2G07A

X-ray structure of mouse pyrimidine 5'-nucleotidase type 1, phospho-enzyme intermediate analog with beryllium fluoride
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
290
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITFDMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosolic 5'-nucleotidase III
publication title Structure of pyrimidine 5'-nucleotidase type 1. Insight into mechanism of action and inhibition during lead poisoning.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 98
structure length 290
sequence length 291
chains with identical sequence B
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2006-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2g07A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2g07A01
2WF8A 5AVQA 4UU1A 4FFDA 2HCFA 3IJ5A 3N5KA 4J2TA 3ZTWA 1O03A 1Q92A 1CQZA 1T5SA 1ZS9A 3DNPA 2FDRA 5T41A 3U26A 5AW4A 3VAYA 4EX6A 2D2VA 2ZBDA 4OFZA 3WK9A 2G08A 3U7EB 4ZEXA 4YIKA 2G1AA 3ONNA 5IT4A 5AVWA 4EEKA 5AK5A 3QUQA 3SKYA 4J03A 2BDUA 4EX7A 1Z88A 4E88A 3PCTA 4Y2QA 3L8EA 5AW5A 4OCZA 5AK4A 1ZRNA 4HGOA 1L6RA 2FUCA 3ZVMA 2FPSA 1ZOLA 4XE5A 4CF3A 4UMDA 2I54A 1U7PA 4UW9A 4GXTA 3L0BA 2BDEA 4Y2YA 4OHFA 1Y8AA 2YMPA 5ALRA 1Z5GA 2FUEA 3QU9A 3NUQA 4JDPA 3SLRA 2RBKA 2X4DA 2C8LA 4C4SA 1RLTA 1SWWA 3IRUA 3U7FB 2YJ5A 1VJRA 2OBBA 3ZX4A 2IOFA 3WKBA 2JAUA 5AIAA 1YNSA 4H1WA 1ZRMA 3ZX5A 1Z4OA 3B9BA 5AVYA 1TE2A 4YCLA 5ALJA 2JARA 2YMMA 3ZTYA 4B6JA 2G07A 2C8KA 3AR4A 2C9MA 2NYVA 1U2SA 5AVVA 1L7MA 1JUDA 4UMVA 5ALTA 5JJBA 3FPSA 2YY6A 5AKIA 5IT0A 3NANA 5AK3A 3MN1A 3OCVA 4KN8A 3TLMA 4UM7A 1TJ5A 3I76A 3L8GA 3WK4A 2PR7A 2FPUA 3RFUA 4CF5A 5AI0A 3RF6A 3A3YA 1O08A 5AW6A 4FE3A 1SU4A 2B82A 2W11A 2I34A 1YMQA 1U7OA 3S6JA 5AKXA 2HF7A 2P11A 2G09A 4CE6A 1NNLA 3WKDA 2WM8A 1N8NA 4BNDB 4XPZA 1Z4LA 5AKYA 2OA0A 4RETA 4CNQA 3MC1A 5AW8A 1L7PA 3FM9A 2FI1A 2AUTA 1WVIA 3NASA 3QXGA 2JAWA 1Z4PX 4QJBA 4ZEWA 2IOHA 2OYCA 4Y3UA 1QH9A 3UMGA 1LTQA 4XOUA 3GYGA 4BEVA 3WK8A 4HGPA 1RMTA 3W5CA 2GFHA 1J8DA 3N8GA 4BX0A 4BYGA 1WZCA 4AP9A 2RAVA 3NAMA 2HEGA 3ZVLA 3P96A 1XPJA 3MMZA 2QLTA 2G06A 3IB6A 3KBBA 3M1YA 1AQ6A 3N28A 5AW1A 1QYIA 5A3RA 2I33A 3N07A 1RKVA 3NIWA 4EENA 2GHQA 2CFTA 2QYHA 3QU2A 5ALYA 2I7DA 5AVXA 2NO5A 3W5AA 4C4TA 3WK7A 4G9BA 4UAVA 2WF5A 4KX3A 4HYTA 2B1RA 4Y2PA 2B0CA 5AI6A 4G63A 2AMYA 4NAVA 2WFAA 3ZI4A 2HF2A 5AKKA 2PKEA 3QUBA 5AVUA 2O2XA 2BY4A 2EARA 4BEWA 3DDHA 3QLEA 1EK2A 2HO4A 4OD0A 2ZG6A 5AESA 5AKLA 1RRCA 3WKCA 4YH1A 3WKAA 3EWIA 3U13A 5ALEA 4UMEA 2JAOA 4BX2A 4AS3A 4KYTA 3UMCA 2ZBEA 3CNHA 3QU4A 5ALQA 4F72A 3KZXA 3L8HA 4MWOA 3W5BA 3R4CA 4F71A 4DFDA 2IOFK 2P69A 5AW9A 3SF0A 5AVZA 1ZD2P 2ZBFA 2YFYA 3UMBA 5AW7A 1RMQA 3SMVA 1LVHA 2MSNA 3L0CA 2YJ6A 3OCXA 3U19A 1S8OA 2EAUA 5ALFA 4BNDA 3FPBA 4KX5A 4YCNA 1K1EA 2PQ0A 1VFPA 1T9ZA 2R8EA 2JGAA 3ET5A 1XVIA 4NWIA 2WF9A 4AS2A 2FEAA 4IG4A 3A1EA 5ALSA 4CF4A 2R8ZA 2WF7A 3HLTA 3KOOA 5AM0A 1ZD4A 1RQNA 2FPXA 3AR6A 4HGRA 1CR6A 1RC8A 3BWVA 2O9JA 1Z4IA 4Y2UA 3E81A 1FEZA 3DAOA 1RKQA 2HSZA 4I9GA 4BKMA 2CFRA 1QQ5A 5AM1A 3ZUPA 1RMYA 4O8CA 1NRWA 2MU1A 3AR5A 4L57A 2YJ4A 2ZBGA 4EELA 3L5KA 4DCCA 5IS2A 3E84A 1YDFA 3AR8A 4FYPA 2Q4RA 3F9RA 2W43A 5ALWA 3ZVNA 4BX3A 2WHEA 5AM5A 2VKQA 2DQSA 5ALKA 5AVRA 5AKEA 3PGVA 1T5TA 1U2TA 4NFLA 3ET4A 4HGNA 3QYPA 3L1UA 3L8FA 3AR7A 5AI5A 3KD3A 3QX7A 4Y2JA 3L0YA 3W5DA 2HHLA 2RARA 2HX1A 5A3QA 2G0AA 2B8EA 3B8EA 2IA5A 2YN4A 3A1DA 4NABA 1L8LA 1KYTA 3R9KA 4HAIA 4PNHA 3FGOA 1X42A 2YBDA 1QQ7A 3DV9A 4RESA 1EK1A 3K1ZA 5AW0A 3KDPA 3QUTA 3QGMA 2AGVA 3R09A 1U02A 1NF2A 4UASA 3ZU6A 1N9KA 1Z4MA 3EF1A 5E0OA 3M9LA 2I6XA 2OM6A 3QNMA 1VJ5A 1RLOA 1WPGA 2HDOA 4C4RA 4YCMA 2NO4A 1QQ6A 3A1CA 1Z4KA 3KC2A 2ZXEA 4Y2TA 1IWOA 2FPRA 5AKZA 5AVSA 3E58A 3J7TA 3ZWKA 3QU7A 1YS9A 3ESRA 5AI8A 3OTQA 1S2OA 1TJ4A 4UAUA 3I6BA 4KNVA 4DWOA 2R8YA 2EATA 3I1YA 1YV9A 5AIBA 3E8MA 2P9JA 1RDFA 2C88A 2G80A 5ALZA 3I28A 1ZD3A 1ZD5A 4GIBA 3WK6A 5ALIA 5ALOA 1Z5UA 3AR3A 4XQ0A 2YJ3A 5ALDA 1F5SA 3SKXA 2Q5EA 3L1VA 5AKGA 5ALUA 4KNWA 3NRJA 3OCUA 3NALA 3L7YA 1PW5A 4YGYA 5ALNA 3WKEA 3ZW7A 2B30A 3WGVA 1TJ3A 2RB5A 4UATA 3WK5A 2IYEA 4HGQA 1ZJJA 5ALLA 1J97A 2C4NA 3U7HB 2YMLA 2AH5A 2W4MA 3N1UA 4UU0A 3ED5A 5AM4A 3U7GA 2Q4TA 3FVVA 2P27A 1L7OA 1L7NA 3AR9A 3OCZA 3ZWDA 5AW3A 3OPXA 5AVTA 3OCWA 3AR2A 5ALPA 5AM3A 4JB3A 4UMFA 5AKJA 3OCYA 5AK6A 2GMWA 5AI4A 1RLMA 2HI0A 4UARA 2I55A 4QQFA 2B1QA 3BA6A 2CN1A 3FZQA 4I9FA 2YMQA 3SD7A 1WR8A 3B9RA 2GO7A 2CFSA 3EF0A 3WGUA 5AKHA 3CZ4A 1Q91A 2HOQA 1SWVA 5FP0A 4L6AA 3EPRA 5ALVA 4UM5A 3QUCA 3QU5A 5AI9A 3MPOA 1RKUA 4Y2VA 5AW2A 3PDWA 2R8XA 1Z4NA 4MUMA 5ALMA 5ALXA 4BBJA 4DW8A 2B8JA 1Z4QA 5ALGA 4Y2XA 1MH9A 4L6CA 2FPWA 5AHXA 1TA0A 1Z4JA 3SHQA 1L8OA 4IFTA 1RPZA 2ODAA 3D6JA 5AICA 2WF6A 4Y2SA 4EZEA 1XP5A 5AM2A 4YIHA 1YJ5A 4NV0A 3UM9A 5A3SA 3ESQA 2GHTA 3PGLA 4Y2RA 2ZOSA 5ALHA 3HYCA 1RQLA 4ZEVA
chains in the Genus database with same CATH superfamily
1ONBA 4RJJA 4DQRA 2W6PA 3FNEA 3SPXA 2Y1CA 4MCHA 2ENWA 1N6PA 5DPMA 2ZSKA 4U7CA 5FOUA 3FIJA 3I4CA 4GYYA 5LOVF 2BKUA 1USGA 4TSFD 3QY9A 1UWCA 4HV4A 2IH2A 4UW9A 5CHEA 2WTMA 3DZKA 3QKWA 1L7XA 1G20B 4E5SA 5A04A 1XD9A 2GZDA 4F2PA 3PXEA 3IVGA 4FC6A 5BUZA 2P9YA 3QVJA 3RB3A 2A4KA 1U1FA 5BSTA 4FTWA 3CXRA 1AE1A 4LAFA 1ZCZA 5JV5A 1Z62A 4R64A 3SS9X 1R6VA 2YUTA 1KI6A 2AJ8A 5JC1A 1Y3IA 2JHGA 5KNDD 4FBLA 3FKQA 5J0YA 5C81A 2OILA 5HK9A 4BCDA 1JAHA 1AD2A 5K2OA 2ZT6A 5F1KA 4RSRA 4WCDA 3B48A 4MK4A 2HWUA 2QKYA 3CH7A 3UK0A 3GYGA 4DR3B 4JT2A 1CP2A 1YQTA 3C5CA 2VHXA 4PG6A 4OXKA 3C3JA 1QO7A 2YVKA 1R1DA 5AXAA 2Q3JA 4IDQA 2MU2A 2X41A 2X58A 5B1EA 2FX2A 2Q8PA 1G8AA 3Q87B 1BNOA 5IKOA 1ZQCA 3CGWA 5TPWB 3EY4A 4LOJA 3WC4A 2Y1XA 1O8CA 1ZH0A 1RYEA 1TKCA 3RYTC 4RMGA 4BJHB 3PCRB 4CKBA 2OFXA 3AB7A 3L05A 4PYIA 3X3HA 2BONA 2V58A 4MH0R 3KQQA 3HVJA 1WMEA 1Z6XA 4E5DA 1EX7A 1E5DA 2A5DA 2GH1A 4LIPD 3HQ4O 2QB5A 1T91A 4WOCA 4RY0A 4J16A 4EBEA 4DYVA 4JQZA 3T3EA 3CWQA 4YJGA 3UANA 4BECA 1CUFA 4R1MA 2AQHA 1HGXA 3VZCA 3QHAA 3LT1A 1XCLA 3DHYA 5JH7F 2QM0A 1N5JA 5P8WA 1EE2A 1ZITA 5AM1A 1L1QA 4ME6A 5FUXA 3TVYA 1XG5A 3H8VA 4D3FA 4UD6A 3EVBA 5JSQA 3A10A 3NOVA 1GOTA 3A26A 4JV2A 2XZPA 1MLDA 1ARZA 3OHBA 5LMNB 3WGLA 3HPQA 4N6OA 2X40A 5JT1A 2WZCA 5KB3A 4N5IX 2WSIA 1BXKA 3IP3A 3EXHB 2BPGA 1VE3A 4S2EA 1N8TA 3WLHA 1VKOA 1CETA 4RESA 1EK1A 1OI2A 1N2HA 1WZNA 2R66A 1PJ2A 1RAHA 4UASA 5TS3A 3IEVA 1YR9A 1QNLA 4KMRA 4OJKA 4YA6A 1VJ5A 1NZBA 3VDMA 2IUFA 3BCRA 3ITEA 2FPRA 5AKZA 4PLGA 3GR6A 4TMKA 3GEBA 1U31A 4KLDA 3ZEAA 1AGNA 3WVNA 2K87A 4ZYUA 1QB8A 1ZRHA 4E21A 3RGWS 1QE0A 1VIAA 2QV7A 4MV0A 1TA4A 3WGGA 1UFQA 1EUZA 5BO5A 3WGVA 2ZM5A 3ZW9A 1XTBA 3LMKA 4ZDKA 3OBBA 1OXBB 5JI3E 5FUQA 5IWCA 1TAGA 7ICKA 1HQKA 3E9DA 3FVVA 5K9ZA 3F8SA 4ESEA 1BIFA 4RL4A 1PAUA 1RC1A 4S35A 4YP1A 4Q4LA 4MSUA 2WWXA 4FEAA 3ZHQA 3EPLA 4CT4B 3QLVA 3FKJA 4HUQB 3V9AA 4KBGA 1G2IA 1LDEA 3BIWA 3R41A 1AXEA 1DOZA 2VH1A 3OFNA 2PU7A 4WEQA 1E0DA 1ZK4A 3GJZA 1H0KA 1KI9A 2I03A 4R31A 3WFIA 1P72A 5FBKA 3C3XA 4W82A 7AT1A 2NV0A 2ZVDA 3NTVA 3KB2A 1PZXA 3SYZA 3ZS8A 4DDVA 3VR2A 1FCJA 3C97A 1BS2A 4EHJA 1A9YA 2VYND 1KBQA 3COZA 4N7JA 1QTQA 1S97A 1G6Q1 1V0JA 1O94A 3CP8A 1R0BA 5GWXA 3E15A 1PL0A 1TFUA 2C8VA 2QD5A 4C4OA 4EX6A 3ZCTA 2F77X 1P1CA 1PJ8A 4I08A 1CS4C 4DF3A 4FNMA 4US2R 1MO6A 4ISBA 1GFSA 5G53C 2IEAA 2ANCA 3UJ7A 1XIVA 2AJTA 3EXG2 3KKAC 3D4BA 3SAHA 4YRKA 2QVGA 3DVRX 5D3MB 3TIXB 4I1RA 1N8SA 1YTUA 5C3UA 2PJZA 3BGIA 5L1KA 4QAQA 4IHKA 5LJLA 2CVPA 4FR2A 3CEAA 1Z47A 2BMEA 3GAMA 4YS6A 4H0CA 4JMPA 3ZNOA 3OJOA 1TE2A 4A0HA 4ZT2A 3DC7A 2HMTA 1Y7IA 3LK6A 4FQ8A 1M8GA 4BO8A 1KZYC 4MMXB 4GNKA 1ZOOA 3GRYA 3OTHA 4K86A 3RK1A 4L0DA 2KW5A 5KTPA 5EIEA 4YJ2A 4M9CA 4CM6A 2YQEA 1EZ1A 3FBWA 1T9BA 3EWAA 1ZQYA 1SU4A 2W11A 3ZC3A 2VHVA 2ZCJA 4EW2A 3S5UA 4QAJA 2WKQA 4B31A 1F3LA 1PVPA 2Y1IA 4P32A 4C3VA 4HN9A 4K2HA 4O4JF 3Q1LA 2YXNA 2YRFA 3VR1A 2H11A 2YW9A 3L0PA 3DV0B 3EVZA 1ZMXA 3IAM1 5A2GA 1YUMA 2H7VA 5KAMA 4XZ3A 4LRQA 2RD2A 2OCPA 4CUZA 2JANA 4RTMA 4HQRA 4N1AA 1LKZA 1OHHD 3OJSA 1G17A 3AIIA 3U61B 1TO1E 2G5TA 1P7YA 3FETA 4WBXC 3HU2A 1CY8A 4KLLA 4B75A 3BPSA 4OI4A 5F73A 3JD0A 2OT3B 4JUDX 4MUFA 4RQUA 1KDYA 2C0PA 1FFYA 4HDNB 2V5AA 2FLPA 3K20A 3F3YA 3OCXA 1YS2X 1BHSA 1Z26A 4Q82A 3W2EA 2J5BA 2WF9A 1JLSA 4D6XA 3UPUA 4JQYA 3TRJA 3USZA 3IBTA 4AYBF 5ED4A 4MA0A 2HJGA 3BCSA 1RM6C 1MRSA 3NJ8A 1Q2XA 3TNFA 2JGDB 1Q6YA 4YRCA 1ZMOA 3H9EO 4URUR 1N1DA 3ZVNA 2FXIA 5KKAA 2JFZA 4B3CA 1VJDA 1I3KA 1RRMA 3T34A 1EYZA 4J0HA 1WY5A 3JQAA 4OXRA 5G4KA 1PJTA 2LVBA 3GMIA 3RO7A 3F2BA 2AGVA 1BJKA 5KOHB 4AQDA 2WYHA 1ETHA 1DG9A 4NL9C 4OPMA 4U9IS 3LX6A 1NJXA 3KV1A 5SY4A 4LZPA 4U2CA 3M6KA 3V6KA 1EFVA 1M1UA 4FJ0A 4KLNA 5SZIA 2LDXA 4EITA 4YXFA 1Y8RB 4NBWA 3EIUA 3K70D 3VSCA 4DBZA 1SUIA 4HB0A 2O0JA 4P84A 3LX5A 3QLUA 3PVCA 2PXCA 2JRZA 3LXUX 4J6EA 1OPXA 2O7NA 3OIFA 3WL7A 4IIXA 3LBIA 2EC5A 4NE2A 1BHQ1 1NQAO 4CI9A 1TCAA 1Y9EA 5KG5A 5B2ZA 4RPXA 1U7HA 4MAAA 3AZOA 5GQSA 1A0OA 1OZ0A 1KPIA 1Z63A 1YQUA 1UBKS 3I6IA 2WFZA 4MTLA 1GG9A 2G77B 3LD9A 3TI9A 2J46A 4CW7A 4F5NA 2W2OA 2VJBA 4WJZA 5JO9A 2W83A 2J85A 4DV3B 3ZDEA 3G5AA 4A92A 1WX1A 1V5WA 3R20A 2JLUA 2R6ZA 4GPD1 5BSKA 4UB3A 3G9XA 2Q5HA 1LTHR 3I2GA 5AM2A 3IV7A 5LA6B 5KFVA 1H6AA 4F9EA 2JFXA 3UWPA 4GEGA 4TXJA 3HP1A 4C30A 3CLVA 3GGOA 4Q1AA 1STOA 3U1TA 2QT1A 3GAAA 5BV0A 1ZJMA 1X94A 5A7FA 3AWDA 3RSOA 2NZ2A 1G5FA 4WJ3B 1O4WA 3O6VA 2YCLA 2J9FA 3ZY6A 4CF3A 3WWZA 4X8HA 2REQB 4JJFA 3EEBA 4D9FA 3BE8A 1O96B 4R2JA 1GCGA 5ENZA 3LVVA 2B4YA 3GH3A 3M5DA 4G5SA 4G5OA 3S4YA 2D7JA 4YQYA 3WV5A 2VAVA 1K88A 1LS6A 5I4CA 4ZZ0A 1OLSA 2ZRAA 1UC4B 3AMVA 3A0RB 2Z98A 4TT3A 3ESBA 1OX4B 2C2DA 3S70A 4F38A 3RVOA 1O5IA 5ADVA 4TS9A 4DR5B 2YFQA 1P4JA 4FZRA 5A4AA 1HLDA 1JPUA 3W6NA 4A26A 1JG4A 3RIMA 4P34A 1P0QA 2HBQA 2OV4A 1Q7EA 3C6QA 3WQHA 1Y9DA 2PGDA 2QQGA 1ODIA 2VNHA 2DETA 1Q83A 4QZ8A 1N2JA 2ZETA 1MB0A 1P1HA 3CMMA 3NM5A 3ZVKA 2WABA 4DAEA 3OX4A 2C97A 2AQ0A 3K9HA 5JFOA 4AMZA 3E9QA 4P4SA 2XZTA 7REQB 5CP2A 1QCKA 1X80A 3TNJA 4AZTA 2ZBRA 4URWR 3JX9A 5CTAA 4NMXB 1PJQA 2H3IA 2ZYIA 4G1VA 4LKRA 4X6XA 1FJ2A 4BFWA 1G0OA 3FNBA 4MVJI 4X1OA 1QCZA 4XB1A 3G02A 2O6LA 1IEVA 1GADO 4D9JA 1T8TA 1E3DA 3TSYA 4R8VA 3RG2A 5EHNA 1P9OA 4DRZA 2VJDA 1WSWA 2IIVA 2JGEA 3HZZA 2MSNA 3CVYA 4GU5A 1PP4A 4V0SA 2Q41A 4U7JA 1CY1A 1U8ZA 5GOTA 2OYRA 1JR3D 1ESEA 5TQ0A 3QPWA 4MQBA 1XKQA 1Z0IA 4XSHA 3BSSA 4O1IA 3TSAA 3V8BA 1LQTA 4LE1A 5ADWA 2FZWA 4WTOA 5DOZA 4LYFA 2YJNA 3SZ3A 1F51E 3B1KA 2DQSA 5AVRA 1L5LA 1OFHA 4I4TA 4WNIA 1PWXA 2HX1A 1MT0A 3TZLA 2OGWA 1AHIA 3KB8A 4MPJA 4BS9A 2PO5A 1M6VA 1H1LB 2DHDA 4B7CA 3M6WA 3IKTA 3IUQA 3ACCA 2UYHA 4F9GA 3D3JA 4Z0NA 2PKQO 3GG2A 1E1RA 4CI0B 4TWZA 3EDCA 2BYTA 3ENKA 5KFYA 4IGKA 5JISA 4II3A 2O19A 2ZK7A 1W85A 1RDFA 3PXXA 3JTMA 2PX4A 4QEDA 2QD2A 3M49A 5EJGA 4G26A 4HS9A 1TK0A 1IYZA 3LIPA 1N2SA 2CFCA 3KZ1E 4M8LA 1C7IA 3W5JA 2XDQB 2AD5A 3KE9A 4Q19A 5IK2D 4ZYZA 1BMTA 1SG6A 2VP6A 3F1LA 1P80A 2NRVA 2WNSA 5IANA 2X4IA 8ICZA 2J30A 2XXAB 3HZHA 2HOQA 2FMQA 1FF9A 2BR4A 5C18A 5BQXA 1V41E 1M6HA 1LLDA 4RY9A 1R8XA 2R8XA 3SYTA 4Q9LA 1JG1A 4ALIA 3VX3A 1XNJA 5B4UA 2QJFA 2FPWA 1P1FA 3FCOA 3TM5A 1XTIA 3QA9A 4UCXA 3QVGA 1WMDA 4KIWA 5FD8A 5K8IA 1PZMA 3REQA 3O3NB 2SNIE 4UU1A 3MR3A 3R3VA 4MA4A 5AUPB 3RV4A 4X92A 1V3VA 2QL9A 3TOSA 2QENA 4DV2B 1U7DA 2OZLB 3H5VA 3UJCA 2GLEA 1Y4SA 1VL0A 2QR5A 4BWVA 1NA5A 1A9PA 1I5OA 4A03A 1KRXA 1UMKA 2I3GA 4Q47A 2GD2A 2FUEA 1ZZEA 2C8LA 3KDSE 3MM4A 3U7FB 3NHJA 4P4LA 1BTOA 1E7WA 1I6MA 4F1JA 3EDQA 1KIMA 2BCSA 5HDBB 3UA4A 3SZGA 1N6LA 6GPBA 4F06A 2IHZA 2CDCA 4WLNA 1WOYA 3TIVA 2GHIA 3TNLA 1XL1A 2QYTA 3BRWD 1N60A 4MFAA 1W2HA 2GSWA 3E3AA 3H2BA 4LZOA 3HV2A 2Y2UA 3PYXA 4R9UC 3BREA 5BNTA 3AVYA 3ZV4A 2W48A 1ADJA 4MUEA 3LDUA 4HPWA 5BOLA 1SULA 1NFFA 1N5LA 1YT5A 3IESA 1DQYA 4KDCA 1AUQA 4NY1A 4HNRA 4HX5A 2PKCA 3S6JA 4R6XA 2P4EA 1SOAA 1UBCA 3ESCA 5A0VA 2LCIA 1ML3A 3IAUA 5C4GB 4XYBA 1YS7A 3MC1A 2KSQA 3BSFA 4NARA 3KSUA 3AB8A 4YQEA 2JAXA 5FA6A 4ASUA 3AEUB 1KEPA 1QH9A 2FZVA 4ZALA 2BEUB 4RS4A 2DLDA 1ZA2A 2AGOA 1LNQA 4FDVA 3ABSB 2WPNA 2ID7A 4WX2B 5KFCA 3WOVA 4N82A 3QWAA 4RJKA 3DBOB 1BQ3A 4E2FA 1ZHOA 2XXJA 1LKYA 3TEFA 2C54A 2PFGA 5K3CA 2OXCA 2Q2NA 4MARA 2A84A 3AUKA 3T7KA 1SUAA 4ZVNA 5IDQA 3KUCA 1OLOA 2QJOA 1D04A 5U4QA 4P3OA 2ZWIA 3IV9A 4C7VA 5AW7A 5IFLA 1ZDMA 3IMKA 1PS8A 4MVJP 1QKKA 1E1DA 5F5XA 1ZUWA 1YRQA 4BCCA 4PLTA 3RABA 4CF4A 1GGKA 2QN8A 2A9JA 4U6NA 5DB6A 2YC2C 1WTCA 2V1UA 3PENA 4HJRA 4MWTA 5KWSA 1RQXA 2HLDA 4MB0A 1PLKA 1ZQEA 5KVCA 1RJDA 5EP2A 3P1JA 4YK7A 3Q3EA 3EPHA 4DQPA 3A1NA 4M0EA 4N03A 2NVWA 1SXEA 3D6FA 3EUEA 1ZGHA 3EODA 3A31A 3BXEA 2B8EA 2HDHA 1KH1A 1L8LA 3KV3O 5F9HA 3FDZB 4WBNF 1KORA 2ZYGA 2JI8A 3KQSA 4S0ZA 1IJEA 3MWDA 5B7NA 2C95A 1VZ2A 3GUYA 4X5VA 5JNVA 5C32A 3R4VA 2P7IA 2I4RA 4RXUA 2DHRA 3OMLA 3S8EA 3H11A 3C6KA 2WWGA 1TT5A 3GDFA 5DTRA 4TYQA 3N2GA 4RZRA 1EUQA 4C06A 1L6IA 2MYNA 3GVIA 4BTEA 1TTHA 1SOVA 2BCQA 3QVSA 1U6IA 2IVFA 3N3BC 3RR2A 4IO0A 3NDJA 1FX1A 3ORRA 2XMQA 2OHVA 2BUBA 3GCDA 5KX5A 3AFNA 3GJTA 2YZNA 1HFEL 4MUYA 5BMOA 4JI5B 2F67A 3THYA 4AULA 1TM5E 1J0DA 1HORA 1XFAA 4UEQA 1LPAB 4O29A 4JODA 5DDIP 1E4EB 2ZIUA 2I2WA 4F4KA 3JS5A 4LE0A 1SA0B 2PFPA 4NZPA 1NVEA 3ZXIA 3PNCA 5K3AA 1IZ0A 1U0EA 4KR6A 4NMMA 4DDMA 1Z7BA 3P8ZA 1K8XB 1NI4A 1KYVA 2H92A 1UPUA 4G65A 5E79U 4A0FA 1RQLA 4R5HA 2H1CA 2X86A 2OHIA 4F8JA 3IP7A 4F93B 1JLLA 3T4XA 3VGPA 3Q8KA 2EQYA 2MSWA 1SQ0A 3SKYA 2D54A 4BVBA 2ZTMA 2J87A 2E4WA 3SHVA 1UZMA 4O5CA 4JJ7A 1FDVA 3VI4B 1E1CB 3DCIA 3UH1A 1JZQA 3TVTA 4XWWA 5AT1A 5KMGA 1IOLA 3ADKA 1JIXA 3PHIA 3R9IA 1PQYA 3R3JA 3RGGA 3N7AA 4TRMA 1DK2A 3O1HB 4U2DA 2PZAA 3DV2A 3QPCA 1W59A 3INYA 3V7WA 1NBMD 2HHXA 4OTZA 3TZQA 2J7KA 5LLSA 1MQ2A 1N5OX 3IVAA 2MR6A 2WUEA 3QE2A 1IPHA 2QQ5A 1H5QA 4MB6A 3AI3A 1JFLA 2JVIA 2K5UA 4WHMA 4CKEA 2GK6A 4XARA 1EVYA 4HDRA 4YN4A 4ZVTA 1J0AA 1KEUA 2QUZA 4WN3A 3CW2A 4AW9A 3U7JA 5K0TA 1HI9A 2ZW9A 2NU9B 3UIEA 2NSDA 2OG2A 3ZY3A 5E9AA 5I47A 3I2KA 4EY3A 3BD6A 1GVHA 4JAVC 2PX2A 1X1AA 1SKUA 1YBMA 4DCPA 5KT4A 1Q15A 1KAOA 2ZT7A 2QP3A 2DUJA 3WMFA 2KHVA 3R3HA 4YN3A 3E4DA 1MVLA 3ETLA 1L3SA 3TL6A 4F4FA 5CFZA 3AERB 4N54A 5CDGA 4CCYA 3H4BA 4IDNA 2BFOA 5GTDA 5CA0A 2HSJA 4DUYB 1Z68A 1UH5A 5F35A 2I7TA 2OXOA 4EO9A 2PV7A 1M0SA 5E6SA 3RVNA 1M83A 5FBQB 1KBOA 4AS3A 2QIOA 3ESDA 2IYSA 1X9XA 5FRDA 2GGSA 3C6ZA 3H42B 5FUMA 4NONA 5LMCA 4PPYA 3QA3E 4Z6KA 3HVKA 4NH0A 4XQEA 5TGDA 2ZU0C 3WJ1A 3WYGA 2JZNA 5AWFC 3CNQS 1X7YB 4QU9A 1BA3A 4GX2A 3A6FA 3TLCA 3BWYA 1PEDA 4Q7LA 3GARA 4W7HA 4PLYA 4ED1A 3UZUA 3NB0A 5DGCA 5BUSA 3WMRA 2WAOA 1KKLA 1PX2A 5JASA 1YB4A 3BICA 3CONA 3PE3A 4ZOEA 3SSAA 1D2RA 3KXPA 1KO5A 1GZ3A 4ND6A 4KQJA 5AKEA 4QODA 1Y8QB 4Z0HO 3PGVA 4GL2A 3IR5A 4RQBA 2KYRA 5NLLA 2UZIR 4PQYA 1WXHA 4U0JA 3G5TA 1DOQA 1NF9A 1VE7A 1F2UB 5CDUA 4S2UA 1I3OA 4RO0A 5TMBA 1SKRA 3KQPA 2P2SA 2D2EA 4LRWA 3TCKA 3SHTA 3O8OA 4BNLA 5BVHA 1SC3A 2QJWA 3R9XB 1K89A 2XTZA 4JLVA 1AOXA 3AEQB 1ORVA 4Y9TA 2EIHA 1RKXA 5KTOA 3BS7A 1QB7A 1ZQSA 2GZSA 3TSOA 2ZT8A 2ZRCA 2R00A 4D9IA 4LCEA 1P1KA 1W87A 4MS4A 3AM4A 1V45E 4CN8A 2YY7A 5IAKA 3KHRA 5TQ2B 1L5NA 3WK5A 2GDJA 2C7BA 5REQA 1D8AA 1HDZA 4JBYA 4UBCA 1R0LA 1UBHS 3BE6A 2BFDA 3BN3A 3OCWA 3DTVD 3ANNA 1WB4A 2JI9A 2V4QA 2P6UA 3KEFA 1T26A 4OK5A 4Y0VA 3ZBPA 4WLVA 2WJAA 1WHSA 9ICXA 4BV3A 4PO8A 2DR2A 1X74A 3QYFA 2XWBF 2QMYA 5E7IA 2OHFA 3V7LA 3UGQA 2P78A 2IWHA 4Z0TA 2QARA 1S76D 4D82A 1W29A 4B2YA 5ALGA 4M1MA 4AZ3B 1XQ6A 3AKCA 1BD4A 1C80A 3S7TA 4OO1J 1JHOA 4ML3A 4FZLA 4P7BA 1SQFA 3KZCA 4ELVA 4OEHA 1P17A 4DQSA 5F1OA 4C6TA 5DNCA 4BVFA 2G1AA 3STTA 2O20A 5AVWA 4BJ5A 1DCMA 1HYGA 2NACA 1O77A 2X2OA 4DJ5X 5TVKA 3BD8A 1H3EA 1BKDR 4GSLA 4Q3AA 1B2LA 2E6KA 1R9GA 2KEYA 2DWQA 1F0YA 1MIHA 4PNZA 2CC2A 7ADHA 2I4LA 5I9TA 3GLIE 2CEAA 5I9MA 3TL3A 3CH5A 2HBLA 2RGDA 4OVKA 3OE4A 3FGPA 4NMWA 2Y1WA 3DDOA 1J25A 2ZPTX 3ICOA 2V65A 4LBYA 3DH0A 2C1ZA 2W7OA 4QIWC 4FI3F 3FA2A 5LMUB 2IYOA 4W8HA 3ZU3A 4YP9A 3WB2A 5IIJA 3K2EA 2OWEA 2E0IA 1PS9A 4UHFA 4KQHA 1P62B 1DC6A 2EFGA 2ZRIA 3PF8A 4HQ0A 2Q8NA 4BWYA 2NYRA 5IYZA 2WYUA 4OBXA 4EYKA 3CINA 3OZIA 3BIOA 1TK8A 5CT9A 1AXGA 1HPLA 5HF8A 4ZI7F 1NU6A 1HFKA 2FI1A 3LHDA 4G07A 1RCUA 3EXEB 4QYIA 3UWKA 1U0OC 1DP4A 4LKOA 3AJDA 4YV1A 2UVPB 3CB4A 2X9LA 1HETA 1MV5A 4BYGA 4RH1A 1T3GA 1AQ6A 4COOA 1RWOA 4GOXA 2JLAA 4TYYA 3WLLA 4JROA 3AUOA 4MJ3A 4DHWA 1SUBA 4CG2A 1P9RA 3OQVA 4L0CA 1OFIA 3EAFA 2ZSHA 1UIMA 4DS3A 3AZPA 5ALEA 1DDOA 2OAEA 4WINA 1S3GA 5F4BA 4F71A 3SF0A 3FXAA 2ZRLA 4BNXA 3WAJA 3OSUA 1X7HA 4EGCB 1EFRD 4KUHA 1ADFA 1W0CA 2O48X 1TVCA 1IG6A 5KFEA 2WF7A 4Z9BA 3WQBA 1DOAA 2WJPA 5KSOA 4JD5A 4E2ZA 1KVTA 4NX2A 5L1MA 3WYFA 2G83A 2VUHB 3G0IA 2XT9A 3R5SA 1U2TA 3IYLW 3NCHA 1ADYA 3EG9A 2AQIA 3C2LA 2ADMA 3KPWA 5CEFA 2FMTA 5C8YB 4IIJF 4WK0B 3GIMA 4P2BA 4C0QC 1DIHA 2DPMA 2H3QA 1RYFA 4E30A 4TKZA 2F3SA 4KIFA 2Q3LA 4L95C 4M8KA 1U5CA 5CPBA 1DX4A 3DMHA 1PNTA 5CW2A 4UAUA 4ZOLF 3NT5A 2G80A 3D54D 4ER6A 5DLFA 1NLYA 5F3DA 1BMQA 1N61A 2XTJA 3NVWA 5A05A 4RKWA 3CKKA 4L9SA 3PZBA 2X4GA 3IHKA 1AS2A 2JV3A 2WVGA 2C94A 4WZAE 1Q7RA 4BJ6A 5U4XA 5IKPA 4EMBA 1P2TA 1RI4A 2O0HA 3I01M 5AK6A 2JL1A 4I81A 4I4LA 2NV2B 2VP2A 1J56A 2R1TA 5JG7A 1Q6ZA 4FCCA 1CJKC 3BXOA 3HKEA 1GUYA 5CK5A 4DOMA 3UJ6A 3PDWA 5KYWB 4D92A 2FR1A 2JF0A 4RULA 2WZQA 2P0YA 4A36A 1TA0A 1Z4JA 1N4AA 4MEBA 4MS1B 3E3MA 3JATB 7ICJA 1KRPA 2Y93A 4HNUA 3UC5A 1GAWA 3F5DA 1ODFA 4DMHA 1CQZA 1VECA 4EKEA 2YIJA 3CNOA 2FLLA 3QXHA 1RZRD 2G72A 4QUKA 4R41A 3K4GA 1FDIA 1FYFA 5L6MB 2XB4A 1U1EA 5DASA 5DCYA 3T3MB 1Y3CE 4GZ3A 3HA3A 5CFLA 4R8RA 3QPUA 4JVLA 3TFWA 3FFTA 2YDXA 1T2AA 3F47A 2GLXA 1C30B 4MJLA 2OO5C 3CVVA 4DQKA 1L4HA 4PYOA 3L01A 3VV3A 1ZRMA 2BBSA 1WQ1R 1MXFA 2AOWA 3F49S 4KXMA 4Q34A 1YI1A 5D5HA 5JZSA 2B8TA 4MVJH 1JXOA 1ACLA 4L8WB 5IZCA 4U2EA 2BN4A 2VPWA 1HNWB 1UT5A 3QOYA 4DNQA 5F7JA 1F60A 3GAFA 3O9VA 3WNCA 1GFIA 5M29A 4P38A 1N63A 3H9BA 3ZDQA 3BXHA 3R5TA 2GN0A 1Q3UA 4L16A 2L69A 3Q3IA 3HFRA 1TU0A 5L53A 3WKDA 2Y27A 2ZSUA 3ASYA 5DN6A 1NVKA 5E2AA 3LGSA 1L7PA 2A19A 1IBRA 2YVLA 4M21A 1NVWQ 2BCGY 4NK5A 2OR3A 2ZUCA 2UVRA 5IVIA 4EAAA 4CDRA 4E70A 3DOEA 4BDSA 3CFYA 1UXHA 2NNLD 4QUIA 4EO7A 4X6YA 3M4ZA 4OA8A 2ZTHA 3VR3D 2XGMA 3OZCA 3T7EA 2XY7A 1GAJA 2HPAA 3QTLA 1I4LD 5HRAA 2ZYVX 2XMBA 4XD7A 4S05A 4EENA 1UMCA 1YD7A 4YJ3A 2ZDQA 4BWMA 5I9BA 3FUUA 2Q1SA 4REQA 1KOJA 1OI4A 1Q19A 4OD0A 3ER9A 2G5CA 3ZLUA 3SQXA 1UBNA 3AY0A 5EGSA 3LF2A 5J63A 4IIUA 3NNSA 2FW0A 2AZXA 7ICVA 3FTDA 2C78A 3UYKA 3VOSA 3JYNA 1OBOA 2IHTA 1THTA 1BS1A 4KQ6A 4LHZA 1HE3A 3I04M 1Z4IA 2B6NA 2CFRA 1BZYA 4X20B 8ICBA 3JQFC 4FE7A 4H7DA 1CVRA 1ETUA 3IOMA 2RGBA 5HCNA 2AL7A 4GXRA 4V2UA 4M0UA 1L9KA 2DUMA 4HWRA 4BWJA 4CM4B 5F1YA 2W6ZA 2ZIXA 1Q3HA 1TJPB 3U7QA 4LMPA 4RFLA 4R0NA 1KO1A 2IA5A 1NW4A 3M9OB 5G5HA 3EMBA 3NTOA 1J2TA 2P62A 3WNDA 3KHHA 4H4CA 5E3JA 3KZKA 3WGHA 1SIBE 3T5CA 3S1AB 5FX2A 2FE4A 3EHDA 3A0BU 2R7MA 4IIBA 3T5KA 2G8LA 1YE5A 4MW4A 4FFNA 1GHTA 3DMTA 5TGZA 3QPBA 1Q44A 4MVWA 1PJRA 4B46A 4BQSA 1O0BA 1NYRA 1E69A 5K0SA 2NO7A 1ZPDA 1QSGA 3P9PA 4AXBA 1MX9A 3PC7A 1IN4A 4TM7A 3T5HA 4YRAA 4MYUA 2ZXUA 4MP8A 1KK0A 3KSZO 4D0GA 3BD9A 2AEJA 5CFOA 3DZHA 4QG7A 1E9CA 4MWDA 1HA3A 3SKVA 4ES6A 1NHWA 1C29B 3OECA 4KC0A 2AV6A 5JY1A 4DSFA 1ECGA 1L4KA 3R1IA 5LD2C 2AN9A 2CXRA 3IS3A 1A9XA 4BP8A 1DC4A 5I6DA 4UHEA 4ENTA 1IK4A 1RQGA 5DHRA 1C0EA 1QFXA 2PH7A 4FVTA 4IDOA 3TB4A 3PZRA 5AICA 3GEMA 1Y81A 1PR2A 4YYZA 4Z6CA 1SQGA 4PJ0U 3GPLA 3ZDDA 1BNPA 1P6QA 3HUUA 4DEXA 4D1YA 3PWZA 3B13B 4K9NA 5FTNA 5TF0A 3BQ7A 3C7AA 1EESA 2B9VA 3NBYC 4OQLA 3PUJA 1OWNA 2FX5A 1G9SA 4RTLA 5GM1A 3BD7A 4MNTA 4ZQFA 3FOCA 1CJCA 4YP0A 1NQWA 5ALRA 3I9LA 1Z25A 1GTZA 3N59A 3AEKA 1CY0A 3AIKA 1TYCA 2QROA 5H02A 2HQOA 4WACA 1X8JA 4A8JC 4WXRA 2QQEA 2VZEA 1CR0A 5ALJA 1LLQA 3EZ5A 4P5DA 4NLGA 3FKSD 4NCHA 1VYVA 2ZI6A 1OZAA 1KAHA 1Z3EB 3MZ0A 1EUYA 5CURA 1W76A 2VCYA 4L07A 4MKZA 1I2MA 2GZ2A 2PX3A 4AMYA 4XYEA 1ZQHA 1JDBC 1JAYA 1ZQFA 1XSNA 3DVQX 1D7OA 1R7RA 1MQ8B 1A4RA 1R6XA 1CVIA 2A5YB 1YZGA 3CZAA 5LXTF 3PFBA 4BV9A 3PX0A 4HFJA 2V7GA 1U0NA 3N2IA 3W3AH 1K8RA 1V8DA 3DGEC 9ICNA 3ANTA 2GZ1A 4TTIA 4M2LA 1ODKA 5JUWA 4OBBA 1M66A 5CHGA 3NEJA 16PKA 4MZXA 3UMGA 2I87A 4V3CA 3JPWA 4YBRA 4DJDC 4P3PA 4HNVA 1Z56C 2XY4A 3IAS1 2WYVA 1SZPA 3D3QA 2CB9A 5E4FA 3UOGA 3RODA 3OT1B 5LWHA 4RA9B 5JTTA 3O2NA 3QVVA 2B83A 3IAM6 3SS8A 1RM0A 4JLKA 2OFFA 3OEEA 5A5DA 2F8KA 1JROA 3H9JA 2GERA 4BP1A 2VPQA 1YZTA 5BP7A 3NYIA 3E7DA 5IEJA 3U4GA 3KM0A 3L5OA 3UB3A 3AJ8A 2P9CA 1FS5A 5IWAB 2IBKA 1HT0A 1CP3A 4OQYA 5LQRA 1BKSB 1UWKA 1C0PA 1RE1A 2DHQA 3TKAA 3W8FA 3U16A 5EWEA 3KT0A 1Z2NX 3AR6A 3OG9A 4HGRA 5TARA 4BIIA 5I7FA 3BGWA 5GONB 5F9LA 3BT7A 3DR3A 5IJ9A 4MWGA 1TK5A 3R0IA 3K32A 3E1SA 1C2TA 4PZLA 2RIRA 3P0JA 3RK4A 1PYOA 1KJIA 4DNPA 2V0NA 4UU7A 3BSWA 1NR5A 4HGNA 3PGMA 1UBLS 1AB6A 2ZIVB 1U0SY 2BKLA 1KYWA 1QKIA 4QULA 4PAWA 4EUKA 2F6RA 4EB6A 4C0XA 3BTOA 3QF7A 4MULA 4GR5A 1BCRB 2FW8A 1I01A 3H6KA 4E5PA 3NHPA 1G4HA 2HWKA 1M33A 1QRAA 1S0VA 4CKWB 5B2FA 3KC2A 3LZ6A 3DULA 1MABA 2A7QA 1X7DA 4K9QA 1I2BA 3O3OB 1XZBA 4MIEA 2YC4C 5I8ZA 4LJXA 1T8WA 4ZVMA 5COBA 1IOVA 1ZD3A 1MDFA 5KYXA 1Y1PA 3UKOA 4CUJA 1G2OA 2YJ3A 4W1RA 3A7EA 1Z0JA 1I1HA 1ZQKA 1X9SA 3L6DA 1E2GA 4P36A 2V7VA 2WAQC 3HSSA 4CL3A 3WDSA 3ND6A 4Z4CA 4GLOA 3AR2A 4JVOA 4LDJA 1RLMA 2VYVD 4W5HA 3OPYI 1LPBB 2R7AA 1FVHA 1Y6QA 1B8PA 4J43A 1V43A 4PC7A 1ZQAA 2WB4A 1W4ZA 3SD7A 3GJ3A 2GSDA 1E58A 3OHMA 4QELA 4B3DA 4CBVA 5TSDA 1T3ZA 4S04A 5ALVA 4KO8A 2OZPA 2XW6A 5LYJF 4Z9YA 4B3RB 3BFPA 3D7LA 3FOWA 1FQWA 2OHOA 5AJVB 3RW9A 2CLFB 4LOAA 5CYPA 5JXHA 1DAOA 3HCNA 5K7SA 2NVUB 4PGYA 1F8XA 5HHTA 3LU1A 3T3OA 2FFQA 3O0DA 4TLCA 4X94A 4N76A 4D9NA 3Q40A 4GBGA 4Q16A 1NW9B 3TW4A 4BFVA 4CEIA 2G08A 1RRGA 1N2CE 2QZ4A 1BPYA 2NX2A 3KTAA 4PXAA 3CF4G 3BJRA 1P74A 5KFUA 2AMFA 2I4NA 5H9WA 1P77A 1W44A 2EWVA 5LBUA 4Q4CA 2QDKA 1W36B 3KB6A 3ZLTA 5DQGA 5ICMA 2YJ5A 1X92A 3U62A 1SKYE 1GSAA 2F90A 1BE6A 1PHPA 3FGZA 3K70C 1OLUB 2Z2XA 4UAJA 2FPPB 1JQ3A 1WXIA 2ZTCA 3H4MA 4DJJA 1S7CA 3RHFA 3HB4X 1JI7A 1EBFA 1K0FA 3FWHA 1WY7A 1EM8A 5AVVA 3GP3A 1R3DA 1OTYA 5J4HA 2BFWA 5BPHA 3INGA 1LDYA 5JNUA 5E0KB 3UK6A 2C2RA 4D25A 2UVVA 1SVIA 2H5IA 3CN7A 1FJHA 4GPZA 1V3TA 2HXGA 4RE6A 2FW7A 2PD3A 4S1NA 4E12A 2C82A 2W98A 1E5QA 3MUFA 1P33A 5HILA 1R2QA 2F8SA 2GB4A 2C3YA 2KE7A 1CLUA 5BW6B 2AUTA 3IOYA 4Y1RB 4RQ6A 3HWWA 2CYAA 4A9AA 3RKSA 4Y3UA 1CEQA 3LXMA 4KRGA 2DU8A 4E7OA 2Z3ZA 3JQ7A 3R7DA 5I51A 2ES4A 2GUGA 1K9VF 2YHIB 1M0EA 2V59A 3IEIA 1XPJA 1FSPA 1E0KA 2HVIA 2O1SA 3D8NA 4XR9A 4BLSA 2HHVA 3NHUA 1GVNB 2HSWA 1JIJA 1IH8A 4O5OA 1YOVA 2GN9A 4ZICA 1CULC 3QLEA 4Q44A 4Z1OA 1FDWA 3W4JA 5A4IS 5BT8A 2VXOA 1WS6A 1F0NA 1Y63A 1U2PA 3K0FB 5DZSA 4LYGA 1R0CA 4NEHB 2BMVA 1XLWA 4J7CA 3AFGA 3KYDB 3VKUA 3H5WA 5KYYA 1LVHA 4OM7A 4QDOA 4D80A 2RGEA 1FYDA 2PXAA 1U65A 1G7RA 2JFUA 5A9TA 4Z99A 5DXAA 5FF9A 4YPFA 5ICSA 5AOBA 1NMYA 3OIGA 2A94A 1T2DA 1XAHA 4I9GA 1KJ8A 2Z6UA 3MHTA 4EBBA 1HOXA 3DMPA 3V4RA 2C2KA 4PV7A 5NULA 3SENA 2OBNA 4IG9A 1T8RA 3SSMA 2D1SA 3GEDA 3V2GA 5F2NA 3OZRA 4DXDA 3UK7A 2ECPA 1USKA 4XYGA 3G5UA 1J21A 2OOKA 4QZHA 3IP9A 4MPRA 1U98A 2CNNA 3EQ6A 3QGMA 3VR5D 4BNZA 1SIUA 3GD5A 5B12A 1XXHE 3KKKA 3ZWYA 3KUUA 3PEFA 1JQJC 3UWOA 3VU9A 2JS7A 3OD1A 3HPOA 1Y4UA 1V1MB 2MAXA 1UHUA 4NLCA 1THMA 4AG3A 1PK9A 3QZUA 2JBAB 3MBKA 1XAIA 3GI1A 4LY6A 3RV3A 2Q5EA 3E48A 1NONA 2Z95A 3NALA 3WKEA 1SL0A 4K6GA 3DHWC 5J2UB 4G84A 3O8QA 2WD9A 2H2IA 1OH6A 4FGSA 1PT8A 3FCCA 5JLJA 4YMNA 1K7XB 4H4EA 1EK5A 4FONA 2Q0HA 4NDZA 5EE1A 2IZ6A 4R2XA 4BMDA 4H1TA 3ML1A 1CDZA 1S7GA 1R66A 1TM2A 3TE6A 2YXPX 5DV9A 1LNZA 4JR1A 1G8MA 5DKWA 3AESA 5BWCA 3PK0A 4IR7A 1VSTA 2GARA 2HIAA 1CJUC 3CKLA 3EGEA 1ISJA 3B3JA 4N48A 1P45A 2Q9AA 4IFBA 3UJ8A 1BRMA 2BFEB 1LSSA 4KPUB 3WLSA 4AAYA 1I4OA 3K0AB 4NFHA 1PVVA 2PMCA 2ZYHA 3VISA 3X1YA 2NUPA 3HYCA 2G36A 3GFFA 3NHFA 1J9ZA 1T9GR 3F7OA 2HA2A 3ZS9A 4XB2A 3K3PA 3MT7A 4PHTA 3SFZA 4B81A 3HFSA 9MHTA 2RAUA 3RAXA 3KPYA 3CRW1 3M6XA 5KVAA 3R5JA 3JVDA 3QVOA 3RDPA 4C6SA 4D8VA 4Q8EA 3WG9A 5KNBD 2NYAA 1V9SA 4P53A 2JDIA 2D0IA 2ICAA 3N2KB 4A4DA 3EISA 1QKJA 3ZE7A 4EA7A 4H1WA 5KTSA 3HKZF 2OVFA 1XO0A 5THQA 3A6JA 5E3IA 5LP6B 4LYEA 3UMFA 1OXXK 3L4SO 4MLDA 3OURA 5EWFA 2CEKA 2WVAA 3AV0B 2AX4A 2P41A 3O4IA 4C3UA 8ICXA 3BJZA 4R7TA 1EE1A 4PAQA 4HEHA 5J2BA 3IP4B 5JMTA 2D1RA 3EYAA 1E3LA 4I1IA 4ZK6A 5L7YA 1WUHS 2OYSA 2XB9A 4ZODA 1RQ2A 1E1QA 3LFHA 2XY6A 4KN4A 4OATA 3GGJA 5K6AC 2B35A 4OKIA 1RXUA 1CQXA 3L4BA 3AGQA 1Z16A 2JAHA 5LZ4A 3T0IA 3PD0A 4DLGA 4YCAA 3KAKA 4XAQA 4L27A 1VL5A 2QLLA 1IU9A 4HDSB 3WMXA 1J8DA 4U6PA 1H3FA 1GNSA 1W1IA 1P39A 2Y76A 2KP7A 2IITA 3UV3A 1Y88A 2WE7A 4C05A 4IDBA 4BZQA 4RDIA 1P3JA 3K8YA 2V97A 4JLAA 4M1QA 2VQEB 3THWA 2QSZA 2F59A 2JMGA 2QE6A 1D8LA 3LWDA 1WVGA 5CVDA 2C9BA 3P52A 5BSHA 4E1BA 1YU6A 4YT4A 1P2VA 2IX9A 2HRZA 1DFHA 4ERXA 1PJLA 4CR7A 4H3SA 5KFAA 5F3XB 3MQ4A 4F5ZA 4I8XA 1BXRB 3EIQA 2PRJA 3JWPA 3IILA 2ZB7A 3HK2A 1EWQA 2ZI5A 3EVGA 5IKMA 1WE2A 2V03A 3SWWA 4ICAA 3AI1A 1NP6A 1OFGA 3LI2A 1M1XB 1H0HA 2AN1A 5TMEA 4G8DA 1D4ZA 2PCLA 5ALKA 3WRXA 2YV1A 1KZGB 2Q46A 1G3QA 2HHJA 2WNIA 1D6SA 2H2WA 4IQFA 4BN5A 3VQTA 5FNVB 4MV4A 1M3SA 3UATA 3REOA 3UTDA 4K1XA 4TL6A 3DBVO 4UTVA 4N39A 1SHLA 3EN0A 1ZIOA 2EZUA 1UMDA 5EE0A 4X41A 2VQ6A 3SMQA 2OM6A 2CE7A 1Y7LA 3OTWA 3A3NA 1V6CA 2J9XB 1I2CA 4XQ8A 5BQ5A 1DOHA 4HR7A 3QU7A 3H65A 4ERNA 4XR4A 5T5QA 3NBAA 4JP5A 1YV9A 2PN1A 2DWOA 3R7SA 1QYCA 3LWBA 1SC9A 3BL6A 3OPVA 4BEJA 1ZSVA 4XQ0A 1QHGA 2MTBA 3MYRA 4JBNA 6Q21A 4HB4A 3ORSA 3QKRB 4Y7DA 2B20A 4H1UA 1XRMA 1YACA 5KFJA 4JEMA 2W4MA 3WWPA 3LV8A 4ECVA 5IHXA 1L4UA 5E6UB 4RKYA 1YZ6A 1RIFA 4WFKA 2MINB 4H3KB 1XLUA 3KL2A 2BQUA 4N0MA 1YS6A 3AY6A 1AF4A 1T1GA 3KWMA 3VR0A 1EVKA 2CL7X 2EZ8A 4D6YA 4DL5A 3KKAA 1DKRA 4DGQA 3PF9A 1IN8A 1GQ2A 1NQXA 1HEUA 1TVEA 2RGUA 4EJ2A 2D74A 4G5FA 1DJOA 3T52A 4QPJC 4LC0A 2IPLA 4LSGA 4OLBA 2TMYA 3NHYA 3FTCA 4Z1MD 4TWAA 3AL0C 3OQNA 4ZI2A 2C7PA 2PI4A 1BA2A 5EJ7A 5CB8A 4OV6B 2I71A 4N7RA 1IDN1 1UFOA 1O95D 2O1XA 4MVYA 4YP3A 2Z83A 3UJAA 1HL7A 3EA4A 5B5EU 1E1NA 2D3TA 5SYMA 1WDKA 3MWFA 1XU7A 3CCBA 2QTMA 1EFLA 1VPLA 3E53A 4HB2A 3K5HA 2QQ0A 4PL2A 3GG9A 4JN6B 2OBXA 2VC2B 5DB4A 3QW4B 2AOVA 4FCWA 5KHLB 4O4LB 3TQ1A 1BMFA 4O08A 1VMEA 4M9LA 4IKOA 1OXUA 3F46A 4BO3A 4IQ8A 3ZX4A 5KAIU 2XRMA 1GNRA 3D2LA 3QF4A 1LX6A 1LRJA 5SZJA 4JXZA 3A9TA 1Q0LA 5G1PA 1AGYA 3G2MA 1L5RA 4BU1A 4E6EA 1ZONA 4GM0A 1WAMA 5JVDF 4QNLA 2KHZA 3VDRA 3M8SA 4KN8A 1OGYA 4IW3B 4YPVA 5I45A 3NVVA 5DF1A 5CXQA 3V7JA 1KJZA 3MWEA 3S1SA 2P11A 1BPBA 4JWKA 1T10A 3QENA 3GHHA 2W9MA 1S77D 3SAJA 2YWGA 3NASA 2XJ9A 4HXEB 4M36A 4EA9A 3HYLA 2BZ1A 1HOTA 4CM7A 1DLIA 3CE9A 3WBJA 3BXFA 3DBRB 2OBLA 1P4AA 1T1EA 1US8A 2J59A 2H4JA 4B3BA 2GWSA 3KVNA 2RAPA 1SHZA 2VF4X 1FBTA 1PZFA 3PIRA 2AMYA 3OAAD 4ZYYA 1B74A 1SXJA 1TCUA 3ZE1B 2ZVQX 2WTAA 4JU8A 3R2JA 1BHO1 1QE3A 4IOJA 5ALQA 4F72A 2VF2A 2IIQA 2Q6LA 1DJNA 3RM3A 3JWJA 4QM6A 4WOKA 1Z35A 4ZZ3A 1WEHA 4QZCA 4H4DA 2XF2A 2P5TB 4JH0A 1ORWA 4CN9A 4ICIA 3QOXA 2PIAA 5J2TA 2FW9A 4H60A 1YBFA 3F9RA 2CXPA 1Y3HA 5EWJA 1DZIA 3FRIA 2H1IA 1UOEA 2VAWA 5D1HA 1ZK2A 4TKUA 3LLVA 1O89A 4AP5A 2YB1A 1AIPA 4U8HA 3UQYS 1G6HA 3KXIA 4BATA 5KWIA 1N0UA 4OP2A 3GEIA 4ND1A 1XNRB 3GLVA 4A1FA 2A86A 4O4IA 3DAFA 2G9NA 4G4IA 1XTJA 3FD8A 3LBAA 1NUHA 2C5BA 421PA 3TF5A 2E1FA 4PIMA 2P8SA 5FTKA 4FZJA 4CU5A 2Q0SA 3RAFC 3A05A 3QOWA 3E9CA 1XTVA 4C4YA 1WDWB 1T5LA 4Q02A 4OHVA 9ICVA 4UOZA 3M5CA 2XUZA 4MW2A 2D13A 4DIKA 5ALUA 3IJPA 4Q1DA 5FFMA 5JJIA 3P5BA 4MV3A 2GPJA 2Q4DA 3RWBA 4Q1VA 2HRCA 5IBRA 2MCFA 4D9EA 4Q9IA 3A11A 3ZIDA 1BVRA 2XNDD 1QTMA 2XYQA 5TQJA 2D7CA 3S8YA 1ZNYA 3DBLB 1GGNA 1ZGCA 1NKTA 5E38A 3UICA 3NXSA 1I5RA 4DMUB 2AN4A 1PKXA 1JG3A 5K45A 1H2RS 3VH4A 1H6BA 5KFOA 2XBMA 3MJCA 3RREA 1JQBA 2HDWA 4JUCA 1V7PC 1OXKB 2ZSFA 5L9AA 4QOIA 4AF8A 1YT3A 2PM8A 1D4OA 4XASA 4EJSA 1CXZA 1W34A 3MDCA 1W88B 2CSXA 2PR2A 3HKCA 3PPYA 2F1IA 4MS3B 3ZI0A 2OEHA 4Y2GA 1RR6A 3MGHA 3A9SA 2J6BA 2ETVA 5HM8A 1GQRA 1RPTA 4F50A 1OMOA 5KYKA 2PNJA 1QF9A 2FLNA 2IYPA 3OJFA 2ISCA 3HCEA 3TD9A 1UPHA 3VDXA 3QWFA 3EQ2A 2J0VA 1P5JA 1EFHA 3EYZA 2LYBA 3QUQA 3IQEA 1JKXA 1W73A 5JYEA 3ETHA 4B3MB 2CHQA 2H2HA 2PCJA 4HWPA 2FW1A 1L6RA 1WIWA 1EQUA 1PFYA 3SX4A 4RADA 3IH5A 5JSKA 3H0EA 2KZ3A 3MCTA 5GOZA 1RJEA 1O54A 4XOIA 3OLQA 5IVKA 2V7QA 4IXWA 4QYXA 2VDLB 4O3RA 4GI5A 2PXXA 3UCXA 1QH1B 2EYUA 3FPGA 1OAKA 2VVTA 2OBFA 2J7PD 4M7OA 1U1GA 4N9QA 1N25A 3K5WA 3I9MA 3EUB2 4AZSA 2H7CA 4PLZA 5L3QB 3RRMA 4UDYX 3ST7A 2PSEA 2OCBA 3W1EA 5F98A 7MHTA 2ZZMA 4U00A 2COKA 4UB1A 3ZIAD 3IT1A 1ZD9A 4RAQA 1Z8DA 2DFKB 4HVCA 4HQLA 3I3SR 4ARZA 2VH5R 5ARCA 1CPYA 3OLZA 4TXMA 1BD3A 4PZ0A 1OFUA 5EJAA 4RVOA 2XVTA 2X0DA 1RCTE 3D7SA 4QTXA 5CD9A 1KOLA 1U04A 4JC5A 3PLRA 5KL1B 5DYTA 3DGFC 3C28A 3U9SA 4K4IA 3NGMA 1LY1A 2PX8A 1V85A 1G38A 1JECA 3S8MA 3JQGB 1U0JA 4LW8A 2CLKB 3GA7A 2J6UA 2PUTA 3BB3A 3PUVA 5F7OA 1R0RE 1A9ZA 2JJ1A 3KQUA 3WGMA 3UV7A 3TYXA 1IBCA 1Q7CA 2RHCA 1UQTA 3TTSA 4XH9B 2B3DA 4MB2A 1VPTA 3W4KA 3ZG6A 1LVGA 3UXOA 1YAHA 3SIXA 3GA0A 4V1CB 3SK0A 3B9JA 4X3PA 3OT5A 1UJ4A 3HKDA 3EPKA 1PJSA 4IVPA 4MEAA 4PX3A 1WLYA 4ECSA 3HTXA 1YVPA 1KI7A 3TLKA 1O6BA 3WYBA 2QUAA 2ZAIA 2NZWA 1TLLA 2CNLA 4IILA 4K9KA 3ADCA 1X7WB 4AS2A 5ALSA 1QPZA 1UL1X 4OGKA 1IJFA 2BFMA 1JR4A 1MP0A 1P9NA 4UTPA 4CIXA 2W4QA 3IDWA 2BUAA 1M1YE 4CM8B 1D8YA 2VDKB 5DGHA 2V5UA 4WI1A 3Q9SA 5T67A 2ZWPA 5BVGB 3TJZA 5K8UA 1FFBA 1T5TA 4QXAA 2OHGA 3RTGA 5CCBA 3RJIA 3U81A 2FRVA 5ESXA 3TQTA 4PZAA 1WM1A 4DF4A 4QXMA 2VS1A 5EKTA 5DGDA 3ZHYA 1BDHA 2O2DA 2Y99A 3FH0A 4HLQB 4YFVA 1NFQA 1K7FB 2JA2A 1R6AA 1NI3A 2NO4A 4O0MA 1X1QA 3MD9A 1N5IA 1A77A 1EVQA 1DDGA 2XNKA 1RJ9B 2IZ1A 4EFLA 2X5NA 2BMFA 3PUWA 2XE6A 4RNOA 3U4DA 4XWTA 2ZCUA 1UBSB 5FTJA 1S2MA 4TS4A 4X1IB 3QVXA 1PGQA 1EWKA 4JL6A 1QF6A 4FN5A 2GBLA 4KXXA 2GWRA 3B52X 3RTVA 3EDMA 3DMYA 2YHAA 4X90A 3T7SA 4QWEA 3D2CA 2X42A 4IKPA 3VU3A 2R8IA 5IXJA 5G0VA 4E0DA 1M2GA 3FYSA 5JRDS 2NZYA 5IX8A 5G4LA 4AJNA 3BB1A 3FPFA 2MT9A 2DUUA 3EFOA 3TZHA 2RBEA 4ZTZB 5DI3B 3ND9A 3JQEA 1AY0A 2BI7A 4Y2VA 2WJ3A 1ND6A 4U02A 3R0QA 3O4GA 4UE3S 4DV5B 3GLFA 5C35A 4DG5A 1T35A 4P98A 3RUIA 3IBGA 2WM3A 3T12A 1I4EB 1PUZA 2O8BB 4PZOA 4NHEA 2ZULA 1VFNA 1IQ0A 4WFJA 3DBHA 4G01B 4WLUA 2EZ4A 1NXVA 2DFTA 3AT1A 1NJSA 2R25B 3NORA 2QPAA 1QYDA 2V8BA 3KAPA 3V7KA 3ZCSA 1M8FA 3QEBZ 1XZGA 4BY9E 2OFOA 3IMCA 1T0PA 4OQNA 1A1SA 4A8TA 5J23A 1E0SA 4HB3A 1E6LA 3HYRA 2A3RA 3D6UA 3MJEA 2HSDA 2ORIA 1APBA 1XNHA 4RQ4A 3I0ZA 1XDDA 3O95A 2GNPA 4HH3C 3BGDA 5ITVA 2XNSA 5LQAA 1U47A 3V48A 2E82A 3GLGA 4Y1FA 5AKIA 4FGZA 3WB0A 1SCJA 4KXWA 4Y6PA 2HA0A 1TRKA 2UYOA 4OAOA 1QR2A 2CXHA 2ZSEA 1JIQA 1FSFA 4AUNA 1YIDA 3GIIA 5K3BA 3EIHA 2IYVA 1TV9A 3WA6A 4P8RA 1DKQA 4CLOA 1A4UA 3U0VA 1SCNE 1X77A 5FBZA 1A9TA 5T57A 3C7CB 2QTVB 1M2HA 2RHDA 3OZBA 3RS5A 3T38A 4DSTA 3DW1X 4HDOB 4IJMA 4CV2A 1YQEA 5IZ4A 1CEEA 1REQB 2QUJA 3WP1B 5E4TA 4WOPA 1HRDA 1AHNA 1OWOA 2FA9A 1XB2A 1QIFA 1KVUA 4AKEA 5JQGF 1XPOA 5TY0A 3J81j 1G5RA 2Z9BA 2OYYA 4UAVA 3WU2U 2LMRA 5BRNA 4P3XA 1FYEA 4PRYA 4KYUA 3K1RB 1EVZA 1ZQ1C 4LNUB 4QVKA 4YAGA 2BOVA 2DQNB 3LKBA 1TMKA 2W2VA 4ENPA 1NSYA 3K9GA 3HEAA 2Q6VA 4TMFA 4TURA 2PKRA 3UNXA 3QU4A 4NECA 2GZRA 1RFLA 2EFHB 1XZFA 3LE8A 3PW7A 4FW8A 2PUWA 2IA6A 1AKNA 3WA7A 2QVLA 1K75A 3N97B 2QAGB 2EAUA 2G4CA 3Q0IA 4ED8A 3KZIU 1P2DA 3M1IA 4DWVA 1RC8A 2O9JA 5FWYA 4ZPXA 4BVLA 3JQCA 1QUFA 3QH4A 4FHCA 1MU0A 1BU8A 3SM3A 2H1VA 1AHPA 5EHZA 2WAMA 3AR7A 3ZZNA 3C98A 5K3SA 1KW4A 4OHPA 3I05A 5K2MA 1DQZA 3T5PA 2JIPA 2WHRA 4NABA 4J4BA 5DG7A 3G17A 3FYUC 2C9DA 4TS1A 3ROKA 3E2EA 5KSZA 4RD0A 1W46A 1KFDA 1MB3A 5G1OA 1NK7A 3BH0A 4TZTA 5EOVA 1BVSA 2IP1A 3BF8A 3KPJA 2OGSA 4MV8A 1PJCA 3EFEA 1X40A 3OTQA 3CG0A 4UDNA 3L1KA 5F1PA 1GRCA 3C5WP 3RVBA 3AF3A 3H1EA 4MYSA 4CQNA 5KNDH 3FSGA 1U2DA 4EYQA 6ABPA 2G76A 4XQCA 3L1VA 3NRJA 2W0MA 1ZUHA 6NULA 2UZAA 3MMSA 3OT4A 1OYYA 4MDFA 4FMBB 3AN1A 1ZJJA 2EP8A 1M1ZA 3JWIA 4I99A 5CUQA 3L7AA 2JCXA 1PF7E 3U49A 5BRJA 1N2OA 4YONB 5B1YA 3NTLA 1C1XB 1BQ4A 1ZN9A 4LG1A 3PNQA 4LHWA 4A8EA 5J2DA 2AMVA 4JOBA 1M75A 4JXKA 3TOXA 3ZK9A 3Q15C 1KGDA 3NO4A 3RSZA 1XMXA 4BVKA 1ECCA 4DC9A 3DJYA 1FTNA 2FPMA 1T4BA 1FDUA 2HZBA 3LT4A 3RIEA 2GCOA 4LJ8A 5ALXA 3GJ0A 3D5EA 1UXOA 1DI0A 3AIOA 4ETWA 1S0OA 2DTEA 4FUTA 3KJIA 2RGNC 4JCOA 3NNNA 3IDFA 2J3LA 4I2CA 1E5LA 1Z37A 1KWGA 1IATA 3JARA 2QZ9A 4FD3A 3KLMX 5AW4A 3ZDRA 5A6SA 3U7EB 4K4GA 2A0YA 4PWZA 3W6UA 4OSOA 2CB0A 2ASLA 3U3JA 1JFSA 3IPCA 1CEYA 2BM8A 4GOOD 3AVXA 4FOPA 1QGED 1HRKA 4FB5A 4FHFA 4RDCA 2RI0A 3W78A 1VCOA 1RLTA 5H16A 3FCYA 2PL3A 1U0GA 2AQKA 3N76A 4BWFB 1LJUA 4EYEA 1JP7A 5HQ3A 5B1IA 3GGDA 1FDTA 4D6PA 4G0XA 4WGGA 5L3ZA 2AR0A 1NN5A 8ICWA 4I2IA 4NY8A 7ICLA 2B25A 2BJVA 1X7ZB 5BY2A 3AWIA 4WCFC 1EMDA 3HBMA 2C28A 3TTWA 1HEIA 2ZIGA 4IX1A 5KNLA 3R5HA 1PT5A 3U44A 4RNNA 4HFRA 2PSDA 5KYUA 3PDIA 3U56A 1I3NA 3MRXA 1L8XA 5GGYA 1J2NA 1BO6A 5LKRA 4IYJA 5AOCA 2ZVPX 1SCAA 3P0IA 2K8AA 3RIXA 4X7PA 4QRDA 4F9FA 1JRPA 2V6BA 1XKLA 2R7KA 4RVCA 4H3HB 1RXSA 5GAJA 1Q3VA 3EPIA 2F1KA 3KLPX 3R5KA 4BWGA 3H19A 1KEJA 4KN7A 4ZT5A 5AVJA 5JALA 3AJ9A 3IIKA 1YVEI 2OBMA 5TNXA 4YR2A 1XVAA 2XAUA 2FMUA 4UQGA 2FE1A 2PMWB 3IAS6 3AQ4A 1MC1A 1XR3A 2NO5A 3PQ2A 1CW2B 2PYIA 3GRFA 5K3DA 1E61A 2IP2A 4TRNA 3OIYA 5AJUA 3RSSA 4BL5A 4J7XA 4J0JA 4HRXA 3GLRA 5L9XA 1I1OA 1VKJA 3CEMA 3N8NA 4JBXA 4TTAA 2W2KB 2XRZA 4O4HA 3KJXA 2RK4A 2JIDA 2X8JA 3KIPA 2BRUC 2BW0A 3NM6B 1M73E 1GKIA 4HWOA 1ITZA 3C45A 2O2YA 2B98A 1P91A 2BEWB 3MWGA 2Z4TA 3PD1A 3LL4A 2EZTA 4G0VA 2L19A 3O84A 5FOVA 1NVXQ 2RGYA 4JBWA 1V6AA 3W34A 5K8LA 4DC0A 3AM1A 2CMKA 3OI7A 4DBLC 5EMMA 5EJ9A 4BZZA 4Y9DA 1GQSA 3EC7A 3SZOA 3WHPA 1UWVA 1GFZA 3HI4A 1C3EA 1GRQA 3ZD6A 2GK3A 4F4JA 5MGBA 1QFJA 5CJJA 3Q7TA 1PG0A 1ULTA 3FCAA 1F12A 2P3QA 5EJ2A 1ACJA 2WEKA 3H4TA 4YMOA 1WNFA 1C9JA 1O5OA 3AF2A 1SQSA 4ED3A 4YR3A 1PSWA 4W5OA 3L7LA 2Z2ZA 4QXOA 1ZD5A 1O0CA 3BWEA 1P60A 1AK9A 2YOGA 1TVKA 1AQUA 4DV6B 3PVZA 4PANA 4Y6QA 1OT3A 1TJ3A 4NLBA 1I0ZA 4JUZA 3RNLA 5E9WA 2EX1A 4XIIA 3JQBA 4B9LA 3DT8A 1C81A 3ILXA 1IAQA 4QDZA 1NJ6A 4D8TA 3DAGA 4XIFA 2K60A 4HHEA 1JMVA 4FO6A 1KFBB 1WWKA 4IMRA 2RHMA 1J8MF 3PKIA 1B4FA 1XZ8A 4XB6B 4KV9A 3PE6A 2JI4A 3K1AB 5KC8A 5DNDA 3P9XA 4LNAA 2O3JA 3BBPA 4F4IA 4MQLA 5T4BA 5L7TA 3CO0S 4N5MA 3IKVA 4LK3A 1XDUA 1YMUA 3T5BA 1QLJA 4LRYA 4ED6A 4BO1A 4KOEC 5KTNA 3BF7A 3CRVA 4F4UA 2PZMA 5C3MA 2DWPA 4Z4EA 3V97A 3WLQA 1AN9A 4PSVA 1ZNXA 3D6JA 6REQA 4XDYA 3L0OA 4YIHA 5EGNA 2BGRA 2AE1A 1D1SA 3KU1A 1K2VN 4HEQA 1JHXA 5AVQA 5E2IA 4QARA 4BHTA 4I55B 3ONNA 5IT4A 5DH9A 4XEHA 2E1RA 4FYVA 4GWLA 2FKAA 2F3QA 1QYVA 2QN3A 3SE0A 1Y3BE 5KFHA 4MI1A 3GUCA 2Y1EA 1DAHA 2MA1A 4GRDA 1YJBA 3NONA 4XX1A 4KGVA 2VNIA 9ICBA 1JZSA 1ZM2A 1X9HA 4EZ9A 3I9OA 4YECA 4YRMA 3E3NA 1PR1A 5HCUA 2N75A 4P83A 4TL8A 4MQFA 1CDOA 1H8ED 2KLHA 4JX8A 4BKUA 1Q50A 1OCEA 1DTEA 2R84A 4LOIA 4FK8A 3KJHA 1UPCA 3RS3A 3IE1A 3LUHA 2IXFA 2BCUA 3LSTA 3PRJA 4Z9FA 1I8TA 2GLTA 1KFSA 2X9GA 2XGQA 3RF6A 4LV5B 1WB9A 1C50A 1I0IA 2G09A 4CM9D 4EG6A 3E6AA 3IA2A 4G9GA 4RHCA 1UM9A 2P0AA 1E3TA 5FFNA 5C5EA 2ZYUX 4F5QA 2B36A 4L9AA 4PQFA 5KEIA 3UO8B 4XUSA 1H42A 1K27A 3IQFA 2FSUA 4JUFA 5ENVA 4ARBA 3KEQA 1GCIA 3K1YA 1O0SA 3A6PC 4OJYA 2KPOA 3RTCA 2PWZA 1F5NA 4EGFA 1OAAA 2OLJA 4ALJA 1YFLA 3O8NA 5EG5A 3ETRA 1O87A 4C7YA 2CXSA 3DHNA 1J7KA 3G6XA 3BYZA 4YMUA 4FIDA 4DOBA 5BN3B 5SICE 2BCVA 3H8WA 1D5WA 4RU9A 1QZUA 1YZHA 3DAHA 5IJWA 1WHTB 5ANRB 1GM5A 4AFNA 4IV5A 1AUOA 4FM9A 1ORRA 2ZUSA 2BEJA 2PPLA 1QDEA 3F3MA 2JGJA 5EHQA 2JJ2D 1F0KA 4CKBB 4MV6A 2K4PA 5BNWA 3PA6A 3BQNB 1O4VA 2NTYC 1XZHA 1TJNA 2R8PA 3LUBA 3MK31 4RJTA 3QTTA 3PI6A 1ESNA 1Z5OA 4K3VA 2YH2A 1MV8A 4A6DA 9GPBA 1E0AA 2QLNA 2YYAA 1YZNA 3GUHA 4DVGA 2JCYA 1QORA 1AQNA 2REBA 1M0TA 1QIGA 3I5XA 2HDOA 1Z28A 1ZGAA 1KRHA 4N41A 4B9AA 4XWOA 5KJCA 4O2BB 3UUEA 1DIGA 2EF0A 5FWNA 2R68A 2WD7B 5BSMA 1DBSA 4D9KA 3R24A 5FAXA 3L92A 3WYEA 3QV1A 1NJYA 2JGMA 4PG4A 2QNBA 1HDOA 3X0DA 4J4HA 4NF2A 4J0KA 4CEJA 1F8GA 3K9QO 8OHMA 3V7FA 5ALLA 4MIOA 3GRZA 4G0OA 3VTAA 4WXEA 5GADl 2C07A 2NO0A 3AFHA 3UF0A 3ZCUA 4W5WA 5HDQA 3H6HA 1W9HA 1JXEA 4FYKA 2A0FA 3ZD9A 1DGSA 1U28C 1NUTA 4IXMA 4MR9A 3IC5A 2JKZA 3NIFB 3A1SA 1TO6A 2TECE 1V47A 1XHFA 2GPBA 1NVVR 4QLAA 3FHOA 3NBXX 3O92A 3T94A 3A1UA 3WISA 4GX5A 4BRUA 1QTRA 3VZDA 3K0HA 3WBKA 4L5AA 5MDHA 4O2AF 1SKQA 5C0OE 2ESRA 2O5VA 1RCFA 1SPBS 3LJKA 4X93A 1I9CA 3SYLA 1BPXA 1O1YA 2FRXA 2OO5A 1BVHA 3GJYA 1ISRA 3WRYA 1UQRA 9ICTA 2PEZA 4WLFA 2OCXA 1J07A 4DLRA 2AD1A 4Q3NA 1ZHFA 3BUSA 3QBDA 4V0MA 4IHQA 4GKAA 4R9NA 4BKQA 3ESXA 4JI2B 3UJPA 4M2YA 1E1MA 5MFZA 3NMUF 1SD1A 3WWDA 1YU9A 3EXFB 1FSGA 1VG9B 2E49A 3KQHA 2HBZA 1YQGA 3SJUA 4DY6A 2FG6C 3F4LA 2CL6X 3VAZA 2B92A 2NU8A 3EUAA 2X4DA 3DEHA 3EZLA 4M1YA 1E3WB 4AXXA 4B6OA 1FU7A 3VXKA 4INZA 7ICQA 2R3SA 2I6FA 4CM3A 5BWLA 3FLEA 3LBNA 2CVOA 4OG2A 4X8MA 4QBFA 2I3AA 1OGJA 2O59A 3KLNA 2IYZA 4FZ5A 1DKUA 4K6HA 3MS2A 1T5IA 2JIOA 4Q66C 1XL0A 4ZU3A 4UMVA 2VZ8A 3B89A 4WZBA 1NRIA 3OM1A 2J31A 3IT2A 3AB3A 3SFVA 3C48A 4B33A 1RLJA 3IHQB 1GNLA 2JIBA 4FEEA 4ZQHA 1TLFA 1CUYA 2RJNA 1EVLA 1Q46A 4K9DA 3RG8A 2H06A 4DADA 4OYLA 2ZTLA 2XY5A 1OGIA 2XPCA 1AQIA 1IBKB 4V39A 3G7SA 4XGKA 4HVTA 1KAGA 4PBSA 1WZUA 2RIPA 1U45A 4MWSA 3RT1A 3EXIB 1IHDA 1T1RA 5F23A 1GAQA 3LQYA 5C53B 4HH0A 4Z7JA 1GUFA 3UTCA 2HA6A 4FLMA 2PYZA 1KK3A 2F3PA 4B9MA 2GRUA 3N6RA 2A9KA 3C1YA 1DTSA 5JROA 2VUIB 1PFUA 5EUMA 4IXTA 4YDRA 5DBBA 2EZZA 1A5BB 3M4YA 4LSZA 4Z7QB 2ZBFA 1QH8A 2QN7A 2LYAA 1LJ8A 4HYQA 2D4HA 2WQ7A 4M9RA 4GC7A 4XGQA 4F4ZA 2AG0A 3H6GA 1WQ3A 3ZQUA 4GPEA 1JVNA 1A8IA 2PFKA 1WUKS 1SBNE 1LDNA 4G5HA 4DV4B 2HSZA 3KOXA 1S2IA 2Q9UA 1ISFA 4CQJA 2ZBGA 2I66A 5JR3A 2JAQA 1JFVA 3QPDA 3TMKA 2DBZA 3P9IA 4MVJA 3HY4A 4FS2A 5AM5A 3IP8A 4X5OA 4Z4GA 1F7UA 3F4KA 4B7ZA 4F7WA 4GKBA 3OA2A 3L8FA 1N6OA 3OZDA 1YZUA 2P4SA 3TSZA 2IC5A 4K6MA 4YRJA 1XMOB 1EVJA 2XVAA 4R2WA 1JDSA 4PRLA 4NBTA 1JEAA 2HZ7A 4YRGA 1N1EA 2CLLB 1HF3A 3A3KA 1BE8A 1PW7A 4EGQA 1A2BA 1YRBA 4N8EA 3MG9A 3RROA 3JPSA 4URZR 5LFAA 3F7NA 4G5QA 2WIDA 5FFFA 5JADA 3OX3A 4K0KB 1DBPA 1Z6ZA 1QO9A 2YR0A 1ONSA 3SOZA 3CEPB 5K3OA 4HH4A 4JP2A 5CPFA 1JPNA 5FAKA 3KCNA 4BMPB 1UJNA 3NC1C 5MFPA 2JGKA 1BE0A 3E05A 1QONA 3HY6A 3GGSA 2JEJA 3U7GA 4R16A 5LZ7A 2V3CC 1BW9A 3UBMA 2GETA 4MX8A 2RK6A 2F4VB 4G5XA 5K01A 1N0IA 3ZV6A 3I64A 1TIPA 2FZCA 5TQVA 1M6WA 2FZGA 3E9RA 4CLDA 4FZMA 3IHWA 2DJIA 1LCIA 2PYDA 1DBVO 1DAKA 1JFFA 4X7MA 1CQWA 4CKXA 3TLGB 1J8QA 1IAVA 3E22A 2Q5FA 1XQ9A 3JAMA 1O97D 1E9BA 3RC9A 4IWXA 2Y71A 1JZTA 2DPIA 4D8WA 4YP6A 4B5KA 1T3LA 2POCA 1OIWA 4R1UA 2H7XA 5MN6A 1RHJA 2NT4A 4A3SA 4ZVKA 1KYZA 4JSRA 5FBWB 5IN5A 2IYLD 1PNOA 3UJNA 3THXA 4NBSA 4NAHA 4MPTA 1E94E 2BDTA 3FZNA 4Q7JB 4Z4QA 1CV2A 1NC3A 3TW6A 2XCIA 1XDGA 2ZEJA 3OY7A 3TBFA 1FTSA 3ZWMA 1S2NA 2QGFA 1R10A 8ICOA 3UMYA 1C3JA 5CYGA 3FWPA 4G23A 3HO1A 2YYYA 2X7HA 4FBTA 3CB2A 5A5EA 2DQKA 1OD6A 3KHGA 2ATEA 3QVKA 4BNMA 1G20E 4EZ6A 2GFQA 2IYYA 1ZGGA 1H94A 5DRTA 2BSQA 4BZXA 3U4HA 4XM1A 1N3BA 2EKQA 3W06A 3ZLBA 1IXKA 2IUSA 5UKDA 5DHFA 4WD3A 3LZDA 1KY3A 4ZAVA 4PONA 4NZNA 4UXJA 4ACAA 3D8UA 4D42A 1H6DA 4EW3A 1YHNA 3VR4D 1D4AA 2WM9B 3NUGA 1ST2A 2WI8A 4TLLB 1NE2A 4KN9S 2GPAA 4TMVA 1E66A 5GV7A 4FFLA 3AX6A 3W5CA 1BYIA 3DPIA 1OU0A 4YMIA 2FH5B 2G06A 2G0NA 2OFPA 5HF5A 4URHA 5B7GA 1Q22A 5ALYA 5A9SA 4DR7B 4AROA 4D74A 1U3GA 3T79A 1QRSA 2Y66A 4KODA 4RQ0A 2YTZA 2OCKA 5A5VA 1R5OA 3CR8A 3SBXA 2XLBA 1JKJB 1XAGA 2ZG6A 3O4HA 3TSWA 5GONF 4YT8A 4OQ4A 4JSTA 4JB2A 3WIUA 1KL9A 5K5EA 2CLEB 3TQQA 4MGYR 4DFDA 1X80B 2FFJA 3PEEA 3R6WA 1BH2A 4JCCA 4OQZA 3L0CA 3UAVA 4RENA 4X8OA 2H9IA 4RABA 5TMPA 3KSMA 2O0KA 4OKNA 2JH3A 5J4KA 1LI5A 3ROMA 3HP6A 2EQ5A 1Q0TA 2Z8YM 2GPNA 1VE9A 4OLJA 2YJ4A 2WV9A 4GI2A 4XX0B 4CMJA 3RF9A 2Q0QA 3CZMA 4JLMA 1BHJA 2GAIA 3A06A 3JQ8A 2PBFA 4O3FA 2XA1A 4YFYA 2IXAA 3A9CA 3JR7A 1FLAA 5TQ0B 1XHEA 3QPVA 4PGMA 4Q7EA 3IUNA 4WXPA 2GKSA 3AUUA 3RSHA 3NPMA 1T43A 4X3CA 3M33A 1RPLA 4A0QA 4D3ZA 5F21A 3H2ZA 3TQHA 5BOSA 2A1UA 2GT1A 3O4FA 3W3AA 1B7GO 1CRXA 1WPQA 1ZH4A 2QTFA 3ZQKA 1SC6A 4P0QB 3W5SA 3WQQA 4EQZA 1V9LA 1NKCA 4K6OA 2OP1A 1MAVA 2P9TA 2MMGA 3A6KA 4RS3A 3EJ6A 3LY5A 4WN9A 3S2FA 3T4PA 3Q7EA 3K1JA 3RYCA 2ZJYA 1BVUA 2DBVO 1PIWA 2FMSA 3ZJ5A 3ENQA 2XMRA 1I9GA 3S28A 5DXJA 3V6JA 1R00A 4NMHA 5IRCD 1ZLXA 3DKIA 1X66A 4BZWA 1VG0B 4ODIA 4MUJA 1AO3A 3D59A 3CH6A 4EZIA 1VHQA 2CD9A 1ZX1A 3O7WA 3J80A 3OOEA 5L45A 4MLCA 9ICAA 3K9WA 5DP1A 3O9MA 2F2AB 1E4VA 2ZYSA 5J9FA 3QU5A 4P80A 1KDOA 1UJ5A 5IW8A 3KE8A 5BN1A 4FJ2A 2YKGA 3VA7A 4ZDIA 1P31A 3V4PB 1EK6A 4AUMA 4KXFB 1NXOA 4DMFA 1TW3A 1V95A 3P9NA 1QVVA 4Y2SA 1WV1A 2WILA 3PUHA 1NU8A 1Z07A 1XVLA 1GPJA 3LVQE 1W47A 5B66U 1RS0A 4KIGA 1ACMA 1N2GA 3FCXA 5TISU 3O0FA 2EDAA 2MUTB 1AROP 4ZEXA 5KSWB 4XTCS 5AK5A 3LK7A 5B53A 1KDPA 1L7QA 2DR0A 4EGJA 5K6TA 4OCZA 2G7ZA 5DQHA 4PX5A 3Q5GA 3A4YA 2C03A 5IM4F 4IIDA 1AH2A 2OY0A 1GITA 3H5IA 2OGUA 4ZI3A 4GVPA 4Q37A 2OMKA 5DWVA 4DG8A 3OOJA 2A7XA 3BTUA 3LFTA 4EK9A 1QC5B 3T5MA 4HNTA 4WWHA 4BVGA 2OB2A 3WYCA 5CNJA 5IT0A 2LKYA 4NL9A 1HNZB 3TFOA 1HIWA 4R7GA 4ZHSA 4NH4A 4R01A 4BV8A 4EDFA 3OETA 1KI3A 1GG8A 1G21A 1Y5IA 4MWZA 5F76A 4JITA 1IHOA 1MG0A 2WG0A 4PQGA 1F4PA 4AZ0A 3RRNA 2ZKIA 4MJXA 3H7AA 2QXTA 1SG0A 4XPZA 4IGFA 1Z4LA 3KCQA 3MUEA 3TQCA 1UODA 1XZAA 3S29A 1MW8X 3N87A 1IM2A 3FPEA 4PL1A 3LL7A 1ILWA 4LWOA 2LI6A 2VL7A 4LSMA 4L5YA 4QQRA 3E7WA 3QWHA 4JR0A 1C2YA 1P2SA 4EHLA 3I9KA 3NHAA 4UPEA 1RKVA 5A62A 3KL4A 1SNYA 4LQ4A 2EG9A 3M1AA 3DB2A 3VHXA 4YMWA 4AJIA 2HAEA 3BH7A 3CZQA 2JVKA 3AEYA 4IH1A 1QYXA 3WKCA 1B3BA 5EZYA 2BMJA 4WK6A 4C0JA 1ZL2A 5B1HA 1H0RA 1HE5A 2JKVA 5AW9A 2A4MA 1KJNA</