2G07A

X-ray structure of mouse pyrimidine 5'-nucleotidase type 1, phospho-enzyme intermediate analog with beryllium fluoride
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
290
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITFDMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of pyrimidine 5'-nucleotidase type 1. Insight into mechanism of action and inhibition during lead poisoning.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Cytosolic 5'-nucleotidase III
total genus 98
structure length 290
sequence length 291
chains with identical sequence B
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2006-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2g07A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2g07A01
1RDFA 2O2XA 4NABA 2BDUA 4UM5A 4C4TA 2WF5A 5ALLA 1RMQA 4EX6A 5AVRA 2JGAA 4G9BA 5IT4A 4QJBA 4YIKA 1Z4NA 4Y2QA 4Y2RA 3AR7A 4OCZA 3ET4A 5ALEA 2YMMA 4UASA 2HX1A 3KDPA 3QLEA 3WKEA 3ED5A 4UW9A 3F9RA 2HCFA 1RMTA 2YN4A 3A3YA 4BNDB 2FEAA 1J97A 4HGPA 2I6XA 3QUBA 2OYCA 1TJ5A 3DV9A 3N5KA 3ZU6A 2WFAA 2AUTA 3IB6A 3A1CA 1T5SA 3QGMA 3QU7A 3U7FB 5ALTA 4BEVA 4PNHA 3E84A 2CFTA 3U19A 3DDHA 2B0CA 1LVHA 2RBKA 3OCVA 3WK6A 2QLTA 1RKUA 2GO7A 1N9KA 4UU1A 3KBBA 4OFZA 3FVVA 3FPBA 4Y2VA 4HGRA 3L1UA 2YJ3A 5ALOA 3ZTWA 4AP9A 2X4DA 3AR3A 4HAIA 2EATA 3QU2A 5AK3A 4CE6A 2R8ZA 1VFPA 2JAOA 1RQLA 4I9FA 5AESA 3B9RA 2G0AA 4XE5A 3N07A 1WPGA 5A3SA 2Q4RA 3SKYA 4H1WA 5E0OA 5ALIA 2I54A 4BBJA 2AMYA 1TA0A 2W11A 2YY6A 3L5KA 3WK4A 2ZBFA 2HF7A 4Y2UA 5AW0A 4RESA 4OD0A 5AI5A 2W43A 2WHEA 3ZVMA 2CN1A 5ALWA 4UMDA 2G80A 3QYPA 4UM7A 1K1EA 4Y3UA 1PW5A 4UAUA 5ALHA 5ALZA 1Z5GA 2GHTA 2OM6A 4EELA 4QQFA 5AKHA 4GIBA 4EENA 1U02A 2C8LA 2NO5A 3BA6A 3KZXA 5AK5A 1CQZA 4AS2A 5AKYA 5ALYA 2JAWA 2FUCA 3R09A 5AVWA 4ZEXA 4EZEA 1YJ5A 2WF6A 4GXTA 4J2TA 2B1RA 3WKAA 2JAUA 5AI9A 3J7TA 4KNVA 3QUTA 2FDRA 2NYVA 1L7OA 1L6RA 3ZWDA 3E8MA 2HEGA 2EAUA 4DW8A 3L8GA 1AQ6A 1TE2A 2MU1A 3K1ZA 2G06A 4KX3A 2FPSA 2BDEA 3NALA 3UM9A 2I33A 3VAYA 4YIHA 5ALQA 1XPJA 4DWOA 3R9KA 1ZJJA 2CFSA 3NANA 1U7OA 4UMVA 2P27A 4L6CA 4BX2A 1ZRNA 5AVUA 4ZEVA 1N8NA 2R8XA 4IFTA 1T9ZA 3AR9A 3EWIA 2ZBDA 2G08A 3BWVA 4UU0A 3WK5A 2W4MA 2ZOSA 5AM3A 3SF0A 3FGOA 3W5CA 3ET5A 4BYGA 3OCWA 3WK8A 3SHQA 5ALXA 1SWWA 1LTQA 1WVIA 4KNWA 2CFRA 3RF6A 1Y8AA 5AKZA 3FM9A 1ZD3A 2VKQA 1JUDA 4FE3A 3HLTA 2YJ6A 5AKEA 3WGUA 2C9MA 2ODAA 4Y2TA 5ALPA 5AI8A 4YH1A 2GFHA 4CF4A 3ESQA 3L8EA 5AK4A 4Y2SA 2MSNA 2GHQA 5AKLA 3U7GA 2FPXA 4NAVA 2HO4A 2ZXEA 3EF1A 3QUCA 4NFLA 1QH9A 1NRWA 5T41A 2YJ4A 2B30A 2HHLA 4IG4A 5AKIA 3L8HA 4XPZA 5AW2A 3E58A 3NAMA 5A3RA 5ALDA 3QU4A 3ESRA 3OCZA 2AGVA 4KYTA 4J03A 1Z4KA 3MC1A 5ALVA 2P69A 3DAOA 1XVIA 3AR4A 1YV9A 2HSZA 3QU5A 4HGQA 4Y2PA 4F72A 4KX5A 2FPUA 4O8CA 1X42A 1L7NA 1RLOA 1RKQA 2I7DA 1L8OA 5ALGA 2FUEA 2JARA 5AKJA 2IOFA 4UATA 1WZCA 4OHFA 4UAVA 2BY4A 4NWIA 4YGYA 2HDOA 3W5BA 1L8LA 2QYHA 4BX3A 3W5DA 3NRJA 3I1YA 1Z88A 3A1DA 3U7HB 2G07A 2R8EA 1T5TA 3AR5A 4ZEWA 3ZWKA 3SKXA 4JDPA 1Z5UA 1L7PA 4XOUA 2C88A 1YMQA 3B8EA 1FEZA 1Z4QA 2WF9A 3NIWA 3QU9A 4HGNA 2OA0A 2YJ5A 5AVTA 1RPZA 2B8JA 3NUQA 2YMPA 4Y2YA 3W5AA 4G63A 2PQ0A 3OCXA 4EEKA 4NV0A 3ZUPA 1U7PA 3B9BA 1O03A 5AW9A 3GYGA 3L1VA 3CZ4A 1S2OA 3MN1A 2D2VA 3HYCA 3NASA 4Y2XA 1Q91A 3PGVA 2YFYA 5AW8A 1ZD5A 4MWOA 5AK6A 3WKCA 1O08A 5AI0A 1SWVA 5AKGA 2B8EA 5AW1A 4HGOA 1F5SA 3MPOA 4Y2JA 1J8DA 3WKDA 3PGLA 3L0YA 2RAVA 3UMGA 2B1QA 2PKEA 1U2SA 5AW3A 2WM8A 2PR7A 4MUMA 3ONNA 3P96A 5AW7A 3FPSA 3I76A 3ZW7A 3ZVNA 3RFUA 2GMWA 3OTQA 3ZI4A 1KYTA 2FI1A 3U13A 5AM0A 1S8OA 4XQ0A 1WR8A 1Z4IA 2Q5EA 1CR6A 2R8YA 4DCCA 3WGVA 1VJ5A 3IJ5A 5AKKA 4UMFA 3UMBA 3IRUA 3AR6A 4C4RA 2WF7A 2IOHA 1NF2A 4BEWA 5AVQA 4YCNA 4UMEA 5ALMA 5IS2A 3ZX4A 5IT0A 2FPWA 3KC2A 2AH5A 2I55A 4UARA 3SLRA 4JB3A 5AHXA 3QX7A 5AVXA 2YMLA 3OCYA 1U2TA 1RLTA 4BNDA 5AVSA 1XP5A 2RARA 5ALUA 4B6JA 5A3QA 3WK9A 4L57A 3PDWA 5ALFA 2Q4TA 2YBDA 5AI4A 5AVYA 3AR8A 1ZOLA 3WK7A 1TJ3A 1YNSA 1QQ5A 1RLMA 1TJ4A 3QUQA 3ZVLA 2C8KA 2IYEA 3N8GA 5AM4A 3TLMA 4CNQA 5AVZA 4KN8A 5ALSA 4BKMA 5AW4A 4L6AA 3L0BA 5AM2A 3U26A 2YMQA 4FYPA 5AICA 4HYTA 2HOQA 3QNMA 3EPRA 5AW5A 1QYIA 3MMZA 1RC8A 1ZD4A 4YCMA 3U7EB 5AW6A 1RRCA 4EX7A 1ZRMA 1QQ7A 3I28A 3ZX5A 5AIBA 1YDFA 2IA5A 1ZD2P 3QXGA 2P9JA 4CF5A 1SU4A 1QQ6A 1Z4PX 3EF0A 2IOFK 1Z4MA 2HF2A 2P11A 3M9LA 1Z4JA 2RB5A 3R4CA 3DNPA 1Z4LA 2O9JA 3AR2A 3CNHA 3FZQA 3A1EA 2ZBEA 1MH9A 3D6JA 3L8FA 4YCLA 3SMVA 4F71A 3OCUA 5AI6A 4AS3A 2DQSA 2WF8A 5AM5A 1RMYA 2ZBGA 3OPXA 3PCTA 4DFDA 1Z4OA 3N28A 4I9GA 5ALNA 3N1UA 3L7YA 3L0CA 3E81A 3UMCA 3KOOA 2FPRA 4BX0A 2G09A 3M1YA 4RETA 5AIAA 5ALJA 2G1AA 2B82A 1Q92A 5JJBA 4CF3A 2NO4A 2OBBA 1YS9A 3KD3A 2EARA 1ZS9A 2I34A 2ZG6A 3WKBA 4C4SA 4FFDA 1EK1A 1VJRA 1RKVA 5AVVA 3ZTYA 5ALRA 3I6BA 1IWOA 3S6JA 5FP0A 1EK2A 5AM1A 3SD7A 1NNLA 5AKXA 2C4NA 1L7MA 2HI0A 4E88A 1RQNA 5ALKA
chains in the Genus database with same CATH superfamily
1DQZA 2FKNA 1YRWA 3O4VA 4UM5A 4L76A 4D82A 3QPWA 1YOBA 4HDKA 4IMPA 1V8OA 2XQJA 3H9GA 3OC0A 1WHSB 1YDEA 1I0ZA 5BMVB 4WASA 4CCAA 3KUUA 3N2KB 4E08A 8ICNA 2PQMA 4BKPA 3MBKA 3K15A 3N2NA 1EWQA 3T7KA 4JI1B 2F3QA 1KDZA 3C2MA 1B00A 3O8QA 1O6FA 2E4WA 3HCPA 5EWFA 4UBMA 3ROGA 3UMVA 5M29A 1C8VB 1IXRA 2HX1A 2VP5A 3IUMA 3RVQA 2DH5A 3B51X 1X6JA 3PYXA 1P6XA 3LT0A 5CDYA 5CNIA 1PQYA 1NJ2A 4PHGA 1Y4AE 3U4HA 3W05A 5IZCA 4QOGA 4CGZA 3JZMA 3PQFA 4ILKA 1ZQ9A 2VQ3A 2FEAA 1JZSA 2G7ZA 1J97A 2H1HA 4I1RA 4C5BA 2CNKA 3TAXA 4CI9A 2HBJA 1T1GA 1FFAA 1R9JA 1I2ZA 4E1AA 2BN4A 1P7VA 1U4NA 1OGJA 3N5KA 5A04A 5CT4A 4UUNA 1F2VA 1TD1A 2OO3A 2JLYA 3Q88A 4A2PA 1WB6A 1BFUA 1A76A 3JW8A 1M10A 4HGZA 4OMFG 4YONB 5H16A 5MN6A 3TMKA 4ZO6A 4RZXA 3DDHA 1K5PA 1LVHA 4MLZA 4IQWA 3ZV4A 4NCIA 4AJJA 4FZ3A 2YQZA 3SICE 1FMTA 1E4EB 2ERXA 4ARSA 4GVLA 4UOZA 4MH0R 2DPGA 5KFXA 3PPXA 4X66B 3TQTA 1VCHA 2YXNA 4BNVA 3TQIA 3WGTA 1CUSA 4CIBA 1NG1A 2V3VA 5KQMA 1PK3A 3FOBA 2UVDA 3GGSA 2IYPA 2C5GA 3CGWA 2MMCA 1UMCA 5TQ0A 3RSHA 1T1JA 5L4SA 2ZE8A 5D84A 5J4KA 2GBLC 1E61A 4OLFA 1WPQA 2GI4A 1ZONA 3V9PA 3N07A 2XD9A 3C41J 1L2TA 3CGGA 4BKUA 2RHBA 1ZA2A 1KO5A 1DPGA 3I64A 3LMKA 1TOAA 1P1CA 1MJGA 1SCIA 2X6TA 3HH8A 3K0CA 3KE9A 4OQMA 3GLGB 2IS6A 4M04A 1W29A 1C7EA 3WK4A 4FFWA 4UM9B 3IBCA 4YJ2A 1C2YA 4CJXA 2OXEA 1A8SA 4P3PA 2B5OA 2R8JA 4RNCA 4NYIR 5EHGA 3HX0A 2XXJA 4W1SA 1E1CB 1NK9A 2AG0A 3NIGB 4QSHA 3PSFA 4QM6A 3I6QA 4WLNA 1V38A 4G0NA 4FWBA 1V8BA 4R2WA 4ZDKA 4ZZ2A 1LBEA 2JDIA 1BXGA 1DLJA 3TAQA 4Q16A 3HJGA 3PT9A 1ZQ1A 5KFVA 1B6SA 2CLDX 1M6VA 3WL3A 4F97A 2R6DA 5A4AA 3GEMA 5CYPA 3PNBA 3R7FA 1RHMA 3V8EA 2EWVA 1WCLA 4EELA 3CUUA 2CZCA 2G6BA 1E98A 3L8CA 4BV3A 4EUKA 1UOPA 5CLJA 4JI2B 4BFWA 2D5IA 3NFRA 3TFQA 3LL7A 1GPJA 1R6AA 1X39A 3A4NA 4RK6A 4UU8A 2ZUTA 4L3VA 3U17A 2PUJA 2QTNA 4EHJA 1R4ZA 5ADHA 2D2XA 2GETA 2HREA 3OE5A 3OSUA 2RGEA 2XTNA 3HHEA 5JATA 2WWGA 2GO1A 4NP6A 2JAWA 1E2JA 1C20A 1D2HA 2E4XA 1F0MA 3SQIA 4IVRA 4QTXA 1TZKA 4BO8A 3G0GA 1CD5A 1QR2A 4Y1RB 1PZNA 1HPLA 3TL3A 2V96A 2V4UA 3C24A 3F6EX 4R9RA 4UHJA 3LVWA 2EZ4A 1NQWA 2D59A 1KEPA 3FRIA 4IDHA 1SKMA 4TQAA 1E3QA 2DY0A 1LF0A 2PZAA 3RVSA 3L7NA 1TAUA 3KHLA 4CMCA 1SCUA 4IHAA 4HVLA 4AUMA 1AK9A 2ODEA 2WP0A 3T52A 1AK1A 3PYMA 4C05A 4F8JA 1PJBA 3QFCA 4YDHB 4NCAA 2C2DA 4QWAA 2X41A 3FCAA 4KRYA 4ROSA 3QFRA 2UZAA 4TL9A 1HMYA 3HZHA 2ZQZA 3LVFO 3OX4A 3P0FA 4YPFA 4FTWA 7MHTA 1U11A 1M67A 1QK3A 4O2BB 4MB2A 4ENQA 3HBNA 1A7JA 2IZ6A 4GC6A 3IKJA 1QPBA 2NG1A 3PNMA 5J2CA 1JXLA 4U3JA 3R9KA 4NV1A 3D6TB 1JLLA 1BCRA 4YQEA 4HX9A 1SU8A 1OLSA 4DBLC 3M5PA 5I9IA 4B82A 3IBTA 1N5RA 3TH5A 1FRFS 4H08A 2ZBDA 4WFJA 1GZHB 1UKZA 1KFTA 2UKDA 3CX4A 3D3JA 5BSFA 4RVOA 2W4MA 2H2FA 1WPXA 2EIXA 4OQDA 4W9RA 4I4TB 5BW8A 3EVNA 2GPJA 1NP7A 4F1JA 1XC7A 2IUFA 1UF9A 4P84A 3RV3A 2X9QA 3PPWA 4I66A 3UQYS 4QODA 5INTA 4LJ7A 3GPDG 1WVIA 1C1XB 1S3FA 3D3WB 3N70A 1VGQA 3I04A 3N2GB 1TD9A 2X5XA 3KPWA 3NOVA 3ND8A 2OGSA 4GMFA 4GZ3A 1A7UA 4QZAA 2Q0ZX 2WSLA 3KB8A 3UO8B 4DV4B 2VHVA 3I8XA 4RAOA 3H2SA 3P9KA 5CLFA 1IBRA 3MBIA 2LHTA 2J87A 4GBJA 4P34A 4OAOA 2G71A 3VI4B 3I73A 1JR3D 2VS1A 3C2QA 5F4ZA 3K2BA 3BL6A 2FK8A 1GQRA 3CNQS 5IMBA 3KJNA 3WIBA 1CJUC 1GUYA 1V1JA 1Y9EA 2R9VA 3K9CA 3V42A 4YMTA 4CQMD 4WZAE 2VYQA 2HO4A 4RM2A 2X3FA 4LTDA 4KR6A 4R05A 2VDWB 4F9EA 5EPEA 1WUDA 3E58A 1H5QA 2HPHA 3K9NA 2CHQA 3I9FA 3QU4A 1ESDA 3AO0B 3O4JA 2WUDA 3VU1A 3RG2A 3BDVA 4PYLA 3VPFA 1AHPA 9ICPA 4A5OA 5DBIA 1L5KA 4LVNA 5ALVA 4PICA 1GAXA 1USIA 1T9CA 1KS2A 1ZCAA 4TPKA 1YFJA 4GECA 1M0EA 1V0JA 4CG3A 2VHUA 3WYFA 1XRJA 4ENVA 3OKCA 5F5XA 2CL0X 2GILA 1RKXA 2ACEA 5KNIA 2PSDA 1KP9A 3GELA 1NVBA 3GLSA 3ISTA 3M0EA 4JQZA 9ICLA 1KAEA 1OW3B 1QKIA 2DUWA 2ID4A 3O90A 3ODPA 4BMNA 4DABA 3CNBA 4ED8A 1JQJC 1IEVA 1XBTA 1QC5A 1D3AA 2ZYRA 3FSGA 3PUIA 4MW4A 1L3VA 1MQ3A 2YQ5A 1MAVA 1HDRA 3NC0C 3UW1A 3V2HA 1J39A 3RKUA 4CEHB 1WZCA 3A8TA 3A2NA 2K8BB 2HB6A 4XWYA 4YGXB 5DM2A 3W79A 3W6UA 3Q3HA 4CCSA 3K4PA 4QJ3A 4Z51A 4DV5B 3HWSA 1C4KA 3PO4A 1DBQA 1HYBA 1HYGA 7ICFA 1DEHA 1WVMA 3E3OA 4RGQA 4RWZA 1CQIB 2IU3A 2HDOA 1DC5A 2MYTA 2QX9A 4GOND 4MKGA 1CUJA 4OXXA 3VHXB 3W90A 1Z45A 2VNAA 4HDQB 4F2WA 3LPMA 1CT9A 4M54A 4YMVA 1ZVQA 9ICKA 3DXZA 3TDNA 4DV6B 2O1SA 5ENDA 4MRAA 4AM8A 2O7VA 5J2FA 4Z6FA 4XIGS 3G9TA 4BO7A 4V1CB 3ER9A 1OAOA 4JNKA 3OHBA 1L1RA 2H2AA 3CEJA 4KQ2A 4EAAA 1U8ZA 3F98A 1C7ZA 3BXOA 1SQ5A 3UQZA 2X4LA 1TKAA 3ASVA 2GEBA 2IITA 2FW9A 2XCLA 3LU1A 3QKWA 4XUDA 4JKOA 1S5PA 2O2ZA 2ZUUA 5EJAA 1TCAA 5KSZA 3SJZA 5AVTA 4M8LA 4UVIA 1T26A 2R6FA 2Q7DA 4CT0A 1UT5A 2XKKA 2ZAOA 4EEKA 3WRYA 1E6MA 1PD0A 2FFJA 5KDOA 2WFLB 1ZN2A 1CRXA 3ZUPA 3SSNA 3QW2A 2WW8A 2ZTHA 4CLRA 5DNVA 2YBEA 3ROEA 3EVEA 4O3NA 7ICSA 4BJ3A 3CZ4A 2VQSA 5K4HA 3VJRA 2ZZMA 4IQFA 3NASA 2HJGA 3B5IA 5IIKA 4KO1S 2FW7A 3ZQ4A 3FX2A 4BASA 5IVKA 1EAYA 4EBBA 2ZATA 3NIBA 3R1IA 1L9KA 5ECGC 2A1AA 4NH4A 3TIIA 1PEAA 3ZHXA 2NZWA 4BQOA 3I2FA 3GEHA 1BN7A 3JWIA 4A10A 3LM8A 4I3GA 2QJTA 3CC8A 4IHJF 4YMNA 3EHDA 3RE1A 1C9EA 2VYVA 3HR7A 2XCRB 4PSAA 1BDHA 2Q1SA 3UAZA 4CKCB 1UP4A 2Y93A 1N8TA 1WP4A 2I03A 3QX9A 4H16A 4KBFA 5FA6A 4BMOB 3P96A 3PC8A 2D5CA 3UMFA 4CKEA 1AQJA 1D8AA 2HA0A 2BFFA 2B8NA 3S8MA 4C29A 4OIMA 4XA8A 1E94E 1MIOA 1X7YA 2BPOA 4X8LA 4JYCA 3FY4A 3NJRA 1BX0A 4LOIA 5GOZA 4ZI5A 5TSDA 4EQZA 2P7HA 5FL3A 2WAMA 3GVIA 5LQKA 5KREA 4O1IA 1YZ6A 3QBJA 1XDBA 1T2NA 4LYYA 3GIJA 4JV1A 1XK6A 3LVBA 8ICRA 3MK31 3V8QA 4ZT5A 3ER8A 2R8BA 1Z6AA 3L5OA 2RD2A 3ANNA 3CNNA 5CH8A 4BRZA 3R3UA 4UOEA 1WDMA 5EQJB 1NMEA 1THGA 3ZQKA 5JS7A 2JEIA 1R5NA 1FMLA 3KKPA 2XTJA 3SBDA 3RUIA 2QF7A 2ZE6A 4GH5A 4EJSA 4WLEA 1IJKA 1ABFA 1RYMA 3I9V6 3FAKA 3OU7A 1Q74A 3DMPA 5KOJB 3QE2A 4UUMA 2AFHA 3R23A 1O95A 4HC4A 3D3NA 4KXQA 4MINA 2FXVA 4C7JA 1TKDA 4R71A 7ICVA 4X5OA 1C1DB 4TWJA 1E2MA 4IICA 3SZGA 3TLYA 4FHGA 2J4CA 2NRZA 4DLUA 4JQSA 4QU9A 3AL0B 3KOXA 4N49A 1KZGB 2CCJA 3EVFA 3B6ZA 1LNQA 1Z47A 1CZOA 2G25A 2KIWA 2DFTA 2GRUA 1P31A 1SC9A 3PCRB 4U9IS 1Z0KA 3PV0A 2JFUA 2OAP1 4UXIA 2YXPX 4MP6A 5KU7A 2WSIA 1NDHA 2QL6A 4JH0A 1JQEA 3VC3A 3QUQA 1KC1A 4D3DA 1L5VA 4FOPA 1PR4A 2IYEA 1DADA 3W3ZB 3B0XA 2VDUE 1M2JA 3CNOA 4MQ6A 4YXJA 5KFJA 3OAAA 5JHGB 3ZW8A 1TECE 1GG8A 2O0JA 3LO5A 4ENSA 5CVJA 3MQFA 1IN1A 1WXFA 1X3SA 3BCHA 4FXPA 2G77B 1NUSA 5CB8A 2PGOA 4C2TA 4FFRA 5FLKA 1DKRA 1CJKC 1H2ZA 3WYGA 5KFHA 1V85A 2J4FA 5DBCA 3R5KA 3EPRA 5TZVA 1V2HE 1SUAA 3DJYA 1I1NA 2O07A 2ZR9A 3F5FA 1ZGGA 4QG7A 3VX4A 3IR7A 1AT1A 4ARIA 1YMUA 2C5AA 2IKQA 1TRKA 3HPRA 1NYLA 1D4FA 4H9GA 1NM5C 2TYSB 5F21A 4AKEA 1NUQA 3ZX5A 3MSXA 2LD4A 4B6EA 1SCNE 2BFBB 2H5JA 7ICRA 1EFCA 5HYVA 1RI2A 1YIDA 2P2NA 4CF7A 4V0LA 2PNJA 4PLTA 1CVLA 2GJSA 3A04A 3WYDA 5HIKA 3V34A 3DVSX 3C48A 1TVMA 2EJTA 4O4IF 4ZOLA 3TIXB 4D9IA 4EEZA 3AWIA 3E5HA 5AHRA 3EC2A 5HQ3A 1OUQA 1PJ4A 2O4UX 2NU8B 3VR3A 4FDVA 4A3SA 1YA4A 1XRQA 5JVDB 4DJ5X 4F5NA 1UANA 2LCFA 3A1EA 3UK0A 1QGUB 4WECA 4XVRA 1WO8A 2OXCA 3RRZA 5B7PA 1CUUA 3PLRA 3LCVB 5DG8A 4ND8B 3RF9A 2OLKA 2VWPA 4F71A 3L07A 1EUQA 1AGNA 4ZCLA 2DQSA 1DWOA 1X1RA 5KFSA 2QR3A 4I1VA 4J4HA 4Z0HO 4G1VA 4X1KB 4ZT4A 4EHKA 3PCTA 4D9MA 1QHIA 5HBRA 5IBRA 4Z4CA 1A98A 3RROA 2JFBA 3VPBA 3DDZX 5H5JA 1EG2A 2AF3C 1GD1O 2R4TA 3HBLA 3L93A 1CJTC 5REQB 3L4JA 3AIMA 4PAMA 2FLPA 1CUAA 1Q83A 1Q3UA 1JHQA 2G5CA 2I4TA 2J7PA 3HI6A 4LV6A 4MUJA 2G09A 3VHLB 4BFZA 5JNUA 4II7A 4MQBA 5B2EA 4LPSA 2OBBA 3G82C 3ADKA 3KD3A 5B1HA 1D1PA 2H4HA 3U3XA 4EATA 2BRUC 3UJ7A 1I14A 2I3AA 1JX6A 2Q2WA 521PA 3CYMA 4PBSA 5GIOE 5DXAA 4R51A 3SV3A 1KMIY 2F43B 2OGWA 3FNGA 1V3QE 1RKVA 2NRVA 2KJQA 2WVHA 3KT6A 1EG7A 1OBCA 3MELA 5SYAA 3KJEA 5IWAB 4G36A 3MR5A 3BA1A 3EQ8A 3S6JA 1H5NA 3RF7A 4A2WA 3WR5A 3SD7A 5K6TA 1LSOA 1XTUA 1NNLA 4MMXB 1SVOA 3IKLA 4GT1A 1XTPA 3OZXA 3LQRA 5COQA 3QRWA 1YCGA 3MOIA 1YRYE 4LSZA 3UG7A 1E79D 1KY2A 1T6ZA 2ZT5A 4HUQA 2AWNA 2PX8A 3DVQX 3K9FC 1UA0A 4YALA 1JAXA 1P7WA 1Z8NA 1BFKA 2Y05A 2JI6A 3DEJA 3Q7SA 3D02A 2P2ZA 3NGMA 2JIPA 1NK7A 2XMGA 5EMLA 3T7IA 4HDMA 5DNWA 4I99A 4B71A 5IDQA 1W9MA 3PHGA 3AW9A 3PF9A 5FF9A 3SOPA 3L4PA 1XHLA 1Z83A 5EUBA 5EOVA 1J99A 4NK4A 3UHAA 1ZVKA 1P5HA 3WKEA 3FHJA 2JIQA 1YE8A 2HQ1A 1PJAA 1JA1A 2Q8PA 3FDFA 4M3NA 1C7JA 1II9A 1K8QA 3R7AA 3CVVA 4D97A 3GT7A 4F56A 4P36A 3AFMA 2Y1KA 3PHBE 4Q1FA 1T3TA 4R2LA 3RGWS 4BO4A 3WQRA 4R84A 1XCPA 1S0OA 3JQQA 4J6FA 4F86A 5CIQA 1MIHA 1YB7A 2GAFA 2O7QA 4UHKA 4E14A 3O8CA 2ZR7A 2V4MA 5I9NA 3ZV5A 4BB9A 2GD2A 3SIPA 3VV3A 3F8TA 3K5WA 4WEOA 1AKQA 4ASUD 2Z58A 2HK9A 5LXTF 5KQPA 3FTFA 5IASA 3QU7A 4MW0A 1EB9A 4H31A 3RUFA 1YR6A 2XCOA 1RADA 5AJWA 3U9TA 1LXCA 3ZHZA 1L0BA 4C4AA 5IJ0A 2EAPA 1JHAA 3HGMA 3MF4A 5K1ZA 3JPNA 1EFHA 2ZVDA 1WXEA 3SENA 3DKKA 2JJMA 1XN4A 4MVJP 3VH2A 4YMUA 1XSPA 4EIWA 4J0QA 4L78A 4BKRA 9LDTA 2A30A 3QIAA 3GU3A 1NNUA 2NZ2A 2I3DA 1I4OA 3TKAA 3PMNA 2IXFA 1YHNA 3O2JA 4RPKA 4Z8XA 4BCBA 5C7LO 1U98A 4R9NA 5ITVA 2Y1JA 2ZIVA 2EH9A 3QKIA 1BQ4A 1Y5NA 1N6LA 3A3KA 3AR3A 3SE7A 4EB6A 2QEQA 2DHQA 3EFOA 1GKUB 4CIXA 1W75A 3OTWA 1IQ0A 2KICA 4I2FA 1X1QA 4RGBA 2CFCA 5CU7A 1TLLA 2CD9A 2ODTX 2P2DA 4MDFA 3B9RA 3G02A 3OQIB 5DN6A 1M6HA 1M66A 1S1MA 1S7CA 2GCGA 5DX0A 1URJA 3M6ZA 1OOEA 1TYCA 3JVDA 3ZNQA 4Z3KA 5BR4A 4QVIA 1X7GA 4CXMA 1ONSA 3G9ZA 1XDSA 5HTKA 2VYVD 3KELA 3O1IC 4E94A 3C3YA 1E1LA 3DL7A 3CEHA 5E1OA 4EY7A 2JKYA 3KETA 3G0IA 5EZYF 3KIPA 1SB8A 5JS6A 4EYHB 1E9SA 2IZ7A 1OFHA 1QANA 4B9MA 1JJIA 3K0AA 5KJ1A 3LP8A 4KLHA 3NUGA 2X23A 4UM7A 2PZ8A 2W4QA 4CNBA 2J6BA 3SS8A 3DF9A 5D6NA 1KZ6A 3ELDA 1QRDA 2BAGA 5JXHA 5LNK6 1NJ6A 2OM6A 1VG9B 1U6JA 3OIGA 2PS1A 5KTNA 2XB9A 4D25A 4LYJA 3QFSA 2D1TA 4HSGA 4MVJH 3ZHVA 2C8LA 1WXIA 1GGVA 2V6GA 3B6MA 3QJ5A 3VNSA 3EHEA 1L4KA 3TIFA 2RGNA 1NWCA 4S1NA 3FHTA 1YHZA 2XB4A 4U4AA 1RAEA 1HT1E 4DV2B 3EGEA 5DLFA 9ICCA 2W9CB 3WRXC 2A5YB 5AVJA 4FWIB 4GEKA 3T38A 4BUGA 3OJLA 5ULLA 4FUTA 3N2IA 5C35A 4RMJA 5HMLA 2RH9B 3RS9A 1I7SB 3OQIA 3TG2A 2M9NA 1QLHA 2EGUA 2IODA 3NT5A 1E1QA 4N65A 2Y9MB 5CLQA 3H0LB 1FNBA 2JD0A 2P9YA 2XJ4A 5D3QA 1ITZA 3D7MA 4E09A 3J7AC 2WRZA 2Q4OA 2HV9A 5LIRA 2JHGA 4RD4A 2ZSHA 1NK6A 2E8MA 3CX8A 2I8AA 2J3EA 4KXVA 2G6TA 4W7HA 2OD7A 3TYXA 1X80A 2A1UA 2BBOA 4MVJG 3HPOA 1DQSA 2C61A 4HN2A 4ID3A 2BLLA 1K9VF 1LI4A 2WZCA 3BERA 3S1AA 3HSKA 3S55A 2W54A 1WNTA 2Q9AA 3NIFB 5C1IA 5JU6A 4CIVA 2FZCA 2GDZA 2IP4A 2FPSA 2YHAA 2DKFA 5J0QA 2EKZA 3R5JA 2BCRA 1VRCA 2G4CA 2GEFA 3LGXA 3V46A 2VA2A 2EKQA 2BLNA 2V7EA 1PP4A 3H1AA 2R60A 3I5MA 3VOAA 2WTEA 2R8KA 1ZKMA 3UJDA 1TZCA 2H57A 1QFZA 1T2VA 2YTZA 4I2JA 2HHCA 3ROZA 4DCOA 2QN7A 4P4LA 5BVGB 1E9VA 1KYXA 2VBGA 5LUAA 3KLBA 4MGYR 1QQBA 2O7SA 3BWVA 3ZS8A 4UAJA 1DFHA 3WK5A 5HF8A 5GADl 3MG9A 2WBLC 4XX0B 1Y8RA 4EA7A 3UOAB 4HNGA 2D06A 4X93A 3MUFA 4F8YA 3OLYA 1UM9B 3T1QA 4BEJA 2YIVX 3KAPA 4I46A 2EZTA 3SEAA 3WK8A 3WDMA 5EJ7A 1JIHA 4S2UA 5ADWA 2M6RA 1Q3HA 1U65A 2C7BA 4B7XA 1XLWA 1NXOA 3PRHA 1ZC4A 5JAIA 4IH1A 4MP8A 1CRPA 3D7KA 1FL9A 4KLNA 4MB6A 3Q3IA 1GAQA 5TEWA 4K9RA 2EFEB 1AROP 1NBMD 5B3KA 1VLHA 3GLIA 4DR6B 1DQPA 3K0KA 4YQZA 4BPRA 2C9MA 4RUAA 3GRAA 3P2JA 3KSUA 1QX3A 3ORQA 4M55A 5COAA 4ESEA 1YQDA 2RB4A 4H7EA 4OBBA 3EMKA 3WJ1A 5KHLB 5L3RA 1W5EA 2YTUA 1G19A 4OL0A 2PGNA 1SKQA 2X0NA 3MGCA 3P9YA 3LRXA 4ED1A 4JFRA 2N47A 5E9QA 1AKEA 3A1FA 5K3FA 3F4LA 4K46A 3QUCA 2Z6VA 4JA2A 3MBYA 4KO8A 3RQIA 3VOSA 4BGVA 5AKIA 2WA1A 1SOMA 3L8HA 1SVNA 1HDOA 5C1BA 4JSTA 3ZDBA 4AJNA 1GCOA 1YNOA 5LJLA 4KPEC 1QTIA 1D7OA 3V1TC 3BQTA 1GZVA 1Q0HA 1ZU5A 3I62A 1VBFA 2FZWA 4YJFA 1Z34A 2DQNB 2DSTA 4BMCA 1QV9A 3TSCA 4CN9A 5ERGB 4D99A 3KQUA 1QR6A 4NU6A 2R5FA 4BATA 2Z08A 4RVCA 4OGWA 4P2HA 1XVIA 5KNBH 3SAFA 1Z35A 4Y2PA 2FVYA 4DV3B 2AN3A 3IERA 3BQ2A 5DNDA 2CLCX 2PV7A 1NKVA 3DUWA 1Z12A 3GF4A 4TYMA 4LJ9A 1VL5A 4KR9A 3WWPA 3R3JA 1QKKA 1T5DX 4W1QA 4B3XA 4E32A 4MVJD 2VF8A 5BSHA 3M9XA 4LQDA 1LLDA 4OV6B 2JARA 5DHAA 1DC6A 2XVAA 4KFTA 3C1ZA 1SVKA 1Y4ZA 4WESB 2BY4A 4K4GA 1E7RA 2TECE 1RJ9A 3AOEC 1NBME 3IV7A 4U5XA 5DK6A 3W5VA 4O8ZA 4NJOA 3T4PA 4HI0E 3EA4A 5LWQA 1WZEA 4XOIA 1U8EA 2IZ5A 4FP9A 2QLBA 3I1YA 1H9CA 4YT8A 1NAHA 3LV8A 1Z88A 4TVOA 3L7KA 1NK5A 3EARA 4QOSA 1GSHA 4WOBA 5F3RA 1USWA 1U8YA 2KI5A 1SBIA 2QVGA 1MB0A 1QDLB 1OYOA 3NDRA 3THSA 4BJ6A 4OF4A 2WOOA 4DDWA 4FDTA 1FNMA 1XKLA 4MLDA 3RSFA 5HFNA 3LQ1A 5KAFU 4YB8A 3AQ4A 4RTSA 1PZMA 4BNHA 1IFXA 4IQVA 3KKEA 3QHPA 1FFGA 3AXSA 4F4DA 5IMSA 2LIVA 1SKRA 2GEDA 1T3LA 2Q0QA 3EY9A 4KBGA 2Y27A 5CFZA 4I5EA 5KTOA 1PDWA 4O3QA 5F7ZA 1G5PA 4H2DA 5HXAA 2I9KA 3K8QA 1XO1A 4M0AA 2MJLA 1AQUA 4HL6A 3K0HA 2HDHA 3GV8B 4LISA 4BQEA 2A5GA 2JLCA 2W98A 2CXPA 2V5AA 1S4QA 4A1FA 4GQAA 1OILA 2OCIA 1GV0A 4WY2A 1UBOS 2VK8A 2DU8A 3VO2A 3GBVA 4DXDA 3EG9A 1O2DA 3RR8A 3TZBA 4AJPA 3CUYA 3RYIA 2CNDA 1PZXA 4Y8VA 1O94D 5EWLA 4FFLA 3TXAA 4TL8A 3FC4A 1F38A 3DE6X 1SBYA 3GEDA 1GCAA 4UBLA 2YFYA 1NK0A 2KZMA 3P0IA 3B89A 3RM3A 3VYRB 1TFUA 1MHPA 3TJZA 3WGMA 1ZQLA 2QVZX 3WLNA 3C5VA 5KMGA 4URVR 3PW5A 2G82A 2Q3DA 4K0RA 4U7WA 4AJLA 4X62B 3IOMA 5K0CA 3JQEA 3O92A 4RIIA 2KB0A 3ZZNA 4RK0A 1V45E 1S3GA 3RYHB 5KYXB 4FGWA 1ZQMA 4R1PA 1KDPA 3C7DB 4LE0A 4MI9A 4Q93A 4WI1A 3U4CA 4E3ZA 5KX5F 1FFYA 1UBHS 2P75A 3PLAE 1SL0A 1XZLA 4S05A 4QOEA 1JYEA 1MV8A 2XECA 3Q9SA 1E89A 2Z0MA 2XBUA 1H3FA 1U0EA 2XUZA 3AF2A 2ZJ6A 3HKDB 3KBOA 1M5UA 4EH1A 1M2FA 2OEPA 2WYIA 2J0VA 3LF1A 2GNOA 4OK3A 3RFUA 4EKDA 5C3MA 3THOA 2O8EA 4E5UA 5FI1B 4KXWA 2H0AA 3DW3X 5K0SA 4LHYA 4IOJA 3X2SA 1SV4A 3R5SA 2GM4A 4EGJA 2EU8A 2F3PA 1JB9A 1J0CA 2XVZA 3S2UA 4B17A 3JQDA 4L4UA 4HFRA 1PT5A 2EG9A 4O4LA 1T0HB 1WUTA 1Z4IA 1GL3A 4I2DA 2OWEA 2YW9A 1Y1TA 4KKXB 4C87A 2DKXA 1LKYA 2JGRA 3UF0A 1AKMA 1QYVA 2CMDA 3RVNA 2QHXA 1D0IA 5BV2P 2A0KA 3ND5A 2Q4DA 3BKXA 4OUKX 4RKFA 5AXCA 3RABA 3H9JA 2G4VA 3BQMB 3UXNA 4NICA 1J5PA 2WSMA 3E0XA 3I45A 3MWKA 3RUCA 4D6PA 4UMEA 2FQQA 3G2JA 3DFUA 4EG4A 1PFVA 4OKIA 5I01A 4DT1B 1Z29A 4ZRDA 4JGBA 3HW8A 4YMGA 4A36A 3MBOA 3IEVA 2X8JA 2P30A 4UZSA 2FCAA 2E5FA 3F2IA 4IWYA 5F4BA 2IOYA 2OM2A 3SZOA 2A9JA 5F3XB 2G9RA 2IW1A 2P9ZA 1IXKA 4M0KA 7ICJA 1ISPA 3KTAB 5J4LA 5ALUA 2XZDA 4NI5A 4AK9A 4DADA 3IVGA 1WYGA 3AY7A 2D2FA 5DGDA 4RTMA 3K1AB 4HWOA 2QRMA 3SXPA 3G5AA 3KQHA 5J0SA 3K20A 3KSZO 3ELWA 4ALIA 4G9GA 3E35A 1JEDA 4LWQA 2WYWA 2QGZA 1VL0A 2YH2A 4WWHA 1RSZA 1H2FA 2BKVA 3D6FA 3QPDA 4ZARA 3TQSA 3VSCA 1P9NA 4HT3B 5I4IA 3QX3A 2R66A 3N7TA 1T2UA 3CW2A 4F5EA 5LQJA 1GPAA 2WJPA 5MF6A 1NC3A 1H23A 2YW2A 2MIIA 2PRJA 3TPZA 4DLXA 1LX6A 2ROQA 1U0TA 2JJ8A 2L18A 4WZAA 3RSGA 4RADA 2OFOA 4TMFA 2IIVA 3ROQA 5L4LA 3C8MA 4HEA6 2Q1YA 1UFKA 1QUFA 1K7FB 4TUYB 4TVKA 4D5GA 3ZE8A 4FYPA 5D5PA 4LN1A 3GNTA 1NJSA 3KHKA 5HEKA 4D42A 3GWGA 4HYTA 3A1VA 2X19A 3S2ZA 3T0IA 4DC0A 4I28A 1N77A 1XF1A 1B23P 3VVLA 2X7HA 1BFDA 3UG6A 2IDKA 3BZBA 3ROXA 1RC8A 1APBA 3M81A 4X63A 1UBJS 4A6XA 2XODA 4KMOA 1AG9A 4BKQA 5HJ2A 5J0YA 3GIMA 3OIYA 4FMPA 3DWFA 4KGZA 5DZSA 1YD7A 3KXDA 2GPNA 3L6BA 4NU5A 2PWBA 2W9BA 4UPDA 4DWJA 4ECSA 1GTG1 1LFDB 1SG9A 3OBIA 4LDNA 4RHEA 6ABPA 4JXKA 2X5OA 2ZS7A 1LJUA 1XD9A 4EOGA 1JXQA 5LMCA 3Q3VA 4ZYTA 3T3GA 4JBIA 4EKGA 1KO4A 3I12A 2E18A 1Z4JA 3R4CA 3K70D 2RH8A 5IVHA 3ICQB 1UEXC 4GC5A 4JBWA 1D9ZA 2M0NA 4O0IA 1HY3A 1KYVA 4JSYA 5AO9A 1KY3A 2CJFA 2WTAA 3N7AA 3ST7A 1FP4A 3AJEA 2ECOA 4FKBA 1Q95A 2H4JA 2VPIA 3FHCB 1NJGA 1XU7A 1V1MA 3FPLA 1ZH4A 3GMTA 5KWVA 4IV8A 2DPHA 2PH3A 1MQ9A 4MEJA 4U9UA 3RAPR 2EQAA 3SZUA 3HJEA 2CLIB 1Z56C 4IIBA 2H1VA 3F7MA 4V3CA 5I8PA 2D0OB 2M9MA 1QZUA 2FN3A 4ZVSA 4B6OA 5FT9A 2B2NA 2XSZD 2W6MA 3V2UA 1ISIA 4ZHQA 4JS0A 5BYJA 3Q5DA 3FRJA 7ICIA 1PFWA 4ON9A 4UNNA 4K0KB 3T1HB 3WLMA 2DLCX 2RCYA 4XJTA 3SZLA 1W44A 2NRTA 5ALJA 4RETA 4Q4AA 3UWMA 1OGIA 1ULAA 1D4AA 1Q92A 1B0XA 1J49A 5KCMA 4IAOA 2ZROA 3BMNB 4HYKA 2ZTUA 3EZFA 1I24A 2CSUA 4YR9A 4KWCA 3VZQA 3T5TA 3X1DA 5IWCA 3FUCA 5GM2A 4QZGA 4YAEA 3W8RA 3EZ9A 3QPBA 4RH1A 2EANA 4C76A 3WLJA 2NTJA 3AI3A 4ILEA 2AG6A 5EEGA 2C00A 4DFPA 3F3KA 3WNZA 3PX7A 2OHVA 5JV5A 1BS1A 3AG6A 4I50F 3DE0X 3E5MA 3V80A 5FP0A 2B34A 1EVQA 1EDEA 3AP2A 4ZQFA 3TDKA 4OK5A 1TK9A 2P68A 4GOKA 4R16A 3ZE2B 2CNWD 1L5MA 4ETMA 3A1SA 4BWGA 1I7QB 2QXTA 1K2WA 2AR7A 1DJQA 2FEKA 3C1OA 1Y3DE 2VPTA 4RV4A 2PYZA 4RJIA 5E9JA 3V4VB 3CSDA 4E88A 1C4WA 2GERA 1COWA 3HM9A 1I4WA 1VOTA 2ZWVA 2ZM5A 1XZHA 1E18A 4J1TC 5GV8A 3L1JA 1U2GC 3L7IA 4FSHA 4G24A 4Y6OA 3L7AA 2HN9A 1DSSG 5DWDA 1CYEA 1XWFA 1SC1A 3QV1A 2OXTA 1Y8CA 4AZ0B 2CKDA 5C5CA 2ZWPA 3BMOA 1P5JA 3AJ9A 4LYEA 2Y66A 5I47A 1BVHA 1RIFA 5C7YA 3AR7A 4OCZA 4M8SA 3N7PD 2G76A 4FB4A 5JNLA 1GXSB 3N58A 1FDVA 3EIUA 2B78A 1NDQA 1YKFA 3AU9A 3FTDA 4HHEA 4KLOA 4LKOA 1PVQA 4N0MA 4DBVO 2P6OA 3FAZA 4WVFA 1K9SA 4DQIA 1DNPA 3PUYA 4IEIA 3DTVB 1FVFA 1NVTA 2GXAA 2QTBA 4JLAA 5DU2A 3ICEA 2QI9F 3ZC3A 4WW0A 5L7YA 4M76B 4MX8A 5F1YA 2J0SA 3BHJA 3D1LA 3G79A 3G0DA 4YRDA 2LMRA 4DCPA 5C5DA 1V41E 2H5LA 3BCRA 4LAFA 2CKMA 3BIWA 3D6AA 3COPA 3FUUA 1XP8A 3CB2A 3W5SA 4M2YA 1QAMA 5JFGA 4D0RA 1L4YA 2BE9A 5T3YA 1E2HA 3RJIA 1EVLA 1BPZA 1LPNA 1K4KA 1XA4A 2QIPA 3AC0A 2NWQA 3C6BA 4QU0A 4FCVA 1L5HA 4BEVA 4D9GA 1I1QB 2I78A 4TKUB 4N5LA 4NU0A 5IDYA 4GOLD 2B0CA 5LLTA 5BXYA 3GGOA 1BXRA 5JO0A 3EDYA 4IIHA 3V3KA 1M83A 5L7WA 2O2DA 1ED1A 3IUPA 3QTBA 1DBWA 1SOVA 4NBKA 1HOXA 3LTEA 1IEWA 4ZOHC 2H4YA 4IZOA 2Y0CA 3OURA 1ZEJA 5AJUA 1EK6A 3NBYC 2VQ6A 1GL7A 1WMFA 3BCSA 1QGED 4V0OA 4ZPJA 1TAHA 3RRNA 5KS2A 4E31A 3E53A 5C5EA 1RRFA 4N9WA 4F4FA 4IRMA 1NVEA 1C29B 2Q5LA 1JQAA 2HGZA 3JASB 4P2BA 2YVLA 1P91A 4M38A 3WSVA 2C3OA 1UBNA 1PLKA 2A59A 3ICWA 2VVTA 2ZTSA 3KDAA 1KZ1A 2B2CA 1JN3A 2GBCA 4GUAA 1HETA 4AX8A 4D2IA 3MWLA 4MA5A 5E0OA 3GUYA 4LF4B 1ZUHA 2BFCA 3CLTC 3FNIA 2GZ1A 3N2EA 5FTJA 5HGJA 3T7TA 4DNPA 4DZRA 2K2WA 4D4MA 5LDHA 2ZWAA 3ORSA 3I72A 3A2MA 3RREA 1D04A 3ZQUA 1ZBDA 1J24A 1HDZA 4HS9A 3TD2A 1QP8A 2Y4OA 1HYEA 1ODKA 2YHBA 5FTKA 1QIMA 1IUNA 3DYVA 3HRIA 1K7SN 2GN9A 2C8JA 1C3VA 3A0BU 1JDJA 2IY8A 2I4OA 2YV1A 3E4DA 3RH4A 1SU6A 1I1HA 4QJ4A 1JNXX 4CLEA 5ALHA 1R8JA 2DWQA 1HGXA 2BZSA 3I0MA 3ETNA 3FVWA 2GD1O 4J9OA 2XI4A 3KV3O 5EUCA 1KLNA 1MF7A 3B3FA 1LSSA 4S1PA 1N3LA 1L4UA 2ACWA 4H4CA 4ZVTA 3N39C 3BEOA 1MN8A 1MV5A 4Y6RA 3NPAA 5IU6A 5AK0A 1TUIA 4DCTA 3H83A 3R6WA 3GFKB 4FD3A 4F3RA 5HGXA 3ZCPA 4PHDA 5JSYA 4REOA 1SUBA 2JNWA 4R0NA 3ENKA 4G5OA 4JB8A 3ZDXB 1M1UA 2QUBA 1OBVA 3H8SA 3QE0A 4XM0A 4DS3A 3WKAA 4QT0A 4J76A 5EKDA 1D6SA 3DHWC 3GGGA 3DFZA 3U7RA 3OQOA 3D3KA 4YP0A 1GJRA 3L6RA 1NLMA 3QZ8A 2XLBA 1F8FA 4HQ0A 4OXYA 2GH1A 3KCNA 4BQFA 3EIQA 5F1KA 1J9GA 3JQFC 2JFVA 1JS1X 4R31A 4G01B 3RTAA 4C6HA 1JJVA 1RE1A 3UK7A 3VKHA 1BXKA 3RYTC 3GN2A 2HEGA 3QVWA 1M72A 1W4RA 4FYIA 3DULA 4W9NA 1T4BA 2AJTA 3A4TA 4JROA 1RWPA 5KUTA 4J9UE 4DW8A 1S8NA 1W2GA 2O8CB 4Y6QA 1R66A 1CQXA 3L7OA 1UPTA 4I5DA 5EEHA 3GCXA 4J0HA 3C3DA 1ZUD1 3OPYI 1BE6A 2FF5A 3EPLA 1S2LA 4RMNA 5IDVA 2JEYA 2OUKA 2X8BA 1XPJA 1W0JA 2ZRAA 3N0TA 1IMJA 3N59A 3NYIA 1N2ZA 5HG0A 1U9LA 1UJ5A 5BY2A 5DQIA 4B2PA 3C3AA 1OZFA 1M6VB 1FCJA 2EZUA 1L6IA 3TIVA 4CCYA 1ZJMA 3KK0A 1DWQA 3NB0A 2IUSA 3IXLA 1YB6A 2B4QA 3KUDA 2OSVA 1ZMBA 4XQGA 3RTDA 3JQ7A 2CXNA 3NWPA 4EYEA 4HDRB 1NNSA 4KUGA 1N1GA 3VBEA 3K0FA 5BWNA 3FE2A 3LW7A 2LVBA 1A5AB 1E6UA 1UJMA 2PHZA 4L74A 3V8NA 5ARCA 4EVSA 5CPFA 1EDBA 1PFYA 1RM5A 3UW3A 2NX2A 4W5TA 4NULA 1UWCA 5DLYA 2CK3D 1HLPA 3H1PA 3EAFA 1HLFA 5I7HA 3KYDB 1GZ5A 3WGUA 4NBNA 5D1HA 3KQPA 3M8RA 3QKSB 3H9UA 3BF8A 5C1OA 2I4MA 3C97A 4ARBA 4DQLA 2ZB8A 3B0YA 5DB6A 2AG5A 3BXFA 5CR9A 1X8LA 5L3ZA 3RT7A 1LJLA 3QENA 1LBHA 1X7ZB 2XUFA 3GDXA 2PYIA 2I9GA 3PR3A 1A5TA 1H2RS 1SUSA 4MIEA 4MIKA 4F5WA 4YJ3F 1BMFA 4JJAA 3MJEA 2VNHA 4GVPA 3SK0A 4RULA 5A9SA 5EIXA 4WKCA 1LTHR 1YONA 4N03A 1Y80A 3EZ5A 4NY1A 1SHJA 2BZGA 3WADA 4FMBB 3UPUA 3DQZA 3C7TA 3WHLA 3E3MA 1GPH1 5B4VA 1K3UB 1LWOA 3UPTA 3AF1A 4C8KA 1F6WA 2Q6KA 4O2RA 4OJQA 2FZVA 2XR1A 2UDPA 3R40A 1XQWA 1M0TA 4L22A 3TGWA 4Z9AA 3AHCA 4CTNA 2EW8A 1Y4UA 4UVDA 2HSWA 1R0XA 2LPEA 2W0SA 3BD8A 3LVRE 3R9IA 4ECRA 4R8UA 1MO3A 1FLDA 1ZH6A 3KWMA 1GPWB 4O33A 1RCFA 3RC3A 2P40A 1QQAA 2F9FA 3HKEB 8ABPA 2QTFA 5T4BA 2Y0DA 1Y1PA 5AXAA 5HMMA 2FQWA 3OEED 4Q24A 5JQGB 3ONWA 1T15A 4N3CA 4D4LA 4D9JA 1EFPA 3STWA 2C59A 4JUAA 5BNFA 3G0BA 1CEXA 3SHWA 4UAVA 1LDMA 1D0VA 2FSVC 4KTVE 1G5RA 1TI7A 2FY8A 3TJMA 3PNCA 2HSDA 3QVLA 4ZALA 3UB2A 5HJ5A 2FUG6 4ZYUA 2YNMA 3O0FA 4U3JB 3EXAA 3RRFA 4YGYA 5CCXA 4ABYA 3IPLA 1CFJA 1PK7A 2XTZA 1VL1A 4AJOA 2IZZA 1E1CA 4MYHA 4YJHA 1IVYA 4IIUA 4PG6A 3HDVA 3P9NA 1YQ9A 2EV9A 4Z2AA 1JR6A 1NW8A 3DONA 2NW6A 2FE9A 1Y7LA 3GZTB 3HUUA 4U1RA 1Q7TA 3LK6A 3B2EA 5BYKA 4DCGA 1IUKA 4DYDA 4WJZA 3H11A 3PI7A 5TPZA 3CRW1 3CH7A 3GIKA 3DR3A 3I1IA 4TTVA 3KZNA 2FMQA 1W1WA 2OVFA 3EN0A 4IGEA 1YVRA 1VSBA 3OLZA 4NM2A 4RA6A 2WIGA 4I9NA 3F2DA 2QVYX 5IIIA 4YYZA 2XI9A 4WV3A 4B40A 4HZGA 4NEQA 3U6KA 2HA6A 1OZ0A 1QTQA 4XVQA 3IJRA 1EXDA 2E21A 3JARB 8ICAA 1OU0A 5EXEA 2DJIA 4LNUB 4YA6A 1U2EA 3BRWD 3K09C 2IV7A 2D5BA 1TDJA 3L1HA 3W5AA 5J2EA 4L07A 3IPRA 4EVRA 1GG5A 2IW3A 3ETJA 3EUB2 3MGBA 4JMLA 4GXJA 1CUZA 4QD3A 2XLCA 4HTFA 4Y0AA 1X2IA 2Y1IA 4DR1B 2ENWA 2CBXA 4MAFA 4D43A 3N3AC 3FI9A 1O77A 4TTQA 2WSSD 1IN5A 3I04M 4EPXA 1V7ZA 2Z6QA 3ESCA 3E1KA 1EVJA 4JYBA 4OYHA 2OCPA 5TXGA 5MFZA 3I9MA 2YC2C 1NVKA 3ME5A 4E5SA 1YZTA 3AVPA 2I6FA 2PX5A 1XO0A 4WBNA 1PDOA 5K8JB 4W9NC 2GLEA 3AI1A 3U7QA 3DZGA 3N8HA 2H2WA 4BLTA 2QR5A 3GRPA 3RC2A 4A8PA 3GEPA 4I2HA 3ESBA 4G97A 4X1OA 1B76A 5HIMA 3W2TA 1BDBA 2ZTDA 2BCQA 1IRIA 1NLUA 2PR7A 3QYAA 1JH8A 1JMVA 1OZGA 1FFUA 1SQGA 1W5SA 4DQVA 1E2NA 4L8FA 2R62A 3R8XA 1GO3F 4QIHA 4ICAA 1D5CA 1VE5A 2W2TA 4YAFA 4AVYA 4B87A 4GPTA 3TCNA 5JTIA 1F51E 5LR6A 3C6KA 3B20A 3VR0A 5EWJA 2MYNA 1ZW1A 5TPZD 3ZUGA 4TQRA 1QC5B 5J2AA 3RK1A 4ID9A 3FPEA 5KFOA 4LCJA 5THQA 1B7GO 1FP1D 3DTVA 4F8EA 1PFQA 4F6RA 1Z17A 1XXHE 3DCYA 3FZYA 2OOSA 1JAZA 1EWKA 1X7XA 1CR6A 3HKZF 1PFKA 3Q9NA 4QHSA 4PVCA 5DX8A 5J5AA 5CVVA 1XZCA 2YRXA 4U6NA 4X1YA 4DIEA 3T79A 5KVVA 5DHPA 1MZVA 2AR0A 1T5HX 2IIBA 3KLPX 4YI5A 1YBFA 3Q3EA 1VCMA 4JC4A 4MROA 1G2QA 2PQ6A 2V7XA 3DFMA 4H6WA 2UYHA 1TL7C 4QQ8A 4NYMQ 1YS7A 2D54A 3NXKA 5IT0A 3VZBA 1E6CA 4GDMA 4EZ6A 1XYVA 1FNDA 1ODLA 4JNCA 1Y7IA 2F3SA 3I4CA 3SAJA 4DJEC 2G1PA 4G3IA 4A0GA 4JB3A 1YBVA 5L1IA 1I6MA 1OA1A 3D1VA 2HWKA 2IYSA 4RNOA 4NCHA 1WZ2A 4N76A 1MABA 3WA7A 4M9GA 1BD3A 2PKWA 4O3FA 5CNJA 2WD9A 2HBMA 4M46A 2JD2A 3IVMA 1R0CA 9ICHA 4DG8A 2CSXA 5EGSA 5G0TA 1WCIA 1AZWA 2ZXHA 4BO3A 4QZFA 4AMVA 4XUSA 2GOYA 2BMVA 2JRLA 1OVGA 3CNLA 5AI4A 4UQGA 1UK6A 2O57A 2QUKA 2GK3A 2OHFA 4R1UA 1ODJA 1Z5PA 1XLVA 4N6OA 3I9V1 3KLOA 1I94B 3G0CA 1YCFA 4HQLA 3WHPA 4MVXA 3TTWA 3U39A 3EEYA 3TLMA 4BFVA 4IO1A 4X7MA 2VA3A 5ALSA 3BGSA 1ZNYA 2Y0SC 3EOBI 1ISHA 4PWZA 3NBXX 5LDDC 4LZNA 4MV4A 3N6VA 4E30A 5AW4A 1EM6A 3NTOA 1NGSA 2I65A 3U26A 2PXHA 2UUOA 4BV9A 8ICBA 1OCEA 3E2EA 1G20A 1XMPA 3H1BA 3D5EA 1EINA 5JD3A 4IEFB 4DEVA 1TTTA 4OX9Y 2ZJ3A 2ICAA 4OOEA 1U94A 1KFCB 2GF2A 1QYIA 3SYNA 3K0CC 5AUQA 4B2YA 2F8SA 1SZCA 2NO0A 2QL7A 4JC5A 5KFRA 2PZGA 2KLBA 1HL3A 1PRYA 4ZGBA 4QTTB 1Z2CA 4GMGA 3MINA 4U2FA 5DLQC 2RGCA 1N2CA 1P4GA 5AJTA 1X1TA 4JVMA 1OXXK 4QTZA 5EJGA 4CT4B 2L42A 1VMDA 3B9QA 4PZUA 3N7SC 2VHYA 1RPTA 4O3OA 4JBLA 1IPFA 3ITEA 1D1TA 4DS5A 2Y1LA 1GADO 2ZDHA 1M8GA 2EIHA 4EY4A 1HZZC 3DLPX 2HU8A 3EZLA 3IUJA 4HJRA 3UGKA 1WKCA 3W8EA 3B53X 4N18A 3D6JA 4RW0A 4DDMA 1FSSA 3U9SA 1OXTA 2VP9A 3EIWA 1PJCA 1X0XA 1UEJA 2BHSA 2CJWB 1M33A 3W6NA 4YP3A 1HWYA 4RHYA 3H5IA 5AHWA 4CM8A 2GEVA 3FHOA 3I9JA 5EUQB 2HOIA 1A2QA 5DPMA 5AM5A 1ZJZA 2XJ9A 3ND7A 4QM7A 3OPXA 1Z0SA 4DFDA 4WVLA 4DNFA 3V7YA 4I9GA 2Y2VA 3R7WA 3GRUA 1Q7CA 4P3YA 2IRWA 2ZIWB 1PR0A 5B57C 3KOOA 1G21E 5FBRB 5T6MA 1QDEA 2EGHA 5EJ8A 2GVZC 2IZ1A 5JJLA 2POCA 2ONKA 1YZLA 2FR0A 4C89A 4MV3A 2YDYA 2FSVA 3JRWA 2H0RA 4MZXA 4IM7A 4RDHA 1H69A 1H65A 4XFDA 1RHRA 3W6ZA 4O5CA 1IL0A 1PZGA 2EX4A 1TRHA 4UFPA 4YAIA 5FTLA 3DQPA 2Q0HA 4OMUA 4RXUA 2M6LA 4B8WA 4JUIA 4GLJA 3E9YA 3AM1A 2ZB4A 3B1WA 1ZM9A 4P4MA 3D4BA 3IO5A 1Q1QA 3DD1A 3L0DA 1EK2A 1N2CE 3AUUA 5FR1A 3CCBA 4DMHA 1OYWA 1FMCA 3WO0A 3N2GA 4K9NA 1G18A 2PMWB 1PSWA 3P9XA 4XR4A 5KL8B 4OMDA 2KJ8A 1MXHA 2AI3A 4M9CA 3W5HA 3L7BA 3ZI0A 3UXPA 1H0KA 3IA2A 4IOMA 3S81A 5GAJA 1YQWA 5ALKA 3UB3A 5IJZA 3L1IA 4P5EA 5B6IA 3TQ1A 3V8PA 1JU9A 3G7UA 3G5LA 2IE8A 2NU8A 5ESXA 1KETA 4IIXA 5EYPA 3PEYA 5I7UA 2NM0A 3FNHA 1EGVB 5C1PA 4D0SA 3HCAA 4OQNA 5EE0A 2W37A 3I1FA 4E5YA 2KWIA 3TRKA 1T9HA 2FP3A 2L82A 4BVHA 2WINI 4CKXA 4KLUA 3H04A 1SGWA 1GTVA 1VPEA 2FFBA 4Y2RA 2MSDB 3I37X 2JZNA 1T8YA 2IC5A 2V3CC 3Q8LA 1HT2E 5J5VA 5BNTA 3KDPA 5B37A 1KNQA 2NT4A 2HYIC 4D3ZA 2R5NA 2I2BA 5JSZB 1JVNA 4GBGA 4OQLA 1KAGA 4UW9A 3HBFA 4G5HA 4H0FA 4DB2A 1YASA 5HHHA 4KQXA 4UVEA 4FC7A 1R0BA 1MC8A 2GJ9A 3OIUA 1YZ7A 1ISFA 1CUEA 4PGMA 2R2AA 4PS1A 4PSDA 3IM1A 3GLVA 4I4TF 5FR2A 2WKRA 1WXGA 1IHPA 4WKBA 2E85A 5G4LA 5KNCH 5KQGA 5KZMB 1X1DA 2OYCA 4HGYA 3X1MA 5KWEA 1YKSA 1JJAA 4JXZA 2HJSA 2W7TA 5BSWA 1MRZA 3FVTA 1SXHA 4FQ5A 2WFAA 1G2IA 4OXNA 1M1YA 1ISSA 2P8SA 5HZMA 4F3OA 5GIPE 1RBZA 3V97A 1E7QA 2I7XA 5LVAA 1G4AE 2OFFA 1FY2A 2FWBA 2I87A 2HIGA 2JEZA 3HCRA 1E9BA 3LIIA 4FHCA 3TD9A 3U19A 2QRKA 5DW3A 2O8BB 3EAGA 5CD1A 5C18A 1OBHA 3N2LA 5JH7A 4YUYA 4CEJB 3JPYA 5ABPA 1M74A 3QJYA 4LVUA 2C4WA 3IOEA 4MMZB 3QOYA 1P74A 5KYGA 1N61A 2RGYA 4TXMA 2KLHA 4Y2VA 1TT7A 3LUJA 3OPYB 2PU5A 4XPIB 5BMVF 2R86A 2NU9B 4ZGGA 2WSSA 3JD0A 3L0PA 5ER6A 1QK4A 2DSNA 1WXXA 1VFPA 2Y6UA 3CLRC 4ITVA 2HIMA 3IGFA 4HDNB 2G8NA 2HK7A 1BWRA 3HFRA 4GR4A 1HE2A 1LW7A 3QNWA 3AVQA 4IX1A 4J1NA 3E9NA 1RQ7A 2JA2A 1KEEA 2ZJ2A 2KJ9A 2JAQA 3LUDA 3PXXA 1X80B 3ZDDA 2Q4RA 2A0XA 4XM2A 1IJBA 3L18A 4BFCA 5DHRA 4OHBA 2B8WA 3QE4A 3Q8KA 4K6KA 5CXXA 3DAFA 4GM4A 2XUDA 4XVUA 2IHZA 3LFHA 3LP6A 3UUGA 4BN4A 1D4ZA 2NUPB 3NAZA 4YCDA 2HF7A 4IR7A 1A97A 1E3IA 1OB5A 5CX4A 1W73A 2O8NA 5E8JA 1OTXA 4RNMA 1HOTA 3B1YA 3TI0A 3H1GA 4UUOA 4PPQA 5FNVF 3ZVMA 2RHTA 2LYHA 3OUZA 1PGJA 3SAGA 1XKTA 1C3OA 4GC7A 3BH0A 1KXJA 3K94A 4PONA 1FS6A 3GB9A 4OXQA 3SEQA 5J2GA 3CH4B 5JD5A 5KYUA 3WQHA 1GZ3A 1MGPA 2NYAA 3C45A 2FWIA 2LWIA 6REQB 5BR8B 2ODPA 3UK6A 3DEHA 5CVDA 4ENWA 4NLNA 1EM8A 1P8AA 4D7AA 4QDUA 2RGDA 4ZZ1A 5CB4A 1SXDA 1QP0A 3NIDB 1KI3A 4MR7A 1FB5A 1RZVA 4JLWA 4IQTA 1HE3A 2D3WA 4G41A 1HSZA 3M9OB 1K6EA 1ONBA 2A94A 3JQPA 3N7RC 1JPNA 1XTSA 5JNSA 4NLCA 3L6DA 4DLPA 1NKSA 3BFKA 4RH0A 2Z1NA 4RQUA 2IBKA 1QHSA 4DCJA 5KFEA 4MUFA 5EJFA 4CQNA 1Q7EA 1YCHA 3H6GA 3K5PA 3VTKA 1KN5A 1ZAKA 4CIDA 4D44A 1MKYA 3U7QB 1WCYA 4G37A 3ROPA 4FX2A 3V33A 4IJWA 3LGSA 3K1TA 3GARA 3DOUA 4KRXA 4XD7A 1K27A 3MA0A 3QUTA 4E22A 2VJDA 1BHJA 2OGZA 3BEDA 3DSRA 3OHSX 4U6PA 1RM4A 3ELBA 2WHRA 3FCSB 3OPMA 2DF4B 2LP4Y 3OE7D 1TU4A 1A9ZA 4GI7A 5JE8A 1AUQA 3RH0A 1DKPA 3RSSA 3EGCA 1JVSA 2NXEA 4KLMA 3TI7A 1RXWA 3FDXA 1P39A 8ATCA 3NVVA 3KX2A 4ME6A 1E3EA 3FPKA 4AN0A 2JCYA 3DE4X 2PZKA 4DMFA 4J7XA 5J8YA 5GQSA 2PMZF 1NDUA 1NZDA 2QWXA 2R6HA 3PRKE 3W7BA 5DNAA 2BDEA 2V0NA 3N05A 4OLHA 3TLJA 3Q7EA 1FRZA 2JL1A 1JR3E 2VSOA 3ANTA 4DWOA 4JJIA 1Z5VA 1VRWA 3DV2A 3UK2A 2RP5A 4C07A 4QULA 2W6OA 4DG9A 3GDFA 4E7OA 1GG2A 1M2GA 1OBOA 3L8YA 3IE1A 5HQTA 2GJAA 1D8BA 2YOGA 4RYDA 1ZEMA 4FMCF 5IF3A 3ICVA 4P4PA 1TU3A 4MLCA 1EA5A 4WQMA 4MJ3A 1J8FA 4HWRA 4RHXA 4RTKA 1UXOA 4D1YA 1NBHA 5J1TB 2A5LA 4QBHA 3UWPA 3WAKA 7ADHA 4JXJA 5IYZB 1IN4A 4LOJA 1OSNA 1YXMA 1J23A 2C28A 1DCFA 3FWHA 1GKLA 5ALXA 1SWWA 3NKFA 1LTQA 1ORHA 3Q9UA 2HCTA 2WUGA 2PMBA 4UEJA 3RF6A 1BW9A 1RZRA 1U0BB 3T5KA 3KVOA 3A37A 4W5NA 3O84A 3AG5A 1QRUA 4RACA 3DVAA 2BOVA 4W5JA 1AVTA 4DLAA 1RRKA 2EWMA 4GGOA 5AKEA 4MARA 2WJIA 1FMJA 4GX1A 4BVLA 4UQLA 2ODAA 2RLTA 1O97D 3CW8X 1XJWA 1S3IA 3Q40A 5LBUA 1CB0A 3ESQA 1IEQA 1L8QA 3PFHA 1FS5A 2XADA 3DHNA 4BVKA 4EWLA 3KEOA 3NVAA 3LX8A 2QTTA 4KSYA 3CXRA 4X6LA 4AY2A 3EQ9A 1Y5MA 5I48A 1ZSNA 1GUDA 3QI2A 3K92A 3IAS6 2O5EA 1S2DA 3P4XA 4EDHA 3ZE0B 3M5WA 2WWHA 1RBMA 3RVKA 3ZE1B 2EX1A 4GUDA 1E3WB 2PMEA 2QRZA 4URUR 4C1NA 5BXQC 2PFPA 2SCUA 4E4YA 3PJRA 4DYHA 5FUWA 5EINA 3RLFA 1XELA 1YC2A 3I61A 1Z4KA 3MC1A 1MEJA 2QW0X 2VEDA 2ZVPX 3ENVA 5JSQA 2PE5A 1RWVA 1SVWA 1TM5E 3E1SA 3DAOA 1M2HA 3JPQA 5KFCA 2RMKA 2R1TB 3EXFA 4J7AA 4R6XA 4RZRA 2AA3A 3MW8A 4O4IB 3H2JA 4GBED 1BU5A 1J90A 4U00A 3LSYA 2JJYA 5EXPA 3D54D 3RS5A 3S70A 4B33A 4C3ZA 3TRDA 4BNJA 3PLNA 3M8SA 2OQIA 1U0LA 4H0NA 1C3LA 1SHUX 2I7DA 2XMDA 3NRWA 2AEFA 4L02A 4RQMA 1RBQA 4LI3X 5TT0A 1JQ3A 1UMCB 1EX7A 2PT9A 2IPMA 3DGEC 3A4MA 3CP8A 5KKNB 2RK4A 3VPSA 4CQMA 2Y1FA 4DSIA 3AJAA 1L8LA 3PDJA 4MO2A 4N5DA 4JK1A 5F35A 1WDWB 1ZI6A 3WNCA 4DARA 3KQNA 4RF5A 2AKYA 2J8ZA 3REQB 3S5JA 3HR8A 4EABA 1BZYA 5BN4A 2PPVA 4YAGA 3SC2A 4R8LA 1U3DA 1V6SA 4TMTA 2BPGA 3AR5A 4AN4A 4QDOA 1OZAA 2G0TA 1Z6YA 3TLEA 3JPTA 4RQBA 2K4IA 3FBTA 1FTQA 2F4NA 5KSPA 4UNQA 1L7AA 4XOUA 1BEZA 3LLCA 3ZLUA 2AG1A 5FPPA 1JXAA 4AUEA 3DOOA 3F6CA 3T5MA 2V98A 4EO9A 5BN3A 4M9SA 2CMKA 2WF9A 4PLVA 1OXSC 1L8AA 2VG8A 2G28A 3KQQA 1ADYA 4LGVA 4R01A 4DJJA 2RI6A 4D92A 5A4JA 4LC0A 3NWBA 4C9BA 2PTHA 1JBEA 1L5FA 2P1ZA 3NDIA 5JQGA 1BCSB 1OJLA 2JGNA 3LXUX 3PL1A 4S12A 2WZBA 4BO2A 3JZIA 4FGLA 3H75A 3V6HA 1DDOA 3LUGA 4OHKA 4PZ9A 4TSKA 4Z1MA 3K9QO 1RYFA 5H59A 2XYVA 1WD7A 5JBNA 4L27A 3NOXA 4AB1A 4QXQA 3UOGA 3ZWAA 3Q8XB 2CJYA 3SDSA 2ALZA 1Y5RA 2DFNA 3J81A 3HV0A 4I1UA 3HNRA 1P1HA 4JMPA 3NWOA 1JR4A 1V1RA 1Y3AA 3G2LA 2C2BA 3MPOA 2E1FA 3RIGA 1TMKA 3NVZA 4LY0A 4X8OA 2Q6TA 3STXA 1POXA 3LQ2A 3REQA 3FMFA 4J2OA 4FGKA 4BKOA 2EL7A 4L5JA 1NYTA 2BTEA 3C43A 1V7CA 4PO1A 1VHTA 5G41A 2I7VA 1AM4D 3ONVA 1DRJA 1U7UA 3EYZA 1GTZA 4NXZA 1UPHA 4IDEA 1X1BA 4Y1RA 4KOAA 5CP8A 3OMXA 2ZKIA 2BEVB 3TTUA 4OBXA 1W93A 2YNMC 4QYXA 2IH5A 2G88A 1B26A 1WW2A 4OJYA 4EFDA 2IUEA 2X76A 1H2EA 3VU0A 3LGAA 3WVNA 4NTZA 2H00A 3C3BA 1D6MA 3IV9A 1V6AA 3HM2A 3IR5A 2XPCA 4HADA 1OB2A 1FMFA 1EUDA 3KJQA 4YLGA 1X40A 1YQEA 4UMFA 2IHYA 2ZSIA 4J9KA 4DJDC 1MX5A 2XOKA 4QDXA 3KJGA 4UXJA 3S27A 2IOHA 3IMFA 2J3QA 1M1YB 3N6XA 4I4TA 4BV2A 1IN8A 5DNYB 4NFYA 3V7KA 3RVLA 3FOZA 3BYZA 1U0SY 2Q21A 1NHWA 3CR8A 4LHVA 4PSVA 5J4VA 3PFIA 4GL4A 1FFSA 5KFTA 2Z5GA 2GM5A 4V0SA 3KZVA 5EKSA 2ZBRA 3B12A 4PINA 5J2TB 2CCGA 2FEXA 2C3YA 4QZHA 2Z8XA 4IGFA 4Y1GA 4RLHA 1OPRA 4NLGA 1N1DA 1BCRB 4HMOA 1Q1EA 4BAUA 4TVBA 4ZPXA 3WSTA 4N40A 3KB1A 1XCLA 1N2BA 1WB5A 4TTSA 1TMOA 3ZXSA 1C0KA 3D2SA 1HEIA 5FFFA 1OH8A 1V9PA 1V5FA 2BGGA 4N39A 1I51A 2R6R1 3BMXA 2Q4TA 2QRVB 1OAKA 4K9KA 3TW8A 3UXEA 4CKBA 4DJTA 5J2BA 2ZLBA 4P54A 5ICCA 1PG5A 1ZOLA 2IX3A 2JF0A 2ZRMA 1MQAA 2KVSA 1AXEA 5G02A 1WS6A 2DBQA 4BNWA 3CG4A 4C88A 2VTKA 5JXJA 4Y6SA 4F9TA 2BFBA 4IRUB 1E3JA 4CUZA 2GF9A 2CPRA 3LVQE 4DM4A 2EGGA 1ZQDA 1P4RA 3PU6A 5HKKA 4BPBA 5E1MA 4KXFB 1DG1G 5KYVA 4ZOQI 5KBYA 2NAFA 3I6YA 3MCWA 4MQUA 2ZE7A 3F5SA 3TBKA 3OF2A 3IQIX 2QNIA 2QD1A 3PO5A 2VPZA 2JFOA 2BH9A 3WGOA 5CVTA 3I0NA 1D1SA 4ECZA 3OBBA 1AUOA 3C5GA 1G17A 1NI4B 1TJPB 1FIQA 2OZEA 2A2ZA 2NAPA 3AF5A 2BJVA 4OUDB 1PL8A 3CWCA 4O5EA 1AF7A 3NGXA 4KP7A 1GSAA 3A36A 2KQUA 3CFYA 1V95A 1ZN7A 2VXYA 4RWEA 4GMKA 3DBOB 4KE9A 2XMRA 3IEPA 5CK5A 4ZV9A 4KCGA 1DXHA 3D8UA 4MRMA 4ZOBA 2A4MA 1BVYF 1YDFA 2IA5A 1Z00B 1VI2A 1TUBB 4RA9B 4WLUA 1EUCA 5CYFA 1G8YA 4LDAA 5KI6A 1J42A 3ZQJA 4DLSA 4H1HA 1S9HA 4WCFA 1QQ6A 1KL7A 3IEIA 4UNSA 5HPYB 1KTIA 5CHYA 1BRMA 2C2HA 1GNPA 3O91A 4RNNA 1T1SA 4BU1A 1N9GB 3DNPA 3ABOB 4QICA 1F17A 2ZBEA 4OA5A 3RBXA 3ZK7A 3OT1B 3C7CB 2OCKA 3GFQA 4E70A 2GLXA 5IANA 3ECAA 5G2OA 4L8LA 4KLAA 4C7OA 4E5NA 2XT6A 121PA 1JSRA 3DTTA 2J07A 4FFOA 4MYTA 2FOIA 2WUWE 1N8SA 2YDXA 3BJYA 3HVRA 3B9PA 5TQVA 3OFND 5T4FA 2JGKA 3TZ6A 3GGDA 4G9EA 4HZIA 3BJIC 2P3LA 3PXBA 3C2KA 4EHLA 1AC5A 4EYKA 4YRIA 3PP8A 5A06A 4ED7A 2HT6A 5BYAA 1XLTC 1C9YA 1JEQB 2VP2A 4Q03A 4PW0A 1CQIA 5CFNA 5G3ZA 5ARBA 2ZYDA 2V7UA 1JT2A 4B44A 5BQFA 4XRHA 4J16C 1GTSA 3BGVA 1P2DA 1BGWA 2XO7A 3S99A 2ORYA 3FWNA 1DRUA 3LY5A 2G5PA 4AD8A 2OBMA 5U1PA 5DYGA 1ZNXA 3M6KA 1ZW6A 2X2PA 4LXYA 1P75A 1ZAYA 1BE1A 3TVDA 4BO5A 4C6TA 2DKOA 2E3TA 4LGMA 5ALRA 4HLDA 3GLFB 4IINA 3N87A 4JBNA 3HP7A 4YWHA 1SHLA 5AM1A 3NBAA 3C5WP 4OH1A 1ZOSA 5FTWA 4UE6A 3R0XA 4JB0A 1MT0A 1ESMA 3ZGLA 3AU2A 4LQCA 1WLSA 4E4TA 4TWZA 1CZKA 1N1EA 1EFTA 3F78A 3LOPA 1MB4A 3AGPA 1NIPA 4DL4A 3U2QA 3CEAA 4JLDA 3QWHA 4YO8A 5GONF 5FWYA 3ROFA 5JR3A 2ORVA 2IA6A 2RHLA 4NZYA 4UB8U 4QUEA 2R3SA 1SQFA 3PR1A 1ULZA 5K3OA 2UYOA 5KG6A 1TIBA 4UB4A 1A9QA 2UZ1B 9ICIA 2WNIA 3C87A 4IVPA 4Q39A 3CRZA 2ECKA 3D8NA 3TQOA 3KWJA 5C37A 3UAVA 1QQTA 3KVRA 1IIRA 2PUBA 2EERA 4IKPA 4M89A 1XKXA 1KC3A 1ZN9A 3IIKA 3LT2A 3PYLA 3AHEA 5DGXA 1GAJA 3SIWA 4Z4GA 3FTEA 1C9DB 3AVTA 2CVPA 3D4PA 3V8RA 4AO7A 1O1YA 1MW9X 3FUWA 4MQEB 3NBKA 4TV8F 2X0KA 4GOJA 2RJOA 3QEMB 4JLPA 1DRKA 2HR1A 1ANKA 1RCTE 3ZH9B 5GONB 1D8LA 2ZB3A 3A3YA 4HY3A 5DG7A 1LC0A 4C0BA 1RXCA 2VPYA 2V8BA 4LECA 3OGUA 2P9HA 2QS9A 3OM9A 3AH8A 2Q50A 1H8ED 5IVDA 1N63A 2Q3HA 3OOEA 4PV7A 5IJ9B 5JSUA 4LJAA 4NE9A 4Z99A 2O54A 1A9OA 2JRCA 1Y3BE 1EGMB 3AEQA 4JX9A 3BMNA 4FMDB 1XZGA 3PRJA 1J07A 3IQDB 1ZMXA 1P44A 2JEJA 2I6SA 3UJ3X 4DLBA 4MW2A 4LOLA 1T0PA 2IEYA 1A2OA 4KMSA 1K5OA 4M21A 4WPGA 4EA8A 1QHHA 3H2KA 1DT3A 4BZWA 5LYYA 4IMIB 1Z6TA 1LLUA 3E84A 5LQCA 3U60B 2CMGA 4XARA 3E1GA 4F5ZA 1Y6GA 3C3WA 3N5CA 4XASA 1N6IA 1Y63A 4ZCTA 3K2QA 3GFOA 4X1IA 4J0FA 3ND6A 2FWAA 3FPBA 2I2WA 4CG0A 1J2EA 1E1MA 3D64A 5IH7A 5EWMB 1XR3A 1RVDA 2W8BB 1QAQA 3MVEA 4BP3A 4CQLB 3CIOA 3NTVA 1CEZA 1G8MA 4PZOA 1QSYA 1N32B 4MVJI 1G64A 4FBUA 1J00A 3GILA 1XAGA 4XRRA 1FA9A 2GYVA 1A5SB 3MCTA 1HEUA 2OD2A 3QA9A 4YP7A 5AESA 4YJ3A 4GLXA 2HHJA 2G0AA 1O96B 1IZYA 4INPA 4Q7MB 3DEFA 3LXMA 1V8FA 4PRLA 1QMPA 1E6KA 2DP4E 3PJDA 3RS8A 3TLAA 5H4HA 5EQTA 1RRMA 1CUFA 1JLHA 4AQDA 4J2HA 3TWOA 2DRIA 4UNRA 3JWGA 3WAJA 1E9DA 3CS3A 1ZHFA 4MWCA 4PIMA 4IIGA 3WGKA 5LMZA 2NTEA 1ORWA 4KR0A 4ZQIA 3JSAA 1L4EA 1FU4A 1NBEA 3Q15C 2ZDGA 4WRRA 4X8HA 4Z2YA 1PYOA 1XS9D 1DBRA 2JK0A 3MR3A 1RWWA 1WOMA 2I6GA 2P9QA 3AEQB 1K4MA 4WCFC 5LXTA 3K31A 5C7OO 4UMDA 4YCXA 1R18A 2HSGA 3OF3A 2C7QA 2VTDA 4JJ7A 1CLUA 3EXG2 3W78A 1FNSA 3JD3A 4PN7A 1L5OA 2P65A 4NKRA 2YKGA 3LX6A 2YJGA 4JL8A 4NYJR 1T10A 2AJDA 1XVAA 3IT2A 4QQFA 2H1OA 4RQ6A 3G5UA 3EFOB 2DUUA 1G1MA 1KERA 4IDAA 1U02A 2OUIA 3RU7A 4MUHA 4KIWA 1WULS 5FOXA 4CG2A 2J48A 4CEIB 4RENA 1ZQOA 4MS4B 4F06A 4Z54A 4MGIR 4D3SA 3A31A 2DVMA 4F4YA 2WKWA 5IN5A 2COKA 2JJQA 1MA0A 2VT7A 3WLKX 3LT1A 3ZJUA 5AKYA 1ECLA 4FYYA 2HHVA 3IO3A 4TQSA 1IOWA 1CP3A 2P0EA 4R41A 4MRPA 5AVWA 5J40A 4KVZA 5DN9A 4X95A 1NBOA 4IR9A 3DHEA 5CJ7A 2WIDA 4L9RA 2V1UA 3V5NA 3ZY4A 3W7VA 2DL0A 3EGXB 1M2VB 3IE0A 4YPVA 5LMNB 2VPXA 1IM2A 2XVTA 2PNFA 1DIHA 4QU5A 3CJQA 4KWIA 5IAJA 2VATA 4Z0NA 4ENTA 4UAGA 4J3FA 4IC9A 5K01A 3K9HA 2BHLA 3FYUA 4ZTBA 4NENB 4NFSA 2LI6A 4QELA 1G4UR 2FWNA 3TINA 3Q7RA 3PUWA 4U6SA 3KYCA 2INGX 4R2KA 5TB5A 1NV9A 1EFRD 1Y8RB 3FKJA 1XJCA 4AIIA 1XZIA 3MJSA 4WUTA 2EAUA 3RB6A 5H3CA 1DK3A 3RD5A 2X1LA 3ROMA 2NADA 3W3AA 5BORA 5EWEA 4RVFA 2R7AA 3IR6A 1CNMA 3RBDA 2HLNA 1ZM7A 3CH5A 1FLAA 2ZU0C 2G06A 1LV7A 3UM9A 1Y7TA 4AZ3A 3KG2A 3BKWA 2JGFA 2ZRHA 3LLVA 3PE6A 1ZD9A 2PBLA 4EEXA 3IUYA 4J0IA 3EXIB 3O3NB 1R4NA 3Q87B 3R3HA 4BQPA 5KWJA 2KFNA 5CB4B 3HNPA 2HXGA 3W2IA 3GJQA 5K7SA 3OUUA 4BNZA 3TEFA 3NBZC 3AR9A 5JZ9A 5REQA 2QTVB 2KN7A 1PDVA 2BF7A 2Q3BA 3INRA 4HLUA 3RWOA 3MJFA 3PZBA 1CBUA 3P5BA 1WBDA 1R0KA 5JZSA 2ZJ1A 3ZU5A 1SC4A 3FR8A 4ZEMA 4BTEA 3C28A 4F50A 2Q62A 2QMZA 4PTLA 4FLEA 2TMGA 3AI2A 3K16A 4PG8A 3OEWA 5GJCA 2NSLA 3GH1A 4O1HA 3TTTA 2Z2IA 3DMHA 2EW1A 4GPEA 5BWBA 1KQOA 1UOEA 1U8TA 1KI8A 2H3QA 3TCXB 5EC8A 1NQTA 5FWDA 1KHHA 3IP5A 5DEIA 4BGIA 5FBVB 5ALPA 3BS4A 5FPKA 3LCCA 3KUCA 3WHIA 2XGPA 4CF4A 2W9XA 2ECPA 3RVOA 4BLSA 3R6LA 1NPDA 1P60A 3HUEA 3TEMA 4Y2SA 2XC9A 1RP1A 2JCSA 2ZI5A 4AJ4A 4QUHA 1MOZA 2MR5A 2NXWA 2IIQA 1UXJA 4HX5A 3CF0A 3WB2A 2MHCA 4ZGWA 1F4PA 3MGAA 5G0UA 2XOXA 3B7GA 2B30A 2VA9A 1AXGA 3GJ6A 3I3OA 4EYOA 1U8CB 3F0TA 4F93B 3S40A 5GINE 1G60A 1ZQCA 2CVQA 2PGIA 3NG1A 4JODA 1LLCA 4LJ8A 3ZJ5A 3I9KA 1EFDN 1NSFA 1YJ8A 2PDAA 3DAGA 2YN2A 2R1ZA 1ZY2A 5DLGA 3KKAC 4HNRA 3VAZA 3CW2C 4ZOCA 4TT3A 2GNAA 2GB4A 1LBQA 1WP9A 1ZZGA 5CT8A 5AFSA 1XTJA 4DLNA 3PR2B 5H83A 5T64A 4KB5A 1NFQA 1ZXXA 1NURA 3WZMA 1ZVJA 4JUFA 3JTMA 5DHQA 1Z75A 5BUZA 1P2BA 2VYFA 4NAUA 3GLGE 4I2CA 3BSWA 1X42A 3HB0A 3A6KA 4K6OA 1EX1A 9MHTA 1K92A 2OPBA 3AONB 3LUBA 2XVYA 1NULA 2AJ8A 3PEFA 3BAZA 2DPMA 2NUTB 2JGLA 2QE7D 4FN5A 2EKBA 2ZRCA 2ZYIA 3FSGD 2NZUG 1UBKS 3OTGA 1CUCA 4FFNA 3C16C 2XKBA 2OV1A 1N5MA 5JMPA 2GLTA 1A0PA 1EFKA 4Q47A 5JNTA 1ZYUA 4BX3A 1CZRA 4YXWD 5CDGA 5ESWA 4KIUA 3U37A 1KEZA 1IOVA 3ZDYB 1N7GA 4OHCA 1VIVA 1ZESA 3Q3JB 4KE8A 1SQ6A 3EGDB 1OFVA 4M83A 2GGSA 5DV9A 5BNZA 4AKGA 3OQVA 1QYCA 3KYIB 1WV0A 3TUIC 1IULA 4Q9JA 1XDZA 3SKXA 4UAWA 1FTWA 3FDJA 3HDGA 4JDPA 4BC1A 1Y1RA 1DV2A 4BVJA 3ICXA 4M99A 2PS3A 2CLHB 9ICWA 3AINA 2CUKA 4HLNA 2PK3A 3VR3D 4UM9D 3L82B 4ZVOA 2V45A 3TZLA 4EYQA 5I5EA 3UUEA 2RKWA 3B8EA