2G07A

X-ray structure of mouse pyrimidine 5'-nucleotidase type 1, phospho-enzyme intermediate analog with beryllium fluoride
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
290
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITFDMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of pyrimidine 5'-nucleotidase type 1. Insight into mechanism of action and inhibition during lead poisoning.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Cytosolic 5'-nucleotidase III
total genus 98
structure length 290
sequence length 291
chains with identical sequence B
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2006-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2g07A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2g07A01
4UU1A 2GHQA 4PNHA 3DNPA 1XVIA 3N8GA 5AI8A 3ONNA 3QUCA 5AKYA 4DFDA 4NFLA 2YMPA 4YCNA 5ALVA 2Q4TA 3WGUA 2G07A 2G80A 3L1VA 3ZTWA 4Y2XA 3WKCA 3IB6A 5ALJA 2HHLA 4UMEA 1CQZA 3KOOA 4L6CA 1YS9A 3WK7A 1VJRA 3PGLA 4CF4A 1YJ5A 2P69A 4UM5A 3RFUA 1ZD4A 5ALWA 5AESA 2C8LA 3KC2A 2WF7A 5AI4A 1ZOLA 2W11A 1Z4IA 2IYEA 3QX7A 2I7DA 3AR7A 4MUMA 5ALDA 5AVUA 3E81A 3DV9A 1TE2A 5AW1A 1Q92A 1SWWA 4MWOA 2OBBA 2EARA 5AIBA 3EPRA 2HF2A 3L8EA 1S8OA 1QQ5A 1N9KA 2I34A 5JJBA 5AW0A 1QH9A 4YGYA 3FGOA 5AM1A 4Y2PA 1Z4PX 4E88A 2MU1A 3E84A 1L7MA 1TA0A 3EF0A 3WK5A 5AVSA 5AVYA 2FEAA 5AKIA 1VJ5A 1U02A 4NWIA 4GIBA 2RBKA 5AK4A 1L8LA 3ZUPA 4RETA 4HGOA 3NAMA 3QLEA 2HSZA 3AR4A 3OTQA 4IG4A 4UAVA 5AM0A 1U7OA 5ALFA 3MN1A 4ZEXA 3AR2A 3L8HA 3NRJA 4CF5A 1Z4QA 1J97A 3B9BA 1AQ6A 5ALUA 3WK8A 1TJ5A 1O08A 2QYHA 3BWVA 3KD3A 3SMVA 2OM6A 3AR5A 4ZEWA 3KZXA 4UW9A 3IJ5A 1RQNA 5ALTA 4Y3UA 4BNDB 3UMBA 1L7OA 5A3RA 2FPWA 4NV0A 4YIKA 4IFTA 3OCUA 3R09A 2QLTA 1QQ7A 2I55A 1Z4MA 3ZVLA 4GXTA 4G63A 3A1DA 2ZBEA 3N07A 2FPXA 4Y2SA 4UAUA 4YCMA 3R9KA 2P9JA 1NF2A 2NYVA 4OHFA 4BEWA 2JAOA 2AH5A 4KX3A 2YMMA 4FYPA 4HYTA 2HX1A 2ODAA 3ESQA 2BDEA 4BKMA 5AK3A 2OYCA 5AHXA 1RLOA 3WK6A 3MMZA 3A3YA 1WZCA 2G09A 3N5KA 3SLRA 2YJ6A 3OCVA 5AKEA 3B8EA 2HDOA 2AGVA 5AI0A 1L8OA 2FUEA 1MH9A 1EK1A 3IRUA 5AVQA 3L0YA 1QYIA 3M9LA 3RF6A 1JUDA 3NALA 3QGMA 1ZD3A 1EK2A 3ZI4A 4KN8A 2P11A 1TJ3A 1NRWA 2AUTA 2I6XA 1IWOA 1RLTA 2JARA 3U19A 2CN1A 3OCZA 3ET4A 3OCWA 3NIWA 4Y2QA 2FDRA 5AKGA 4Y2TA 2B8JA 4EEKA 1WVIA 3DDHA 2P27A 2FPRA 1T9ZA 5ALLA 2IA5A 1RC8A 4DW8A 3CNHA 1L7NA 1LTQA 5AI9A 3WK9A 1RKQA 4XOUA 3FVVA 5ALIA 1U2TA 2O2XA 3WKAA 5ALYA 3ZVNA 1RDFA 2MSNA 3SD7A 2B1QA 5AW4A 4EZEA 2YFYA 2W4MA 4Y2RA 3ZW7A 2W43A 3U26A 4UMVA 5AW2A 1XP5A 2HF7A 3U7GA 2IOFK 3AR6A 3SF0A 4JDPA 2X4DA 2I33A 2JAUA 5AM3A 1X42A 4EELA 3EF1A 2YJ5A 3L0BA 5AI5A 4BYGA 2ZXEA 3NANA 2R8ZA 2ZBGA 2YMLA 2YJ3A 1RMTA 3NASA 3A1CA 2HO4A 1RKVA 1RRCA 4BX2A 2CFRA 5AKHA 3QUBA 5AVRA 2R8EA 5AKXA 2B82A 1QQ6A 4YCLA 2O9JA 3W5AA 2C4NA 2YY6A 2G08A 4UASA 3W5BA 1RMYA 4J2TA 3U7FB 2BDUA 4UATA 4AP9A 5AW8A 4L57A 1KYTA 3WKBA 3MC1A 1F5SA 2JAWA 2DQSA 3I6BA 5AVXA 1ZD2P 3B9RA 3D6JA 1T5TA 3HYCA 2G06A 2OA0A 1Z5UA 4CE6A 2EATA 2WFAA 5E0OA 2WF5A 4HAIA 2NO5A 4F72A 2PR7A 5ALMA 3A1EA 4Y2YA 1WPGA 2FPUA 2VKQA 3I28A 2GMWA 5AVVA 3U7HB 1TJ4A 3ZWKA 5ALNA 3L1UA 2GHTA 2D2VA 5AICA 3TLMA 1SU4A 4C4SA 1YV9A 1RLMA 3OPXA 4RESA 5AW6A 4HGNA 5ALKA 1Q91A 4C4RA 4H1WA 3MPOA 4UARA 2B8EA 1U7PA 3QU5A 3QNMA 4KNVA 1RKUA 5AVZA 5AM4A 3QU9A 2YJ4A 3QU7A 3ZWDA 1XPJA 5ALZA 1NNLA 2ZBDA 2PQ0A 2WF6A 5AKKA 4ZEVA 4I9FA 2C88A 3I76A 3PDWA 4YIHA 2GO7A 3HLTA 4OFZA 3QXGA 4HGPA 5ALGA 5AW9A 3ZU6A 4O8CA 2Q4RA 4NAVA 5ALSA 4YH1A 1Z4NA 2WF9A 3M1YA 5ALHA 3VAYA 3FPBA 4QQFA 2AMYA 2CFTA 5AKJA 3SHQA 3ZX4A 5AKLA 5AK6A 5AI6A 2HOQA 2CFSA 1YMQA 4FFDA 4Y2UA 3WK4A 2BY4A 3I1YA 3OCXA 5ALPA 4AS3A 1ZD5A 3U7EB 5AVWA 2R8XA 3DAOA 2RARA 5AW3A 2IOHA 2NO4A 1RMQA 2I54A 2WF8A 3L7YA 3SKXA 2YN4A 4KNWA 4FE3A 3E58A 2EAUA 3KBBA 2HEGA 1FEZA 4UU0A 1WR8A 1CR6A 5A3QA 5AK5A 3NUQA 1Z5GA 3UMGA 3N1UA 4UMDA 1Z4LA 3WGVA 4NABA 3L0CA 5ALEA 5ALXA 1N8NA 2RAVA 5AKZA 4BX0A 4KYTA 3AR3A 4F71A 2FPSA 2B30A 2PKEA 3AR9A 3KDPA 4UM7A 2JGAA 3F9RA 1ZRMA 4DWOA 5IT4A 2Q5EA 3FM9A 3QU4A 2ZOSA 5AM5A 1SWVA 5A3SA 1ZJJA 1Z4KA 5FP0A 4Y2VA 1ZRNA 1PW5A 3ED5A 4J03A 1Z88A 2HI0A 4BBJA 4OD0A 3PCTA 5IT0A 4G9BA 4XPZA 3N28A 1ZS9A 3K1ZA 1L6RA 2RB5A 1Y8AA 1K1EA 3L5KA 4OCZA 4XQ0A 2B1RA 3QYPA 4BNDA 3QUQA 1VFPA 3R4CA 4JB3A 4KX5A 2C9MA 2GFHA 1U2SA 2WHEA 4B6JA 3W5DA 1RQLA 1RPZA 2G1AA 1LVHA 5ALQA 2WM8A 2ZG6A 5AW5A 1J8DA 3AR8A 1Z4JA 3ZVMA 2C8KA 3BA6A 5ALRA 1L7PA 1O03A 1YDFA 4HGRA 4EENA 3WKEA 4BX3A 2YBDA 4EX7A 4UMFA 3S6JA 4Y2JA 5AIAA 2R8YA 3UM9A 5AVTA 4DCCA 3UMCA 1T5SA 4HGQA 3U13A 3J7TA 3SKYA 4C4TA 3GYGA 5T41A 4CNQA 3P96A 3EWIA 2G0AA 3PGVA 5ALOA 3ESRA 3ZX5A 5IS2A 5AM2A 1Z4OA 3QU2A 4I9GA 2FUCA 3FZQA 4EX6A 4XE5A 2HCFA 2FI1A 3QUTA 4QJBA 4BEVA 2B0CA 3L8GA 3CZ4A 4L6AA 3OCYA 2IOFA 1S2OA 3W5CA 3WKDA 3ZTYA 4AS2A 3FPSA 3ET5A 4CF3A 2ZBFA 5AW7A 1YNSA 3L8FA 3E8MA 2YMQA
chains in the Genus database with same CATH superfamily
3LKVA 4GC5A 3FMOB 4XJXA 3TB6A 2GHQA 2YTZA 4P2GA 5K0JA 1FFWA 2J3KA 4PX5A 4KTQA 2ZSAA 5HR6A 1NJ2A 1BW9B 3JPNA 1YONA 2ZIEA 3U3KA 3ZEIA 4BAZA 4A8EA 4DDHA 4K3VA 1V3VA 3HBAA 5L51A 5AKYA 2OKCA 5TV2A 5KUTA 3SHOA 9ICEA 4ESHA 5TQJA 3AVXA 4BPRA 1ZQWA 1L5QA 3KEMA 1IVNA 3EISA 3K32A 1GZ6A 3M1AA 4LTNA 4JB0A 3PIIA 3D6UA 2YVQA 3QWHA 5FNZA 5D5HA 2WZCA 3L0IB 2N1MA 1WZUA 3VDMA 1L4HA 1H6DA 3BXFA 6AT1A 3JRWA 1A4RA 4J49A 4YN3A 4DFJA 2D5AA 4FFRA 4FHFA 1YJ5A 2Y76A 4OLAA 1SZJG 1KJIA 4RNMA 4OJYA 4PEVA 4BWJA 1E94E 1VC2A 1W0KD 4REOA 3DKPA 1XJ0A 3K2EA 3TLZA 4RTMA 3NDBB 1H2XA 2ZVPX 2W8ZA 3R7FA 2BQUA 3I34X 2J3DA 2VT3A 1O0SA 3AY0A 3RJMA 4YX9A 2VCEA 1QE3A 5D1HA 1GYQA 4I2BA 4FZNA 1AZLA 1Z36A 5HUQA 2GO1A 4QHYA 4EA9A 1Y9ZA 3DE7X 5DHSA 1Q92A 4TN1A 5GONA 4WCFB 1UWKA 3F5FA 3GXBA 1GG2A 4MWOA 2IBTA 2EARA 2XWSA 2KHVA 2RD2A 1D04A 4B7XA 2I34A 2XIQA 3I64A 3ABQB 2QNIA 3A14A 4CU5A 3K15A 1NGSA 2VYVA 1U65A 4C7MA 3DWEX 2QP3A 5FDFA 1SQ5A 1WX1A 3GEMA 4FZJA 3PO4A 5KNCH 1N92A 1B3RA 2LRHA 4O3OA 3AEVA 2WAAA 2COEA 2MU1A 5E0KB 1QV9A 1NF8A 1AKEA 1JIQA 2H9AA 3ZNOA 5C8DA 1GRRA 1J2YA 1XTKA 1ZISA 1UJBA 2OBMA 4HWKA 4ZAXA 1DG1G 1VJ1A 2DTXA 1V7PC 4ZT5A 1YO6A 2DG2A 4TKMA 1P9RA 5BSHA 5KAFU 4JT9A 4JYMA 4C9BA 4ZGBA 4NWIA 3TFRA 1SUAA 4YO7A 2XE8A 2R1TB 2C3YA 2R6DA 4MFAA 1BWPA 4IFBA 1DO2A 1QIKA 3ZXUB 5H9VA 4B4UA 1QAOA 2VP5A 2ZJOA 3ROQA 4GLXA 4V0RA 3OTQA 4EYGA 3ASVA 3JQQA 2BEVA 5B53A 4LSWA 2RK3A 5DRYA 2FB9A 4Q4AA 1DTSA 8ICCA 3AR2A 1C7RA 1XP8A 3GV0A 2PCLA 9ICVA 2YWHA 4YMIA 5F9MA 1DNPA 2PMCA 2CCGA 5FLXA 2ZJ2A 1G63A 4G81A 4QELA 1RRCA 1C7IA 1G4HA 4C5CA 5M34A 3QBJA 3QV1A 2XHZA 1W76A 2BM9A 1O08A 2REXB 1DKLA 2A33A 1L8AA 4TT8A 1E0SA 4ZOLA 2VA9A 3LP5A 1R15A 1SCBA 1NR1A 1JVSA 1S6YA 1COOA 4GGOA 4L5IA 3AKCA 4UC0A 3U48A 2X19A 3O4VA 3G79A 3ADDA 1T5IA 4D80A 4NV0A 1QLHA 2EOAA 2YX1A 4OSOA 2HWKA 4YIKA 3RH5A 4OHWA 1W1WA 4DB4A 1DIGA 3AEKB 2FMFA 1UFQA 2VATA 1XD2A 4CMKA 5F2KA 2IX3A 1LC3A 2I55A 2WMYA 3DTYA 4V02A 4UEKA 3B60A 1EQUA 1BPBA 1A50B 1WQ1R 2FP4A 4BMPB 3EPGA 2PGAA 2FEWB 3P9SA 4I66A 4GKKB 4E70A 1S97A 1GOTA 2Y05A 2ZJ8A 3DBHA 3B78A 3S99A 1ZM7A 1BYUA 4Q9JA 1JN3A 3QEAZ 3SCZA 3V1YA 3VR1A 3VU1A 3ZBPA 3C1YA 3MNFA 4OXQA 5FUQA 5KTPA 1T2NA 2FE4A 2GNOA 2BSAA 4R2MA 3P9NA 4WN9B 5MGBA 2JGRA 1M8KA 1Q0SA 1XZEA 2G88A 4P4LA 1HX7A 3Q8LA 2B2CA 5BRAA 1GSAA 4FS2A 2DPHA 1W4ZA 4KLFA 2DRIA 4FUTA 1Z9BA 4DLBA 4ESEA 2I1VB 3LP6A 3L6OO 1FSPA 2GRJA 1IBKB 1LI4A 3IALA 2BKXA 4K40A 2OILA 3WGLA 3NAGA 1GZ7A 1LWOA 1QS0A 2FWIA 2QLFA 2CNKA 2UVPB 1A9XB 3B6EA 4Z86A 1QO0A 3I37X 5BOMA 2A0YA 5FPTA 4RW0A 4RQ7A 3FHTA 1RAHA 2PQMA 4DMUB 4H0FA 1VCOA 1TT5B 5DNCA 2WJGA 2F1HA 1Y4DE 2BMJA 5AHXA 2WR8A 3GAAA 1ENPA 2H16A 3PHHA 4FDLA 2E5LB 1WQ4A 2VJ4A 3PY8A 2VQFB 1DAPA 2F3UA 4IDPA 1M6VA 5FI5A 2CMHA 4INOA 1J90A 2RHGB 2DGZA 4TQSA 5KFOA 2Z56A 4QT0A 5FT9A 2R8HA 1XLTA 3ORHA 4MCAA 4MQ5A 4ZU3A 1P72A 4ITUA 2KQUA 4X1YB 2WB4A 2FF7A 2Z3ZA 1ZH0A 4F5OA 4BJQA 4ZAYA 2O0HA 4DLNA 1PN3A 1XHEA 2W2TA 1ZP6A 1PQUA 3DZGA 2WTFA 3MGVA 2FR8C 3IMKA 2QTBA 3OD5A 3RF6A 3G2LA 3MWJA 3SS9X 3UF0A 4RTOA 1WP4A 1M6VB 1BX0A 1YWGO 3CLVA 2VCHA 3M3HA 3WGNA 1NRWA 2EWVA 2DH5A 1NK8A 3I05A 4ISBA 3RS7A 3RUFA 2QZPA 4ZK6A 3IEIA 2CN1A 1HLFA 3BJYA 3OCZA 5LIPA 4BMZA 3JR7A 2B0JA 2D6FA 4V1CI 4NRDA 1JWAB 5AK0A 1V1RB 3JZMA 4DSIA 1NWCA 2XY4A 4KQ2A 4X6XA 3NHMA 4NPHA 1KE2A 4DW8A 3ZDEA 2P2ZA 1HTTA 3ILHA 4E08A 2G67A 3H1AA 1EA7A 3B3AA 4TLCA 1LTQA 1S0UA 4GDMA 4MEXA 4O5KA 1JW9B 4D79A 4K2HA 3BCUA 3FPEA 4AY3A 4ETNA 1T0JB 2H52A 2ZSIA 5H8WA 1ULAA 3KKNA 1M2FA 1Y89A 2K4IA 1KFEB 4EZEA 1TCAA 5IAKA 3TAXA 3NYIA 3DVQX 1U2RA 5DT2A 4DCMA 1ECBA 2VDRB 3GH1A 4IM7A 1RZ3A 3QVTA 4I4IA 1M1XB 4UMVA 3RHTA 2Q7OE 5LYJB 1JFVA 1R0ZA 1HG0A 3VSEA 4AJ4A 3U7GA 1YT3A 1IPFA 3VVBA 1KI8A 3PEUA 2O3UA 4P0QB 1QNLA 1XXHE 2JKYA 2OR3A 4RFLA 2I33A 3T5TA 5B6IA 1LVUA 1F3LA 1N1DA 4YD1A 3AUJB 3AWDA 2VP0A 3LHDA 4GXNA 5HG0A 2PMZF 1D4AA 3VHQA 1KLNA 2EEZA 1JAZA 2RMKA 3KCNA 3F2DA 4OLJA 2V7XA 1NKEA 4N4AA 5SICE 2YJ3A 1HT2E 4MPDA 1QH1A 4WT7A 1WMFA 2FPLA 3GJ5A 1WU7A 2YUTA 1BE1A 1G4AE 1MIHA 1WMEA 2CFRA 1G8MA 1N3IA 1NQTA 3E23A 2PSFA 4QARA 3D54D 2YXBA 5A03A 5C0OE 3FCYA 3F2VA 4RCVA 3U37A 1AGPA 1FNSA 1SN7A 2IZ0A 1YQQA 4P3PA 3USES 2IMWP 4X1YA 1UK6A 1JDBB 2L69A 1EVIA 4BVJA 1A82A 2FR1A 3F2BA 2NTYC 2M32A 4KLSA 1GRVA 2R8PA 4GQAA 1NVMB 4JWTA 4UZFA 4C2TA 2R11A 2IYNA 1U98A 1KS9A 1OI4A 5HBRA 4L57A 4JENA 4F38A 2IF2A 4LRSB 1QK5A 4A5SA 4P53A 4XPIA 2RGYA 1M6EX 2GN4A 2YQ4A 4QU5A 4B4WA 5B1IA 3DZBA 5BVHA 3GILA 10MHA 2VLBA 4LZOA 2C82A 3CF6R 4BYMA 1W30A 3HKEA 1PFGA 3H8WA 4CWAA 4DRXA 2JLVA 3Q9LA 1JLSA 1FP4B 3S0JA 3HYCA 4CLOB 4F5DA 4GL2A 1ZXBA 2P41A 1O0BA 5CTAA 3C5WP 1VB5A 4EG1A 2V7GA 3NNDA 4OYLA 4RJLA 1KH3A 3UGQA 4CM9D 3PW2A 2B6NA 4CRWB 2ODNA 3NCHA 2BFEA 3SXPA 4EGAA 4B74A 4R9SA 4RVOA 1CS0B 2VJMA 3LT2A 2GMWA 3DAGA 3ONWA 4KBGA 2ISSD 5E4JA 3BEDA 4D4GA 1OX5A 4WWHA 2VHTA 5ECGC 5ALNA 4KXYA 3KVRA 4Q66C 4GPAA 1V9SA 4UE2A 4BUGA 1AXGA 4R8MA 1PJQA 1DRVA 2R7KA 1YJ8A 2VDJA 1X1SA 3EUWA 3WLEA 4X65B 4C4SA 2JG3A 1C8KA 1K68A 2GEJA 1WCNA 2OZVA 4WSOA 4NG5A 1KN5A 4I4CA 4JA0A 4HGNA 1SGGA 4Q9NA 4BMNA 4QM6A 3GFRA 4GLOA 3AVTA 3WXBA 5BWBA 2BFOA 3BMOB 1Z39A 2PKCA 5GZ1A 1QXSA 5CG1A 3JTMA 4BO5A 4BWMA 1JQJC 5D6NA 2PUWA 1KFSA 2ORWA 1NY5A 4L85A 3NOXA 1TK3A 2DETA 5HQ3B 8ATCA 5DJ5A 1XYVA 1DAHA 1SBYA 1RYZA 2WF6A 2FAXA 4GFJA 2E4YA 2PSHA 2ZBDA 3H3XA 4TVKA 2DKFA 3PEFA 3D7NA 4ROTA 1FFSA 5C7IO 1EB8A 3BCHA 3UMFA 4YJ2A 3PEVA 3A1WA 3L93A 4KWHA 3QELB 4ZI3A 2HQRA 4JQOA 7ICFA 4H7PA 3FFTA 4RQ6A 4AMVA 1KEVA 4HNUA 1ITZA 4OQYA 3IQGX 4RFSA 3LK6A 3GLHB 3GGGA 3JQ6A 1WOYA 3FTCA 1JQAA 3L43A 3X0DA 4L8GA 1UINA 3N8KA 1XF1A 4FGWA 1QC5A 3TI9A 1JH9A 3AVWA 3PEYA 1CRXA 5IIIA 5EKXA 1IWBB 2PUJA 4HDKB 3L84A 1Y33E 4D9EA 4RFVA 5KJ6A 4HWRA 4DKXA 2IYAA 5HCUA 1ZVMA 4TURA 721PA 5H3HA 3IHQB 3H0RB 3SZGA 1QF7A 1MHPA 2CFTA 4DAEA 2OCXA 3EA5A 3K71B 1E98A 1HDOA 1IBMB 5AK6A 1IY0A 2I99A 3X1XA 3FRJA 1OFUA 1JHDA 5F7ZA 1RI1A 3GQBA 3OEYA 5EIBC 3AERA 4EI9A 4DDUA 3DF9A 3OG9A 4DDMA 3FSRA 1DJPA 2GWHA 5KQMA 1I7DA 4W1QA 3SYZA 3EVNA 4JC0A 3WISA 3DL7A 5DYWA 4H3SA 1CYDA 3ZXIA 1P7ZA 1I14A 3IFSA 3SC2A 3WQRA 4R2XA 1M7GA 1LRKA 1L4YA 2QE7A 3HCFA 5AVWA 2AZMA 4G0XA 4K3UA 1R6TA 4C0HA 4GWLA 1GD1O 4NONA 1OZHA 2F90A 2J3IA 4A8JA 2IBKA 1QTQA 1K0UA 3NHUA 3CUEF 1IJEA 3RNLA 3QFSA 4ALMA 1ZM4A 4HVAA 4MV6A 1SUSA 3LOQA 4Q15A 5F1KA 4AY6A 5K4LA 4QZHA 2J6HA 4IRMA 2D1YA 1IZ9A 4DCNA 5IVPA 1V97A 4ECYA 5DBIA 3UANA 3G17A 1QRRA 1Y48E 4L28A 1F51E 3B13B 5JUWA 2CD9A 2JCBA 3EIQA 1IG6A 3S2UA 2YS7A 1GUZA 3K5IA 1O6BA 2GBPA 4CMAA 1TIBA 3BXHA 2ECQA 1B23P 1T1IA 3NNSA 3DTVB 3BAZA 4WBNF 1J5EB 4XFJA 4G5SA 2FWNA 1NJ6A 4KREA 2FPSA 3H2GA 1XV5A 3URMA 3ZNNA 2ZRGA 3KJHA 4ELTA 4KR9A 5KT3A 2QN9A 3E2PA 3H4DA 2O2ZA 4WJKB 2VDWA 1EFLA 1DJNA 4DWOA 4FR0A 2PGXA 4GUAA 4L2IB 1PEYA 3RGGA 4DG8A 1KH2A 3AHHA 3GBVA 3K1JA 4FB4A 3MJSA 1XU4A 4IHJA 1C4XA 4Q7LA 1BVUA 5CNMA 3N7TA 2Z2YA 4BCCA 1PL7A 4QGFA 1N2XA 1A6SA 4UUQA 4AG3A 3HEMA 5FEMA 3T0GA 1WUHS 1UPBA 1QORA 1YRHA 1I7PA 1X77A 4GUDA 2C4VA 4QUJA 2Q5JA 1KDZA 3BM5A 4IGEA 1Z1VA 4JJ8A 2LV8A 3C15C 1M6YA 1JR3A 3E82A 4JUIA 5JYBA 3NV9A 2JV3A 4M49A 4G9GA 1K06A 1MHTA 2B37A 3G59A 2W8KA 3MS2A 3AQEA 1XBTA 3TQIA 1PWZA 1ZA2A 9ICOA 2VK8A 3CNBA 3ESXA 4OFXA 4X8OA 5DNDA 2EANA 3ESYA 1UBJS 1BRMA 3HJHA 2JEYA 4GU5A 1ST3A 5CA0B 3F6RA 2DUUA 1DKPA 1IMOA 1SKYB 5L6MB 1HZZA 3ZVMA 1ODSA 4FT4A 4HT3B 4FHZA 3OP4A 2W9XA 4GOLD 4MUFA 1TYZA 1O5OA 2CW5A 4EENA 2NVBA 3B5EA 1ACLA 1CDOA 2C96A 3H9GA 2UZ0A 3O8OA 2EIHA 4LOHA 1KZHA 4I1PA 3COWA 3BFXA 5AVTA 4I1VA 4DCCA 4HB0A 3FE2A 4Q4HB 2Z08A 3UUEA 3MT0A 4U2GA 3SEIA 4X62B 5CVUA 1BOOA 2MR5A 1FDVA 4C4TA 3QNWA 2NO0A 3QH4A 1J8MF 3GFSA 5H3CA 4PJ0U 4F5QA 1Z1BA 1Y4SA 2WIBA 3VAZA 3LBIA 3VNAA 4BNJA 5LMUB 3THWB 3A4YA 3L6DA 1NMYA 5F4BA 4R64A 2EKPA 2QE7D 1XQWA 3O2JA 2X58A 3NT4A 5JDCA 2B98A 1E5QA 2O05A 1TL7C 2ZE7A 1J8FA 1U1IA 1T2VA 2C5BA 2B0CA 3CZ4A 3TOSA 3DFFA 5HR5A 621PA 2QF7A 1C5KA 1S01A 2G1KA 1N2BA 3F6EX 3DW3X 3R3VA 4MA4A 3V8MA 5JV5A 1J20A 3PLNA 2H3HA 5C5CA 4G1CA 5FULA 5F7XA 1X19A 2BL4A 1X66A 1T8WA 1OLUA 1Y1SA 5FHQA 5GIPE 2I91A 2B4TO 1V8DA 1BC5A 4Z9FA 1PGPA 1GTRA 3LDGA 1ECJA 1QBKC 1P9WA 2HLHA 3LF1A 4HDRB 5TPWA 5M04A 3DO8A 1EJBA 1P7YA 2BP7A 3HYSA 2X41A 2JCSA 1S2LA 1U1FA 8OHMA 1BNOA 4LVCA 5IVIA 2H1IA 2CSXA 3LX8A 1YOBA 2XOKA 3UUWA 2Q4TA 5GJCA 1D9XA 3HH8A 3LCJA 2VPIA 3AOEA 1B0AA 4U1RA 2M6LA 3C6BA 3DGEC 3F5MA 3GA5A 3GT4A 8ICWA 4N40A 4J0CA 2XECA 4HX9A 4YV2A 1U7TA 4A16A 3AFMA 1NE7A 1BSVA 3BSYA 4JVOA 3WK7A 4B6OA 2WYOA 3DJYA 1CJBA 3Q3GE 4J0DA 1WOMA 4RGBA 3W8DA 4KRGA 3PQEA 3C3AA 1BGVA 4N3NA 5J2TA 4B4VA 1M8FA 2ODTX 3H4MA 3SSMA 2QT9A 4BP8A 1ZXLA 4DNOA 5DFAA 1BU8A 4D96A 2GXUA 4DUYB 3PDHA 4FLMA 4ZOEA 5ALWA 1OB2A 2QW8A 4PZ9A 4QDXA 4B31A 4AUKA 1E7MA 1ZQ1A 3CC8A 2ACEA 2IYOA 2VAPA 1QKKA 3V8PA 3JCZA 2Y6UA 3ZBUA 3HC7A 1MX3A 3ZVRA 3GP8A 2W11A 1E7WA 2HD4A 3C8UA 1OXJA 3LWDA 4KAAA 2GWRA 2WD8A 4P54A 2JHFA 3O6VA 2PZ8A 4C6SA 3MCUA 5AVQA 2PMEA 1IL0A 2IW3A 4MS1B 1LF5A 5ALDA 1R10A 2OCBA 4N6GA 4YONB 4LE2A 1GKUB 1XVUA 3FC4A 3P20A 3JQ9C 3HGQA 2RAFA 3IPLA 1LQ2A 4FGJA 3VX3A 1U5AA 2EC5A 2FNAA 3M4XA 4WECA 4EY5A 1I1NA 3Q8WA 4O3MA 4WN9A 2ATLA 1DCFA 2C4TA 1S8OA 1ZIDA 3L8EA 4EJSA 1N6HA 1RJ9A 3IUSA 3MJTA 4OI0A 1WL8A 7ICRA 4DS5A 4TUYF 4FZRA 1HMYA 3HP1A 4MH0R 4WK0B 2EGUA 3AVPA 3HSYA 1R4ZA 3FGOA 4OUKX 1Z25A 2AG6A 4E12A 4ETIA 1JSLA 1ZCAA 2YDXA 3HFRA 1GZ3A 2X1HA 2XVYA 6LDHA 1DEKA 3WFZA 5K2MA 3TEFA 2VVTA 1L6IA 5T6MA 2ZU6A 1JHAA 4BOYA 4WKBA 3JQRA 4TROA 5AKIA 3IN5A 1WCV1 3KPUA 5B7NA 4WPGA 1YZYA 1UDRA 2OD2A 1KAGA 2TECE 3V6KA 1V96A 2KFZA 1G3UA 2GYUA 3OUUA 5K3FB 3BKWA 4DUGD 4UFPA 2O20A 2EJWA 1JIUA 1OTYA 1SUWA 4YQYA 5EIBD 1RBQA 4L5AA 5J47A 2QJFA 4EF6A 2HSZA 4WZAB 3VR6H 1M1YE 5FPQA 3RAPR 2H3VA 9ICKA 1HORA 1PVDA 4BBZA 4ZZ1A 1H5NA 7REQA 4QYMA 4GZMA 4J94A 4LZAA 2JH1A 2ZB3A 3I83A 1A97A 2VYND 3OESA 4KQGA 1G3RA 5F7JA 1XAHA 2NVOA 5JPIA 1QUFA 4QSHA 1UBLS 1L4KA 2NXJA 4A91A 1ZVJA 4BNYA 4D0NA 5J8YC 3OIGA 3N6RA 5DDIP 4UHEA 5FR1A 5CEFA 3CUVA 3UNXA 3T79A 2DQYA 4PSCA 3R3JA 4W5JA 5ALUA 5EWJA 3TZKA 2ZUEA 4YRCA 1Z28A 2DFPA 1O5TA 2OM6A 2GK7A 4EY7A 3VPGA 4XB6B 2SCUB 4IDQA 1VJ0A 3AUKA 1X9WA 5DHRA 4GEKA 5DKWA 4Y3UA 2IV7A 1NATA 4A23A 4YAGA 5B5SA 2OXRA 1CDZA 1EGAA 5D49A 2WSLA 1SXJB 3ZHCA 3ZCVA 3MRTA 5KFAA 1U0OC 1J8QA 1I32A 1Y4AE 3OOJA 2QL9A 1NDQA 1FX0B 4ILKA 2CVFA 1QQ7A 3K0AA 3Q98A 5C1PA 1FK8A 3V72A 1IG3A 1KKXA 1YRWA 2J4CA 3EG9A 5KDDA 1NUHA 1MSWD 1AD2A 2YXDA 3I09A 2BFMA 4EYHB 2ZSHA 1L2TA 1KR5A 3AO0B 2I5PO 5FTKA 4CRXA 2EU8A 2PH7A 2PJUA 2C2DA 4W7HA 1CUIA 4Y2SA 4CIVA 5DB6A 1R74A 3CLRC 3WYGA 1C2YA 4B8WA 1RYEA 3OPYB 5IG2A 1U8EA 2QZJA 2I9GA 1U8AA 3HNRA 1GYRA 1TQHA 4J7CA 4ZYVA 2FE1A 4KO3S 5CR9A 1DBWA 5JVDB 5JAPA 4M1SA 2XKKA 2JHAA 5FH9A 2W9BB 2P9EA 2X7XA 3JSXA 4NBSA 4YXMA 3UQ0A 1I10A 1KIFA 3I6ZA 3PFFA 3K94A 4FHDA 2YHSA 2ZAYA 3GT7A 2YMMA 1RRKA 2GX6A 2UZ1B 2ZE8A 3AUAA 2HX1A 2PA0A 1GFWA 4FOOA 3B36A 4I1SA 2AU0A 2V54A 3D6FA 3UG6A 1DIAA 1N5KA 4WCFC 3VDQA 4JI8B 4EYIB 3H84A 2EV9A 3T9AA 1XQ9A 5I7SA 4PRKA 1WPRA 3A4NA 3GP3A 1DG3A 4JDUA 4WZBB 1WZCA 1ZK1A 2ECKA 4FYKA 1QSYA 4H0NA 2H1CA 2BI8A 1C8VB 2DQZA 3KIPA 4MIYA 9ATCA 3KOYA 4CMIB 3WYFA 1MIOA 4IWYA 4CV0A 1U8UA 5KZMB 2JS7A 1RYYA 1MH9A 1OFTA 1W46A 2BM8A 1JU4A 1VE1A 2HHQA 1NV8A 2QLLA 2VNSA 3ZDXB 5IUNC 3EZNA 1TVKA 2P2CA 3GLRA 3N7PD 3M9LA 1EVEA 4JL6A 4O4HF 4P0TA 3P9KA 1NOMA 4B3RB 1M83A 2ILTA 3ZI4A 2CJXA 2C61A 3LQFA 3ZK8A 4F5ZA 4X1IB 4FW9A 4QDTA 4TYQA 4QZFA 4HH0A 4YRJA 4GT1A 2AUTA 3PUKA 4E03A 1RLTA 1VPLA 1XRMA 4UAWA 1RXWA 2J3HA 3CN7A 5GP1A 3UGKA 1TDJA 4EGCB 5CVJA 4PAQA 3JQ9A 2C8VA 3WC4A 4YXFA 3K0SA 1U3WA 1IY1A 3VZQA 4OI2A 4MVJP 1VECA 3KAJA 1KQOA 4FGLA 3VH1A 2C9CA 3M49A 3UJCA 3L0SA 5DDMA 4YAUA 1CB0A 1UHUA 1RC8A 3MMPA 3VV3A 5F3WB 2AEMA 3C1AA 4V3BA 1FPMA 3RQIA 2R6ZA 1S3IA 1F4LA 4OQDA 4IP0A 1XD8A 3MFIA 1Z6XA 4RE6A 3OF2A 1WMDA 2G5HB 1PZFA 1JZQA 1T5HX 4IQ4A 1R4NB 4KMMA 3T3OA 1FVHA 4C4PA 4I5DA 2LDXA 5CFOA 5DP2A 2DKZA 4LPKA 1KVTA 2VA2A 1Z68A 1YIOA 3OY2A 4M7OA 1SURA 4X3CA 1YGPA 2AQ8A 4DY4A 1YAJA 1ISJA 3CG4A 4MXDA 4DA0A 3CKMA 2JATA 1A76A 2R79A 3OQJA 4A8PA 4CJXA 1V7QA 2VJKA 3AOEC 3DFKA 4BTLA 1E2UA 4V3CA 1OI2A 2PH5A 3JQEA 1GDDA 1OZAA 1IRIA 4P33A 3GHHA 1X6JA 4KSYA 1WCIB 3VSAA 2R8ZA 3HHPA 1Z22A 5BNZA 2MYTA 1P2TA 1XZFA 4EJ2A 1Q2UA 4DR5B 3F9IA 1TEZA 1G8FA 4BLUA 4D9BA 3EIHA 4U6PA 3FPLA 5AJWA 2YWEA 4JBYA 3KB1A 4YVFA 1JKXA 1UP6A 2O5CA 1K7SN 1NFFA 1Y6JA 3QXXA 4RLFA 4IWXA 2NV6A 1DRWA 1BHSA 1L1FA 4BECA 3EFEA 5KYYA 2VDKB 3ID6C 2O8DA 5H5JA 2H4FA 3GDWA 1Y6ZA 3EPKA 1ZQDA 3L9WA 3M83A 1NY6A 1W25A 1ENOA 5JSKA 1VLLA 4ED8A 2PFKA 3BL8A 4QATA 2EW8A 3T3EA 4HZUA 3ZZUA 1KC1A 1UBCA 2Q0HA 3MRXA 4IIXA 3RFCA 1TUEA 2IEIA 2CVOA 3L02A 3QVOA 4PYKA 2KZ3A 4XA8A 2CFOA 2P4QA 1CUXA 4GPD1 4HPWA 4UEQA 5E6SA 2QRGA 3NBQA 4GD3Q 3VZRA 4ZHSA 1SVNA 3DOIA 3BF8A 3R6WA 2JFZA 4NYIQ 2JAWA 1I2AA 3GMTA 1V38A 3JVDA 4A8JB 1FW6A 4A15A 1EWQA 4KQIA 2HLDA 3KKAC 2YC4C 3ITKA 4KQ6A 4L0QA 2BGMA 4MRSA 1ZD2P 2IX9A 4GWGA 4AXXA 2PXAA 3NNNA 3OPNA 4QTYA 2HBQA 2R8OA 2JRLA 2KFNA 3ECAA 5AXAA 2ZROA 4KR7A 2J9GA 3W7BA 4QKQA 5AW8A 3VNQA 2IYWA 4EPRA 3OHAA 1GZDA 1W2HA 3K9CA 4RQ3A 1ATZA 5IC6A 2HBRA 1YRAA 4Y9UA 4HAIA 3QPCA 4MWGA 1KBZA 2X3FA 1X1QA 3BK2A 2E55A 2CL7X 2V9WA 1F6WA 3BMXA 2DVMA 2B4QA 3U31A 3OQIB 1WAMA 2PZEA 1XTVA 1C7ZA 3OTHA 4JXKA 2WOOA 2NXCA 4EY8A 5A06A 1CVIA 1Q46A 3F5AA 1WLYA 5GM1A 1BEUB 1UDAA 3SZOA 3NONA 2QT0A 4M7PA 1RYRA 4AX4A 1J70A 1GTG1 3GN2A 1TYBE 1OFIA 4MCHA 4OUDA 4B2YA 1BFUA 4JYZA 1J25A 4HDSB 2QQ0A 1PJ8A 1JTFA 4PFQA 1EUZA 1TRHA 3PNLA 3ZGOA 3AETA 4DQSA 1JV2B 1YZUA 3DM5A 3G1WA 1GG5A 3LVWA 3O3CA 4BNFA 5I9LA 4AO8A 2GYWA 2ROQA 2H18A 2XKBA 4RAQA 4RSMA 3QNMA 5CT4A 3HT3A 4D42A 1LKYA 4LJ5A 4YRQA 3AEUB 4PH5A 4ZI7A 1AE1A 1G8SA 1PL0A 1VLJA 2YJ4A 4FGUA 1NR7A 1O2DA 4GLLA 4XQCA 5ICEA 5IC4A 4XUGB 2Q2OA 4GVXA 4JR2A 1VFNA 2QVBA 5TR9A 1QGOA 4MRNA 4B8ZA 2Q4OA 2WFZA 1C8BA 3KKQA 3MW8A 3R40A 2OXTA 1MO3A 2XUDA 4U63A 5DM0A 5B66U 3SOZA 4IHAA 4ARSA 4BN4A 5CB1A 4HQOA 3HKZC 5C3MA 4ZA2A 3WDSA 3STWA 5B5EU 3KYJB 1P9LA 2EEPA 2XNCA 2HIAA 3P71T 1XDWA 2OCEA 4REQA 4MDYA 2O2DA 2BP7B 1TUGA 1W49A 1Y8RB 1ATIA 4DEYA 1KVSA 3A10A 1VJCA 3OOHA 4KXFB 3N58A 4G9EA 1KAMA 4O2AB 4OHXA 5D00A 3TN7A 4EIWA 1M9NA 2ORIA 2HKIA 2BEJA 3HILA 2WKRA 1X6VA 2X8JA 2VJLA 2XA9A 3B52X 3NHKA 3R74A 5A1TA 2PYZA 3TPZA 2A19A 1CQPA 2XVZA 2HWXA 4I1YA 4IRDA 4NHEA 1H4QA 4II3A 4UM9B 2F59A 3U1BA 5EJ4A 3ZKAA 2V4ZA 2VNHA 3M6FA 5HIJA 4JBLA 1V4VA 3V7WA 1UPAA 1DT3A 1T8EA 1RW4A 1I3NA 4TLDA 5B3AA 1E2NA 1W75A 5L4LA 1ADBA 3CJRA 1HSOA 1OY1A 2B61A 1NRIA 2EZ8A 2N42A 2WM9B 3AV0B 3HU2A 4P5EA 2CE2X 4WCVA 3PKJA 2PUEA 1JQKA 3FAHA 3MQ2A 3DHYA 3OCXA 1Y3FE 1Y42X 2OD9A 1BX3A 1A27A 4RY2A 4AKSA 2NTNA 4P08A 2FZ5A 4K4GA 1LI5A 1FUUA 1HG1A 2R8XA 4MS3A 3D4IA 1OXMA 4OJ5A 5IDYA 4F5YA 5FXMA 4ZXPA 2CZGA 1GZSA 1WXWA 3KKEA 3UXEA 2ZTEA 2Q6KA 3PF8A 3PYLA 4HRYA 1SUCA 1ZQ1C 4BX9C 5DBEX 3SMQA 3RJGA 2C2EA 1N61A 1WDKA 4MKHA 3F98A 2XQIA 4NEGA 4QULA 3WQBA 3X2SA 4RSRA 3FGNA 3PXCX 3KXKA 1AKWA 4LYDA 1NK9A 3RBXA 4DMLA 3Q5DA 1L5LA 1SL0A 2FUNB 3S2SA 1GGHA 1O94A 1WB6A 1JHRA 3OVMA 3AQIA 4LXTA 2QG6A 4MEJA 1CZUA 1HWYA 1OBFO 3BSFA 3E7XA 1CUEA 3VNBA 1Z0JA 3RRYA 1QHHA 3TIFA 1FVXA 4K4HA 2PKEA 1KYQA 1M0TA 1W88B 2B30A 2C1EA 3ETEA 1KI6A 4G8BA 4HD8A 4TL7A 2IWHA 1ABFA 4X64B 2OV6A 5JU6A 3L6BA 2I66A 3TARA 1I33A 3ILSA 1QG2A 1KEZA 1UZNA 2PX5A 4KVZA 4YMSA 2Q5EA 1P0PA 4QFDA 2JA1A 2FW7A 3E2IA 1OU4A 2GAAA 2XRZA 3ENWA 2C03A 1KA9H 1Z5OA 4A6PA 8LDHA 5J0TA 1QH8B 1PTJC 5F2OA 3IAM6 2ZJBA 4RQMA 3VTFA 3KU1A 4JWKA 4WHMA 1A5ZA 1OWNA 2DKXA 2IHKA 1E0DA 3GRFA 2XF8A 4K1LA 4W5WA 3ISJA 3STUA 3BJEA 3T9EA 1UXHA 4M9JA 3EASA 3SYLA 1DFGA 1FDTA 2XI4A 1TZKA 4PTZA 3UV6A 3H9JA 4AN0A 2QTCA 4U2BA 4ED9A 1V11B 5YASA 3E9EA 4GE0A 1PZGA 5FTWA 2F3NA 1ICIA 1WCLA 3A6DA 3SYKA 2Y1JA 3HHEA 3R0VA 1VFPA 4DHEA 3SQNA 4YFVA 3NR2A 4FCVA 4JELA 4B84A 4ZDKA 2K4MA 1W5FA 1BQEA 4JB3A 1V48A 4DMRA 2PMWB 7ICHA 1M0SA 5JI3E 2ADMA 5IEJA 5BSWA 9ICHA 1JBQA 5HZMA 3BC1A 5JRZA 5F51A 1SAYA 2VHXA 3NJRA 3JVEA 1X7GA 3GHYA 3HBMA 1I6MA 1PV2A 2NV2B 3RSOA 2WAYA 3UTCA 1PF7E 1UBOS 3SNKA 4DMFA 3AINA 4AJLA 1RQ7A 3OHSX 1U7XA 4AYXA 4BKQA 1Y80A 2C58A 1C30B 4HDOB 4FDVA 5BT9A 3UB4A 1VBFA 3S6JA 2H2FA 3T5LA 4G5RA 1NM5A 2OVBA 2VL7A 1ZQKA 5IVKA 2DGDA 4BAGA 5FOWA 5JYDA 4JHLA 3U44B 2B2NA 1QR6A 2IDKA 3MCZA 4MQ4A 1C3XA 4EA8A 1JXAA 4DSEA 1WXXA 1MEJA 4HFJA 4XCQA 3D02A 4YR2A 3QPWA 4FPXA 4RVSA 4OJOA 1VGRA 1GUYA 2CLFB 3DZDA 1XYYA 4KLIA 3EWIA 3FYUB 4MUXA 4TQUS 3ZCXA 5ALOA 8ICGA 4J8PA 2O3JA 1Z4OA 2CHEA 3GBPA 3UWMA 2FUCA 1L4BA 3LG2A 5EZYB 4Q9HA 3F78A 1XMOB 1NR5A 5HM8A 2QRNA 2YFHA 4P84A 2VHEA 4XE5A 3RHFA 3ZIUA 4KE8A 4LZGA 4FDTA 4BWYA 4NHOA 2R44A 1RXUA 3CRZA 3SR4A 5KFJA 4O5CA 3LVVA 4IEFB 3C48A 1E3DA 1N6IA 5K0NA 3H18A 4XD2A 5HNKA 3B38A 4EA6A 1IPHA 1GN9A 1JF8A 3HJAA 4WTOA 1WSBA 4Q3DA 4CLDA 2IH2A 3AGPA 5ILOA 3RAJA 2ZBFA 3BMCA 3ND9A 4G1UC 1YOVA 3D3QA 5BOSB 4W7IA 1KYZA 1QTIA 1X0VA 2QUJA 4ZDIA 1WZIA 7ICLA 2P0AA 2P1DA 3FYDA 3IBTA 2M6KA 1I5OA 1G16A 3A2NA 3M6VA 1GZ4A 3FWNA 2LKDA 2Y1DA 2AVNA 4YP7A 1DAIA 1PLKA 1A3CA 3OETA 3ROFA 2YMPA 2OKGA 1QFSA 4FEAA 4QIWF 3V34A 4CR7A 5JAUA 4YCNA 3SQIA 1R9JA 2PLNA 2Q3DA 3E9QA 4HEQA 5LC1A 1A7JA 4C0WA 1A9ZA 3SHVA 4OX9Y 1D1TA 2SHKA 1WETA 2XXAA 2O0LA 3ZV3A 4ZMSA 2X8JB 2CT8A 3VU3A 4M9HA 2HBMA 2QN8A 3DPUA 1OTHA 5KFWA 2VEDA 3X43A 3Q0IA 4DV1B 2AZXA 3QMPA 2FQXA 3S2YA 3CS3A 4AW9A 3HI4A 4UDNA 2YWXA 5E4FA 1WUIS 2JEFA 1JG1A 4G89A 4KIFA 3RSCA 2P3QA 4KCGA 4QUHA 2I78A 2LR0A 4IXNA 2CK3A 3GIIA 1ACJA 3REGA 3VR6A 3OQNA 1CEZA 2OEHA 1QH0A 1P31A 3DPIA 4LRXA 2ZIXB 3H0EA 4R3NA 2O7QA 3UJPA 5BNWA 2ZULA 2FXVA 3LZCA 1DOQA 4M6WA 2IY7A 2XBLA 3ABSB 4JXJA 1YR8A 5EGNA 5EE1A 3P2JA 4Z0PA 5HK8A 3REOA 3T15A 1K9SA 4CQJA 2PWZA 4UAYA 3A4MA 5JDIA 3WA7A 4QICA 4Y9TA 3QVVA 1UR5A 3E81A 1S9DA 3KQLA 2H3EA 3K4GA 3IKLA 3MS7A 4RMGA 3MTQA 5J2DA 1LGYA 2AJCA 3PSAA 1HDXA 4QSMA 5IF9A 2C5FA 1D1SA 2HU7A 1A8PA 2PMFA 5LU8A 5ES3A 3T41A 3W4IA 1UADA 4TV8B 2FR8A 1E18A 2IYTA 2DX7A 2YHUA 2PUCA 2TMDA 5IWCA 5A6SA 5DLEA 3OMWA 5HSGA 1QYVA 5K3EA 3F8WA 5AVSA 4QUDA 3PR4A 5AQ1A 2QDKA 1XTRA 3RPEA 1A88A 3K9QO 5HE8A 1S8NA 2IV3A 3TD6A 4AICA 1VMAA 4WBNB 4KE6A 1E2LA 2PBZA 2XYHA 1E62A 5HMMA 4J0EA 2SKDA 1DXHA 5D5QA 3UJDA 1F7UA 4FFPA 3CF4A 1G38A 3DO6A 4JT8A 3C2LA 1GHTA 2H1RA 3OO1A 2W3SA 4U8HA 1E1DA 4P4MA 4M55A 2VP6A 1EVYA 2E82A 2SICE 1BGWA 1Y8QB 3MBIA 3WSTA 4IG4A 1BRTA 5C52B 1M1UA 3SDSA 4F6CA 3IESA 3AEXA 3RB3A 5BVHB 3LBAA 1E77A 3JALA 3V7JA 3GCXA 4FYMA 5TPZD 3GY0A 1MB2A 4UE3S 1AKMA 4W1PA 5CFPA 3ETLA 4MYCA 3RHZA 3DDCA 2NO6A 4ZO4A 1E1YA 3PFGA 5I5GA 3UXNA 2KE7A 1P4SA 5KNBA 4BQPA 2BMFA 1P45A 4PC7A 5LD2C 1FTGA 5JNVA 1ZUNA 2QYHA 5LQDA 3QLUC 4B7UA 3SMVA 2BZFA 2NN3C 3OZ7A 1UQUA 1YFLA 4MCJA 3VTZA 3ELWA 3ESBA 1E7RA 4ECVA 3A27A 5KWEA 3LPLA 2EDCA 3OUZA 2W2KB 3R0IA 4G07A 4KOEC 5DCLA 5DXFA 4F12A 4ZMBA 1BW9A 2XYVA 3G5LA 3Q7RA 4NBUA 5KTNA 2O8NA 2OPHA 2JZBA 5F5NA 5F3XB 4DCPA 2PIAA 1TQ6A 3IM1A 5E3HA 2MTBA 5KBYA 1GPKA 1RM5A 3F47A 1K3FA 3M3PA 3C2KA 1FP1D 1HDRA 1ZU5A 3P45A 4P93A 3P9PA 1DO0A 2CJFA 3LVQE 1NVTA 3LW8A 4YMHA 1X1EA 4IS2A 1G0OA 1TAMA 1BTOA 4JP5A 3CWZA 1EGHA 3GQCA 1PGNA 1JR3D 4Z6FA 1ADCA 3IT2A 3M6WA 3O7WA 4KLNA 2QROA 1YB7A 3GC6A 3KBOA 1S3SA 2PL1A 3ZV7A 2QVGA 2WFLA 3FN4A 4JLUA 1NBHA 1KAHA 2Y99A 1V8PA 5TEWA 4YYEA 4QOIA 3NRCA 2P9JA 2AN1A 1DEXA 3PPXA 2AJDA 5KSZA 1TIPA 1XX6A 2EQ5A 1O58A 2LDBA 4LZWA 3KR0A 4CUKA 1IUNA 1FFDA 3RBDA 2HRBA 1C81A 2NRVA 3HWX1 4FC6A 2XT0A 4M99A 1FQJA 2FZKA 1GAWA 1VE6A 2YH2A 5BW8A 3F8SA 3KYCB 5KYUA 3T5MA 1SEPA 4NBWA 5LZ7A 4ZAZA 2AKYA 2ZSKA 5BT8A 4F60A 4M76B 4K28A 1EG2A 2FP3A 2P1RA 2JGIA 2FSPA 2Q2WA 3FZEA 1OH6A 2A1JB 1U04A 3UW1A 3VSDA 2O8BB 1S0OA 2BFWA 8ICMA 2COKA 2JK0A 2LWIA 2ORVA 2ZAIA 3D3KA 3FBTA 3IBSA 3WK6A 3KV3O 4M53A 4RZUA 5I5EA 3O1IC 3LPAA 5J40A 4BUCA 3S70A 2CYAA 5I51A 4OGKA 2QL6A 2RCNA 2JLQA 1IHOA 3VCBA 3PHCA 1RNLA 2V74B 4DLTA 2RDJA 3N4MB 2CMKA 4IQTA 4J9KA 1YQWA 5AJHA 5AMXA 2GPAA 4ZRMA 4M22A 4EFMA 1ODCA 1FYVA 1UPXA 2LVBA 4PXYA 3W9UA 4EEXA 5B30A 5IKMA 3W04A 1ESMA 3E4DA 2VK1A 1XWFA 2KI5A 3KPVA 1T1RA 4FEEA 4MV1A 2P11A 2YN2A 2RRDA 3ZZ1A 2BFBB 3I6YA 4DL7A 1U94A 2QXUA 1YHZA 5D3ZA 1G59A 2C22A 2G63A 4IX1A 2QE6A 4G0WA 1ONSA 5BSKA 3TACB 4JUAA 1KDHA 1H23A 4LJAA 5GONF 1QCCA 5KFQA 1WPXA 2OY0A 4Y7DA 5ECWA 2W6PA 3EPLA 1EI9A 3IAHA 4IFIA 2VDPB 3H6GA 3UHJA 4ABTA 1TADA 5CT9A 2P27A 4YP6A 9ICLA 5DOVA 3D2QA 1GUFA 2ZWIA 4FWIB 5KYTA 1Q1EA 2IVFA 1RKQA 2HF9A 3FVVA 3BVPA 1SRQA 1MCZA 1XROA 3C29A 2QM3A 1KU0A 3WKAA 5TRTA 1N7JA 3SIRA 3SD7A 1RJEA 3GD7A 2ZUDA 2BJHA 1ZK3A 2FR0A 2I29A 2GAOA 4YA6A 4DBZA 2UUAB 2W4MA 4OJQA 1XXLA 3HUFA 3TSYA 5CXUA 2QX4A 5P8WA 1CIJA 1XCGB 2CXOA 2JDID 3O91A 3QJ5A 3VZBA 2I1LA 5AW2A 1QQBA 2H9YA 2WSBA 2XMBA 2ZCUA 4IJQA 2EKLA 4ND6A 5EA2A 4ZVKA 1QIIA 3E22A 3LPNA 3SF0A 3GROA 4GMDA 2WHPB 2D2EA 2B8TA 1I5RA 2I2XB 3CH4B 1WSAA 3FPHA 4P7KA 4IAOA 1WMBA 1ZSYA 2ZETA 2ACWA 2YXNA 3AW9A 3R24A 4QLAA 1RIFA 4J9OA 1SHTX 2Y93A 2WQ7A 1U7DA 7AT1A 4NSNA 3THWA 5TLSA 1BO6A 4I4TF 1BS2A 1XTSA 1ZUNB 4L1KA 1GVNB 3HJRA 5B55A 3OU2A 3SJCA 4FLEA 1I2CA 5KFBA 4OX9B 1XRQA 1FLVA 1G20A 2CNWA 2C07A 2OCIA 1EX6A 4EW6A 4ASUA 3QWAA 4GWKA 2FRVA 4H16A 4MPRA 1QIEA 4RU9A 2ON6A 3ENQA 4PFSA 1M3SA 3UJ3X 3WGGA 4PNEA 4FYIA 4R1QA 1KJ8A 3KS9A 3TZHA 3ZLUA 2X2FA 1IOLA 2HSEA 5BR7A 4QNRA 3U1TA 4HL6A 1ZKDA 5MGNA 4FGSA 2RLTA 1IHDA 3I6BA 1SD1A 4DSJA 3DKIA 5L4NA 3KZNA 3KQUA 1FRVA 1TZMA 5CLFA 3RUPA 2AX4A 3LHIA 1R5NA 2AG0A 2G06A 5ECDA 4QWBA 1RC0A 2OA0A 2DZDA 5L7YA 6Q21A 4O2RA 4FHCA 1HFEL 2O2IA 1IU9A 2M6SA 3I53A 2WF5A 2O2JA 1CZHA 2SKEA 2Q0SA 3AEQB 1H2EA 1Y7HA 2W2OA 2NO5A 2WUDA 1CQIA 1W5BA 3NVYA 3M7IA 3UXMA 4F72A 3CSUA 2XCAA 4ZYLA 1RKBA 3P2IA 3ER9A 2UUPA 1N0IA 3D5TA 3G2QA 1OUMA 3GLKA 4IJVA 4MW4A 5CB4F 4AO7A 2C04A 2YS6A 3N8IA 1U4BA 3EG9B 3ZU5A 4LF9B 3N97B 3KXDA 3CNEA 2PWBA 3BHJA 3L18A 1K1QA 4LCEA 5J0UA 1OKKD 2ZTHA 1UT6A 4NZ9A 3RKSA 3WS7A 2D2VA 5DGDA 1AS2A 3BDIA 5BWLA 4UU7A 2P5UA 2IU4A 3F7OA 3W3AD 1JSXA 1XJWA 5BSRA 4A2WA 3NP7A 2D4HA 2ONKA 2WHYA 4Q3OA 4R68A 5KVAA 1BAPA 2VJQA 3OT4A 1WO8A 1H0RA 3EDYA 2WB2A 3OEED 1U2EA 2PZLA 1HE3A 4X8MA 1U7HA 5EJGA 5HM6A 4AJIA 1H05A 3THOA 4MS1A 1PT6A 3CZQA 1RKUA 2PFGA 2HWYA 1RHQA 2I4NA 1AM4D 3A4VA 3RTEA 3IPRA 2FFRA 4YCXA 1HFKA 4OJMX 4OP3A 1V85A 4OU5A 3ZWDA 4Z4CA 4AKIA 5K0FA 3C5EA 3M6UA 5BN4A 2MINB 5I7UA 3HKBB 1ODLA 2WKSA 3HJUA 4TX1A 4U7FA 3T7AA 4EARA 4YIHA 3TI0A 1MX1A 2GZRA 16PKA 2WPDA 3FPAA 1I36A 3IO3A 5DQHA 3VKVA 1Z6AA 5DO9A 1QG6A 1RBZA 4D8WA 4UFOA 4EKNB 1P2SA 3UAYA 2NRTA 3WMGA 4QOJA 1DBRA 3DE2X 3C8ZA 2WIJA 3P2EA 3QHPA 4YACA 3U3XA 2VUSA 3BH7A 3ZD8A 1NMQA 2A1TS 2F62A 2OHVA 2RIPA 1V47A 1G7TA 1DK2A 6ABPA 3HO8A 3AHIA 4DIUA 4HTAA 3N75A 4QQFA 4E32A 4CM6A 4KMSA 3W4JA 2BCVA 3B1YA 4IDCA 4O4LB 4AO6A 1GNVA 2B5OA 4KFSA 5CVCA 1U8CB 2FW8A 1OHHD 5KFZA 3BFJA 1DC6A 1ISGA 1N2GA 1P7VA 5SY4A 2FFAA 1U3VA 2FG6C 3VBCA 3ABZA 1P6UA 3VYVA 2ZPUA 5TPWB 1J9GA 4DSOA 1ZWLA 3L7BA 3FLBA 5JISA 3ROZA 3ZGZA 1LNZA 4MO2A 1KP2A 3PNBA 5KWIA 3F3KA 4EQ6B 2DSNA 4BTVA 4NLKA 1NI4B 4I27A 3D0KA 1H9BA 3EQ7A 5HBGA 3ZS8A 5KCZA 2QZ9A 4PBRA 4J9LA 3IUPA 2REBA 4J91A 3KJIA 4WCFA 4B3BA 2V98A 4YAKA 4LE1A 1GUDA 1MQ8B 5CLHA 3RRNA 5DYGA 5C7LO 3F3MA 5M5BA 1T10A 3DWFA 1II8A 1WULS 3AK4A 3LL7A 4MJLA 2KJQA 2GHIA 3OTOB 1RWXA 1WNTA 5G0SA 3KSUA 3T5BA 1Z2PX 3U4HA 3BZCA 3BWEA 2QBYA 1S02A 1ST2A 3C6XA 4O0IA 3DCNA 3PHGA 3M4ZA 2AGOA 7ICSA 1WUYA 3OX3A 4A1OA 1W0JD 1IXZA 4DV3B 3JZFA 1G7RA 3AJEA 4KKVA 5ALEA 4P22A 3V8RA 3WP0A 5L4SA 4JMLA 2BRUA 1RJGA 3IA7A 2W6NA 1QSGA 2XD9A 4YECA 5EVJA 5FWAA 4EMTA 1BWRA 1ILWA 2ZEJA 3FTPA 1TX4B 2HZ7A 1J2UA 3N9IA 2HRRA 3AESB 1OH8A 1ZRMA 2IKSA 3GFVA 3SICE 5K9ZA 4XQ8A 2VK4A 2XE4A 1GNLA 4FOSA 5HCNA 3TH5A 3FM9A 3QU4A 1G8GA 2ZOSA 4MQEA 5B3KA 1MJGA 3LVBA 5IPFA 4RF2A 1CUVA 1T1JA 3DOCA 3F49S 3NORA 3RYHA 2RH8A 3KZ1E 2LKCA 3PUWA 4OK5A 2QV7A 3WGQA 4AQ7A 4OHBA 4IPTA 1A72A 3IO5A 4BKRA 2WICA 3VYUB 1C1DA 2J6TA 3PCTA 4MNTA 3BIWA 4R1SA 4KLMA 1ZS9A 2REQB 1M2HA 1V8ZA 4LDAA 4OQLA 1R5JA 4PQGA 4LRWA 4MGEA 1NQ5A 4L4XA 1L6RA 4P0PB 4TOIA 1PDOA 4PLTA 1SCJA 3U3MA 4MPPA 4QPJC 1OXVA 4BNDA 2R7AA 1MB3A 3ZOKA 2H2HA 3KTAB 5SYAA 2Z6VA 3PQ6A 3C4QA 3LUFA 4LTDA 5CX4A 4J4HA 4OQZA 4UQPA 2BPCA 4JJZA 4C87A 4JJAA 2Z30A 2HXYA 1GA6A 2MU2A 1Z2EA 5A4AA 3CF0A 1PGJA 1Z4JA 1L1EA 3PUZA 3HX0A 1CUHA 4B48A 2HM7A 2B99A 2X3UA 1CR0A 5AH0A 4Q5IA 4COOA 3KQWA 1OB5A 3GL9A 3IEKA 4JJGA 1A96A 3KVYA 3DLTA 4KQWA 2WNHA 4OBBA 4B85A 2JASA 1FFXB 3BQMB 4NV3A 4ZO7A 3JVVA 5GV7A 4DILA 5TEVA 2PUGA 2XMPA 5EP3A 4OHRA 1HQYE 3R77A 4EECA 3DLHA 1CPYA 2X8BA 1R4MA 1ZQVA 1DCKA 1OX4B 5B3JC 1G9TA 5KNDD 5KQSA 1P74A 3DC2A 4MUHA 4JLKA 2I67A 3MUEA 3S2ZA 5HTOA 4EHIA 2W22A 2NZVG 3SG0A 3ZY3A 1X7XA 2OBFA 3H05A 1N78A 5A2QA 4K2AA 2IUUA 3L4SO 4P8RA 4H7JA 3LPCA 1LWNA 3VPAA 4EATA 1PG0A 1B73A 5IINA 4MV8A 1A7AA 2Z4SA 3FDJA 1SV0C 4H7HA 4CKYA 4LQCA 4FFNA 3PQFA 5BUCA 4JLNA 3PEEA 5CB0A 2YNMC 2ZRLA 5GMOA 3ZNPA 1S2OA 1Z0KA 3CVOA 4YRIA 1MORA 1GL6A 2QTVA 1TB4A 3CG0A 2HCBA 3FPSA 4AS2A 3ET5A 1YZ6A 1T13A 2JDIA 3ONEA 4OMUA 4ZT4A 1DSSG 3UO8B 3ACCA 1AOXA 4WOCA 3OZDA 4QNNA 4AJ9A 3GQBB 5HIIA 5JZMA 4OQPA 9ICCA 1WUDA 4R65A 1GTJ1 1RWNA 1Z0FA 3C1TA 4GI1A 4J0GA 1HNZB 3T99A 4A2QA 3BD9A 3IQFA 4W5NA 3BPSA 3UWDA 2F7SA 1LQTA 4DOAA 1IOVA 1X14A 2BDTA 1NN0A 4PNPA 4WH0A 3SN6A 3WKCA 3K9BA 3KKOA 1Y63A 4TVBA 1BJTA 5KYXA 1TD1A 1NU6A 1HT0A 3HCBA 1FJXA 4XIGS 4HYQA 3UXYA 3COJA 1P7CA 4KV7A 4O08A 2Q50A 1DUIA 5JUMA 1WB4A 4A82A 3Q8XB 4M21A 3AJRA 3GCGA 2GBLA 4UM5A 2RBEA 4AY4A 4HLDA 3IP5A 3DZHA 1SHLA 2PO7A 3W2IA 5I01A 1QTRA 2HJRA 3VH4A 1E9DA 2DWOA 2JFFA 4QAJA 4RY0A 3U3JA 2GN8A 2AMVA 3ZXYA 5IX8A 2MSDB 1JALA 4IMPA 1SCQA 4L9AA 3NKFA 1KAQA 2V59A 2Q2VA 3Q3VA 4RORA 1QONA 5JS8A 1GGNA 2PDAA 5B7GA 1XC9A 2ISPA 3EJ6A 4BO1A 2TRSB 3PRJA 4O63O 5FTNA 1JEQA 2FN9A 2IL1A 3FROA 3LU1A 1N7IA 3NHRA 2NSJA 4KXXA 1E3TA 1EWVA 2G7ZA 4HKTA 4ONEA 2BCQA 3ML1A 5EHGA 3U2QA 1P80A 1A2KC 5AIBA 2ZUVA 3T0FA 4M0UA 1QDEA 3RVDA 3CZ9A 5JJBA 2NUAB 2G8NA 2AJBA 4TWRA 2ZBVA 1HF3A 1SCDA 5BSFA 4IR1A 3PQ4A 3OQVA 3KYDA 4FOTA 1FRFS 5CGZA 3G0HA 1JDUA 3M89A 3CUSA 2XKAA 3K09C 2NZYA 2VTEA 3RTBA 1F0YA 3SZRA 4EI8A 4QASA 2HMUA 2VTKA 2UUOA 2YYZA 2RP5A 3RRBA 3SQOA 1LFDB 5ELXA 2QW1A 2NUTB 1WXGA 4QA9A 1E9EA 2H9IA 4WA8A 2Y66A 5E1MA 4DMMA 4C6HA 3H99A 1S96A 2CJYA 3CZRA 3P9YA 2DPXA 1E2JA 4O2AF 3OSUA 5FR2A 3KHLA 2YWCA 3QUSA 2ZYGA 4P35A 4NLGA 3HUUA 2JFXA 1D4FA 2PKWA 4ARCA 3CUYA 5EJ2A 1I2BA 5TT0A 5J2KA 3H97A 5CEHA 1DWUA 1W5AA 1VP9A 3PXBA 4P2HA 3G5MA 1FU7A 4LNUB 3RYCA 2EBUA 3DEIA 4JS0A 4UAJA 1WZEA 1EFTA 1B2RA 1PS9A 3N7RC 4UBBA 1DBPA 1TKCA 3FNEA 3L8HA 1KHTA 4HFMA 5FO1A 1E9SA 4D5GA 2H1WA 2MINA 4QZVA 2FX5A 1IXKA 2P1ZA 2AT1A 1EU1A 1J9EA 1P75A 5TIIA 2LPMA 1CY8A 2AFIA 1TM3E 1XL1A 5AVOA 3HCCA 1OUQA 2JZNA 4M87A 4TTQA 1BYIA 3RROA 1AUPA 1MPXA 2KVSA 3AHGA 3PG5A 4F1KA 2X4IA 3DC7A 1C1HA 2JLRA 1Q0ZA 3LYUA 1GCOA 4R54A 3VU8A 5J29A 5ER9A 1PRYA 2F1OA 1L7OA 2Z0MA 1Z08A 1E3WA 1TVCA 3E3NA 3GRKA 4JNKA 3ADOA 4IZ6A 3TL6A 2E8NA 4QJ3A 2JGMA 4CR6A 4ZZIA 4L0DA 2F8SA 4RC9A 3T3MB 4KRFA 4RJ2A 1WMAA 4QIHA 1MX9A 4QDOA 1SG6A 2AI3A 3DE6X 3LTEA 3WHLA 1GQ2A 1KNQA 1QIFA 2ODPA 4G37A 1M2KA 2OZEA 1F2DA 1JXEA 2A1UA 4MS4A 4P1ZA 3ZVLA 1X1TA 3IAFA 5KSYA 1UBTS 3IT1A 1XNQB 1GNPA 4DTIA 1D4OA 4E0DA 2QAGA 2FSVC 2IE0A 4L16A 2Y0SF 3DS8A 1JFTA 2FPXA 1OV6A 1R9NA 2X4GA 2XXJA 3EULA 5EMLA 1T9GR 5LOVB 4HDNA 1KO7A 3GAMA 1R3UA 3EEBA 3RI3A 1IN8A 2WNSA 3TK1A 1X92A 2YICA 4L9WA 5FBHA 4YXWA 1MEEA 2Y4NA 3NPAA 2D5LA 1F17A 3EQZA 1JX6A 3D0RA 2ZTSA 4M3NA 4ZEMA 3UUFA 4XDZA 4JA2A 4XCVA 1P4JA 3TLEA 2ZT8A 3A1VA 1OZGA 2JI6A 2JEJA 5C5JA 2ZYSA 1V4BA 2Z83A 3RVSA 4AZWA 2YYAA 2ODAA 3O73A 1WB9A 4JLVA 5J1SB 3TSWA 1M34E 1RCUA 3T4XA 5L9AA 5F3DA 1V5GA 3AONB 1IUOA 2X86A 3HFSA 3O0DA 1EDDA 4G0PA 1OLUB 2KV2A 3KUDA 4YQEA 4AULA 1NYQA 5I48A 1PZEA 1TQ2A 4N7MA 2HHWA 1C7QA 5NULA 3NRZA 3NZEA 4RENA 3JAWB 3INTA 2Y1KA 4NEQA 2OHHA 2YJ6A 7ICJA 3UJ7A 5LKAA 3A1SA 2XCUA 3OCVA 1XU7A 1GAEO 4UXIA 4O6VA 1AK1A 1HYEA 1T5OA 2I6UA 3KD2A 2QI9C 4LV5B 5KTKA 4NBVA 3IJPA 4HTFB 3T95A 4HCJA 1PJ2A 4DCUA 3DCJA 5DG8A 3L6CA 2YV3A 4TV8F 2DAPA 2PX0A 2CLMB 3HU3A 2J8ZA 4TTRA 3EH1A 4URZR 4X63A 5TQ0A 2X0FA 4B6FA 1TJ3A 4KN6A 5DBAA 2A57A 4IR9A 1VCNA 1KKLA 1Z8DA 1IWOA 4R2HA 2F2AB 4LC0A 4IIJF 4WXYB 1CF9A 4KN7A 1IDN1 3D6NB 3IIJA 3HUEA 3JWPA 3KKLA 3IR5A 1ZIPA 3DHVA 3Q41A 2XMSA 4G5QA 4LUCA 4P86A 1VKOA 4I2DA 3G2IA 3ELDA 1XWWA 4ZPXA 1OYOA 2PV0A 4L8VA 1G0NA 4UBJA 4PQYA 4GOND 4RMIA 1OYYA 3EFBA 4IOKA 4K6HA 4RD1A 4KLEA 1C4KA 1T0BA 4HATA 5KFDA 2A0WA 3CNHA 4XD7A 5LP6C 4EBBA 4A73A 3RAEC 2J09A 5FUBA 4M7WA 1TZ2A 1PJ3A 4PN3A 1G2PA 4CF7A 2WT8A 3R7NA 1C9MA 1HH4A 2V5AA 1ADGA 1MABB 3I1JA 3HKZF 1Q50A 4ZCSA 2HBJA 2IGBA 2C9BA 1EK6A 2WFLB 1C7JA 4EHDA 4IHQA 3SI8A 3P4XA 4L22A 4UREA 2PHZA 4H35A 3PFKA 4NZPA 1U9LA 5KS2A 5G1PA 4IF4A 2UDPA 1ZMTA 3VJLA 2BBOA 2FWAA 4QU8A 3FOEC 3FVTA 4F4WA 1DDIA 2FK7A 5DBBA 3O93A 4KB5A 3TTXA 4D9HA 4UTVA 1W6RA 5DB8A 4Z7OB 4IIJA 3GJ6A 3ADCA 1X42A 4PGQA 4DA9A 4EELA 2P79A 3W90A 2XUAA 1P7PA 1JAXA 3WGMA 2WVHA 4XQ9A 4I2HA 5TS2A 2GEBA 1NBOA 3M5WA 3MJFA 4Z7NB 3WAGA 1Y88A 3M0EA 3WYEA 4RL4A 3MAGA 1FSZA 2WWRA 3NT5A 3MJ4A 2BZ1A 5F9NA 4HH4A 4N18A 4UXJA 5KMGA 5KFPA 5C0YA 3AI2A 4ALLA 1G1MA 1JECA 3HZZA 2CVQA 1H93A 4LHZA 1QE0A 5KG7A 2HV8A 1NVWQ 2I62A 4BJ3A 2QQEA 3IE2A 4C4ZA 5LP6B 3TFSA 1N4AA 1ZXXA 5I7OA 3W5BA 1KXZA 1RMYA 2J67A 3JQCA 3MJCA 1IULA 1L4UA 1QFXA 3P32A 4PNZA 4AP9A 4X1OA 4C14A 4IIHA 5CLJA 4A0RA 3WKBA 3IVAA 1TK2A 3MC1A 2FSHA 1CUGA 5EG5A 3UICA 3VH3A 3MYYA 5HKKA 3K9FC 2R00A 4DMHA 2G82A 1D2RA 1J0EA 1ZQ9A 2W7TA 1XZNA 2OB1A 2ZANA 4CHGA 2VP4A 4DCTA 4L8WB 5BY2A 5AVXA 3X1JA 3CVYA 5I4KA 1ZM2A 5BOLA 2HA6A 4DPKA 3IXQA 3AF3A 2CNLA 4OHKA 2C84A 4O1HA 1TLFA 3R3YA 3DDOA 5J58A 2Q0QA 4QE3A 1VZ2A 3S29A 1C8LA 4D98A 2WC1A 2Y3IA 3G82C 2A2ZA 4F11A 3PZPA 1ESDA 1KTIA 4DV4B 1G9XA 1GDHA 5KFUA 1W93A 2J7PD 3QWIA 4TS3A 4ENRA 5FOXA 2XUHA 1ISIA 1IN5A 4J75A 3PXEA 1UXOA 1Q0QA 5DG9A 2IPXA 2WOJA 5DRTA 4J9PA 4TV9A 5K4AA 3TE6A 3U7HB 4G0QA 3M4NA 4AY2A 4XIFA 4IHKA 4Y6QA 1EVKA 2BMAA 5K6RA 2WJZB 2PYDA 4IIVA 4YJGA 3E8SA 3PNVA 4BC1A 1GARA 3JATB 3UT5B 5EXSA 3GMIA 2B21A 1RI2A 2IYRA 1H3NA 4P83A 2MDTA 3RBEA 3U4AA 4F97A 2G5PA 2FX2A 3RRJA 4C2BA 1ETHA 4OG2A 2HWWA 3O03A 3GDXA 1K89A 3AEZA 3FETA 4IDFA 1X15A 4LWPA 1NN3A 3MTGA 1R0YA 4DQPA 3DOFA 2X0DA 2OAQ1 1JXMA 5IHXA 4EGFA 2OGTA 2V7WA 4R98A 4PF1A 4ZAGA 2GCIA 4G85A 4YAWA 4GYKA 4BATA 1USUA 2V03A 1RCFA 4R5HA 2HH9A 1DP4A 3OIDA 3C3XA 3G0IA 3KLNA 4IRCA 1PT9A 4FJ1A 3ZZMA 1KO4A 3NS1A 4GC6A 1UXGA 1JMYA 1PFWA 4JIMA 2WSSA 3VPBA 1JI0A 4KR6A 1SZPA 3LUGA 3MPUA 2IK8A 5CM9C 3I32A 4HGPA 1QVZA 3KKPA 4CTKA 4Z51A 4NXZA 3ISBA 2FE9A 1HV8A 4TXJA 4KUEA 4J7XA 1MB4A 4RQBA 1WUKS 2QZSA 2J0SA 1Y1PA 2GYYA 2XGOA 1O57A 3T7TA 1J2NA 1U0TA 5JALA 5DIFA 2Q1SA 1R6UA 2AW5A 3M1YA 5ALHA 1R37A 1T8SA 3OA2A 3OLZA 2H1OA 5T4HA 1U1EA 1EWKA 2OCLA 3KB6A 4BVHA 3KOWA 5AJYA 3NTVA 2IV2X 1KYVA 1CI4A 4JU9A 2H48A 3O1LA 5EXXA 4BUJA 3AJDA 3FWPA 5A0LA 1GRQA 3CUWA 4TMZA 5IUJC 2VP2A 3E15A 3LKDA 4Z3KA 1O77A 2BPFA 3FVQA 4GMXA 2Y2VA 3PX3A 3BHNA 1JVBA 1YVPA 1ZJ6A 1G20E 5JNWA 4OHYA 3LDAA 4ND3A 4LZJA 1FFCA 5JJLA 4QOEA 2BY4A 1KJNA 4GL4A 2J9FB 5EIFA 3I5XA 4KNYA 3TTUA 1BDMA 3SX0A 1M6HA 1UQVA 1UC9A 9ABPA 1NDUA 3ULKA 3G9TA 1MVLA 2W6CX 4BNNA 5AP9A 1VSVA 1N5XA 1RMQA 2CYBA 2P9FA 4DF8A 3SKXA 1QP4A 4DYDA 5IILA 2BGIA 3W5SA 4ECQA 3LOPA 2PMDA 4GLFA 1I4WA 3U9SA 2J33A 1PR6A 1UAYA 3I9NA 4NOKA 3RH4A 1W9HA 3R7SA 1AN0A 3NHFA 3RVRA 4ENTA 1NQAO 4F06A 3GEGA 4XIIA 2DXIA 3Q5EA 1UPCA 3PE3A 1VGQA 1YR7A 2QMEA 1D2MA 3CWCA 1V6CA 1X7ZA 2I8AA 2ZLBA 3D81A 3HDHA 4FNOA 3IB3A 4M1TA 2Z6QA 4MOWA 2D74A 4TZKA 1SPXA 2EFCB 5CFNA 1V1JA 4QDJA 4WCDA 2ZQ5A 4DV2B 2GRAA 2VUTA 1YCFA 5JEDA 1NJSA 2VHQA 3TNDA 3MQFA 2QRPA 1ZO8A 2GPTA 4AECA 3D7KA 5IN5A 13PKA 2VAXA 1BXGB 1JILA 3ANXA 4KXQA 1OILA 4WBSA 1EP2B 3MR6A 1Q19A 1R0RE 4B82A 5IFKA 3P5SA 1MR3F 2WIDA 1TT7A 5AM5A 1SWVA 2AW3A 4IDOA 4TRNA 3QOYA 2HNKA 4AF7A 4D41A 1QH1B 4IEEA 1GRCA 4M2LA 4QPDA 2B4YA 5C9ZA 4Y2VA 1QGUA 3A2MA 3ED5A 4OXKA 3I1FA 4EG7A 4G0NA 2M98A 4F3TA 4BVLA 1P0MA 1VE7A 1UT5A 1G8JA 2OFOA 4A03A 2VYFA 3N28A 4KPGA 4K4IA 1KSHA 4TLEA 3DMNA 3BE4A 3D1LA 1KK3A 4F5PA 3OSPA 1E7QA 1NRJB 1Q77A 1XVTA 2BPGA 4CLEA 2H0QA 5IT5A 1GRNA 3GLTA 4X91A 5B1YA 3QXJA 3UT5A 2XDQB 3RK4A 1GNRA 1HYBA 1XZQA 3FY4A 3GG2A 2XDYA 3N70A 4KWCA 3M9MB 1SIBE 3EA4A 2OHIA 4KQXA 1Z6PA 1GGFA 2GZDA 2BONA 2C9MA 3V7KA 4YJ2B 4O5AA 4OP1A 3SK0A 3HB5X 1YCHA 3EVCA 3QFCA 4YI3A 5FLKA 5FWXA 4DTCA 1JXQA 3FGZA 5ALQA 1U2DC 3ZG6A 2XZLA 2H5XA 1KSJA 1X3LA 3F1KA 3GVXA 2QB5A 4LYFA 2VIIA 4F4HA 3DVLA 5BN5A 1MZPA 4HPJB 5KT6A 2OYRA 2QV0A 2ZP1A 3E7DA 2QDXA 2W42A 5JSUA 4KHZA 4MQ6A 1KFDA 2WUEA 3WA6A 5JBNA 4ECRA 1W8IA 2AMJA 4NF2A 5J0XA 4OFBA 4B6QA 4YV7A 3BB1A 1XQXA 4II2A 2ZS8A 1YI0A 5LQSA 1BH2A 2Y1OA 1VE3A 1HR0B 3SKYA 3GYGA 3F2CA 2VT2A 5J4YA 4YRTA 2W2KA 3PGVA 3CIOA 4KO1S 1CEEA 5AM2A 2OFPA 3VVMA 1I2DA 5CFLA 3DBRA 4YLEA 1Q22A 5GOZA 5EQFA 3ZU4A 1WS6A 4BN0A 1I0ZA 2KSOB 2B7BA 4XARA 1Z5WA 4DS3A 4AQYB 4L6AA 1LW6E 1TC1A 4WERA 2PZJA 3WRVA 1OXUA 5JR3A 1B4FA 2AHRA 1XCMA 2IDZA 3K4HA 3JASA 3NWEA 3V1TC 4G1VA 1PEAA 3KEGA 1M2GA 2C7QA 1OQAA 1OASA 1KR2A 4MVJM 2GLXA 2X42A 5K03A 1CUJA 3O4JA 4F8YA 1Z8FA 3A4IA 4IZIA 5IYZB 5JNLA 1M8PA 1TCUA 4B71A 2D5IA 4RLSA 1NN1A 3RC7A 5EJ6A 5LXTB 2C3OA 5BYJA 3RVKA 4F1JA 4RSHA 5CFQA 3C7TA 2H92A 1SU6A 2GPNA 2DLNA 2RFLA 1R6XA 4C1NA 2VJ5A 2ENUA 5FOQA 3ZDDA 2JJYA 4OXYA 3ANNA 3C3EA 2FA9A 4GNKA 5BN1A 4GR9A 3Q9NA 3WIEA 1EPUA 1URJA 1DQSA 4BV3A 1EFDN 1G60A 1K5DA 3VYSB 3H4BA 4ZVMA 1UIRA 4I2GA 1VHWA 1UJMA 2CUNA 4CF4A 1ND5A 4ZCMA 1HGXA 2MYPA 4MUIA 3EZ9A 3I23A 4ZEOA 3WICA 1YQGA 2OHXA 3H8VA 1IZYA 4L5CA 2IEDA 4BNTA 1SKAA 1S8AA 3MTIA 4JIGA 3BREA 3OC6A 5J0OA 5FUMA 3ZR4B 2JI9A 3WYBA 5BR8B 1XLTC 3LVFO 4NULA 1JFFA 2GJ8A 1XTUA 2MCFA 1CY6A 1B0UA 1RADA 4M1OA 1UZMA 1ZJ4A 4GRIA 4OKIA 4FHGA 4DVJA 5BQFA 4PAWA 4ACOA 1NG1A 1EK0A 2OV4A 2ZIUA 4CEJA 3GFGA 3RHSA 1DO8A 3I2HA 1KQFA 4TXNA 3SNHA 5AVUA 4CMGA 3GNQA 2EVWX 1EAYA 1XZKA 1RQXA 4PWZA 3COPA 2POQX 5JSZB 2BZSA 2J07A 2JRZA 5LQNA 1Z0UA 3TVTA 2BHTA 3MLAA 3TFQA 4PHAA 5BW4A 4WXRA 4JVMA 2F4NA 4FGKA 4KLCA 3U0VA 4KV9A 3V1KA 4FFOA 1N5OX 3MDAA 2A9PA 4O4HB 5IAEA 5HZKA 1ID1A 2C98A 3NIDB 3KLMX 5B58C 4ENVA 1DC5A 5E79U 5DB7A 4DQ0A 3BH0A 3O75A 4QGBA 3C4VA 1CFZA 4EITA 1EINA 2FW1A 3MERA 1W4CA 1ZN7A 3OX1A 4LOLA 3JPTA 5JH7A 1XLUA 4RZ2A 4ZWNA 1VHQA 1JPJA 4YYZA 2QQFA 5KWSA 4LZDA 5AVKA 3QVKA 3GVHA 3W78A 2IXEA 4NBNA 3TSAA 4QPCA 2ODBA 5BWMA 5HRUA 2FWBA 3CE6A 4OQMA 2ZGVA 3LQQA 5CDUA 5CA7A 3W8RA 4IL5A 4N5DA 4JWMA 1QB7A 1RJWA 2VJBA 2IZ1A 3MA0A 3PJEA 4L0MA 5FTLA 3CJTA 1U7OA 1B26A 4ZEXA 3FBGA 5KYGA 5D4BA 4X5VA 3M33A 3CW9A 3KEQA 4J7AA 3PA6A 5EJAA 6ADHA 4R4JA 2ECFA 5TC4A 3C3KA 4QUEA 2XD4A 2CHFA 3ROMA 4D0LB 3H17A 3VPXA 1SXGA 5BV7A 1PNQA 2ZIGA 4I2CA 2XLBA 2GSWA 5E1BA 5F3RA 3OLXA 4DLXA 2FZWA 3KZXA 4Y18A 4F4XA 2KG5A 1AB6A 2C9ZA 1AIPA 1Y4ZA 3H8MA 4I55F 4RPYA 2QRQA 4C7XA 4CEIB 4K86A 2NO1A 3E9CA 1GG8A 3R5XA 3EVTA 4RGYA 3DQPA 2C2KA 3KX2A 1NNI1 4IVNA 3GLVA 4TMTA 1SULA 2PWPA 2I4MA 3B9JA 2XUOA 5JAHA 5HXAA 2C3UA 4FYYA 2GB4A 3H16A 2BEWB 3WLPA 1I01A 5DM4A 4RPLA 3C3MA 4BFUA 4UPDA 5U4XA 1DQRA 5IM4A 1E2GA 2C3PA 2JIZA 1SKWA 2I6TA 1GGJA 5SV2A 1ZUWA 3DM9B 3PGMA 3A9WA 3GJ0A 1P39A 2R1ZA 2HMAA 1NF2A 3DV0B 4G24A 3TMAA 5JAOA 2CHUA 5TB5A 4HG2A 3S28A 1FMLA 1GA1A 1XHFA 2UYGA 3WGJA 5IDQA 1C3JA 2NYVA 1RQGA 5C35A 4MYRA 3B6KA 1HKHA 1P60A 1APBA 5EZQA 4LKOA 1D0IA 1C1DB 1X39A 2IHUA 1PJBA 1DQYA 7ICPA 1R2QA 1QGZA 1RHRA 3OICA 1NMXA 1Y3CE 3OUTA 1VJGA 2NVUB 4NZZA 2X22A 1I3LA 1NVFA 1T1SA 1XJCA 3ETGA 2CXSA 1KO5A 1RYMA 2XI9A 9ICGA 1E1QD 1WXIA 3COSA 1UK7A 1EEXB 3BMCB 3BD8A 3CXRA 2XCRB 2BWJA 3MTAA 4GPTA 4EWLA 4XR9A 1RE1A 3HDQA 4PIPA 5FWYA 3V4ZA 2B35A 4LNUA 1KE1A 1TJYA 4YUXA 5JAIA 5L3QB 2VSNA 1ZX1A 1BGXT 2VJOA 4W6ZA 3S5JA 3D7LA 3TVDA 2O8DB 1X74A 1YQDA 3IJEB 2RHFA 1J06A 3LCUA 3WJ2A 2P6PA 2FWPA 1QVRA 4HRAA 2OBNA 3L7MA 1RZRA 1P4RA 1VG8A 2FG5A 4JQSA 2GZHA 4UVHA 5D5PA 7ICKA 1ZJYA 4DZZA 3GV8B 2GEKA 4KXMA 1JMVA 1ZC4A 2G9VA 4XLLA 3OM9A 3QY9A 4BVAA 5LJLA 2FMPA 2QSJA 4Q1FA 2G3YA 1S77D 2NAPA 2VPZA 4LHEA 1YB6A 4F91B 4P6VF 4TSKA 2YZMA 3U19A 4HUTA 1THMA 2K2QB 2YZ2A 3T5PA 4KTTE 1DAMA 3B7PA 5T4EA 4KGXA 4B81A 2DPMA 4IOLA 3LCVB 1XFAA 3ZE9A 1NK4A 3Q8MA 1C9JA 4GOOD 4IW3B 4G5FA 1TLLA 3DDHA 1Z29A 2AWNA 3BMOA 5EPEA 4ABYA 1FXWA 1X2EA 4HNHA 1T9ZA 3IP9A 4TMFA 4C3ZA 3U56A 3R9XA 4G97A 1GKIA 4HNRA 4NYMQ 1P7WA 4Z1MD 5F73A 2LW7A 2EG9A 5DNWA 2V65A 4I2AA 3COVA 4WV3A 4RVNA 3WJAA 1VIYA 5CFMA 1U2TA 1ZQAA