2G07A

X-ray structure of mouse pyrimidine 5'-nucleotidase type 1, phospho-enzyme intermediate analog with beryllium fluoride
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
290
Chain Sequence
AVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITFDMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of pyrimidine 5'-nucleotidase type 1. Insight into mechanism of action and inhibition during lead poisoning.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Cytosolic 5'-nucleotidase III
total genus 98
structure length 290
sequence length 291
chains with identical sequence B
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2006-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2g07A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2g07A01
1L7MA 2R8EA 2YN4A 2FI1A 1PW5A 4PNHA 2RB5A 2G07A 1EK1A 3RF6A 3QU9A 3R09A 3A1CA 2R8XA 4ZEVA 3R4CA 3L1UA 2C88A 5AKGA 2ZBGA 5AI6A 2C9MA 1T5SA 2EARA 1VJRA 2HOQA 3IB6A 4F72A 4RETA 4BBJA 3FZQA 4BNDB 4RESA 2O9JA 4C4RA 3W5DA 4EZEA 2VKQA 3MMZA 2Q4RA 3A3YA 5ALHA 2YMLA 5FP0A 1YDFA 5AI8A 5AIAA 4J2TA 3L8GA 3UMBA 5AVTA 1L8OA 2GO7A 5A3SA 3BWVA 3AR8A 2RAVA 3BA6A 3N5KA 4OCZA 3PGLA 1SU4A 3AR5A 4AS3A 2B8EA 4GXTA 1Z4QA 3WK6A 4UMFA 3FPBA 3PDWA 4FE3A 4OD0A 5ALSA 2IA5A 5AIBA 2AH5A 3L7YA 1MH9A 3WKCA 4BEWA 3IRUA 2FEAA 4O8CA 1YJ5A 3QU4A 5AKKA 3KZXA 3HLTA 5ALZA 4YIKA 2I34A 4MWOA 2FPUA 1Z5UA 1L7PA 1LTQA 2AUTA 2B1RA 4HGRA 2YMPA 3SMVA 5AM5A 5AI4A 3DNPA 4HYTA 1QQ7A 2WF7A 2GHTA 5AKEA 2BDUA 2DQSA 3D6JA 3U7GA 3NRJA 2G1AA 4L6AA 4BX2A 3WGVA 1SWVA 3AR6A 3S6JA 3W5AA 1RQNA 5ALMA 3QU2A 5IS2A 3ZVLA 4OFZA 3L5KA 4IG4A 1ZD3A 2B0CA 2WFAA 1RLOA 1XP5A 3HYCA 4Y2JA 3QUQA 1RQLA 1Z4MA 5AKIA 4CF4A 2JGAA 3L0BA 2YFYA 3WKDA 1Z4OA 3ZVNA 2D2VA 1ZD4A 4HGOA 3VAYA 2CFSA 3IJ5A 1XPJA 3ZWKA 2YY6A 5AM0A 1T9ZA 1Z4JA 3TLMA 1LVHA 1Z4LA 3QUCA 2B8JA 2HCFA 4HGQA 5ALRA 5AW8A 3U7FB 3M1YA 3WKEA 4UM5A 3UMGA 4CF5A 2ZBDA 3ZU6A 1ZS9A 5AW0A 3U19A 2I7DA 5ALIA 2OBBA 3FVVA 3KDPA 5AM4A 5AW2A 3AR9A 4Y2XA 5ALQA 2OYCA 3OCVA 5ALDA 4KX5A 3J7TA 1FEZA 2YJ6A 3KBBA 4DW8A 1RRCA 1RKVA 2ZXEA 4DFDA 5ALLA 4UU0A 2YJ4A 1U7OA 3U26A 3ZX5A 1QH9A 5JJBA 2C4NA 4L57A 4UMEA 2Q5EA 4YCMA 2JAUA 3W5BA 1S8OA 2NO5A 1O03A 5AI5A 2WM8A 1L8LA 1N8NA 1ZOLA 2B82A 2HI0A 4BNDA 3WK4A 2JAWA 4UU1A 3GYGA 2MU1A 2O2XA 3FPSA 3WK9A 5AVVA 1WVIA 3RFUA 3OCUA 2FUEA 3F9RA 3SKXA 4UMDA 3K1ZA 1Z4PX 4J03A 3ZWDA 2IOFA 3L0YA 4I9GA 3QGMA 5AW3A 2WF8A 4YGYA 3PCTA 1WR8A 5ALKA 4Y2UA 3MC1A 2C8LA 5AKJA 4UMVA 3L8HA 3NAMA 4BX0A 5AM3A 2FPXA 5AVZA 2RBKA 3DAOA 3NIWA 3OCXA 5AVUA 1RMTA 4KNWA 2GMWA 3OCZA 3PGVA 4NWIA 2P11A 2HSZA 5ALTA 2ODAA 3WK8A 3ZVMA 3OCWA 2G08A 3MPOA 1ZRNA 4IFTA 4EEKA 2HHLA 3I6BA 5AM1A 5AW6A 1J97A 5AK4A 2JARA 4L6CA 4QJBA 4UW9A 2MSNA 3U7HB 1Z88A 1NNLA 1Z4NA 5AK3A 5ALPA 5AKYA 3ET4A 4E88A 3U13A 1J8DA 1YNSA 5AKLA 3DDHA 3WK7A 1RKUA 4XQ0A 5ALYA 2NYVA 1U02A 3AR2A 4G9BA 4NABA 1U2SA 4Y2YA 1WZCA 4I9FA 3EPRA 3WKBA 4EELA 4F71A 5AESA 2W43A 2HF2A 2R8YA 4AP9A 3WGUA 2BY4A 3DV9A 2QYHA 2WF9A 4GIBA 1QYIA 5AI0A 4MUMA 2JAOA 4UAVA 4JDPA 5ALJA 2HF7A 3M9LA 4ZEXA 3UMCA 5AVRA 3OCYA 2B30A 5ALOA 2WF5A 4C4TA 3KOOA 3L8EA 5AI9A 1RDFA 1SWWA 2W4MA 5AVYA 5ALFA 1RLMA 4XOUA 1XVIA 2AGVA 2IOHA 3CNHA 2EATA 1YS9A 1Z4IA 2QLTA 4AS2A 5AHXA 2I33A 2YJ3A 1Y8AA 3I76A 2RARA 4UM7A 3NASA 2I6XA 2YMQA 2AMYA 5AW7A 1RLTA 4NV0A 3FGOA 1EK2A 1VJ5A 3AR4A 5ALEA 4CE6A 4Y3UA 2ZBEA 2OA0A 3E81A 1NF2A 3N07A 4UARA 1CR6A 3QUBA 5AVSA 3R9KA 3WK5A 1IWOA 4EX7A 3SLRA 3SHQA 4B6JA 1Z4KA 1RC8A 3KD3A 4H1WA 2FDRA 2X4DA 2BDEA 4FFDA 5T41A 2HDOA 2YBDA 3ESRA 4EENA 2CFRA 4YCNA 1N9KA 2HO4A 5IT4A 3ZW7A 1L6RA 1TA0A 4XE5A 5AICA 3A1EA 3B8EA 3U7EB 5ALWA 1JUDA 2FUCA 3MN1A 1QQ6A 1L7NA 3ZTYA 5ALVA 4HGNA 5ALUA 1TE2A 3E8MA 3L8FA 3N8GA 2G0AA 4NFLA 1WPGA 2IOFK 3I28A 1F5SA 1Z5GA 3OPXA 1YMQA 2W11A 2YJ5A 2HEGA 4Y2SA 3AR3A 2GFHA 3OTQA 4CNQA 2ZBFA 5E0OA 3I1YA 1O08A 3P96A 4G63A 4BKMA 3EWIA 1ZD2P 1ZD5A 1KYTA 1U2TA 1X42A 2OM6A 3QX7A 5AW4A 5AVQA 4YCLA 1T5TA 5AW9A 5AW1A 2IYEA 3QNMA 4UATA 1ZJJA 1L7OA 3FM9A 2GHQA 3AR7A 4XPZA 3UM9A 2P27A 3ED5A 1NRWA 1U7PA 3QXGA 4KNVA 3QLEA 2HX1A 3L1VA 3ZI4A 1VFPA 4Y2QA 3NANA 3QYPA 4HAIA 2I55A 3KC2A 3NALA 2YMMA 4OHFA 3E58A 5AM2A 1AQ6A 4JB3A 4UAUA 3NUQA 3SKYA 3L0CA 2I54A 2CFTA 4HGPA 2G80A 2FPRA 2Q4TA 4YIHA 5AKZA 4NAVA 1RKQA 4ZEWA 3B9RA 5ALXA 3ESQA 5AKXA 1TJ3A 1ZRMA 4DCCA 3EF0A 3SF0A 5A3RA 2PKEA 3QUTA 3N1UA 3ET5A 4Y2VA 1YV9A 3B9BA 2B1QA 4FYPA 1CQZA 1RMQA 4Y2PA 4Y2TA 1QQ5A 2PQ0A 3QU5A 5ALNA 5IT0A 2PR7A 5A3QA 1S2OA 5AK5A 4BX3A 4DWOA 3QU7A 3W5CA 3SD7A 4KN8A 4C4SA 4BYGA 4QQFA 4CF3A 3N28A 2EAUA 3EF1A 4YH1A 5AVWA 1Q91A 3CZ4A 1Q92A 5AW5A 2P69A 5AK6A 2C8KA 2R8ZA 5ALGA 2FPWA 4KYTA 1RPZA 2NO4A 2ZOSA 3ZX4A 2P9JA 3ONNA 1TJ5A 4Y2RA 2CN1A 3ZUPA 4UASA 2WF6A 4KX3A 2G09A 2G06A 2ZG6A 1RMYA 1K1EA 2WHEA 3ZTWA 3E84A 4BEVA 5AKHA 5AVXA 3WKAA 3A1DA 4EX6A 2FPSA 1TJ4A
chains in the Genus database with same CATH superfamily
2GEJA 2R8EA 2NXJA 1PKXA 4WCFC 4IVRA 4FXOA 4Q03A 3ZV5A 3IQWA 4HLUC 3CRW1 2RB5A 5FV7A 4UDOA 3RSSA 4B45A 3ZCVA 3FOCA 3RF6A 5CB1A 4DV5B 4OSOA 4PG6A 2JAQA 1IC6A 4ZVVA 5D00A 1L7BA 4DPMA 9ICEA 2DX7A 1UP4A 1NW7A 4L5JA 4MV5A 5F3WB 1DAGA 3C15C 4MITA 4UNRA 4UCWA 4IG9A 1HM5A 2JCYA 2ZJBA 2J9XB 1KRWA 1QG6A 1Y1RA 1CFJA 3ORQA 4TTQA 3WHLA 3RKUA 2WJWA 2HOQA 1ITZA 1GL7A 1Y9JA 1Z7YA 2F9LA 4NCXA 1A4XA 3FZQA 3GFTA 1OV4A 1QE0A 5JO9A 5SYNA 3H65A 2DOKA 1P2TA 3VYUB 5KSOA 4MVJG 3TCNA 1TJYA 1BKDR 2Z6AA 4YX9A 2A9KA 3FIUA 3K9QO 1X9HA 2F3NA 2BELA 4UNIA 1ZUD1 3O84A 5CEEA 3DYBA 4M0EA 3UPTA 1IEVA 1L3BA 2BM1A 4JR1A 5KMGA 2O6KA 2JI9A 2ZR8A 1DCKA 2XZPA 4WCDA 1T6ZA 2CNDA 1V1MA 1W4BA 3C3BA 3L8GA 1XZBA 5IVKA 1TLTA 5KWEA 2PH3A 4NM2A 2VT2A 3Q8SB 3L7LA 4PLYA 3DAFA 4H3HB 1Z18A 2ZE7A 3IOCA 1D2CA 4IRXA 4WECA 1M1UA 2IX9A 1GNVA 3KJFA 4XB6B 1MAAA 4OJMX 4TV9A 4CKBB 2EZXA 1ZQKA 1QHFA 3HY3A 4WL0A 5CFQA 1P7CA 4N0MA 5T6BA 4NHOA 1NR5A 2G88A 3W8EA 1DXHA 3WLTA 3LL4A 4S0ZA 4G86A 5KC9A 3OZBA 4OUDA 4P4UA 3A14A 3KHUA 3FDFA 3KQWA 3QE3A 4HMQA 4ECSA 5TGZA 2R2GA 2QB1A 1IZ9A 1N7JA 2CUNA 4ZHQA 3NDRA 2IU0A 5H8WA 4C7MA 3DDOA 3V8VA 2MIIA 3GLHE 1WVGA 3HNRA 2VSOA 1SCJA 1M34E 3H5NA 3K1JA 5BMVA 2J33A 1TOAA 3KHKA 3Q3VA 2QLMA 1VECA 4IH9A 4OI2A 4JX8A 1L7PA 2GS9A 3U5ZB 4MHVA 1EX1A 1ZITA 2YMPA 1JLMA 1XZAA 2EP5A 2X8AA 3S1AB 1BYIA 4E5MA 5AM5A 4UBKA 5JALA 1XSPA 4RKRA 3M5WA 5C5IA 1A9XA 3KHRA 3C6YA 2BMDA 1GA1A 1Y3BE 5JCJA 4TM8A 2E6KA 4RM3A 2H57A 5HIIA 1U9JA 1QHIA 3WAGA 5F98A 1CDOA 4LXIA 1A8UA 4NEQA 1TQDA 5TX7A 2JIMA 2PANA 3EXEB 3ILYA 1KAEA 1G17A 3OTIA 3N39C 3O74A 4TMTA 3ZBTA 4NL9A 2C22A 1J6UA 2FUNB 2HK8A 1T6XA 3HJEA 2H16A 2QU7A 2ZP1A 4OFZA 4LEIA 1A04A 5AH0A 3RJ5A 4BE9A 2W7OA 2GFQA 4C7OA 4RQTA 9ICJA 1E5TA 4N8DA 3DXYA 4AG5A 2BRUA 5LXTF 4BIMA 3FLBA 1OVGA 3PZBA 5AXBA 1MRZA 1RQLA 1G5TA 3PPWA 1BU8A 4KIWA 3S1LA 3KLMX 4AN4A 4YV1A 5KYYB 2RK4A 1GN8A 3ZGYA 2JH3A 5AKIA 4CF4A 1CC1S 2Q3HA 4HZUB 5DNYB 3L0BA 4MS4B 2JEFA 1V9LA 1LPAB 2M1ZA 3BZUA 3RVDA 1HG0A 3IDQA 2CHEA 4W5TA 1W8IA 2FFQA 2QRLA 3P9NA 2J3IA 5GONA 3JQAD 3H8VA 3RIEA 2YY6A 1WZIA 1Y6JA 3NUGA 2GLEA 1ORTA 3JD1A 3TWOA 2ON6A 4M9XA 1H5UA 5GJBA 4MVJI 5EQTA 2PXIA 4Z0TA 1P3Y1 4U2DA 1ADBA 5BXYA 2FJ6A 4GX1A 1ZQHA 2WFLA 4WXPA 3DMRA 4AZSA 5A04A 2D6FC 2XCOA 1E60A 2FWAA 4ED2A 4TX1A 4A8JB 3U7FB 4DQRA 3OLXA 2IKSA 2Q2NA 2BGGA 1Y37A 4UM5A 1EI9A 5DIZA 4K26A 5EEGA 4E15A 3M5PA 4GPEA 1NRJB 4R6WA 1ILEA 2ENUA 9ICRA 1QHSA 3PXEA 3IQDB 4FBLA 3SXUB 2AOWA 5JXHA 4GKKB 3V8RA 4UJ3A 2UUOA 3H18A 3LCRA 3D64A 3TYXA 5CLFA 2CSXA 2FZ5A 2ZAIA 3A1WA 4EFMA 5JPIA 3CF0A 4EY6A 2C2WA 3LCUA 3O03A 4D4LA 2QZPA 2IHNA 1ZA1A 4HWTA 5A5FA 5KQGA 1SXQA 3GLGB 3KBBA 2FTKE 1SUIA 4U3JA 4ZP1A 3W77A 4EPWA 1RRCA 1K7FB 3ZD7A 5HKAA 3ORSA 1GT91 4EI9A 5EERA 4M9HA 3CPJB 3TW8B 3ZX5A 1EUZA 3OIYA 3DTVD 3R9XB 2HJRA 2VK8A 1AKYA 2A9PA 5DQHA 1BEZA 1RAIA 2J85A 4N6OA 3C7AA 3RROA 2YNMA 3HG7A 5ECDA 3DO8A 4WKPA 5JSYA 1NHWA 4XCXA 1VCMA 3G7UA 4IO1A 2REQA 3KQNA 2G71A 2B82A 1KZ7B 4P4MA 3U31A 3C2QA 2XNHA 4CLHA 4FDLA 4BWGA 5ICCA 5AVVA 3FAZA 1RD4A 3KZOA 2Z6QA 5IJWA 1CUIA 1ZJ5A 1JHXA 2K87A 2W8BB 4OHYA 2NO7A 2WQ6A 3RIXA 1F0KA 2YZ2A 4RS4A 3OMWA 4JLVA 4XPIA 5DCLA 5B66U 1E7QA 3C74A 2QTWB 1NLMA 3RG8A 4D9HA 1JR3D 3WLKX 1B4DA 2FQYA 4F5YA 1ND5A 2QLNA 4U2GA 4G0PA 3G59A 3LI2A 2B83A 4JB2A 2AN4A 4AKTA 1ZQ1C 1NN1A 5L1LA 2Q9AA 2VJAA 1W9MA 2X40A 3PT9A 4Q9NA 5T3YA 5B5SA 1I3NA 2XUHA 3S8MA 1FX0A 3I83A 4Y2UA 1VYHA 2DECA 1K86A 2PUTA 5IUKC 4A8PA 2C8JA 4KPYA 1GNTA 3NX4A 1Z6YA 4PZDA 3HR4A 4AZVA 4CHTA 3LTNC 3DD1A 2YNMC 5A6SA 3MWEA 1O95A 4KCGA 1WB9A 4NCBA 5FBRB 1ZD9A 3OCXA 3FNBA 4DKXA 2XUDA 3CLSD 2QIPA 1Y1SA 2QPOA 5DISB 4E6PA 3BBLA 4NWIA 1EUQA 3EZ9A 1ZGZA 5LNK1 3HUUA 2CJPA 1C3OB 3WGHA 4NLCA 1CLUA 1LSUA 2ZJ1A 1Z00A 1P72A 4EG6A 1SVNA 2FUG1 3LPDA 1AD2A 4CLRA 4QZGA 4YROA 1R8YA 2VYVA 4I55F 2MYTA 3GV7B 1U4OA 4IJWA 5LYJB 4RQ0A 3IVRA 3RYFB 1SPBS 3FVRA 5BSTA 4R1LA 4X1OA 2FJ0A 2UU9B 4J0HA 4TGLA 2PMWB 4QSHA 5H70A 3HKBA 3JQQA 5TGTA 3RUDA 5L4SA 1UZNA 3IODA 4DC0A 5GJWC 3TECE 5DB4A 2BZFA 4R1TA 5KU7A 3DMFA 1T2DA 2NU7B 1S5LU 1YZ3A 3HP7A 5KFVA 3K0CC 1JPVA 1RC0A 4G85A 3F7MA 3GYBA 3SZGA 1UZLA 3CRQA 2G40A 1QH1B 3GEEA 8ICNA 1SGGA 3OG9A 3OPYA 4QOHA 4YRGA 2X14A 3KQHA 3DLIA 1MEJA 1DAKA 3U0VA 1Y8RB 4ENPA 1AA6A 3NT5A 5TDHA 4NBNA 1SC3A 5JNVA 2Y0SC 4ME6A 4UOZA 4D3YA 1Z74A 3Q9UA 2O2ZA 1WHTA 2WWVD 4ESHA 4J9MA 3UH0A 2IOQA 1JMSA 5JZBA 4W9MC 2RE8A 1H8ED 3FCXA 1TB4A 2D59A 2FDCA 2FH5B 1WQ3A 2ZUSA 5BWOA 1ZVKA 1JG2A 5ESDA 1KFTA 3OQMA 3MJRA 3AH8A 1AM4D 3F7OA 3MF4A 1SHUX 2OFXA 1L8AA 2I4NA 3ND9A 4KVAA 4PYOA 1CTQA 1RRVA 4EKIA 2VTVA 3PFKA 1MC5A 1DT5A 4WLUA 4G4GA 4PFKA 3DP9A 2R8PA 4LZGA 3WGUA 1D6SA 2GN4A 3UTCA 3FR8A 1Z7BA 2I4LA 4JYMA 2I8CA 2X3UA 3MW8A 3X43A 1UXIA 1ZJZA 1AGNA 3HA2A 4LRUA 1WY5A 5AVRA 3OCYA 4I5EA 2YN2A 3KKNA 2WF5A 3RJJA 1KQPA 3E7FA 3EVTA 4JT4A 5ENDA 3UAWA 1UXGA 1ZLXA 4Q4LA 2AXPA 4YRCA 1KJ9A 3F3KA 3QHAA 3AL0B 3RR7A 1Y8QB 2ZR9A 3ASUA 1FLDA 3HYSA 4XB1A 1USGA 1Y42X 3SJAA 1NJYA 2HU5A 4O5OA 3B89A 2X0JA 4ZYUA 2AR9A 4M38A 3GJTA 4JLPA 1XQYA 4JITA 1FXSA 1OBHA 3AEKA 1FRQA 2FRXA 2JC3A 4LV6A 3V9PA 1ZQEA 4REQB 3U60B 1VLZA 2OK8A 4M99A 2C2HA 2XWBF 3RASA 4XFKA 4KR6A 4C0AC 5BORA 3T9FA 1DG3A 3RIMA 4BO9A 3D1JA 5J4LA 1OH5A 4DQSA 3CP8A 5AJHA 1DIBA 1G9XA 1H69A 4MQMA 5TMEA 1XT6A 3R3ZA 5J58A 3P27A 4I4IA 3SE0A 4RTRA 3EDOA 1HDIA 1YRAA 2AC7A 1UKAA 4LQ4A 1ZNZA 3QBJA 3VKGA 4BGDA 1E66A 3TNFA 5KOYA 2WUVA 4JDUA 2F4NA 4K86A 3JRNA 1OFUA 1H2XA 2KE5A 3F5QA 2PMCA 4YC7A 2P1RA 4J29A 4DUPA 1KY3A 3GA7A 4EQ6A 2V97A 3G2QA 4OU4A 2HQ1A 4GOJA 2OA0A 4Q6WA 2NT4A 2J0VA 1FTGA 3PK0A 4QXMA 1R6UA 1Y1TA 2VJMB 3M4YA 3PR2B 1Z29A 3CEMA 1CERA 2LCIA 4FLEA 4D4JA 4LMAA 1VSUA 2IHBA 2E6UX 2LKCA 2Q1SA 5JDCA 4P2GA 4H1WA 4DR5B 1TECE 4OHXA 4DUYB 5L3QA 1ECJA 1DZIA 1E6EA 1ESNA 2I03A 2Q50A 1EX9A 3N05A 2RC5A 4TKMA 3EODA 4NL4H 2H92A 1SUBA 2HDOA 3ESRA 5CNIA 2C0PA 5DHRA 1NHGA 4AF7A 5A3JA 3BA1A 3QPUA 2JLBA 3PUJA 4BFXA 2ZS8A 1FP4B 1VLBA 4PZZA 3ZW7A 1CX9B 5K8CA 3PUHA 3PF8A 3O95A 4D8UA 1WA5A 3GFOA 3BHIA 8OHMA 2XZLA 1JUDA 1LB1B 4HDAA 2B4KA 4FFOA 1U2ZA 2QQEA 1NPYA 3QVKA 4EG0A 5IYZA 4JSTA 4TN1A 3I61A 2YKGA 1OIWA 3V2GA 2HJ9A 1R18A 3E8MA 3I1JA 1T6YA 1BGXT 2F64A 2VPIA 3ETDA 2FWIA 2QTFA 3L6RA 3N8GA 4Q3EA 4WA7A 4PN3A 1YH3A 3VR4A 1MJHA 1LQTA 3EC2A 5EP1A 4ROTA 1N6RA 1V11A 4KREA 4K3UA 4MTCA 3ISVA 2O8DB 4F84A 1P9OA 2CHGA 2W11A 5F1KA 1FXWA 2X8JB 3DTYA 3N74A 1OAOA 4HSEA 1LPSA 5ICFA 3SSMA 4Y2SA 2FZWA 3QELB 3EQ6A 1TRKA 4MYHA 3WL3A 5JRDS 1BWQA 3V97A 4MRMA 1HG1A 4Z9XA 2H5JA 3FTNA 4R2LA 4NENB 1TM3E 2BHSA 1NDQA 2DSNA 4OOEA 2OMKA 2KHQA 1GSHA 2HBLA 2J6CA 2YYSA 4Q8EA 1CJTC 1SH7A 1KO8A 3CRMA 4MB2A 3SFVA 5HZKA 2AFIE 3EWIA 3ZHUA 4V1CA 2OGSA 2QL6A 4XD7D 1C1YA 4PGGA 4AY6A 2ZAYA 4P54A 3KQPA 4ACOA 4OJ6A 4O02B 1PVPA 2H52A 2D1FA 3FUTA 2SKCA 2PGLA 4GOND 4MW6A 2PZAA 3FD8A 2D3TA 2V6MA 2VDWA 4G8BA 4TWRA 3DCNA 4TTIA 5CP8A 1MA7A 4DCGA 3I6MA 1SKUA 3PWZA 2YC4C 5BSGA 4OHVA 3UT0A 3ZHCA 2HLDD 4CMEC 1U7PA 3ZWWA 3LUAA 1UQRA 1IWPB 1IHUA 3KE9A 4FFPA 4CU2A 1DO8A 5T67A 3UGQA 3QYPA 4GFJA 4GP6A 3G9UA 2XB4A 3HRKA 1A5ZA 4O4LB 3K1AA 4UAWA 1GU1A 4OBWA 4R8VA 3UOWA 1CY1A 1U9ZA 4DCSA 1ADFA 2CDBA 4DNOA 1YFLA 3CNQS 5AM2A 1E5DA 1ORWA 3DHEA 1E92A 3RTEA 1NA5A 5H9VA 3UK2A 3VU1A 3GLFB 3KZKA 4JOBA 2YJZA 2I54A 3CLHA 4I2FA 3VZQA 3DZBA 2Q4TA 3QNUA 1YRHA 5ESRA 1S3GA 3JVIA 5K4GA 4HH4A 1X7YB 1DC4A 4L1KA 1IU9A 4H1UA 4UXHA 4HAOA 4OREX 3UXPA 3VKUA 3AIMA 1EQAA 1JSCA 4DBZA 1ZRMA 2V65A 2VLIA 3JZIA 2Y1CA 1JALA 2X4GA 4XIJA 4QBKA 4LSMA 1CDDA 1PJTA 1KPIA 4FHGA 3U0BA 2ZWAA 5C52B 1SKYB 2R6JA 1NZBA 1ABEA 2PKQO 3RAFC 2G5IB 3DVLA 4R1SA 1AV7A 3QU5A 1CNMA 4RQ7A 1VP3A 3B36A 3QF7A 2X9NA 2CHQA 4L9SA 1BN7A 1XDZA 2FEWB 2Y66A 2CVOA 3L07A 4GXNA 1GGMA 4LZDA 4JB0A 4R05A 4U7PB 4C06A 3G6KA 3N7TA 1DADA 3QI2A 5CMLA 4HDKA 5DSXA 1GQQA 1KOFA 4ALJA 1Q0UA 4BUGA 1FVHA 1X70A 1YDMA 3ME5A 2CD7A 4ZCRA 1JIKA 2NUAA 1C2TA 2PUCA 4DOAA 2DFPA 4X7BA 3KAQA 2NV0A 3AERA 2YUIA 3P2MA 5DCYA 4CUKA 1IN1A 3UICA 3M8SA 3PVCA 2VZ9A 3QVMA 4EBBA 2OCGA 2ZS9A 3U7QA 3GDGA 3JQDA 2KJ5A 4U2FA 3RS7A 3ZQUA 5IIKA 3CQ9A 3HCEA 1KI6A 1RPZA 1W4LA 1YR9A 3QEBZ 3KKOA 4DDHA 2V7VA 3IL2A 2RGRA 2E89A 4YAGA 4Q00A 1UT8A 1YA8A 4HX2A 1LBIA 1MZVA 1PQWA 1V1RB 4M53A 4HMPA 2DLNA 3LD9A 4XGIA 4IS7A 3K0FA 3NJ8A 2ODWA 5REQA 3DUFA 4BJ3A 4CMHA 3R0QA 1RLJA 1KOJA 1QC5B 3H11A 1AHHA 4LRYA 2JD1A 3F6PA 4V24A 4IDNA 2YICA 3FPEA 4R68A 4QATA 4ENRA 3HWWA 4URWR 4JT9A 5EL0A 2NZYA 1AHPA 1I4DD 2VHUA 3UOGA 3AIOA 5AUQA 4RE5A 3KKMA 4DSKA 5H68A 4DT1A 1RWWA 1M2FA 3NQ41 5JSHA 1UJBA 3AEZA 2WIGA 3DOFA 4E33A 1AMNA 4ZRNA 1V7ZA 4QWWA 3QFFA 1V5FA 1H0KA 1RAEA 4NLZA 3P0HA 3W79A 5KEIA 2OV6A 3SY8A 2P9ZA 2ZBGA 1YBMA 2XRFA 1YB4A 3GG9A 4P4NA 1CLEA 5G4KB 2C9MA 5IAGA 2VDVE 4AB1A 1B14A 1SXHA 3GUCA 3K9LA 4FX2A 4RF5A 1SCUB 4BBJA 2ZSKA 3OHBA 1J2EA 1G21A 1YZGA 2JFNA 2ZK7A 1GCOA 3Q8XB 1B74A 1ZQIA 1EFLA 4D5GA 3LCJA 1Z0KA 2WIDA 1E4EB 3I9LA 1IONA 1RJGA 2I6FA 2ZAGA 3EGXA 4FSXA 3Q8PB 2WILA 3MMZA 3RQIA 1FQJA 2WWRA 1T4MA 4JSYA 3QIAA 5IEJA 1B16A 2UVQA 3VYTB 2J8ZA 1BWRA 1JEQB 1Z45A 3MT8A 3OA0A 4MVJA 3W3ZB 3W8NA 4RJJA 4HB0A 4P7GA 4I0WB 4M60A 4YWJA 1D8TA 3DQPA 1Y7TA 1QS0B 4FGUA 4XX1A 3O93A 1AGRA 5G0SA 4ZK2A 6YASA 5AVTA 3MBOA 2HMVA 4RSRA 3LT4A 1SBQA 2EGHA 3P0JA 2Q0QA 5HZMA 3KCNA 3KQTA 2R00A 4QD3A 4RPJA 5A9RA 1DHTA 1FW8A 3WB2A 3QE0A 1ZVMA 1ZQMA 1ZQTA 5CRXA 2CMFA 1OWLA 4MV4A 4AUMA 3Q9LA 4CMBA 5ALSA 1EPUA 1U5BB 2C5AA 1GZ6A 2NZ2A 3I4LA 5IK2D 4DV1B 5HZHA 1DP4A 4IYRA 4H15A 4LF8B 2H9AA 3AM4A 4CEIA 1ZFNA 3V7LA 3RS9A 5CDTA 3Q7IA 3FNRA 4LTNA 4NOMA 3NAGA 2P6UA 4F93B 3PD1A 4K2HA 1AKNA 2OC9A 1U3TA 4G81A 1G5PA 4QQRA 4XRHA 3SFZA 5BURA 1NNEA 3N75A 1K9VF 1NUPA 1C1XB 2P2GA 1JHYA 2PLAA 5T8KA 3MIZA 4NJEB 3CLSC 2J3HA 3ZE6A 1F6BA 2A94A 1BMTA 1RRPA 3GN1A 3RM3A 5P21A 1QRAA 4DIFA 2RGNC 2IWRA 4BVHA 1Y7LA 3TD2A 4ZZIA 3ADCA 3SU8A 4ALIA 1COWA 2NV6A 3WFJA 5EKUA 1M2HA 4ZAYA 3V4FA 3R5FA 2VH1A 1QONA 2WZQA 3O9ZA 4DM3A 4XLTA 4TMYA 2OBLA 1JDSA 2QLBA 2Y2VA 4XJXA 1UDRA 2MT9A 1L5UA 5E4JA 1K8QA 4CL3A 3LOPA 1Z2OX 1XMXA 2C4MA 1MG5A 2QK4A 3D0OA 1XCJA 5J0QA 3WXMA 1L5HA 4B3MB 4Q1AA 2LW7A 5ALMA 2PKQP 1PR3A 1J33A 4GYYA 3GGCA 4PC3A 5CXXA 1OA0A 4ZXFA 4CW7A 4J0CA 3DL7A 3O2QB 1FJ2A 1U7HA 1L5RA 2PWPA 1JN3A 3AK4A 3RSLA 2A4MA 2P4EA 1KMIY 1FP1D 4J9SA 1J00A 1NKEA 3UK0A 5AUOB 4QZIA 4RV9A 2DCUA 1OBOA 1WXEA 4G5HA 4RHUA 1EYZA 3ZWBA 4BFYA 3C85A 3PXCX 1GL9B 3C21A 1DAHA 4GZ6A 3J7AC 3JALB 2UZ1B 2JLXA 4OB8A 2YQZA 4LDNA 5A9SB 3IERA 3ILVA 4B32A 1S2NA 3PSPA 1JAZA 3MUOA 2JL1A 2F1KA 3LZCA 4EO4A 1VBKA 5B4VA 5KPDA 2HA6A 4EM6A 1JR6A 1Z8NA 4MW4A 4GICA 3ZWKA 4ROSA 2C1XA 3KBOA 4F4KA 1ZAKA 5LJLA 4I2CA 3AJDA 4RQNA 3NWEA 4EA7A 3Q7EA 2AMLA 1U49A 1PD1A 3I39X 4QU0A 4EMSA 4YMTA 1AMUA 4NLGA 4L5BA 1A69A 1FIUA 5KQSA 4HGQA 4EJFA 2PFPA 4HS4A 1U47A 4RZXA 4RHFA 3RUEA 4M1KA 4MJLA 4FM9A 1XWIA 3KKPA 2IZ0A 3FWZA 3P0RA 2ZBDA 3GNQA 1EFPB 3O4HA 3ZUGA 2H8KA 1XVUA 3D2NA 3SSOA 1IG3A 3ZU6A 5AW0A 1NF9A 2LPEA 2OBFA 3CCCA 4I1RA 3VPFA 4JWKA 2GJ8A 2W9BA 2PL3A 2CE7A 5F76A 2Y9TA 2IHKA 1ZH8A 2LIVA 3MQ4A 3L3BA 4HDQB 2W6PA 1P1CA 4UBIA 1D07A 3DDNA 4TXJA 4DW8A 1RKVA 5IC4A 2P4QA 3WLPA 2I5HA 4EHAA 1J0BA 4OKSA 1JQLB 1KEVA 1C8KA 1PP4A 1NY5A 3PVXA 4JMLA 4KLZA 4MQ5A 5FULA 2QUZA 4JK1A 4BLQA 1BDMA 2DFDA 1PWHA 2W2KA 2ZSBA 4IOKA 1ACLA 4ANFA 4BE4A 4GF5A 1BW9B 3AKEA 5JHGB 5JI2E 1ZH4A 2P3OA 3VR2D 1N61A 1II8A 4A9AA 4YV2A 4O59O 1W93A 5AOBA 1U8YA 4JBHA 2X1VA 1T26A 5JY1A 4Q12A 4E2ZA 4C3VA 4UE3S 1CQXA 1QWSA 4QTZA 2G8LA 3FOEC 4QG3A 1R9GA 2W93A 4II3A 3SJUA 3NI2A 3LDGA 4MWDA 2DHEA 1FYFA 1XDGA 1E6UA 5JAZA 1QKJA 1P2FA 1ZJ4A 3JSXA 3IT2A 1SBCA 3AP3A 5HKLA 4D9EA 3C1YA 3ELYA 1N5MA 1G41A 3D7RA 1EK0A 1IAVA 3PTZA 1KAQA 1RWKA 1THZA 1C7IA 4DEZA 1RRMA 2IZ5A 4EVRA 2R44A 3O26A 4KLNA 4Z6KA 5LQRA 4R8KA 1LJLA 2JI7A 3PUZA 3DFIA 1Y3AA 2HSJA 5BV2P 3NVWA 1P0FA 3OSNA 2AKAB 5DGBA 3OWXA 3MILA 3FTEA 2VDKB 4QXQA 2VPYA 3I2JA 2GLUA 5G2OA 1X6VA 3TTVA 5A02A 4WZZA 5KYGA 1XZEA 2B8WA 3AUKA 1IBSA 3AKCA 3MRXA 3ANTA 3AU9A 3KVRA 2RBKA 4TSRA 4UCQA 3T7TA 3ZY3A 5JCZA 1UFRA 2ZI4A 2WSBA 1DJOA 2OBXA 5T3UA 3PGVA 1S1MA 1SFRA 1PJQA 1PZFA 2PR2A 5CWRA 2WZDA 3HYRA 3P2JA 4G0OA 1A7JA 5FI3A 4DMLA 4GOOD 4AJ4A 2XQVA 4D4GA 5DN6D 1B7GO 1JWAB 4K6GA 1DBQA 5JNLA 2G08A 2I6GA 1WZ2A 1SAYA 2BUAA 2EEPA 4L7VA 4G2NA 2X9QA 4EY8A 3H1EA 1S0MA 1P8JA 4CDMA 4R9UC 4QZCA 2L82A 4GPBA 4URFA 5B58T 3RC7A 4ER3A 2PBLA 2OEHA 4M0PA 3THWB 5J43A 1SO8A 1DFGA 4RUAA 5LQCA 1EH5A 1PBNA 3PIIA 4FZMA 2FUKA 1Z1BA 4MKXA 5E6SA 4YJ2A 2MSNA 2FWPA 4CKCB 3CEAA 3TMYA 1NBAA 2IYUA 3HW8A 2E87A 4MYCA 5KTSA 4PHTA 4N1AA 5T14A 3NHUA 3HU5A 4C14A 4RIIA 4FFLA 1Q17A 1B0AA 4HAUA 2ZRFA 5KFEA 2I3BA 1Q1QA 2HCTA 2BFOA 2JVIA 3OOWA 2LKDA 5DSZA 2Z08A 2I22A 4GLJA 4HV4A 3TW4A 4D74A 4ZI2A 3B52X 3X1ZA 4JEIA 4E7OA 5JJCA 1XZ8A 1BS1A 4XQ0A 2QRMA 4MK4A 1VI5A 3T1NA 3UVEA 5DBBA 2LRHA 3ABZA 1D9ZA 4URZR 3ICPA 5IJZA 4WAUA 1XZKA 1TK3A 1DAFA 4NPCA 3TIGA 5CB6A 3X1JA 5TQVA 4LVSA 5K2MA 5KFTA 2P4UA 3SWWA 4Y2YA 3NEJA 3GXBA 4OH1A 4L3VA 1RAHA 5TVGA 3SNHA 4E07A 4ICAA 5FPYA 2XUAA 1M72A 1WBBA 2Z3ZA 5KT3A 2QUKA 2Y1KA 3ZZNA 1XEAA 1E2GA 2CHFA 3WLQA 1KFCB 5FTMA 2F8TA 4A6PA 4AY3A 1P91A 2XWJI 2R6ZA 4DJ5X 4IZIA 5KYUA 3ZWVA 1FTQA 4JI3B 2AQHA 1BA3A 3CSUA 4HN2A 3ZV7A 2BY4A 1XKTA 3F2VA 3GNTA 1CUKA 3NTOA 3RS8A 2QYHA 3LUFA 3LYLA 5DI9A 8ICLA 2OKGA 4G56A 3AW8A 4UTPA 1KKLA 3T54A 2EW1A 2O1EA 3M3PA 2OHHA 3UB3A 4QJIA 2R00C 3PHCA 2WYWA 3GROA 2XDYA 3VPHA 2JDID 4G5FA 2G5CA 3HU2A 2Y27A 3LUGA 4EGJA 2KK0A 2H2GA 4DYDA 2QMUA 2IIVA 1BN6A 4HQNA 1SBHA 4WNAA 3JARA 2VIIA 2EG9A 1FL9A 4PQEA 2PV7A 3WIVA 3Q88A 1AOXA 1ISFA 5D5PA 2AFHB 4CJXA 2WT9A 4YAJA 3ZIUA 2VC2B 3M8RA 2C1EA 2WDPA 2XIJA 2VI5A 3EDQA 3LQ2A 2EKZA 3M3HA 4IDPA 4YJHA 4Q7QA 2OHFA 4P0QB 1VFNA 2EZ9A 3ANMA 2Z6UA 5JH7A 3UIEA 3V1TC 1SV0C 2R8JA 1D7OA 1SUWA 3E0XA 3NHBA 1LDBA 2YJ3A 1WU8A 5JNUA 1CIPA 1HOTA 5JS8A 1XRJA 1GZVA 3CH5A 3IQFA 1W0JD 2Q28A 1MPTA 2ASEA 3C4QA 4OYHA 4DIEA 4XQ8A 2PL9A 5AW7A 3TUZC 2IXEA 1PFYA 5LL6P 5KFDA 3LPMA 3BJYA 1F1BA 2WVHA 3GD7A 4LDRA 4MV3A 4DSOA 2F4VB 1OLSB 3GH1A 2VHQA 3TLZA 2HIGA 3VR3A 3W90A 3EDCA 4H2DA 1EDEA 3P9CA 3OT1A 1SURA 4PZUA 5DG9A 3J81j 1NF2A 1QTNA 1UBEA 1TMGE 2H51A 1ORIA 3GAFA 3NKLA 2GBFA 4NSNA 2FZEA 2JJ1D 3QZUA 1CJMA 3UK7A 2HVHA 4ARAA 5H59A 2W5UA 4FW9A 4QT4A 3JRXA 4B6JA 1LF5A 1GPBA 1Z4KA 4O3OA 1V6SA 2KG5A 1WXFA 2C7VA 2GYVA 2D5BA 2HJVA 2KLBA 2PJZA 3L7KA 2C1ZA 5B3KA 1UEIA 5MHTA 1X9MA 3BDAA 3KPVA 4EENA 2QTLA 2YDXA 4RKFA 2J1LA 3WAJA 2IBMA 2KJ8A 2XNDA 2HKIA 2YFKA 3SZLA 1OHHD 1TA0A 1T5HX 2J4FA 4XE5A 1X7XA 4RTKA 5I8ZA 4ETNA 4U63A 2YXDA 4JLDA 4MCJA 2JKZA 3HJFA 4LTMA 4QTYA 4RYLA 2AJQA 3UUWA 2F3TA 3SEQA 3K0CA 4Z3KA 1KAOA 5JMWA 1L4MA 3HR8A 3NRCA 4LIPD 1XNGA 3OZEA 4EBDA 1TVEA 2HNBA 5K03A 1AS3A 3ZV6A 5KVAA 2BSQA 2D2FA 3PLNA 5J2JA 2DHDA 3VNSA 1E1NA 4Z9FA 5I9IA 1OC4A 4RU9A 2GK4A 1F51E 3H6KA 1W4ZA 3GK3A 4I8IA 2WTXA 4TKUA 3WZMA 1ABBA 4R98A 1G59A 4UE2A 1FU8A 3NBQA 3E15A 4OQMA 4J9UE 3WJ1A 5K0BA 1J0DA 4UDXX 2B8NA 4BNMA 2FW7A 1Q7GA 3WGJA 4ZYVA 2Q6OA 3HL4A 4HDOB 3VNRA 1V0JA 2PT5A 3QF4A 4MKRA 3UWPA 5JCOA 4AZ3B 4EHJA 4BKMA 4DQKA 1O6GA 1D4AA 1KYTA 3I5UA 4ZIRB 4V0OA 4AAYA 3QKIA 1FFXA 4JFRA 4QLAA 2DWQA 1CJUC 4PLHA 2YVKA 3M82A 4UNNA 4DHEA 1CR1A 3ALRA 1E8DA 3AM5A 3QNMA 3EBLA 1UMKA 5CLHA 3PGMA 2J3JA 3PFIA 5ITZA 1Q0PA 4BFVA 3DZCA 3ASZA 1P1BA 3C6ZA 3DPSA 3NVMB 3AR7A 3ZWAA 4CR6A 3VAAA 4D97A 2Y93A 1DQSA 3UT5B 3HXOA 3D8SA 1C9JA 3ACCA 4IV0A 2WJAA 1R5JA 3Q2OA 4YRDA 4AO8A 2W00A 1TPYA 5DHSA 3IAFA 3CO5A 4Q4AB 3CE6A 4LJ9A 3TIVA 4TS3A 3DW1X 4OXXA 4RQBA 3COPA 3VJRA 4E1AA 2J3DA 3V4LA 1ZKMA 1I2DA 1BDIA 2F76X 2OO5A 1MA0A 2GD2A 2XY5A 3MLBA 5KFWA 4ZCPA 3ECAA 3HUDA 4FYYA 3UYLA 4NG5A 1S1CA 1WULS 3MVEA 3WE7A 4FINA 4JYAB 3OUTA 2YIMA 1P1RA 4OFXA 4PIMA 1YS6A 3I9MA 3D4IA 1HDCA 4DKJA 3GPBA 3V9AA 5JR3A 2YY7A 1KMMA 4L15A 4TURA 5AKXA 1AKTA 1D1PA 2V7TA 3L0IB 3PGKA 4AT1A 3B1YA 3G82C 2G72A 3B78A 2VO1A 1SL2A 2A9VA 2LKYA 1DZ3A 2GJ4A 2WT4A 3ET5A 3JYOA 4WH0A 3WLAA 4EOGA 4HT3B 2ZGVA 1N2CE 1N2OA 1YV9A 1AU9A 3HS3A 3A9WA 5AHKA 5B64A 2PMFA 3KE8A 4EZBA 1T6BY 2P75A 1C4XA 3BK1A 3LH5A 4LQLA 3PHJA 4KXVA 3IP3A 1Z82A 5IT0A 1B8VA 1CJCA 3ISBA 2NADA 2I1VB 4B9TA 2OPBA 3F5SA 1V35A 3K1YA 4ZODA 4BZZA 2YW9A 4JBLA 2HSEA 4K0KB 1TGYA 3ZCXA 3U62A 5A0TA 1BJKA 1Z3IX 1FMJA 3JPSA 3M89A 3SBEA 3TFRA 4PGFA 4CF3A 2D3DA 2F2AB 4IV5A 3DLAA 3EWSA 4NBKA 1D6NA 4RZ3A 4YH1A 3VOBA 2QBYA 3NH9A 4V0QA 2CF5A 1U0LA 3UXMA 1B76A 1ZOPA 3IB3A 2UYCA 2G6BA 1EWRA 2O0HA 1PT6A 2SNIE 3ITEA 4CU5A 2R8ZA 3LOUA 1L1RA 3WJ2A 1LDNA 2ZSDA 4B3CA 4FFVA 1F44A 1NK6A 5J0UA 2CHVA 2IQ5A 1AHIA 5AHWA 2OXIA 3D6NB 3MWYW 1O95C 5EC8A 4JP5A 3T5MA 1FUKA 4FYWA 1CE8A 4B9VA 2VSXA 1I4EB 4R83A 1U0NA 4KQEA 2Q49A 2CN1A 2C9OA 3R6DA 1VM6A 3CLTD 3D6UA 3DPIA 1AF4A 4NCNA 1QDLB 4U9UA 5BYAA 2XECA 5JY6A 2QARA 2G9VA 3ABIA 3BHJA 1HURA 3BWYA 4L5YA 3UGTA 2H2WA 4AQDA 3V3TA 4EJ0A 1WMEA 2VPPA 1A7UA 1ZUWA 2RJ3A 4KYUA 3T7AA 2C96A 4M1ZA 3PDCA 4GI7A 2ZI5A 2H7XA 3AVQA 4RPCA 1DC6A 3AI1A 3OY2A 4LI3X 4B3JA 3EBPA 4OK5A 4EF5A 4ZEOA 3CH4B 3O8QB 4EUSA 5KYNA 3VTZA 4DRZA 2XD4A 3M4ZA 4R64A 5BYKA 5EKXA 1PVRA 1RWMA 2JKYA 1CUVA 4ZEVA 4GAEA 5D3MB 3E2IA 4C22A 2TMGA 3TPCA 1YB1A 4J94A 2AZMA 2ATLA 3DMYA 4Q1BA 4N3AA 4XVCA 3IVAA 3ONDA 3CLVA 4EHKA 1QHXA 4QREA 2J4DA 4YR3A 1T5SA 1UCFA 2JIQA 2DKNA 4J9PA 2D74A 2H4HA 4RETA 1FLNA 5J2UB 4C08A 3EX7C 3FTDA 1HQDA 1U3WA 3HMQA 2JVJA 2GN6A 4IXNA 4YDSA 2OBYA 4GDFA 4US8A 2V74B 3MJHA 3GIJA 5LA6F 3SZRA 5LQMA 4YA6A 4IILA 4YMSA 2WIBA 5KU1A 5J2TF 2GK3A 3IULA 1ODLA 5IMSA 3G6XA 4YTEA 1P19A 3QKRA 4ZI3A 1OI7A 3DFFA 2V4QA 1NDHA 1E0SA 2FAXA 3O92A 4GG1A 2PX0A 3S2ZA 2RI0A 4J2TA 1TU0A 3RK4A 1SU7A 3DO5A 3H3XA 1TIPA 4U7FA 4XZ3A 4IS3A 3Q7SA 4BAUA 3BCHA 3TKLA 3PJEA 5IINA 4PAWA 3VYSB 1VJDA 1NDUA 3PCXA 4D4IA 2XCTB 2H1RA 4C4ZA 1GQFA 5FLKA 3O8BA 1IYZA 4Q7JB 2GZHA 3BWDD 4C6TA 4CIXA 2Y9UA 2VK4A 5AOVA 3MHTA 1NYLA 3VAZA 1DAPA 1WBJB 4OD0A 3Q8RB 1J25A 3D2LA 3DKRA 1MG0A 4IQFA 4PS1A 4RA9A 1UFVA 2XY4A 4RF4A 4Z4EA 3A1NA 2RIPA 5EIAA 4RDHA 3LL7A 1FFSA 1IDN1 4Q9LA 3HILA 4D9MA 5JZOA 4K8RB 1SGWA 2H1SA 2VEOA 3BB1A 1V97A 3K15A 2IV3A 4FZVA 4NLBA 2AQ4A 1JTVA 1NOKA 3IAXA 1JDTA 5IUNC 5KSWB 3V4ZA 2O8BB 5J2CA 4HNQA 2C4TA 2VAXA 1QV9A 1FFGA 1GPH1 3T4EA 1CY8A 3W2GA 1QF6A 1MIHA 4WK0B 2DRIA 4AMYA 1J5EB 5IXJA 3CW2A 4BO2A 5KZMB 4WGFA 3W9UA 4B33A 1TZBA 1V3QE 4O3NA 3DFMA 3SYKA 3R3WA 3PFFA 4Z1MA 3QEMB 3ZHOA 4A92A 1QJCA 2BGNA 2D0DA 3OGUA 1VE3A 2I4TA 2N3ZA 1Q8KA 1M1XB 1KA9H 4DEYA 3K6SB 2JLYA 3JZFA 1U0EA 3Q6NA 3OE7A 2NO9A 3OOYA 4I4CA 1ID8A 3U7GA 3D4BA 2EU8A 4L8LA 3QMWA 3VI3B 4BX2A 4BEJA 2XZDA 3LVFO 1X9XA 3GLTA 4NYIR 1XZPA 3B9QA 2F8MA 2LXNA 3FSGA 3OHMA 4L28A 3SQWA 4RDXA 5MFZA 3PJRA 4XD2A 2CFOA 3JASA 1UDXA 3DTVA 3PG5A 4DR4B 4PEVA 3WHKA 1MW8X 3M70A 4TV8A 4UDNA 3ESYA 1DKNA 3MS4A 2FMFA 2HWXA 1KU6A 3AFOA 4EKYA 3GRFA 4BNTA 3A9CA 1P60A 3DS8A 3IEXA 5EGSA 2QG4A 3CUEF 1EJ2A 4BMPB 2JGAA 2ADFA 5LOVB 2XCPA 2KVSA 4DLUA 3FGNA 4K9RA 4TKZA 5HJ7A 2XQGA 3LKDA 4ZOLB 5F2NA 4HYYA 3L04A 5T7BA 3M7DA 4EHLA 2WA1A 1C2YA 1W0KD 2GVNA 2YV1A 3DMGA 3CZ5A 1OH8A 2NRZA 2R6GA 1O6CA 3HSKA 3P94A 1W4CA 2OD9A 5FFMA 2B78A 4QJFB 1UM8A 3A6HA 3KXPA 1IPEA 2C3OA 5CT6A 3N76A 4DQXA 2JZBA 4W6QA 1UBUS 2WZBA 5CG2A 4KIGA 4BDTA 3QUCA 1NVWQ 1OYYA 2RK3A 2WJ4A 3PEEA 2Y1WA 5AW8A 3OEHA 1J07A 4OF4A 3DOEA 5IM4F 3U4CA 4B2YA 4Z6EA 3V3KA 2PUJA 3BS7A 3WRYC 1L5MA 3GIIA 1GZDA 2VZLA 1ZS9A 3H1PA 2E3JA 2ZVQX 3QBTA 4U7WA 3OPMA 1U2QA 4NBTA 5DYTA 3TXXA 4UM9B 1WB6A 2HBRA 1T4BA 3E27A 3HXKA 5LP6A 4G3IA 1ESCA 3FVVA 1M1NA 1K5DA 1MNQA 3E7DA 4UD6A 2HFJA 1PWXA 4PINA 4R2JA 2OYCA 3VR2A 3J7TA 3HP6A 3MBYA 4WLOA 3OQNA 4DQPA 2WYOA 2CUKA 2Z2JA 4MOWA 4WOJA 4I4TA 2HIHA 5BYBA 3KZVA 2J7KA 4RAQA 3WHIA 4BNVA 2OYSA 1JAHA 5FUYA 1KO1A 2JIDA 1A27A 1VBNA 1XN4A 6NULA 3CCFA 1D2AA 2J0QA 4RJTA 1M0SA 4PXAA 3NBZC 3VNBA 3NT2A 1N36B 1U6JA 3RB3A 3T5KA 2IBKA 4U6PA 2CLKB 5KFOA 2ZJ8A 1N2BA 1CQIB 2JZCA 4GGPA 4GQIA 5EQJB 5KDLA 5TF0A 4F6LA 3GIDA 1N8NA 5EUQB 1ZOLA 1XD2A 5KNDA 5CJPA 3T5AA 2PK3A 4PGAA 3N2KA 1BO6A 1YVRA 2WD7A 1N5KA 1PL0A 4PO8A 4UAJA 4XUSA 4DFKA 1JHVA 5CT8A 1R0XA 3M1IA 1B0PA 3P9YA 1Y1PA 4U9HS 3SC4A 5JVDF 2WB2A 1Y4UA 3OIWA 3TTWA 4RO0A 2PX8A 5EINA 1F2UB 3WWPA 3KJIA 1CVIA 2WLSA 3AP1A 4WFJA 4UBLA 4CQMA 1ZHHA 3AQFA 5TPWB 3QSYA 4UUNA 4B3SB 3ZWDA 1YUMA 2G1UA 2IOFA 4WBSA 2ZIZA 1NE7A 5B3AA 5LQNA 1SA0B 1XA0A 3R0ZA 4W5OA 1CEQA 3HFSA 1R0LA 2PEZA 2AHOB 3QLUA 2XBUA 3FDZB 1RCUA 3MMXA 1BMFD 4CKWB 4U7TB 3E5NA 2ZPTX 5IAAA 2GDJA 2EP7A 1GRNA 3TN7A 1E2NA 1KVQA 3L8HA 4ZOBA 3OIFA 4BX0A 2VCEA 4F91B 1UJMA 1AXEA 1NI4A 4MFCA 1C1HA 1I32A 4ZVRA 1Z36A 3SDBA 3NIWA 2B3TA 1YZ6A 2GM5A 1ZVVA 2XSZD 1JAIA 2N1MA 1OHHA 1Z1VA 2RMKA 1QDEA 4KYVA 1NQWA 3GVXA 4J1TC 4JQYA 2F8KA 1RZ3A 4DUZB 4BO4A 4FW8A 1NPTO 8ICWA 1X3LA 2PX5A 2YYYA 3A58B 3ANXA 3MR6A 4HCJA 4EUEA 1IBKB 3VNUA 2QRNA 2VOJA 5FTNA 3ADBA 5K0NA 4W5RA 1RC1A 3QWHA 3F78A 3RUPA 5KTYA 2UXCB 1PV4A 3U1TA 4CWAA 4GXRA 2QWXA 2QYTA 4QTUB 5HGXA 2O2IA 5CAEB 4PYNA 5J1TB 4O33A 4W9NC 2MSDB 5F9FA 2B4RO 2ECKA 1M6WA 2J9FA 4QJBA 5BSRA 3S2UA 2JJ8A 3OSZA 3PLRA 2R7LA 3PUKA 1M34B 2P3SA 4HNSA 3QTBA 4C1BA 2XMQA 3IESA 2OQIA 5K3SA 3HFRA 1UIMA 3C6MA 3SHVA 4UVEA 2FEMA 1NQUA 3WYNA 3L92A 1GZ3A 4I1OA 4OI1A 1QH8A 5E4FA 1Q1NA 3ZE2B 3QZ7A 1PVVA 2WHYA 2PT7A 3M6LA 2WAMA 2ZPAA 3FKSA 4YLEA 2WTFA 3TQOA 5DU2A 1BJTA 3K6RA 3MB5A 1EB8A 3WRWA 1P9LA 3L7MA 3IT3A 2J0UA 3GMTA 4K9KA 2OBMA 2Z5VA 1C7YA 2Q8QA 4Z0PA 1VLVA 1RWXA 4CG1A 4EAAA 4R2IA 1AS0A 2R1TB 1G2OA 2OHJA 1K5PA 2WR8A 4RY2A 1M76A 1L4YA 1L4FA 3KYBA 2FMSA 1QO7A 4DLPA 3TRDA 4I5GA 3QYJA 4I5IA 2W43A 1XQ6A 4LX8A 4MRVA 3VNVA 3GLSA 5HHTA 1GGVA 3DHWC 3Q1LA 1PN3A 3OKPA 2BWJA 4I2VA 4PRKA 5CLIA 4KXLA 4AC9A 2LGJA 4PYIA 3JRWA 1AN0A 3PRYA 1FMFA 2C9BA 1WP9A 3UB4A 3RTCA 5U1PA 3UXEA 2K89A 3L4JA 4QUEA 1W59A 1HUZA 4G0VA 2KV2A 4ZICA 3BULA 4XYBA 4EYHB 4C4TA 2X8LA 4EHDA 4TLBA 5M2QA 3AN1A 1N7IA 3JAKA 1V37A 3L82B 4FT4A 1D7AA 3QXCA 3OZVA 2B94A 3FGZA 4CT0A 5ALFA 1AVTA 2WMDA 2XR1A 5EXXA 3WAKA 2VHCA 4JLWA 4DO9A 4RPIA 4AZWA 1DIHA 4DGSA 5EPUA 3BMOB 4NFYA 5JNTA 2IWHA 3ZW9A 3PL1A 4ELVA 1W73A 3CLRD 3FZYA 5FUBA 3S68A 1SXJB 3B0XA 2WWGA 2W2LD 4RHTA 4E2FA 4MYUA 1Y8AA 4RORA 4CM9D 1SUCA 3EFEA 5KOJB 1OU0A 4UM7A 3OAAD 2E5SA 1I1OA 1MN6A 4M89A 1Z2EA 4EHHA 4NV0A 4YJGB 1UF9A 2BHLA 3QX9A 3RRXA 1RRFA 3F90A 4EIWA 4U2CA 4CF7A 1VL6A 2H06A 4NECA 5CJ2A 1LX6A 3Q12A 4DLGA 3H2GA 5AVKA 1CETA 3BQ2A 2ZRPA 5K3BA 1ZQGA 4UEQA 4GGOA 4XD7A 4BCBA 2XBLA 3A3KA 5BNWA 5GTHU 3QUBA 5KT7A 3TQCA 3QZ8A 4EYSA 4CMCA 4FOSA 4GUAA 2UZ4A 3EZLA 1P6UA 2FK7A 1TGVA 3OLQA 5EJMA 1EKXA 2ZIVB 1IE3A 5JSQA 1Z7GA 3ORYA 5T8KC 1VL0A 3GFPA 4TYWA 5K0EA 5C1BA 2WQ7A 1TVKA 3NJ4A 1OD6A 3F98A 4A82A 2RH9B 2OXEA 4X3OA 5CVUA 4D26A 3KHGA 4DLAA 3WYEA 1WCV1 2FW9A 2P65A 3CO0S 4G1UC 1T9BA 4QTXA 2ZIXA 1DO0A 1U7TA 3GJ8A 2GCOA 3MN1A 3FOWA 4CKEB 5DWQA 2LPMA 5C34B 1OGIA 5IDYA 5L6LB 1YC5A 4DANA 4CV0A 4QLOA 5D86A 1QIMA 1MB4A 2MYUA 4JROA 4Z1OA 5EWGA 4LJAA 2JK1A 2ZRDA 3M4XA 3PICA 5WRFA 4ABTA 3HO6A 4LOLA 1HYBA 2FHPA 3AFGA 4GI2A 3OZ7A 2B34A 4EPVA 3AHEA 1K63A 4HAYA 1N32B 4AYBC 3ZKWA 1HE8B 1F8UA 4YMUA 3RVBA 1YQQA 3V46A 1QQAA 2WTAA 1Y9ZA 5JJLA 3AETB 3RBAA 3KSAC 1X74A 5K3FB 4EDFA 3TLEA 2QTRA 1NBMA 1M6VA 4DF4A 1ZQBA 2ZETA 2ZJZA 4JD5A 4ZVLA 2YC2C 3BH6A 3FJYA 2PV0A 3E3OA 2DGZA 5I5GA 3VC7A 4F4WA 5B2FA 2O8CB 2R60A 1BCSB 2OM6A 5JAQA 4F5NA 3JX9A 1XTVA 3KU1A 5B4UA 3RDPA 5LP6F 3FF4A 1QK5A 1TCCA 1NLUA 4DSIA 2J6IA 2GJAA 3E3MA 3FIJA 4QXPA 4UU8A 4B71A 1MFPA 1WPQA 1XKLA 2H1HA 4X9XA 1LBSA 5DYNA 3KQLA 1IN6A 2NVWA 4LQDA 2PMEA 1ZETA 2V7QD 4XJSA 1L7OA 1GGHA 3O4RA 2HHQA 4MA5A 3L7JA 4HUTA 2XY6A 2HFKA 1JB9A 1YJ8A 1RP7A 3HK2A 4QELA 5JU6A 5CGQB 4ZJZA 2ZXUA 5KFQA 1KEEB 1U5AA 4KNVA 3ZKAA 4NXZA 3AW9A 1BWPA 1E94E 1IULA 1RIFA 1W88B 2X1HA 1R9NA 2YV3A 3O6VA 4L75A 4MDHA 4Y2QA 4YAEA 4LYGA 5EWJA 5LSAA 3LRPA 2RG1A 1QF9A 2FQQA 1ZQUA 1M9NA 1WXGA 1LW6E 4C0JA 3AGPA 4HEA1 3ID6C 3KQSA 4OGLA 3RABA 3H7IA 4IHJA 2DERA 1JH8A 4YXFA 4AKHA 3A6KA 1DBPA 1SCAA 2EJUA 3QK7A 5JVDA 3M6AA 5J2HA 2OGUA 3M6UA 4QFMA 4H17A 2I4MA 4PYMA 4WXRA 2ASJA 1SXJC 3ZGOA 4B85A 4L8VA 3K9HA 4JWTA 1GG2A 3TJRA 5LNK6 4MQLA 2VPQA 4C43A 2OHXA 4II2A 1Z6AA 4WESA 2H1OA 1H93A 1KH2A 2I8LA 4FOLA 2DKXA 1W4RA 2AB0A 3ZH2A 4JJAA 3GGSA 5FBZA 3EEBA 4OK3A 4ZEWA 2L69A 3TOVA 2CDAA 1U8ZA 5BV8A 4YRIA 2ZU0C 1IVSA 3RB4A 2YVUA 5BVHA 4GQAA 1X80B 4RTQA 2IXFA 1I7SB 2AK3A 2AXNA 4DGQA 3A25A 4RK4A 5CDFA 1ZOSA 1N77A 2AG8A 3A0BU 1TO2E 2GF9A 3CM0A 1Q12A 1QTIA 3ZTTA 3ZS9A 3RF9A 3O0FA 1DTSA 4U0JA 1I0IA 2PQ0A 1DX9A 2KBEA 3WYDA 3ZGVA 1H2AS 2E4WA 2OO5C 3PUVA 3LQQA 4ZVUA 5K6RA 1XVVA 1ZW6A 1AKWA 3WDSA 2WP0A 1E1LA 1H5NA 3T8YA 4FWBA 4FCVA 4KYIB 3KB2A 3DBLA 1VRCA 3T5HA 2PSHA 1ZNYA 3NWJA 4F8JA 4BKOA 3RKSA 4OA8A 4JHXA 4BKUA 1NW9B 2HTFA 3F2DA 3C98A 4P22A 1T7PA 5HF6A 3V8NA 4Z9YA 4MS3B 2BSXA 1XMSA 3K4QA 3VDRA 1TJ5A 4ES6A 1JKJA 2FSFA 3KLBA 4G5GA 4F5WA 1C29B 3H04A 4PO1A 4O4JF 4RTLA 2ZI7A 3LY7A 4Q21A 4OMDA 4D43A 5KDDA 2ID4A 2BOVA 3LE8A 3QKTA 4AJ1A 4YXMA 5EYPB 5J4KA 2VTBB 1A1VA 3KWJA 1GLVA 2PFOA 5HJ5A 3BWCA 2G06A 1DDOA 1ECCA 4YRTA 1A71A 1LS6A 3BMNB 3WRXC 3DF7A 4MMXB 4R1NA 4F8YA 3QJGA 3SCZA 4MUBA 3ZQKA 1WUDA 3RJZA 4AN0A 1ZMBA 3TK1A 4EHBA 1YFJA 1I7DA 4OX9B 8MHTA 3EZ5A 5MN4A 2B1JA 4JUAA 3J81k 2MHCA 1P7DA 2G07A 2R3SA 4EY3A 2CNOA 1BOFA 1GGKA 1GRVA 3PC2A 5ELLA 5JYDA 4WKCA 3PHLA 5CD9A 3JQFC 1K6XA 2H17A 2G76A 2KQUA 3OFSA 4OMFG 1G2IA 4ARIA 1UBJS 5C9ZA 1RXYA 5EHNA 1PJAA 4YYEA 1LK0A 1UM9A 3RAEC 3L1UA 5EIBD 2A0KA 3PEYA 1DPFA 4GM0A 4C7KA 1GTRA 3CZMA 2WHXA 2NX2A 1QU2A 2F3QA 1MO2A 4ENVA 1UBHS 4KXQA 3HB7A 1TADA 1B1CA 1QZZA 1UOOA 4M6WA 4C8NA 2OORA 2GETA 1QP4A 1UPHA 3IDWA 1NVTA 5DT9A 2CKDA 4PH5A 3QPAA 1VJGA 1QRRA 3BE5A 3EPLA 1M5RA 2ZBPA 4R2WA 2IS4A 5BRJA 5AIAA 3TLGA 4JLMA 4Z51A 2O1WA 2VUUA 1AT1A 2GTIA 2NQ8A 4H0NA 4LYFA 4CQJA 4MLCA 3I9V6 5CK4A 3KZCA 3A1SA 3L7CA 4M1YA 4X1YB 4XUEA 4O2BF 4FZNA 2GO7A 4P4PA 1W2GA 2VRCA 3AFMA 5GTIU 4B3IA 5HQTA 1U9YA 4A26A 2DM6A 3GBSA 3VRHA 3K1RB 2Z83A 4AS3A 5DZSA 3PC7A 4H08A 1Y9DA 1Z4QA 4Y6PA 1YCGA 5F2EA 4AURA 1EWYA 2JBHA 4K4HA 2QVCA 1UBLS 4KQ9A 2BV3A 4M47A 4R2KA 6REQA 3UCFA 4QZFA 1DEHA 2F3UA 3QP9A 1IUOA 2A0XA 1J1IA 1ZR4A 2ZW9A 3VVCA 3L7YA 3LF2A 5E9WA 4O5EA 2HQOA 2YDYA 2K4HA 2O5CA 3FPLA 4JOCA 4F3NA 2Q3LA 3R8XA 4NCIA 2J30A 4JH0A 1USVA 1YQXA 4M9GA 2XRYA 3UXYA 3RVLA 4JC8A 1YQWA 4Q9AA 4DJTA 3V1YA 4BBPA 5C3MA 1LEHA 4DR2B 3KV3O 2WJ6A 1CZHA 1GU7A 1H05A 2PD4A 3R44A 3EIEA 4B3DA 3B48A 3D3WA 3FW1A 3RFFA 4D0RA 4KH1A 4CETA 3F47A 3A6GA 2E4UA 2JEGA 5I9MA 3RRYA 2QR2A 5BVGB 1ANKA 2XPCA 3RYCA 3K5IA 4RUCA 2HQSA 5PNTA 3L0ZA 4BO6A 3RYIB 2ZQYA 1FQKA 3H8MA 2FRDC 3MBIA 5EJ4A 4QWEA 5AKEA 3WYBA 2HW8A 3NBFA 2WAQF 1Q7BA 2FDXA 1WV0A 3L6BA 3P2YA 2O2EA 4B4VA 1RTTA 1J21A 1G0NA 1VJCA 3EWAA 5KVQA 1C3XA 2MU2A 4I1IA 5IDQA 5FFFA 1Q15A 4H1HA 2Q62A 1ISSA 4KMUA 1RABA 4ZOQI 5KAMA 1UPTA 3LNTA 3AIKA 2HOFA 2XOEA 2R5NA 3JWEA 4NJOA 4EDHA 4JL8A 4Q24A 2XCIA 3PITA 3QXHA 4Y9SA 5EHQA 1JSRA 2TRSB 5LIRA 4MVWA 3B51X 1E3QA 3ZWMA 5CTAA 2HC9A 1ECLA 3DZ8A 2CYAA 4PLTA 1XSLA 3PY8A 3FE2A 3FKSD 3RREA 4BV9A 4M9QA 4QOSA 3AP2A 4NBSA 4IH1A 5IKOA 3TR0A 7REQB 3VNQA 3CR3C 1EWKA 5FAXA 1ZKDA 4FJ0A 3HDQA 1ZQOA 3J80A 3EVNA 2CFSA 2X0FA 3K72B 1FDWA 3OJWA 5FLEX 2J6TA 3DVAB 4EZ9A 3JD4A 2ES4A 5CRIA 3NBYC 3VUEA 3AVTA 2JH1A 3EEQA 1HZZC 5BQOA 3O0TA 4PX3A 5KCZA 1NQTA 5HRCA 1DOHA 3HDVA 2HRZA 2Q1TA 4KC0A 3O8LA 2OZPA 3G0BA 4RMHA 3SX0A 5JXWA 3NIBA 5J0WA 1JGTA 3TLCA 4L5CA 2RQ5A 1J5XA 1KO5A 4MARA 5FOQA 3W3AD 1ENYA 3PR1A 3RC9A 5IP5A 2GBIA 2XVXA 1OYVA 3I5AA 4ETWA 5C8ZA 3M9WA 5KWSA 2P8SA 5U4XA 4AX8A 4I8XA 4MR7B 5AXDA 2XZOA 1HDGO 3PI6A 3N8IA 2WWTA 8ICRA 4B3TB 4C7YA 2O5VA 3DKIA 1RRGA 4B4OA 1CF4A 1NVKA 2B5WA 2I7DA 3R2JA 5F7JA 5KTOA 5FQNA 2E4XA 2FLVA 3FUVA 1JLLA 5JDIC 5JAOA 1NIJA 3CE9A 3KEFA 4RD6A 3A4YA 1G6HA 4JIGA 3VHLB 2QAJA 4ZEMA 3OX3A 4XM0A 3E3NA 3WP0A 4RPHA 3GRYA 5DX0A 7ICJA 4XSGA 1XS9D 1XA4A 4BVLA 2PWBA 2RGYA 3C1UA 1UOPA 2NOAA 3CLRC 2Q5EA 4B4UA 1NW4A 3HX0A 1N1MA 3SZ2A 3X2SA 4TSFD 4YCSA 2X0KA 1O03A 5DQIA 1UEXC 3M49A 5C8VA 5F7XA 4ARCA 5BMOA 4DRYA 4Q7KA 1ZZGA 5EY5B 3DZIA 4BYGA 2QMQA 2B1GA 4F4IA 5BSWA 2XMCA 3R7AA 4ISBA 1M33A 3KEQA 4DAOA 4TYQA 2BMWA 5CH3A 1UXHA 3S2FA 3VZRA 5CK5A 1Y89A 3AMVA 1N5WA 1NBHA 3OLZA 1FP2A 4EY4A 3PU6A 1J99A 2R8HA 2FW6A 3MTDA 5EZ6B 1R0YA 1X1TA 2V9WA 1QLNA 2IUEA 2VS1A 1A5AB 1JVSA 2WSLA 3CF6R 3F9RA 2K8CB 3K53A 1IOWA 5DHUA 5AXAA 3VPCA 2NO1A 4RF3A 1JA9A 3W2TA 2A9JA 5I4KA 3PT5A 3DAPA 1BDJA 3A8TA 1ZY2A 4O1MA 3FOFC 3K0SA 4GC6A 3JR3A 1TF5A 1DQPA 5L7YA 1AV6A 2DBYA 3GRAA 3MDCA 4KHZA 3TCXB 3CWCA 1TKRA 5AVOA 4PONA 3UC9A 4HG2A 5IJ9B 3MC1A 5HNKA 1G8YA 5JPCA 4QJ3A 2QD4A 3VGPA 4ZT3A 1P2DA 3KVVA 4YJ3F 3F6BX 3SE7A 5JZ9A 4A0QA 3GQBA 5ADVA 1NW3A 4OJPA 1JIXA 2EJTA 5CVTA 4PO3X 2BGIA 4OXIA 4RKWA 4JAVC 5F9NA 4YAOA 5FR2A 5M7EA 5LLTA 2HSZA 1FFCA 4RK0A 2IL1A 2JGEA 2JHPA 2PVPA 2Z2YA 1N5XA 3QM1A 4PRYA 1Z2CA 3LLCA 1K06A 3KKAA 2OUKA 3EBOA 3CF4A 1PK1A 1FNMA 1ZK2A 3N8DA 4G1CA 4P4SA 4QXRA 4C7BA 2FPGA 1ZRNA 2BQUA 1IY9A 4B9SA 1KU0A 2BEWA 2QMZA 2J6HA 5FUVA 3TR6A 2PU7A 1X2EA 2F2TA 5DWDA 1K5OA 1UMDA 2O52A 1GCIA 4ITUA 1N2SA 2C4KA 5I3CA 1BQEA 1PDOA 3NR2A 2EQBA 3ZCPA 1KLNA 1OJLA 1XDSA 5CHYA 5B53A 4JC0A 2ALZA 4NLNA 1W2HA 2GEBA 4EYIB 1BPBA 1B8OA 1D4ZA 1HZZA 4MZDA 1NFFA 3EIOA 1YRQA 1ZSYA 4O63O 4RELA 3WQBA 4IX9A 4DDVA 2RHCA 3NBAA 4LJ5A 3EPJA 4R01A 3CA8A 3NWOA 3ET4A 2MMCA 3EVCA 4Y6SA 2MINA 3CTPA 4L4XA 3L1JA 3G6YA 4GOLD 1VCOA 1WXIA 3B1XA 1E3WA 4M21A 5EKTA 2Q0ZX 1QIFA 1V45E 1KEJA 3EVZA 1GFSA 4P3XA 4ZT6A 3EVDA 2RLTA 4QUBA 2GKSA 3IEMA 3L7AA 2JEIA 3N5CA 1T4CA 1V6CA 3BK7A 4FFMA 3RR2A 4PX5A 4ILEA 3SXJA 5KFGA 4BUJA 4DBLE 1CQWA 3CLUC 2BFFA 4WLFA 5LZ5A 5TMDA 3CKMA 2QDXA 4LHYA 1LKYA 1NMYA 3AEXA 2JCGA 3C29A 5J0XA 1ATIA 3CB2A 1CF9A 4GUDA 4ZCIA 3OD5A 3M34A 3PVSA 4XR9A 4AMZA 2CZQA 2RKWA 2JJ1A 2H2AA 2XVMA 4GYJA 4IDOA 2YHIB 3I32A 4YCAA 3TAPA 4L08A 4NXNB 4UUAA 1FP7A 1OIXA 3WMEA 2ZJ6A 2A5GA 3KPJA 1YR8A 1NMEA 5CYOA 3ELBA 4Q18A 1PGPA 2WICA 4RQ3A 2JRLA 2VDQB 1NBME 3M9LA 4GR9A 1YRYE 4LJKA 1VHDA 1JEAA 2A3RA 3S2GA 5ALOA 2JIBA 3GDFA 4DWJA 5FLXA 1PKEA 5KNDH 4HN9A 1EA5A 2AEJA 1T0JB 3CX3A 4GSKA 1SC1A 1AQYA 3PTLA 1ZIOA 4IKOA 2CK3A 1O57A 2GVZC 4QPZA 1RG6A 1BD4A 3PQ2A 5F5LA 5AI9A 1CK4A 4QYIB 4G5QA 4XA5A 1H8HA 1SL1A 1JXOA 1Y1QA 2FK8A 2HJWA 5D1HA 4EJSB 4B44A 1TO1E 2F43A 2X9LA 4YACA 2F00A 2AGVA 2VKTA 3AONB 5EZQA 1GADO 3KUCA 1TM4E 1EGVB 2ZRNA 3IR5A 4DADA 3LHIA 1I94B 3ZU4A 1CIVA 2H4JA 4MB6A 1KMCA 5C1IA 3UH1A 1SKYE 3BJRA 4RFSA 2C61A 3F97A 2PGJA 3R7WA 4J75A 4OQNA 1K4MA 4BPBA 3ZHXA 2FSGA 4UUPA 1TFUA 3K9BA 4TLLB 5BV1A 3EXIA 4A6DA 1GR0A 3GILA 3NHWA 2O2YA 4UTNA 1ZBQA 4FZJA 1T3ZA 2FSSA 3Q87B 2A4KA 1QRUA 3RIHA 3TQQA 2P2CA 1LSOA 2B35A 1QLHA 2KYRA 3JQ7B 4I2DA 1EM8B 1MHPA 2WJYA 4H0FA 5KYWB 1AC5A 1SUEA 2B36A 3LO5A 3ZNOA 2XNKA 1AKQA 3TTUA 1F4PA 4DJDC 5KWVA 2WU1A 2C2RA 4L8WB 3BQTA 4D41A 1NRIA 4PGXA 1XP8A 3WMXA 4XDGA 2X4DA 2VPZA 2HU2A 4DM7A 1XKXA 5IH7A 3TANA 3KFVA 5BR7A 2P9FA 2HWYA 4Q3NA 4L76A 2DKZA 3L79A 3MOSA 5DG7A 2R8KA 3U7EB 5ALWA 2F6RA 2JLRA 3MELA 5LB4A 4NCHA 3CJRA 4DVGA 1IVNA 4MKZA 1L7NA 2GCPA 2WG0A 3CNBA 4L02A 1TE2A 4BBAA 3IQXA 2DPJA 1AK9A 4BB9A 2EZTA 3EMVA 3OQ1A 4BQEA 2LVBA 2Q6VA 1QIGA 2W2OA 3Q0TA 3G2JA 3DZDA 3RQSA 2ECPA 5IAOA 3Q2KA 5D84A 5HBGA 1NXXA 4G4IA 4UVIA 3L0SA 3JZMA 1MO4A 4DLNA 4X90A 3QENA 1VSTA 2DBRA 1SKSA 4LYDA 2A14A 3OZGA 2PKRA 4RZSA 3H1TA 1JXEA 2IS2A 3UQ0A 3MTBA 2HEGA 2IZ7A 1K92A 4L6IA 1B2LA 4KXNA 2FSPA 2QNBA 3DC7A 4ZCQA 4D0SA 1JFSA 3BXHA 4Q34A 4TTSA 3GIWA 4QDUA 1EVLA 2LYAA 3F6CA 3KKZA 1DGSA 3DONA 1R6TA 4UFOA 3LWBA 4MULA 3E23A 1R6XA 1H6BA 4NZNA 2OCIA 3LGXA 1WUYA 3L40A 4ZK6A 4QBIA 5KMGB 3V4OA 1U9LA 5G02A 4CKYA 1ECGA 1HRKA 2VP6A 3BS4A 3PIDA 4I99A 1H66A 2D3WA 4ZV7A 2BKXA 3CWQA 13PKA 3THVA 3QKWA 4QHYA 3C4JA 5AJWA 4CF6A 5CBPA 4INPA 2WJZB 3WTBA 2X5NA 4LXYA 5DIFA 3SK0A 2Z9DA 3FHTA 2GPBA 2GGSA 3LIIA 5KYXA 3D8BA 2GASA 2P6OA 4NJ8A 1E0JA 4ARVA 1DB3A 3E2EA 2ODGA 5J40A 4C7JA 1U2EA 2XVZA 4ZPJA 3V2UA 1RKXA 1KQQA 2EL9A 1NPDA 3GZ4A 3OU7A 5C7YA 5K0SA 3S29A 4KPUB 4Z5XA 5JD6A 1NG9A 4OUDB 1KRXA 4MKHA 5K3DA 2R65A 4R1PA 4RMGA 1QSGA 3ZI4A 3CUUA 4JVNA 3ICVA 2R62A 5CJJA 1N48A 1VCIA 3KAJA 4RH3A 3BTOA 3JQAB 3P97A 1U0HC 1ZSVA 1FZTA 1U45A 3KD2A 1D2GA 3PNPA 4PPQA 4ETMA 1ZW1A 4F6RA 5BMVB 2W2TA 4I50B 4KQCA 3HWRA 2BPFA 3FUCA 4BV8A 2HF8A 1UMCA 4I1VA 4DPLA 1LFDB 2BSAA 4NHEA 4DWVA 3MGAA 1FYWA 1KC3A 1R6VA 2Q4EA 3JYHA 4WFIA 4WJKB 1IMJA 2AL7A 3B3QA 1UZAA 4L51A 2GAIA 3T5DA 4FOTA 5EMNA 4HEQA 3FROA 4YRKA 3QMPA 3JQ9A 1LW7A 2L0XA 4UB6U 1LNZA 1X0VA 3NHRA 5LM3A 3UMSA 4MW1A 4U7GA 1WMFA 1X2BA 3UV3A 3TW6A 4AG3A 3P1JA 2FEOA 4HDSA 1SBZA 3UJBA 4D8TA 3W04A 2C5GA 4QZEA 1S77D 2X3FA 4M1WA 1P2SA 2PKEA 3QUTA 4MI6A 1PJ8A 3HI4A 3ETCA 4BDPA 4AJOA 1LK7A 2NZUG 2XWSA 3B9BA 3H6HA 4W6ZA 1RMQA 5JWRA 2JS7A 2M1XA 3VC3A 1WUIS 3DTTA 3RAQA 4CFSA 5FHRA 3ZVKA 4FYHA 4JP2A 3GEMA 5H2FU 5CVCA 1GQYA 2UV8A 4BO1A 2DZDA 3LVRE 5IAJA 1AZSC 5LU9A 7ICOA 2NNWB 4LJSA 1ADGA 1VMAA 2V9PA 4QPPA 2CT8A 2R1VB 3ETRA 5U4QA 4ZRDA 2AIRA 1F9EA 2DWPA 2DYKA 1O87A 1PNOA 2GSWA 3BF8A 4G0QA 3C5WP 4KN8A 4LOIA 5SY9A 3WLIA 1SCQA 4I6GA 2O19A 1M2OB 3VH1A 2KM1A 4DA8A 4MWSA 1GHTA 4U5XA 2B1IA 4J90A 2Q0HA 2Q21A 2YWHA 4KVZA 4OXNA 2P69A 2CNNA 4IVPA 2C8KA 1H1LA 3K8QA 5BYJA 3W2FA 2QSUA 3C7DB 3AZOA 3P52A 1M2GA 4BRWA 3KYCB 3H8JA 4JJ7A 5SV2A 1VE5A 4BATA 5B12A 2WFLB 4HLNA 4A15A 1RYFA 2OEPA 1SBYA 1TCAA 2OXFA 4K5QA 4ZVTA 4JV2A 3UFBA 1NLZA 1T10A 4GP9A 4R3UC 2VDPB 4NDNE 1Z63A 4IDGA 1BE0A 4QWAA 5BWNA 9ICAA 1O97C 1S89A 3HDYA 3I01A 3MOGA 3ZUPA 4AECA 1XNSA 4EJMA 4EY5A 1S8AA 2PIDA 3BK2A 1A95A 4YJ3B 4FS1A 1XIVA 2EDAA 2VPTA 4NZOA 3NFRA 1WETA 1N2ZA 4ZT5A 1YAJA 1ZC4A 2BD0A 1UPUA 1EFAA 4F92B 1ZGGA 1GSOA 2JIOA 4EB8A 3IO3A 2HXYA 1D6JA 2GAOA 2JV3A 3KKLA 3GLGA 7MDHA 4YVZA 4I8DA 4U3JB 4HWSA 4CGYA 5HIKA 9ICIA 2ZE6A 3KOMA 1F1JA 3MT0A 3ANYB 2ZTCA 3H2YA 3FBGA 1V9PA 5ERGB 4EVSA 4YP0A 1K1QA 1J2RA 3INGA 1K7EB 2JH8A 4XEUA 3VMFA 3FPJA 3EZ2A 3OE1A 2N9UA 5AKGA 3C1ZA 3ZZ1A 4DSNA 1C4OA 1J1ZA 2F1OA 2H4ZA 4RZQA 1MNAA 3RWBA 4BNKA 5AJUA 1I36A 4K9SA 4TMWA 2VN8A 1Z3CA 4JEHA 3I05A 4U7DA 3EC7A 3PUIA 2UZ0A 2XQIA 4FBTA 2YXPX 4CMJA 2I65A 4OQZA 3SF8B 4KLIA 2WHPA 4MQBA 2OFOA 2WFMA 3LRTA 1YBFA 3A4NA 2IYRA 3I2KA 4LHVA 4RHCA 3GNLA 1MJGM 1J90A 2I91A 3TTTA 1VDVA 3OTOB 3JATB 3WNCA 1QYXA 1PQUA 2VNSA 4C1NA 2EF0A 4CL8A 4MZXA 4JUBA 4J4BA 4F9EA 1N6HA 1XTQA 7ICMA 1PZHA 2CXHA 2DT8A 4HATA 3IDOA 2RAVA 3BA6A 4R16A 3IM1A 4NV3A 2WIAA 2NMVA 2HREA 2XAAA 3IQIX 4B4DA 4RDIA 4DV0B 2VQEB 1KTIA 1AGPA 1TD1A 4YRFA 2A5FA 3HGTA 3TFOA 8ICJA 4FD2A 3O4JA 4FE3A 2E4ZA 5FUXA 1TPZA 3JQ8B 2IQIA 1XTZA 2QD2A 1JKMA 3FPHA 2I4RA 4D7AA 2GZDA 4M9JA 1RZRD 1MC4A 2VF8A 4IICA 3TNDA 4B0OA 3Q8QB 2DSTA 2P2ZA 4PR3A 1ODIA 4L50A 4A8JC 1Z00B 3NYIA 1KC1A 4DLTA 1D9DA 1KVRA 5F3RA 4K81B 5TQ0B 3PC8C 3BWMA 3AUUA 2FEAA 5CA0F 5LYJA 4FXPA 3SEAA 5C7IO 3GFBA 5JCOC 5DQGA 1RRKA 1Y6RA 4BGUA 3HLTA 1BXGA 5BRNA 4HI0E 3TG8A 2I1QA 1BMQA 1Q11A 4C8OA 2OWEA 3DDZX 3P2IA 1FC0A 1T36A 2QTVB 3BIWA 3CH7A 4KR7A 4HLUA 1KHTA 4P32A 1P4RA 3AF4A 5T64A 4DJFC 4EPYA 5BW5A 4ETIA 3BYZA 3D81A 2C3UA 4IUCS 1YS1X 2D62A 5K09A 3QVLA 1CP3A 1B26A 2W6CX 3EZXA 2E9SA 1WNFA 1GLNA 2A2ZA 5LA6B 1IEXA 1OTXA 4PCLA 5G53C 1C4WA 4DCUA 5K0FA 4ELTA 3T1TA 2QM8A 3GGJA 1AXRA 5BNIA 4D25A 2FNAA 2BFCB 4QC2A 2JLWA 4DS4A 4ZQHA 2KBFA 3GLQA 4QGFA 1WXDA 2ZSEA 2ACVA 3DBRB 7GPBA 5I7FA 5L1JA 5A5EA 4Z6FA 1D0SA 3OOSA 5I7EA 1RI1A 4MHTA 3V7FA 3CC8A 1P9RA 1Z4MA 3WIUA 5D7BA 3HVUA 2V5UA 1YGPA 3HKEA 3I2HA 4Q47A 2P0YA 4C01A 1Z08A 1US8A 5A7GA 3JQ9C 4WZAA 5JQGB 3TCKA 1USUA 2NSDA 2Y8EA 1UXOA 2O2GA 2NACA 3AUOA 3HN2A 2UVRA 1ULSA 3IJ5A 2M9MA 4NX2A 4DCPA 4POAA 2HK7A 3M2TA 3CUSA 1P31A 3PWTA 1TT5B 2V7EA 1W36C 4B9EA 2WPDD 4F3TA 1XZNA 1KSPA 3BD6A 3CLKA 4Q1FA 4UXIA 5FB3A 2I9PA 3V2IA 1G3UA 3NWPA 4JBGA 3FNQA 2W6IA 3KO8A 5DEIA 1V5EA 4ZZ1A 3TF5A 3WKEA 5J59A 2VHWA 4NBWA 1XROA 3UMGA 2HDWA 4CF5A 4DLSA 3U4DA 2V3VA 4FGSA 4NFHA 4Y0NA 1IV8A 1PHRA 4IRCA 2J32A 5DB8A 3DWFA 1UOEA 3AEKB 2IKQA 2C00A 2FG6C 3H5TA 4B43A 2UYHA 3FYCA 2Q3CA 4BQNA 2Z4TA 3IDSA 4OHCA 4WLEA 4EWLA 5C5DA 3L7IA 3IPLA 1FMLA 4MNTA 3IKJA 1WE2A 1O94A 4KACA 4OAQA 2O6HA 1CP2A 2OGZA 4N82A 5PGMA 2TMKA 3VSEA 3K32A 4BNLA 2BFNA 4FZRA 1CS0B 5I7AA 4FUQA 1BNCA 3NH6A 4N39A 3F46A 3B6ZA 2C7QA 1CQJA 4UMEA 4B9MA 3V33A 3BS5B 4JASB 1YOBA 1ARZA 1Z22A 1S9HA 2PUDA 4Z6DA 1V7CA 2XTAA 4OM8A 4E2YA 1T1EA 4D4KA 4R7TA 5F4ZA 3BIXA 5KG7A 2GN1A 3AY6A 4LJXA 3WK4A 4HDRA 4UU1A 4WXEA 4CLDA 5EE5B 3ZPXA 1HMPA 1TK8A 3K16A 3C5EA 3GLHA 3BREA 4ED1A 3HDHA 4D3XA 4EW2A 2I7XA 3FTFA 3IP9A 2GZRA 4NJMA 4OLHA 4C4YA 2OP0A