VA 1HYHA 3B7WA 4PPNA 5AKYA 1U9IC 2TYSB 1N3IA 4E5KA 3KEMA 2VSNA 3JQDA 4D9GA 1DKUA 3FZGA 5EXSA 5EP1A 3OCVA 1U3GA 2NU6A 1EGQA 2C4HA 1ZHFA 1L8QA 5CPFA 1L5LA 4CZ2A 1IL0A 2WG2A 3MCVA 4Q5IA 1DCTA 1JAHA 2CNOA 2QI9F 4UU7A 3NANA 3B3QA 1TI7A 3EPJA 3WAKA 5IN5A 1C9EA 2JBAA 2ZTHA 2I6UA 5JO0A 4BBPA 3COVA 5EIAA 1O5IA 1XTSA 3KYJB 3OQ1A 3WFIA 2ST1A 5JU6A 5I9SA 5CGZA 3B36A 4E03A 1FY2A 2JAHA 3FJ1A 4HD8A 4ETMA 4QU8A 1T0HB 1QRAA 3BM5A 4F5WA 3EY9A 3BGWA 4Y2XA 3THSA 3ZHZA 3D5TA 5JY1A 2JCGA 1YS6A 5KVVA 3PW7A 4DTIA 2IY7A 3EDOA 4RE6A 4YMTA 1NM5A 2OLJA 1J2MA 3UMVA 2WJHA 3C6QA 5I7AA 1V1JA 5J2TA 1DQRA 2QG4A 1FP4B 3MMPA 4GOJA 5KFXA 2AJCA 1Z0SA 4A0GA 2NU9B 1DE0A 2J5XA 1K7YA 3SYKA 1VSQA 5DGHA 1Z5WA 4MYDA 3EEBA 1FDSA 2QX7A 1A76A 3RIEA 1S2NA 1LBHA 4D44A 221PA 3QFSA 1JNYA 1LPAB 4AZ0B 4F5EA 3K35A 4U02A 1SU7A 2VUTA 1SXJA 1XSPA 1XCBA 3LUCA 5JXJA 1J8VA 4CMIB 4JVMA 1ZH4A 4NE2A 1A9OA 3MUNA 5REQA 2DHQA 2K6GA 3W2HA 2YTUA 1WKVA 4IICA 1ZQQA 1DV2A 2AUNA 4H77A 3LNTA 1FTYA 4JWTA 3H5VA 2XT0A 2COEA 5EWLB 1CEZA 1HT0A 1VHWA 3ELDA 3JPOA 4JWNA 1JBQA 4UC0A 4Q3OA 4WESB 1YR7A 2ENUA 2XQFA 3CV3A 4RQUA 1EHYA 3SMQA 4J9SA 4LGVA 3FUTA 2XGOA 1TW2A 2ZUDA 3M5PA 1JYEA 4AN4A 1QU2A 5BP7A 5J0OA 1N1EA 3Q8KA 2CLSA 2ERCA 4LRTB 3I3OA 4PLPA 3FC4A 3H4TA 4OXIA 4BWYA 5C46F 4KQMA 3FZNA 5GTHU 5EQFA 1XB2A 3EULA 5TX7A 4DRXA 3ICCA 3KFVA 2H2GA 4ZIRA 2XTAA 5ALLA 1I4OA 5HTOA 1E9EA 3O4FA 5I9BA 3BTVA 1R0WA 4ARUA 4BY9E 3K1AA 4L51A 3ZZ0A 2QD1A 3EODA 3QM1A 1JG1A 1TT5A 2AF3C 1T1IA 2J3QA 4YDHB 1GPLA 3RIHA 3WKBA 3AN1A 3BRWD 3A2MA 3HJEA 13PKA 2B25A 3C43A 5EQJB 1ZMRA 5H3HA 4CM1A 5IXYA 1A98A 3UMYA 3ZHCA 5IH7A 2ZS8A 4FHEA 3EE6A 1C4KA 1E2GA 1WDWB 4JYMA 4MUXA 2FY8A 4R68A 4CETA 3IPAA 4MPJA 4YT8A 2PQ0A 4M3NA 1XXHE 1KEKA 1A5BB 4IEEA 1UJ2A 4RY0A 4E31A 4ARZB 1P4RA 2XXAA 4D99A 5HKKA 3B6KA 2KV2A 1WW8A 2X0FA 3UCFA 2X5OA 3DDHA 2XB6A 1QUEA 2HJWA 3MTEA 1CY6A 3SK0A 1IZ9A 4QNLA 4MYRA 2XYPA 3CX6A 3B0YA 1NV9A 2IYFA 4P7BA 1ILEA 2I80A 1HBJA 4DY6A 3NVDA 5I45A 3O1IC 3K2BA 2GWRA 4CG3A 1VPLA 3P9ZA 3CF4A 1R64A 3LIIA 4K26A 3P2EA 4S0XA 5BW6B 3T9EA 3WP0A 2JJ1A 1YOBA 3F8SA 1JLMA 4P7JA 5TR9A 4ACBA 3CR7A 3R9WA 4QC2A 2H08A 2VJ4A 4MKFA 1BROA 1SUDA 3A0HU 4C7YA 3BRWA 1YVEI 3GAAA 2WBLC 3H2ZA 3K6JA 3K9BA 4U2KA 4ZHQB 1V9CA 1FYEA 1IRXA 3DTNA 3RROA 5EIEA 4U7GA 1JA9A 1X1RA 1EDDA 2FVYA 1NVWQ 3JQBA 3SXPA 4CMKA 4KXFB 3JZAA 2HW3A 1BIFA 1MOPA 1YRHA 4CQMA 5ADHA 3IJRA 1E0JA 3GLGA 1QRUA 1TGYA 3A6DA 1PL6A 4EL0A 3OKPA 3GARA 3EC7A 4C01A 3GBSA 4QZ8A 5H9VA 4LZDA 3RH0A 1P3DA 1DC5A 1ZZGA 5JS6A 1BJRE 2WF5A 2NTEA 1FRQA 3NFYA 4JY7A 3TLBA 1A3CA 1SXHA 3PGJA 3MOSA 4DOBA 3JYOA 1KEJA 2J7KA 2VHJA 3GCGA 1YVRA 4JZKA 4PHTA 3LQ1A 1KFEB 2VP2A 4D3XA 4EZBA 5BWNA 3EGOA 4R8MA 3SFZA 2FI1A 2P9JA 1BMFD 3AM5A 3DBLA 5HE8A 5ADUS 4F5OA 1WTAA 1NDHA 3PFHA 4JJGA 3CKMA 4K87A 3WWCA 2I5PO 4ZTUB 2GESA 1EVLA 1LLUA 1X7XA 3GFGA 4JOCA 4K9DA 3WS7A 2G8LA 3VR6H 4RTNA 4X93A 6ABPA 1Q3HA 2W9BB 1NK9A 2E5FA 4RY2A 3WRVA 1XP8A 4FNAA 3I3SR 5L3ZA 5A5GA 4FS8A 1YDFA 4CKXA 1EPUA 2DPYA 1KVTA 3WL6A 5K0GA 2FGJA 2JFNA 3OCXA 1EX7A 2BEWA 4GM1A 4RVCA 1WU8A 2FSUA 2Y68A 3JD1A 3BHMA 1E2UA 3QY9A 1E8NA 4KSBA 3ULKA 3D2CA 3TQIA 2AS0A 3MIIA 1H5QA 4H2DA 4OKIA 1R10A 2D06A 2OBXA 5DBBA 2FPGB 1XWLA 2XSZA 3GUYA 2QUKA 3L8DA 1S89A 4G86A 3WXMA 1E66A 1TUBB 3RS3A 5LU9A 4G89A 3KT6A 3K5WA 4O33A 5E7IA 3GJQA 5FEUA 4F8RA 4OHMA 2FXIA 3G9ZA 3V8QA 4OI4A 4TS1A 4CL2A 5ALQA 3OQJA 3VGJA 2I7TA 1V47A 4ZCLA 1DOAA 1OFHA 2QLJA 1V39A 1JVSA 1XCLA 2BUBA 4M37A 5FPTA 1ZK2A 4PO8A 4WK6A 4AIIA 3LUGA 1QVVA 1BPZA 4OP2A 2G0NA 4RK0A 3U80A 4BTEA 2V65A 5FH9A 2BJHA 2DBVO 4TL6A 4D26A 4HLDA 2HY7A 1PZMA 5CVUA 1QF7A 4B81A 1O5TA 1ZX1A 3QKUA 2QGFA 4AJLA 5JROA 4DSTA 1CS0A 5EIBC 4OQNA 4TTSA 1F0MA 1PI3A 4C5CA 3H9EO 4XYBA 5EMJA 2AOTA 5J0WA 3PLNA 5G1NA 4HB4A 1KVRA 4D2IA 4NF2A 1ZJJA 4QNMA 4O4LB 4EEYA 5BXQC 3H5AA 3I42A 1FC0A 4X5OA 4LSWA 3VR6A 4RIIA 2ID9A 3BCUA 2YQEA 1RWVA 1BD4A 3DGFC 1F2UA 2DM6A 2FW7A 3O0TA 4LJ7A 1FF9A 3QKSA 2QR3A 1JIIA 4H1WA 2YRXA 1JHRA 2FAXA 4ZEWA 2F7SA 4A0SA 4C0BA 1Z16A 3EXFB 3S1SA 3KZIU 1L7EA 1O89A 2DUYA 1ORDA 3NHMA 1TW3A 4MW0A 1ZLXA 5KL1B 1CNEA 3GZJA 2OGZA 5FFFA 3KYIB 4HQ6A 5FNVB 1A9RA 2N47A 3UHAA 1ZK4A 2FOIA 4N18A 3X2FA 4CLHA 3AG5A 4RELA 3HBLA 3UBMA 4K6OA 4RTSA 1K8RA 2EZTA 1QFZA 3HYTA 5EIWA 4DC9A 2GXQA 4DDWA 4DUZB 4IMJB 4LISA 2PQ2A 4M88A 1KEEA 1CP3A 3RJIA 4FDVA 2E87A 5HPYB 1QZ3A 2ZE6A 1EX6A 1IOZA 4DS5A 1Z4JA 2D5CA 3HKEB 5K3FB 3ZJ4A 2HHSA 4OQQA 4PHEA 1O58A 3PXAA 4I9HA 1T9HA 3C8ZA 4F72A 1ULUA 3V8BA 2YQ4A 3I45A 1KFDA 4G3IA 5KFLA 1PR3A 1T34A 2RKWA 3N8IA 3NBZC 2EFHB 4N01A 4TV9F 1RWPA 5E38A 5IVIA 5JMOA 2XVYA 3WLAA 3BD7A 3CB2A 4MYSA 3KTAA 4S35A 4UMVA 2O4CA 5K8CA 1TAHA 1HYGA 1F8FA 1K86A 1YONA 2NSDA 2WVJA 2DPGA 2PAFA 3IR7A 5BQOA 3SI8A 4B33A 3HHPA 4CM3A 1X94A 3HXTA 1OW5A 2JFPA 3LGSA 4BLRA 2WZBA 4FGZA 3S99A 3QELB 4KQ2A 4A8TA 1RYBA 2IHVA 4MP6A 1PZHA 4CCWA 3RS2A 4BJ5A 2CJXA 5KT2A 2IBKA 5IAOA 3FBWA 4QWBA 1N5WA 2EWWA 3M1IA 4GYWA 1GV0A 2R1UA 3FI9A 3R7DA 5KU1A 5KL8B 4UUQA 2BDTA 4KXQA 3CLSC 5IKEA 4L8WB 3TI9A 1K3UB 1KYTA 2PX3A 1Y63A 2H52A 2XCAA 1AG9A 5EI5A 3ZH9B 2OCBA 4RTJA 5AP9A 1KMCA 3SAJA 3C2MA 2CYAA 4D6PA 2I3ZA 1TTQB 2BYTA 4BNZA 1XF9A 4KO1S 5CX1B 3TTWA 4ZIRB 5ITZB 4YC7A 2VWPA 4WSOA 1AHIA 3KKOA 2HLNA 2IYRA 4MP8A 2I7VA 1IVNA 1KTVA 2OHJA 4F4KA 4RHTA 5IVDA 3QFFA 5KFMA 2ZYHA 1FS6A 4R9SA 2C3MA 4KUHA 4PHCA 5BOSA 5JCOC 3W2EA 2RGBA 5I7FA 4G0ZA 4ZAYA 1IWPB 4M87A 5H82A 4ZCSA 1VSTA 1UADA 1BXRA 3KFXA 1LY1A 1XTBA 4WCDA 4PNEA 1XRMA 1L5SA 4ZMBA 1ZJ5A 3DZ8A 2KNJA 1D1PA 3JQEA 1TK0A 4BJHB 4QIHA 5LP1A 3PC8A 3HDYA 2HPVA 3IV9A 1KL9A 4TTRA 1LLDA 2AXQA 4FJ0A 2NUAA 1L4LA 3GRKA 5D51S 2QSJA 1HZJA 2Z1NA 2JJMA 4NCKA 2V03A 4L95C 1CQJB 1POWA 1U02A 3NEPX 5EJIA 1VPEA 4GYJA 2FDXA 5LA6B 1XAIA 1OBOA 4UATA 1U2ZA 3I9MA 5C5IA 2PO7A 2CLMB 3PUIA 1WUTA 2ZUVA 4RPIA 1ESMA 4DCVA 3N4MB 1DRVA 4KQGA 4RESA 2ZB4A 4L6IA 3NP7A 1W73A 3JASA 3ONDA 5LP6C 1HNWB 3WMRA 2PWZA 2BKVA 2MYTA 3D64A 1KNQA 4RQTA 3E9EA 4MCAA 4TYQA 3LLVA 1W36B 2P6UA 1BKDR 3RM3A 2PK3A 1EFPB 2GVNA 2WSBA 3COPA 4WJ3B 4P34A 3AP1A 4YPFA 4JR1A 5FCDA 4A9AA 4OHBA 1R0CA 1I7PA 4LJAA 4R9NA 3OTWA 3A6GA 4I55B 2XLCA 3G1TA 2CVOA 1EUCA 4FMCF 2Y1LA 3HJTA 3S6JA 1MJGA 4DJAA 3V4VB 4GKAA 2I7CA 3T9AA 1KN5A 2JZBA 1LPPA 3RC7A 3RLIA 4JI2B 2HJRA 1NUAA 2GLUA 1HDOA 2B36A 2IPAB 3M6VA 3U2QA 3HA3A 3F53A 2W9CB 5L95A 4NNOA 4TXNA 1JHMA 4PNPA 1HMPA 2JGLA 4ZEOA 4G6ZA 4FX5A 4NYIQ 2J6SA 2JB9A 4KZPA 1SWWA 2C2BA 5FOUA 2QN9A 1NYTA 2FP4B 2G76A 4MLZA 3K3PA 4V2UA 4ZYTA 2P4QA 2G5HB 4RADA 4HNTA 2QP4A 1BW9A 2O54A 4YT5A 3JRNA 5K8IA 1QONA 3PJFA 4TTTS 4WFQA 1L8OA 1NK6A 2AZ4A 3A37A 3THOA 1EK5A 3DYBA 3H2GA 3M8RA 3WSWA 1EWRA 3W78A 1R2QA 4KUEA 5HUQA 4LA4A 1CR4A 2AQHA 2ZE8A 1I24A 4K40A 4LNHA 5C35A 2GT1A 3LW8A 4LWPA 1FYWA 3F5FA 1N6NA 1WVMA 3FMIA 5FI0B 3C97A 2ZJ1A 4C8KA 1Z4PX 4DSLA 3A11A 4ZAZA 3S3TA 4BLUA 4YRKA 10MHA 1DIRA 1RYHA 3CUTA 5JD5A 3BHNA 4W8HA 1TYEB 3OJEA 1ZQ1A 3JQ9C 2AJTA 3CRRA 3RASA 2Y0DA 3ZHTA 2D8CA 1DAOA 1RZRA 1X3LA 3AY7A 4FD2A 2JJ1D 5IVPA 1PFVA 5AK3A 1J20A 1GO2A 4HNHA 1MH9A 2KMDA 3WYNA 4XLZA 3IHTA 1Y8AA 2WHXA 2CEAA 5MN5A 3WB0A 2VK1A 1TOAA 3LCMA 2ZT8A 3QPDA 4QBKA 3R3ZA 3X1DA 4GRAA 1IE3A 2RK3A 3OZRA 3LT1A 3TPZA 2KX7A 4K2AA 3T7EA 5ILOA 1ZQSA 1QV7A 2R8RA 1Y9ZA 2H16A 4QZ9A 1NT4A 1PEAA 4J75A 2P1DA 1OPXA 1YQ9A 2VHYA 1JLLA 4KDCA 4US9A 2D0OB 2RH9B 3GNQA 3IVGA 2F76X 4LE2A 5E6SB 3JV7A 2W2KB 3B3JA 1DHRA 4HT3B 1DXHA 3EF0A 3QKWA 4KE6A 4KO3S 3H18A 4JX8A 4F12A 2IOHA 2DTDA 2R47A 3Q8RB 3R0ZA 5D3KA 5BSFA 2VNKA 3MBOA 4L4XA 5FUBA 4GPD1 1K6JA 5LP6F 3VDXA 1QJCA 3GY0A 1HFJA 1F2VA 1T2CA 3TW8B 1Q0HA 5AK4A 4CE6A 1CQIA 2FKAA 1H0RA 4HVTA 1UM8A 2Q3JA 1GSAA 1DXSA 4R5MA 1IDOA 3QBJA 3MBIA 4A82A 1T2EA 1XMQB 1U80A 4J2TA 4D9EA 2BM9A 1LQTA 1UBRS 4RPYA 4X1YB 5LC1A 3B2QA 4ER6A 5AJYA 1P44A 4UXIA 1TCAA 2GAOA 3PQ7A 1QOQB 3W4IA 4EK9A 2HGSA 2WIDA 3V2GA 1EK1A 3SF8B 3UYKA 3ICQB 1ZJMA 1WULS 1ITZA 4JXZA 4JQZA 3CR8A 4P4SA 3VKVA 1IBRA 3PZRA 1R4NB 4RTQA 5A7GA 4ZODA 2XRMA 5AOCA 4OFXA 3E8SA 4OA8A 1N6LA 2C7QA 2VJCA 4LWOA 1FFXA 3ZGOA 4UDYX 2O1WA 4JVOA 1Q3UA 4P4GA 4Y6GB 1CYDA 1IEXA 3HSKA 4R1QA 5AMXA 5JD4A 3PGMA 5DGCA 3E2IA 4XA8A 1KQGA 3EDCA 4X91A 4MSUA 4I2BA 1YVUA 4PHGA 5GZ6A 3T38A 1EWTA 3ZLUA 1O77A 3CBQA 2HF9A 3JALB 1IOWA 4FYKA 2RI1A 2WFAA 3KHRA 4KTVE 2I2AA 3JQCA 2JJQA 2ZJ2A 2G0AA 4UOEA 5KYTA 3Q0IA 4NTZA 5E0OA 3AY3A 4PQGA 4IMIB 3H4VA 3UB2A 1CVRA 1MFZA 1OT3A 1EKXA 4FYHA 3RDPA 4LF8B 4KLDA 1R9GA 1GDDA 4YJ2B 3UQYS 2WABA 5MF6A 4D8TA 2FR1A 4MF8A 3OM0A 2LW7A 3W3AH 4GDFA 4H3HB 1KPIA 4JK3A 2VWGA 3IHQB 1EVKA 3I0NA 4DSUA 4Q66C 2OPBA 4RTLA 1UAYA 1G19A 1EFRD 3O4IA 4DQRA 1LBEA 5J0TA 3ZCXA 1ZQIA 1W5SA 5CXSA 3SDBA 1V3UA 3DMFA 1IHDA 2CE2X 4M0FA 4TS4A 4U6PA 1PHRA 3NIDB 2GN6A 2FE4A 1SUSA 1YDHA 4PZLA 4GMHA 4FCWA 4QICA 2P9CA 2E82A 2RAFA 4J90A 4HNUA 2YUIA 4IV8A 2H0RA 1NP7A 3F6CA 3I8XA 3ZUGA 5JZBA 1AZLA 1K7SN 3P9YA 3EIUA 2V5UA 4O1HA 1D8AA 2N3ZA 1EP3B 5DHTA 5HX7A 3H2KA 1UP7A 2IDKA 1OY1A 3TM5A 2BMJA 4BFTA 4OXQA 1VYUA 1KP9A 1ODIA 4HH3C 4QNNA 2QTMA 5DM1A 3CYMA 3T5MA 4EB0A 2O8NA 1F2DA 4M8IA 1E1KA 2AZDA 4CEIA 4F3NA 4RKFA 3S27A 4EY7A 4CM4B 4M0EA 5MN4A 2W37A 4M76B 1JB1A 1EZ1A 1H4TA 4PVCA 1ZK3A 2RQ5A 3MRSA 2H65A 3OIDA 5KOHB 3ZS8A 1AGYA 1VHDA 2I4OA 4GXTA 3S28A 4MMXB 4MUNA 4LOAA 5LD2C 1NL3A 4MAFA 2PTGA 4EENA 4KZKA 2B20A 2G5GX 1AQNA 3KDAA 5A04A 2VTBB 1Q0SA 1JKJA 5A5FA 5AKHA 5G4LA 3SE0A 3UAWA 1YHYA 1PG0A 3PWZA 6GPBA 1JSLA 4XSVA 2VAMA 1IM2A 1B6GA 5ELMA 3D31A 1DT3A 1KORA 3U4MA 1M1NB 1AO0A 4WQMA 2XNDD 5HRUA 4F71A 2Y1FA 2EKPA 4N5HX 1I3NA 3T12A 1EGMB 1TQHA 2D7JA 4GH5A 2CBZA 2QYSA 3M1LA 1OASA 3VKUA 2BJWA 2PSFA 4LDRA 4R8RA 1OOEA 2VUSA 4R40A 1UAGA 1LQ2A 1Z37A 3OPNA 3GELA 4OYHA 2HA0A 3ZX4A 2IK8A 4S1OA 4QSHA 1EJ2A 3CUSA 3G0OA 3UHPA 4A2QA 1QYIA 5CDYA 3WBJA 5IF9A 1K6MA 3MHPA 1JHAA 2B1GA 2CDNA 3O73A 4MV0A 3QHQA 1VIDA 5KUTA 1XJWA 2Q1WA 3GHHA 4NY8A 1W4AA 4X1OA 3NKFA 4MUHA 2PSSA 2F3QA 2BGNA 2CVQA 4FKMA 2N75A 5E7MA 4L5YA 4M89A 5CFZA 2Y1WA 2PBRA 2WZCA 4WUVA 2QM7A 5DNVA 4B3SB 3PXUA 4RK5A 3AIKA 3UJPA 4Y1RA 4XZ3A 3ENNA 2QEQA 2HU7A 2Q5IA 1LUAA 4M8LA 3M4NA 1YRYE 4P2GA 3TSWA 3C7TA 1TLFA 5LIPA 3AILA 4P6VF 2X0EA 5T4BA 2W11A 4A91A 2DWOA 1PFYA 3DF9A 1WQ3A 2B1RA 3DZIA 3OOHA 4TZTA 4ARSA 2B4YA 2D4HA 4KTTE 4MO9A 4IDOA 3IMGA 2HIAA 2VUIB 5J47A 5HA5A 1DBQA 3EXHC 4KXMA 3AFHA 3ZWDA 3FPSA 2EFYA 5FUYA 4P54A 3HNPA 3ETGA 1J09A 3M6UA 5AI9A 3PUXA 2Q3CA 1EVJA 1VCHA 4H4CA 4MQ6A 5GVRA 1GJRA 1E4OA 1SXJD 3DBVO 5I9TA 2DUJA 4DLBA 5CDFE 3L1IA 2GM9A 2V97A 5JH7F 3AKEA 3GEIA 1MAUA 1KDHA 5KQLA 5J4LA 4KRYA 2KIVA 2H1HA 1Z0ZA 5FYQA 5F3XB 4DQQA 5K3BA 2CV2A 4N5LA 5DI9A 3LQ2A 3UKDA