2G0TA

Crystal structure of a putative nucleotide binding protein (tm0796) from thermotoga maritima at 2.67 a resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
339
structure length
337
Chain Sequence
HMDLWKLYQPGTPAAIVAWGQLGTAHAKTTYGLLRHSRLFKPVCVVAEHEGKMASDFVKPVRYDVPVVSSVEKAKEMGAEVLIIGVSNPGGYLEEQIATLVKKALSLGMDVISGLHFSQQTEFLKIAHENGTRIIDIRIPPLELDVLRGGIYRKKIKVVGVFGTDCVVGKRTTAVQLWERALEKGIKAGFLATGQTGILIGADAGYVIDAVPADFVSGVVEKAVLKLEKTGKEIVFVEGQGALRHPAYGQVTLGLLYGSNPDVVFLVHDPSRDHFESFPEIPKKPDFEEERRLIETLSNAKVIGGVSLNGGFETDLPVYDPFNTDDLDEMLERAMVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (tm0796) from Thermotoga maritima at 2.67 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Phosphate-binding protein
molecule keywords conserved hypothetical protein
total genus 109
structure length 337
sequence length 339
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07755 DUF1611 Domain of unknown function (DUF1611_C) P-loop domain
A PF17396 DUF1611_N Domain of unknown function (DUF1611_N) Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2g0tA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2g0tA01
3WBFA 1ONNA 2UVQA 4LISA 3ZGYA 1DOHA 4QFMA 4MP3A 2FPIA 3UFXA 1K6JA 1O3YA 2R6DA 1M2WA 4OJQA 1P77A 3P1JA 4FCWA 1A7KA 4KFUA 1SOWA 2JJYA 3S1LA 3BMQA 3GDFA 3FNGA 3X2SA 3U4QA 4W7IA 1XMIA 1T8UA 5CFZA 2YYYA 2J8ZA 5G4LA 1I33A 4F92B 2XSZD 3Q9LA 3RC8A 5LDDC 4ESOA 5IZCC 4KVGA 2WYUA 4C2UA 4BO8A 1ZD8A 5A9SA 3MJRA 1N7GA 3ICPA 1PJ2A 3TZ6A 1E1RD 2ERYA 5JXWA 4BVAA 2REOA 5KNBA 2GZ2A 2EERA 2ANBA 1ETUA 3RC2A 4E6PA 1ZM3A 4JLPA 3T12A 4FXPA 2JL1A 2Q3FA 5TT0A 2ZYAA 1UBGA 4XDZA 2NTNA 3SFZA 3AKCA 5HS6A 4M1MA 3QPVA 2VIIA 4ZQGA 2ZREA 4ZN6A 1AQYA 2HJVA 4ZIRA 4B73A 4W7SA 5FEUA 1Z0KA 1DPFA 3EA5A 2XNDA 3NT5A 1RYHA 3D4NA 3LVFO 2IUSA 4A2CA 1D1TA 1Z0AA 3WIEA 4L4SA 3DOOA 2WOJA 3G17A 2A2ZA 3INTA 1PR9A 2CE2X 4RVFA 4CGZA 3OP4A 4KUEA 3GEHA 1BWSA 4XTRA 4L76A 4TQGA 1ISHA 3KETA 4OI2A 2BRUA 5CDFA 4POAA 4PHHA 4PLZA 1NY5A 1FDSA 1E3WA 3W4JA 3JD4A 4GBJA 5DN6D 4CQMB 4RDHA 2JHFA 1LX6A 2ZAMA 1BVUA 4IJKA 4NPHA 2FZ4A 4MGYR 4D3DA 4TYQA 4PFSA 1Z75A 4R3WA 3L07A 2OXCA 4M87A 1QHGA 3AGPA 1Y6JA 1CEQA 2EKLA 5A9RA 1SVKA 3WNDA 2I4IA 2FEMA 4US0R 2AEFA 4FFLA 2VLIA 1OF1A 3HR7A 2EJWA 3K0FA 2JDIA 3LAWA 2AK2A 4JBXA 3MGCA 5K6AC 5B37A 1GRQA 3TF5A 1UDXA 1VL0A 2QT0A 3N58A 2UDPA 1OKKA 3PUWA 3C3XA 1ADBA 2NPIA 3KJIA 3BH7A 3M6AA 3EVNA 1O95A 3GLFA 4GMGA 4I5DA 1MR3F 2Z6VA 4WNIA 3QY0A 3GFPA 1KY5A 1MO5A 2WV9A 1JAYA 3H2SA 3D5TA 5AUQA 4I5EA 1PZNA 2DWOA 4PHGA 2OHFA 5BR7A 4L4XA 4FFPA 1ZEJA 3NH6A 2OLKA 4JLVA 1GPDG 2CSUA 4FMCF 2QTVB 2IYRA 5TDHA 5JE8A 1GITA 2XTMA 1ZINA 3PHIA 4GLLA 4HZIA 1VJTA 4NCKA 2E6UX 4GL4A 1KEUA 2AL7A 1E9DA 1ZIDA 4CW7A 2XJ4A 5K8LA 3IP1A 3UVEA 3O47A 1NJGA 3W9YA 1C3VA 4JXKA 1AK2A 3ADKA 4YT2A 5KUTA 1X1TA 1L4YA 1RKXA 3GAFA 4A27A 2PCJA 3GOHA 5G53C 3EX7C 3U3KA 3IBYA 5DDIP 4OJKA 3QXCA 3PQEA 1G0OA 1BYIA 1WP4A 1I10A 3A1TA 3KUXA 1NPTO 1IZ0A 3DB2A 3EA0A 2B5WA 1TEXA 4XWYA 2JCSA 1OFUX 4V0NA 3QRWA 2ZJ8A 3LFUA 3KXKA 2F6RA 1SBYA 3ZWYA 1NXQA 3U4IA 4ZI3A 4K26A 4CMEC 4IPTA 4QGHA 3P26A 4QM7A 2F3TA 3ORFA 2X2FA 1OZAA 3CZRA 4YWJA 1K5GA 5EUQB 3KX2A 4E5YA 2A9KA 1NNUA 3TZHA 3FWYA 4JVSB 1B2LA 5JMTA 2DBRA 1UPTA 2QRZA 4HZUA 4OIMA 1CYDA 3O9ZA 2R00C 3VHXA 3TLXA 4WA7A 3GZNB 4B3FX 4PVDA 3C24A 5FTNA 1G3UA 4CMIA 4E33A 3RWOA 4IVRA 4QSMA 3U6KA 9LDTA 4J4BA 4Q1CA 3ITDA 1GAJA 2JJ2A 1WF3A 4V02A 2IZZA 4AWXA 1OHHD 4D82A 2O8EB 3DOEA 4YB8A 3DAPA 3ZWCA 1OAAA 4JP3A 5BSHA 2NO9A 3D4OA 1Z6XA 1DFIA 3T7EA 5EXPA 4A8JC 4GLOA 3F0TA 2ZU6A 1J0XO 4D7AA 1SXJD 1AIPA 3FNFA 5TVKA 1G7CA 3QVUA 2B37A 3JQEA 5CPFA 3ULKA 3TAUA 5EE9A 3AVXA 1ZM7A 3VAZA 2WJPA 1A7AA 2V8OA 3TQCA 5LCXA 2GCGA 4OQLA 3DFUA 2C2YA 3BC1A 3JZAA 4IOMA 3OE7D 3TBKA 2GGSA 5FOVA 2AA3A 1OIVA 2IC5A 4BNIA 3ZVNA 1LSOA 2EFGA 4DLXA 1ZJZA 1VRWA 1T4GA 3I5XA 3DMTC 3FR7A 5G41A 1YB1A 3H7AA 1RM4A 3ZYCA 4B43A 2P5YA 1H9BA 3K0AB 3VPFA 5FWNA 3LLMA 4ZQHA 4AYWA 3SJCA 4W9NC 3KQKA 5IT5A 3VKUA 2ZJOA 2O23A 3I4CA 4E32A 3ROPA 1Z08A 4US1R 3CRQA 1EQ2A 1Y1PA 1TVEA 1YL7A 2C77A 4NP6A 2G0TA 4O6VA 3TSZA 5LD2B 4KITB 1DRUA 5B4UA 4M86A 1EWQA 1L8QA 1GYRA 2JCVA 2QAGA 2QPOA 1HDZA 2HMUA 1CJUC 2VP4A 4PC7A 2Q45A 4PQFA 3JQGB 6Q21A 2Q4EA 5A9SB 3ADBA 2YV1A 4RY2A 2PR2A 3CH6A 2CHGA 2ZI7A 2PJRA 2I6TA 4PCVA 4OHZA 1WBBA 1W36C 4BNNA 2F00A 3GNTA 4LBZA 5GVRA 4M1YA 1W6UA 1T9HA 3L0OA 2I5PO 1JXMA 4PG4A 1W44A 1JU9A 5FH9A 5THKA 3JQFC 2YHIA 3OIWA 4Y6RA 3V8BA 5GMOA 4LV5B 3IIEA 4HNGA 4W5WA 1YJ5A 4L9WA 3WGYA 4BLSA 3DZGA 4QGAA 3OEHA 3T1OA 5JJKA 3V1UA 1EK0A 3UXYA 1E1QD 3SR0A 3AP2A 5JAZA 5HR5A 3UG7A 3AOEC 1CBUA 2O0KA 1NIJA 5FL3A 5J4LA 1IHUA 1BHSA 3OE7A 4DQXA 5JAIA 3WFJA 2HMWA 4IQ0A 4LJ7A 1EVIA 7MDHA 2V6FA 1VL6A 1UXKA 2I99A 4KCGA 4LK3A 5HCNA 3AVQA 3CW2A 1Q12A 3RS2A 1ZFNA 1JEDA 4CM9A 2BHRA 4E2YA 4F46A 2B4QA 2OLJA 4I1IA 4JBWA 5JW6A 3DHNA 3L8ZA 2BM1A 2LDXA 4B4OA 1AN9A 5CDUA 1YB4A 3HFGA 1XIVA 4CT4B 2JAHA 5JSFA 5F98A 3TJZA 1E9CA 4M9XA 1JPNA 4RD0A 1YZKA 1U8YA 4E31A 4P4NA 4M0LA 4FD3A 5IAAA 3GVCA 3A28A 1US8A 3QF4B 2X8AA 1AQUA 4JVLA 3TAHA 2C9OA 2GCPA 5KPDA 3TL2A 5TGDA 2BF7A 4G1UC 2NU7A 2IYTA 1BH2A 3IPXA 4XDYA 3NDPA 2JLVA 3GLFE 1UFQA 1Q57A 3WS7A 2QRNA 2I3AA 2OUKA 5F9FA 4URZR 1QDEA 5DN9A 3C15C 3MEQA 2J0UB 2Y0DA 1IXZA 4DVGA 4XR4A 1ONBA 3ETEA 4PZZA 3D3QA 1NMXA 3PEFA 1F5NA 1DPGA 3CM0A 2CVOA 4DLYA 1NKTA 2C5AA 2B35A 4IY1A 2B0JA 4ID9A 3GQBA 2YY7A 1HE2A 1GL7A 4RVUA 1A9ZA 2BGLA 4B3XA 3ENNA 5CK5A 4QJ4A 1L1FA 4ARZB 3L6OO 2Q0HA 1R0KA 1CXZA 2IYLD 1R6DA 2NU9A 2ASEA 4LDJA 2QHXA 2CZCA 1NSTA 4YJHA 3SDZA 3B20A 2GRJA 2HLDD 3THWB 4R5MA 1FUUA 4MGIR 4O0MA 2DVMA 2JCXA 2Q6TA 4Q02A 2O3SA 3EGOA 4BO3A 2REXB 2WWYA 1U7HA 5CPBA 1VG9B 3W6OA 1J8YF 2IF2A 1MC4A 2Y67A 1HDGO 1N2SA 2DM6A 3W6UA 3NGLA 1BVRA 2NGRA 2ZJZA 2YVUA 5EQTA 3CRMA 3MWJA 3WRYC 1IY0A 5AJXA 4U0KA 1P72A 3L4BA 2RHRA 3RC1A 1NY6A 4DIBA 3WWZA 3X1XA 4ASUD 2VHZA 1T0HB 3K31A 2YOFA 4RO0A 3R1IA 4BV8A 4XIGS 4ZICA 3X1YA 4GKVA 5FBLB 1IOZA 2HLPA 4PC2A 4PPNA 1T26A 5AUPB 3EWAA 5T8KA 4Q39A 3HPQA 1F2UB 2OCAA 2GXAA 4YMWA 4NYMR 4M21A 3A36A 2ZYDA 1LY1A 3V2GA 2EFEB 4EEZA 4TT3A 2W0SA 1S7CA 2QYTA 3R3JA 4W5HA 4D0GA 3CZPA 4HYYA 8OHMA 3JYQA 1HV8A 3LXRA 5JJLA 5EIOA 2GN4A 2X8LA 4W9MC 4OQXA 5TARA 3K0SA 5U9CA 1ZBQA 4R7ZA 3BWDD 2EVWX 2VYNA 3BMNB 3GK3A 2VWGA 2FN4A 1GUAA 5K9ZA 5JAMA 1KSFX 3KB1A 3PLNA 2YOHA 3B85A 4NJOA 1LQUA 1KNQA 2Q46A 3SJZA 1QSGA 1PZFA 4HDQB 3QE3A 3GUCA 2MMGA 1X8LA 2CHQA 4YXWD 4OYRA 5A3VA 4CVNA 2BMFA 1BKDR 4R9UC 1P9RA 3PJEA 5AUNB 1HE5A 1V3TA 1BO6A 4DIDA 2D2IA 2WSBA 4W5JA 1OH6A 5BYKA 4AY2A 3NTQA 1R7RA 5DBIA 4CLEA 1GSIA 2VO1A 5F3WB 5DCWA 3BMQB 1GILA 3WHLA 4R1NA 3H9EO 1ZMOA 4A2WA 4Q7MB 4QBIA 4FOSA 1E2QA 2BJWA 3CUEF 3ZV6A 4UEJA 2ORWA 2O8CB 4HLQB 4FI3C 2DTXA 2C2HA 1DC5A 2J3EA 2D3WA 1VYTA 1G1AA 2J9RA 4N3NA 1GU7A 2DFTA 4JYCA 4H15A 1CR0A 5JI3E 4DB2A 2XB4A 1SXJC 1X0VA 4R68A 1PEDA 4D26A 1EQUA 2RGNA 4PZCA 5IN5A 1LRJA 3W3ZB 1TT5A 3LH5A 1NAHA 1VL8A 1X86B 3DDNA 1ESMA 3TZQA 2CNWD 1G7SA 3L0DA 4FJ2A 1E9EA 5JCXA 2FFQA 4ALKA 4TYNA 3B1WA 1P3JA 1GUZA 3RRZA 3CSDA 1W47A 2HJRA 2EG9A 1KEPA 4S2EA 5EXTA 2JJ2D 2I76A 3V1TC 1L7EA 3PJFA 2BEJA 2PX0A 5I9MA 1QHXA 2HK9A 1LB1B 4FIZA 4JBIA 1XD2B 2P68A 4BFXA 4Y9DA 3S55A 1HE4A 1P44A 4C0KA 1IE3A 4B6FA 4IDAA 2BVNA 2GVZC 1NI3A 1I3KA 4BGDA 4GI7A 2FR8A 2O3QA 4IBOA 1SQ5A 2WM9B 4N1AA 4OYHA 3Q3CA 2X6TA 4OBEA 4DWVA 5DNYB 4MO2A 3TR0A 4Z1MD 3D5QA 5EN4A 4V0KA 1IOLA 1MXFA 3Q2KA 3QJ5A 3N2EA 1UEJA 3IEUA 3VH2A 1QG2A 4LYJA 2F3RA 2QEQA 2IUTA 1IUKA 4CLRA 2Q3HA 1TF5A 4BNHA 2R2AA 3DAGA 3B1ZA 3EHEA 4X54A 4UUPA 3AVOA 4MINA 1P60A 4BFYA 1PUIA 3CRVA 3PIDA 4OHYA 1D5CA 3WIDA 4KFSA 4V03A 3E1KA 3SQWA 2VYVD 4PLHA 2YV3A 1E7RA 5GZ3A 4IZHA 1I2CA 1C1YA 3MJSA 1W5SA 6LDHA 4EBFA 3TK1A 5IK2D 1XYGA 2DFNA 1HY3A 4WBSA 3HYTA 3MG9A 5DYGA 2UUOA 4GNKA 1YBMA 2UZ3A 5B64A 3ETGA 3T7CA 1Q20A 5CLLA 121PA 1PGPA 4TLCA 4EFMA 5KJ1A 3UH1A 1UBCA 1SVLA 2FGJA 4DMMA 1H8EA 3P32A 1QYVA 1B8UA 1DO0A 4TRMA 4CEHA 3DBLB 2CCJA 5EMHA 4G5OA 3LX5A 1EGAA 3TZKA 1GDDA 4NPCA 1Z2AA 1J6UA 1KDRA 5C7IO 1T0JB 3N5CA 3EARA 1XD9A 1YXMA 1ENOA 4TWRA 3WGZA 2VHYA 4HP8A 2FPLA 1YL5A 3OFSA 3MOGA 4IDPA 3AI1A 4HAXA 4NK5A 1ZMXA 3I4LA 3IQXA 3K09C 2HUPA 2H5LA 1YRAA 2WMDA 4YDRA 1KI6B 1GFIA 3VH1A 2B21A 1V8BA 3QY9A 2EW1A 2P5TB 3K73O 1N6LA 1E6WA 5CHEA 3VAAA 1K6MA 4QUKA 1J5PA 3WBJA 3WG9A 4XVRA 4J7CA 1LF0A 4W99A 2ZVQX 4DQVA 3IO3A 5DOZA 2PBRA 4BKQA 3M1IA 1Q1QA 1QP8A 4FOOA 3T5GA 5EE3A 3AF4A 3GMSA 1XEXA 1E1RA 4E5PA 3EIQA 3F46A 3UATA 3GFOA 5FOWA 3ZNQA 3H65A 1OBFO 2ZQYA 3UCEA 2OBYA 1WDKA 2QBYA 2XZLA 4GSLA 4NFSA 4JLJA 3QWHA 4R01A 4OXYA 3G5UA 1R8SA 2IXGA 4LK2A 1QR6A 1Z06A 4WVFA 1YRBA 3CZQA 1P9LA 2Z4SA 1KI9A 4Q1AA 2CNBA 3HADA 2RGXA 4K46A 4GVXA 2OZEA 3AUYA 4PC1A 4KUHA 4Q21A 2W2KB 1F8GA 4BMNA 4LVCA 1Y8RB 1KIFA 5HS4A 1RPZA 3TW4A 4IOJA 3LSYA 5CYPA 1LLDA 4HB2A 4YQYA 4GPD1 4E5NA 2NZJA 2V6MA 2WE7A 5JC8A 4WOPA 4B48A 5J4YA 4EKDA 4IHQA 1ZIOA 4RCZA 4MKHA 5FR1A 4FN4A 3P2OA 4PRKA 4DT1A 3RI3A 3P4XA 2NNLD 2AX4A 3RFVA 3R7WB 2R6GA 4BASA 5DSZA 4Q4JA 1KY3A 2Y93A 1MRSA 2YYZA 3VNUA 4M1OA 5U1PA 2ZJAA 3RBZA 2CDAA 3THXB 3Q9UA 1KS9A 1ZXBA 4A9AA 5FI5A 4WOKA 1UAGA 1E92A 2CVFA 1TA4A 1Z82A 3GNQA 1E96A 1CKEA 1W73A 5KVCA 4HBGA 1BGVA 1H94A 4RCYA 1KY2A 3ZNNA 4EUNA 1H8HA 3H84A 1LUAA 4RPLA 2XTZA 1VG0B 4CLXA 4DREA 1RYEA 1C1XB 3GNSA 1GYQA 3AW9A 2OCYC 1GAEO 1PZHA 2G88A 4QM6A 5DBFA 2EFCB 3NJ4A 5B58C 1X1RA 2AQKA 4CM4A 3VZRA 2KBEA 4HLUA 4RZUA 2CL7X 4MYTA 3I61A 1JAIA 4KZPA 2VT3A 4PG6A 1GNPA 3EY4A 1HL3A 1P9NA 3TSOA 1N9GA 4MVJM 4XZ3A 3MWKA 1Y9AA 2BGKA 3AF2A 4ASUA 1WLYA 3VTFA 2ODWA 4LZZA 3CIFA 1Z5ZA 3DZIA 2CK3D 2JA1A 1DG1G 3B1XA 4BZQA 4G0NA 3PHJA 3SXPA 4ZJUA 4IS2A 2J87A 1X14A 1FQKA 1ZSYA 3RDPA 1B23P 1MV5A 2GRAA 5COBA 4XQ9A 3EZ9A 4B8ZA 1XJQA 2GJAA 3DBVO 2FP4A 4TQAA 5G4KA 4OHXA 1E2MA 4GAEA 1GV1A 1U8AA 4KBFA 4URVR 1II8B 3LBNA 2ZRNA 3GHYA 3VZQA 4QRHA 2FPGA 4IDDA 3JYOA 3F4BA 5BNTA 1P33A 1HEUA 5C7OO 4OI1A 3Q6IA 3FNEA 7ADHA 1WXQA 4D44A 1Z6YA 1VCOA 2HK7A 5JPIA 4WE3A 1LDGA 4NH4A 4BNTA 2XITA 4LC0A 5JWRA 3MSXA 3LF1A 4G5QA 2C29D 2CE7A 4BNGA 3B7GA 2VTDA 2GPTA 2YWEA 1VLLA 3QBVA 4JL8A 1BDBA 4WZAE 4E0BA 1NBME 3B5JA 2ODBA 3GFBA 1EVJA 3IKJA 5H83A 3CX7A 4KBGA 5CDYA 5A3JA 4MOWA 3GJ7A 1ZXLA 4YXWA 1I2DA 1FMLA 1ELOA 5JJIA 4S3MA 1GR0A 3PEYA 4IEEA 1FF9A 3UMSA 2WJGA 2R6CA 1MABB 4JLBA 5KYKA 4Z3DA 3TUJC 4YAJA 1NWCA 1P73A 3F5QA 2GUGA 3R8FA 2FHSA 1XF9A 2KSQA 1HDXA 2G17A 1VMAA 4XYEA 4JCOA 2ZTMA 2ZJ0A 4IS3A 4NMHA 3VX3A 1GTVA 1NN1A 3K2EA 4WCFC 4BB5A 1NTOA 4UULA 3CNOA 4LV8B 3N70A 2GCNA 3AFNA 4N5NA 2EWWA 1GEEA 1P1JA 3BH0A 5GZ1A 4DMLA 1YBVA 4D0RA 2ZANA 721PA 2YZ2A 5KNCA 2PKQO 2CLSA 4AJKA 3E9MA 2NU6A 1Z3IX 3GUYA 4TTRA 2P2SA 4KO8A 2PLAA 1GKYA 4EPVA 1PJQA 3HE3A 5L3QB 5FYDA 1XEXB 3TE6A 2V6IA 4LGVA 5BQ5A 1NWHA 1KI6A 5EERA 2WPDA 1AZTA 4ON9A 3ADPA 4BO5A 1LDYA 2WJIA 4I4LA 2YC2C 3IO5A 3RWMB 2BMAA 4NBUA 1H6BA 2ZKLA 1R4AA 4BKPA 1KY4A 2X22A 4CV0A 2ZSFA 1I3LA 1L7VC 3ND8A 5G0WA 4GSKA 4LYFA 2ZYTX 1LRLA 4DLWA 2OBLA 4LMRA 1QG4A 4H1UA 1ZSVA 3O38A 1K6IA 5FOUA 2J5XA 1IN6A 3PJDA 4KTTE 4LHYA 4OSOA 1PGNA 3GJ4A 4EPTA 3WJAA 2C59A 1Z73A 3WGGA 1R0ZA 5FI3A 1U3VA 3H5NA 3TUIC 4JN6B 1EMDA 4TKLA 4XVUA 3PFWO 2DQ4A 4LMPA 2P6UA 1Q0UA 1N6IA 2C96A 3QEOA 3U6BA 2JJ1A 2X4GA 1G6HA 1KNXA 1SZJG 1IXSB 1PQWA 1NKSA 3EMKA 4HB4A 3HG7A 2BOVA 1TLTA 2FSGA 3T34A 1IL0A 1HE8B 4DPLA 4J1SA 4AG5A 2I9PA 2QMHA 2IT1A 3O8DA 4Q18A 2E9SA 3KFVA 4YJDA 1T24A 3QV1A 2B92A 1EUZA 3FTPA 1FW6A 4IKEA 2QAGB 3OF5A 1QORA 1LBEA 3ADDA 1LDMA 2O4CA 1UP7A 3DONA 1U1IA 3FKSD 4FWIB 2GILA 1UDCA 2P4QA 5L51A 2OCPA 3L0PA 3M1LA 2FF7A 4CMAA 4WEQA 3UCXA 3NEPX 1DRWA 2WD7B 3GLHE 1LSSA 5JCJA 4U6QA 4MRNA 5AUOB 3W5JA 2VNAA 5F1PA 3K5PA 2PD3A 3KQHA 3EK2A 2C04A 1A5ZA 2IYSA 2CVHA 2GZ1A 4PC6A 2HF8A 4ZKEA 1NSFA 2FGKA 1NLZA 3ON5A 1Q7CA 3L43A 1W48A 3IHWA 2Q21A 2VZ9A 1MV8A 4UUNA 1SZPA 3VR1A 1XD8A 4QEDA 3ONFA 3PQCA 2QYSA 3VMFA 1Z0JA 3FBGA 5I8ZA 4FGSA 5EQFA 1KZ7B 1P7CA 3G1TA 4JLAA 3I5MA 4DUPA 1I2MA 3FCOA 3WLFA 5F1OA 3SEAA 1RRPA 3JVVA 1E69A 2BI7A 5A03A 5KO2A 1WMBA 1P45A 1DEKA 3THXA 3HZZA 3I3SR 4LI0A 3OIFA 2ZS8A 1I0ZA 1YQTA 1IPEA 1GQYA 3ETDA 1YS4A 2YW9A 1NF3A 3KJGA 5E7MA 4CMCA 2AEJA 4JBGA 3DBRA 3EVTA 5JHGB 5BW8A 1V5WA 3QNUA 1PLKA 4QNRA 3FB4A 3ZZUA 4LVUA 5BN5A 1O8CA 3BMOA 1ZU4A 3FMIA 1KKLA 2Y05A 3IJPA 3SC6A 3P20A 5JSZB 4TVOA 2N42A 3NT4A 1ENPA 4DPKA 1R12A 1X1SA 3DZBA 2JLWA 4QHSA 3U4DA 2HU2A 4YT4A 2YFHA 4RSGA 4KAXA 2VHXA 3D3EA 4DUGA 3S1AB 2QRLA 4RLHA 2PH3A 4ONEA 2ET6A 3RUDA 2GZHA 3ZZNA 2HAEA 2A5JA 3QBTA 3RUFA 2OZPA 4IIUA 3LBIA 1JDJA 3FMFA 4J0QA 4N7RA 3JQBA 2IDZA 4PQYA 3W8EA 3QVXA 1UEIA 3V5NA 2G83A 3R9WA 4KHZA 1XHLA 4IDGA 1U0LA 2CHVA 3NWJA 1N5KA 1KO4A 3QVTA 2BCJQ 4YMUA 2QRKA 3VR4A 5TSDA 3TL3A 2PZKA 4FMDB 1DELA 3ZWWA 4E4YA 4KMSA 3EDMA 5BWMA 5IJZA 3K92A 2LCFA 3V2HA 4OOEA 4OOFA 3U60B 2VQSA 3BTOA 3ZNPA 5GJCA 1B3RA 5DHFA 3FNHA 3UHAA 5IDWA 4KUGA 1RRGA 4C7KA 1WZEA 2RHCA 1PL8A 2EJVA 1CETA 4OXNA 1KGDA 4J3FA 2QTFA 2WBLC 4D4JA 4WLUA 1KSGA 4CM3A 1YR8A 3EZ6A 2YC4C 4L8GA 5IZ4A 5JNLA 1K0UA 2ZRLA 3EUWA 3B78A 1E94E 1WCV1 4CEJA 3ZJYA 1NM5A 2VHCA 4L16A 4X8HA 1PZGA 3FHTA 5A4DA 1XPRA 1II0A 4D45A 1N1EA 2QZ9A 1BS1A 5CDTA 1BMDA 4WGGA 2P3SA 2AWOA 4MVJG 4E5UA 4PG7A 1LJ8A 1VKJA 3DKVA 1F2UA 2PZJA 4U5QA 2Q9CA 5H1YA 1G20E 1VKNA 3UWKA 3K9GA 2CNWA 621PA 2FOIA 4TROA 1XX6A 5JEEA 1DAFA 3SYLA 2NWQA 3HDQA 2NVBA 2DY1A 5DLQC 1VCMA 3FPLA 4CEIB 4BEJA 4E07A 4NCHA 3AY7A 1G0NA 1UUFA 5TNXA 2W2VA 2OORA 4HATA 3QQ5A 1XWFA 3ANNA 1CRWG 2GCOA 3ZHZA 1F12A 1VYUA 3IUSA 2JIZA 3RC3A 4JLMA 2FSIA 1JVBA 2J0UA 2CF6A 5SZKB 2P65A 4B32A 1U5CA 2WD8A 4ZPXA 2PGLA 4Z9XA 4E30A 1LLQA 5HPYB 3U2QA 3B1VA 3QKRB 3EPHA 4ND2A 3K70C 3WP0A 1FNNA 1E0SA 1UKZA 3K53A 1QV7A 4K6FA 2YUTA 5EXXA 4QHYA 2HQ1A 4BRWA 1M34E 4WLNA 5THQA 1PJ3A 4ZD6A 2WAXA 3RAJA 4I8XA 3P4YA 1DADA 3MD0A 3GVIA 3OMLA 3ICCA 2Q2QA 2DB3A 1E6CA 1G9XA 3PQDA 5BXQC 4B79A 2Q2WA 1UH5A 4NIMA 1SULA 1G17A 1ZO8A 3DKPA 3DDCA 4TL7A 2J7KA 1LNQA 1NVWQ 1D8AA 1O94A 5L3ZA 5IDVA 4INAA 1G291 1DO8A 3E48A 1XEAA 4R51A 4IZIA 1K8RA 3B82A 2V54A 4WIAA 3NUGA 2BKEA 2DC1A 5SZHB 2JLZA 3L77A 1EFRA 3WMWA 1HDCA 4O5OA 4XSHA 2RH5A 4CRWB 2IS1A 2QNRA 3TPCA 3WWYA 1I36A 2E49A 4FBGA 1FP7A 1QYXA 4AJNA 4TZTA 1QLJA 4WCFA 2GXUA 2A94A 5H68A 4MYUA 1GYPA 1LLUA 2XOKD 3AKDA 5DO9A 2P5UA 3GZNA 2H17A 4KQWA 2AR7A 3DO6A 4RD6A 4QBGB 2EYUA 3QPWA 4XQCA 4U8GA 2QQEA 4AJ1A 2DWPA 3ECCA 1J90A 3KJEA 4MRPA 3NT2A 3B2EA 3ST7A 3CPSA 4RVGA 1R0WA 2QIOA 2MSEB 1GOTA 4QGGA 1QVRA 1AS3A 1KSJA 1QHIA 5JECA 1GL3A 2W6JA 1SAYA 4Q9JA 2Q50A 2GSDA 2PNFA 4JLDA 1NNEA 4Q1FA 2RGNC 1XCPA 3ZU5A 1KEVA 4JJKA 4H3VA 3TFOA 3U3RA 3I3OA 4G3XA 2XB2A 3F3YA 3KKQA 4LGMA 1RW4A 1TL7C 4LHWA 4JGBA 4PZDA 2V1UA 4BQPA 1GG2A 4YRBA 3PHLA 3IC5A 4IXTA 4II2A 2NO7A 4AKEA 3DAFA 4MKXA 4O2RA 3OIGA 4NDZA 4J1QA 3WRXC 5EUMA 4JROA 4WLOA 2W2LD 2VP5A 1RKBA 1U4OA 2NMVA 4DA9A 1OYYA 2QX7A 3PITA 4WXRA 1G5RA 2VF7A 3O8QA 1R0LA 4FFMA 3K1JA 4OI0A 1Z45A 3D1LA 3MJTA 3L6DA 4F4IA 1WXDA 1OT3A 2JJ1D 3H1TA 1NN3A 3IIMA 3RFTA 3U3OA 4XYGA 4EI2A 1WA5A 3D31A 1OKKD 4B3JA 1K5HA 3GZ4A 1GQQA 1T1RA 4F4JA 1D9XA 3ZGXA 4EJSA 3UCFA 1MP0A 3EZ2A 1E2GA 3WMGA 2RBEA 4OHUA 5ITWA 5JFOA 1IZ9A 1OXTA 4NYIQ 3EWSA 4DLUA 4RZ3A 4CR8A 1E7YA 3GA0A 1E2PA 5P21A 421PA 4LCBA 1JWAB 2IZ0A 4P33A 4FCTA 4DC0A 1MC5A 3CNNA 3AJRA 3ADCA 2C07A 3RWBA 1F0YA 5FTJA 3TSCA 3I6IA 3GPDG 4CM8B 1I30A 1CEEA 2VHJA 2Q3EA 5ICSA 4W4TA 5F21A 4OQFA 4XX0A 2RHMA 1TMKA 2W6JD 4A73A 1C14A 2XZPA 3FKSA 5T64A 3PHHA 1N6PA 3QOFA 1DVRA 2X23A 2GD1O 1RM3A 4DGSA 3E5MA 4WECA 1I3NA 4J9UE 1EWRA 3WBBA 4J43A 3AVTA 4Z6KA 5MDHA 3F1KA 3PDJA 3COSA 2GDZA 4J1TA 3IILA 1KJYA 2ZPTX 3RUCA 2C82A 2D06A 1ENYA 4P0TA 5EZ5A 4BMVA 3QA9A 4TSKA 4A1FA 1EFUA 4BLTA 4GKBA 1NR1A 3DHEA 3ZQ6A 2QY9A 4ACBA 4NH0A 1PX0A 2QENA 2JGNA 2DCUA 3DZKA 1ISIA 1CJTC 4GL2A 4J90A 1HT0A 4OKNA 4CEIA 3DOFA 1AN0A 1LQTA 1YKFA 1DARA 1F14A 1Q1NA 3RC9A 1I32A 4F38A 5BSGA 3N74A 2O0JA 4TRJA 4RF3A 1DO2A 3OFND 3LVRE 4Q03A 3D6TB 3WBKA 3OEYA 2B8TA 4KFTA 1F6BA 4RDIA 4PHTA 3BMCA 1NRJB 2RGEA 3JQAB 3LLSA 3VDQA 4IXNA 4UXHA 5MGBA 2IXFA 2QT1A 4XCVA 3IAHA 4TYWA 3LC7O 1UBFA 5D3MB 1DAPA 1U3WA 3GY0A 4LJ4A 1KSHA 3UGKA 2Z43A 5K0ZA 4D4MA 3H9UA 4MIOA 3RAPR 5KCZA 3RABA 3PWZA 4NDNE 1EX6A 4L74A 4PC3A 1LRKA 1SB8A 4C30A 1V43A 2CY0A 3DL2A 1OC2A 2F9MA 1XRJA 2D0IA 4XRRA 1MKYA 2IWHA 1N6RA 4KFRA 4DLLA 1UKEA 4FC6A 3PPIA 4J91A 1JR3D 4KDEA 4C3ZA 4LPKA 4TWZA 3MWEB 1KEWA 3Q8XB 1FDVA 8LDHA 3HWSA 5FTKA 1YE8A 2ZRAA 4CPDA 4YJHB 1Y8RA 1CP2A 3RU7A 4NK4A 2I1VB 2VH5R 5IRCD 3UW3A 3NJ8A 3DOJA 4HUQB 3Q85A 2DHRA 2EEZA 4KWIA 1NASA 3FTNA 1AJEA 1E1NA 3KXDA 4AJ2A 1MX3A 2JCYA 4M9QA 5JS7A 1IJEA 4IRUB 4RVDA 4ZHSA 3Q5EA 4M53A 4RZ2A 4OI4A 4AJJA 4P4SB 4A2PA 1BOFA 3KXLA 3BAZA 2W0MA 4IINA 4JMPA 4NYMQ 4J4TA 2YWFA 1TU4A 3R7WA 2C03A 2WZQA 1XXHA 2E1RA 4GOKA 2B5VA 1M74A 1AS2A 3KKNA 3IEVA 5TJHA 3OSUA 3ZNOA 3JVUA 5A06A 1DAHA 1Z07A 4NCJA 2RMKA 5BSEA 2HCTA 3PEVA 3UPUA 1HF3A 5DULA 1UP6A 3EIHA 4RCVA 3D0OA 1ZUD1 3EPKA 4BNYA 3TWOA 4BIIA 1XU4A 4HFRA 5AWFC 2WE8A 1ZYUA 4Q9HA 4Q3DA 4MKFA 3WB9A 1S2MA 1YZUA 3SN6A 3O8RA 1YKSA 1QG6A 4RD1A 4BNZA 4QTZA 3B6EA 1P2TA 1ZK1A 2J1LA 3FFBA 1HYHA 4O63O 3OEHD 5K6AA 1H2BA 1R37A 2BC9A 4TZKA 4JLWA 4Y8VA 5SZJA 2Y8EA 4RGBA 4C0JA 3V1YA 4BO6A 4AK9A 3R20A 1UZMA 5A5FA 5G2OA 2ZI3A 2PV7A 2X86A 1G8PA 1R16A 4NBRA 3AU8A 4C0LA 1IJFA 1HLDA 1EFTA 1Z7EA 1QZXA 1KVUA 3UICA 2EKQA 4OJNA 4L9SA 4FSHA 4M1SA 3SBEA 4GRAA 4YRAA 2O8DB 5BNFA 4B74A 4I1OA 4MDHA 5D3QA 2QQ5A 1FFHA 1E3MA 2ZR7A 1FOEB 1W36B 2F43B 2O0HA 1A82A 2GEUA 1RYFA 1XMJA 4Z1MA 2JFHA 3BIFA 2VHQA 4DLTA 5JMWA 4D6PA 4ZDWA 3CRRA 4YRDA 2IWRA 2DUUA 5FBRB 3EAGA 1UAAA 1Q21A 3UMRA 4G65A 2X1HA 4FFNA 2MMCA 1G3IA 4WLVA 3L6EA 1TI7A 1NBOA 1XCBA 3WXMA 3O8QB 3IIKA 3ROMA 2UZIR 3VPSA 4YA6A 2UVDA 5A05A 2H9IA 1GRRA 2IS6A 2ZI5A 4BFUA 2D2EA 2PGJA 2NTVA 4EJSB 3QSGA 2EKPA 3ZH9B 4P4GA 4HAYA 2HJSA 3FYHA 3E18A 5COAA 3W6NA 3BH6A 3FWZA 3HR8A 1I01A 1A72A 2VPPA 4BUJA 3GLHB 3IUPA 2VF8A 1P74A 3I9MA 3TJRA 5ES3A 2CLDX 4ZV4A 4EGFA 5FOSA 2RAFA 3CPHA 5B4VA 3ETLA 3EW9A 3LDHA 2J46A 1VI2A 1I4DD 5KVVA 4IDHA 4L15A 2UV8A 2IZ1A 4D80A 4RFSB 4DQUA 2WWXA 3GDGA 3SHFA 3D3WA 3A06A 1CJMA 4DBZA 4CEJB 4O25A 2ZJ2A 4D3FA 3AUTA 1AXGA 1UDBA 3K0EA 2H92A 2HJGA 4BKUA 3X1WA 1XD2A 2BIFA 1V9LA 3H2ZA 1LXCA 3SFVA 2V1XA 1KERA 1L2TA 1E32A 4GX2A 2P91A 1OW3B 4LJAA 1WW8A 3OJOA 5AXCA 1PWXA 3HYRA 5TLSA 2ZITA 1G18A 1VPDA 3CKLA 3KB2A 3IS3A 2ZJBA 4OQYA 3PRJA 3LC1O 2ZETA 4JIGA 4CZ2A 5TX7A 3W8RA 4I08A 2PL3A 2QP4A 4MUBA 1KI8A 2DFVA 3ZWXA 3GLIB 3GVPA 1K2WA 4L4RA 5EP4A 3GEMA 3WXBA 4Q47A 4FDAA 3PG5A 1S1MA 2XSZA 3REGA 1NMYA 3BS4A 3I9OA 2DYKA 4J2HA 4P4SA 1K6XA 1BMFD 2VRCA 3TUZC 2UYYA 1ZZEA 5LBIA 4GX5A 1Q0HA 1KO5A 2D74A 4NMMA 2BHLA 4J0EA 4KSCA 1KJWA 3R9IA 4R1SA 1ZCJA 3CF6R 2J3IA 3JD2A 1FL9A 1G7RA 4AG3A 3CR7A 2VSOA 3P19A 3PR1A 2R2GA 1GY8A 3PJRA 3PLRA 1JAHA 2GCOB 3V00A 4BNMA 2N1BA 3WSVA 5EL0A 5DCYA 2OL4A 3MTJA 3S1AA 2ZTUA 3GMDA 4UEKA 3ONWA 2ZS9A 1NR7A 3AFMA 4DYVA 1DHRA 3C4JA 3TQHA 4QG7A 3BMCB 1CR4A 1Q2XA 1G8HA 2ZYUX 3AH8A 4ILKA 4RL6A 1F2TA 2IXBA 2G5CA 1T4BA 1E3JA 4LJ9A 2ZYGA 4IDCA 2PZEA 3QEJA 1OIWA 3Q7QA 1Y5RA 1G3QA 5J4VA 3BYZA 3W3AA 1DIBA 1YVEI 3LT1A 3LQQA 4A6XA 1V35A 1N8KA 4Z9YA 1IB6A 3IMFA 3B6ZA 4MGKR 2SHKA 2VHWA 5L3VA 3GMTA 1CQIA 3PEWA 2DPGA 3IQWA 4YPOA 5FBQB 1OH5A 1PGQA 5K8IA 3ZHXA 4NZ9A 2CDNA 2FV8A 2RGAA 3ANMA 5KJ6A 1H9AA 1ESNA 4AKIA 2QG6A 2OG2A 5FI0B 2GASA 1ISFA 4CMKA 3WX0A 4XIYA 3LZ6A 4NG5A 4GMDA 1PJSA 3NXSA 1BMFA 4JLOA 4G81A 3HDHA 4WCDA 2NPFA 2VCYA 2IRWA 4BLPA 1YQXA 4QQRA 4BNFA 2BKAA 1ZNQO 2ORIA 3ASVA 5DP1A 3EPLA 1KDOA 1PU2A 2YNMA 5JRJA 5IDYA 4CLOB 3SJ7A 1G21E 4J9VA 3PK0A 1LEHA 1B8VA 2J6IA 2CXXA 1T2FA 5AXBA 4XGKA 2YDYA 2A30A 5L4SA 3GAZA 3VTKA 3MWDB 4EYEA 1W5TA 2H7VA 4EFNA 1TNDA 2CD9A 2Y1GA 1G5TA 4Q4HB 2IX3A 1XXHB 1XB2A 1VSUA 3ASUA 4ABYA 2ZYVX 2P5SA 2EW2A 1KYQA 1MG0A 2NVWA 3K0CA 3HU1A 4FS3A 2CK3A 4LRSB 3SQXA 3T4EA 3S2GA 1E7SA 1U0JA 4XD7D 4M1TA 3B1KA 2NV6A 4R9SA 1ZNZA 4D81A 4NBSA 1PJBA 2JAPA 2OP1A 1XNJA 1M75A 1OC4A 1W49A 1VJ1A 1U98A 4YC7A 2WIBA 4IJWA 5JHHB 1D8TA 3NEYA 1XTIA 5J4KA 4EDFA 2D8AA 3RSLA 4JBYA 2PKQP 3ICQB 4CT5A 2Q3MA 2ECKA 4CR7A 4U02A 3NBZC 2AE1A 3GEGA 4EPRA 4O3MA 5E7JA 2O3UA 4BNLA 1KO1A 4WW0A 3WJ7A 3QXJA 5KVSA 1II8A 3AP3A 4UVEA 4EDHA 5H81A 1M7BA 4PPQA 2JLRA 2EF1A 1S0UA 3UG6A 4NR0A 4JLNA 3THYB 3DZDA 1D1SA 2ORVA 4AYTA 5KJEA 1Z2CA 3NC0C 1Z0IA 1C4OA 3CZMA 4KXFB 2IS2A 5CIWA 1DAMA 1E9RA 1ONOA 2FZEA 1KETA 1XPOA 1LDEA 4AYXA 4P22A 1ZM2A 4ACAA 5I9NA 1R0YA 3QW2A 4NTZA 2H63A 5IK2A 1KAOA 1QHYA 3OICA 4IMPA 1XCGB 3ZZTA 1Z8FA 3WNQA 4Q4JB 2R8RA 1U0HC 1E2DA 4BEBA 5KDLA 4AKGA 3VZSA 1R0SA 5A5GA 2A5YB 3K09A 1AS0A 4A03A 2W98A 1SHKA 1ZC4A 4GVLA 1A4RA 2JIZD 1DAOA 2DUWA 3T5DA 2J0SA 1P5ZB 3WDSA 4K9DA 1PGOA 4BB6A 5JDCA 4OL0A 3QWBA 2PFGA 5BQFA 1P61B 5JI2E 1C1DB 4PLTA 1U3TA 2I67A 4E13A 5JWHA 1WBDA 2Z5LA 1PSDA 4IXMA 2OAP1 2B7CA 4C7OB 3SEFA 4E2XA 2H1LA 2H18A 3L4BC 2QMEA 5A04A 3RS4A 4AJ4A 1ZU5A 4HUJA 3QIVA 4DKXA 4X8MA 3JQ9C 1ANKA 3GVHA 5IXSA 5DOVA 3ASYA 4EUEA 4ERNA 3IGFA 1P4SA 1GL6A 3B9QA 1UXGA 2VWPA 3UKDA 5EP1A 3I1JA 2VHTA 4GX0A 1NVUQ 3ZV4A 2C9CA 3HN7A 4DXHA 3PVSA 2FG5A 1A71A 4LBWA 3KVOA 2W2LA 2JD1A 5IFLA 1H6DA 2REBA 1Y81A 1NLFA 2KWIA 1NPYA 4GOJA 3ENKA 3CPEA 1XWIA 1NFFA 4LRWA 2OO7A 2FWRA 2Y1FA 3HQ4O 4NFHA 1QV6A 3HDJA 1EE9A 2V65A 3U62A 3QVVA 3TR5A 4QHTA 1S6YA 4YAGA 5CEJA 2ZRPA 3IPYA 1WPQA 5E7IA 1EFRD 3A8TA 3K30A 2W6IA 1VTKA 1CLUA 3FRJA 3BERA 1AHIA 3RU9A 2OGUA 4DJTA 2J41A 3A1NA 1KI7A 4ZA2A 4MDEA 5BSFA 4BGUA 1Z29A 4FMCB 2X5JO 1TQ6A 3GEEA 4FW9A 1AE1A 1PIWA 3RVDA 1GUFA 4WASA 2O8CA 3GLGE 1R5BA 3UANA 5KPJA 2OXIA 5KOIA 4JSTA 4QX6A 3OEWA 1U28A 4E09A 3KOUA 1FTSA 1D3AA 1UJ2A 2H6EA 1RRCA 1EVZA 4ZDKA 2HUNA 1LW7A 3JQCA 5JZVA 3AUXA 1EFCA 3SOPA 4H16A 2VUSA 2B69A 4RORA 4OO3A 2BCGY 3OM9A 1RM5A 4NFYA 1EE2A 5L3QA 1OH7A 2BV3A 2FPMA 3AU9A 3RS5A 2YINC 1LC0A 2C2XA 4IEIA 3A58B 3AM4A 5J4HA 3EYWA 3GJ6A 3OA2A 3BJIC 5ER6A 1PUJA 4CL8A 3U5TA 4DSOA 2XXAA 4OMUA 1XU7A 1D6JA 1E6EA 4YEDA 4KODA 4IQ8A 3ZWOA 3QENA 1R15A 2PH1A 1CJCA 3PJGA 3VH4A 3A37A 2XTNA 1LTHR 4CLHA 4Y67A 4G5GA 1BXKA 5G0VA 2GLXA 4N0EA 3BORA 2Z4RA 3EZYA 4NU6A 1E0KA 2OEPA 2WKQA 5B4TA 1MABA 1I2BA 4RZXA 1NX6A 2HK8A 3KYCB 1UF9A 1W0JA 3PUVA 1LSJA 1IN7A 4N18A 4BO2A 3HDYA 2Y1OA 2GESA 4GGPA 1KI3A 2GERA 1Q7BA 1YZNA 5DF1A 3FSRA 4U0JA 3CF2A 2CCGA 2QGNA 1U90A 4XSGA 3N2IA 2XF8A 3R0IA 4NHOA 4DWJA 2G82A 4NCNA 1AZSC 2G1JA 5EJEA 4R2IA 4JS0A 3ZU2A 3RASA 4BHTA 4PSKA 5KOYA 4NNJA 4TLEA 3VPHA 3JQAD 3RQSA 5DZSA 3RSHA 3NIBA 4FC7A 4KTVE 1M7HA 4JJGA 4PAQA 3U4HA 1E9SA 3GLGA 3VU9B 2WTUA 2W2KA 4ZQBA 2H8KA 4CM8A 4Y0VA 2CMDA 1K5DA 3PV0A 3LLUA 4LBVA 4DCNA 2BELA 4YJGA 5DGXA 1RJ9B 3EIEA 2O8FA 3T61A 2L0XA 4AC9A 5JCPA 1E98A 4IJMA 4HADA 3GT0A 2F1HA 3DZFA 4BFVA 4L8VA 2P67A 1RPNA 1U5AA 4TLBA 3BGWA 4LJ6A 2VYFA 1X7HA 4XJXA 1M1YE 4DLAA 3AVUA 1QYCA 4A0GA 1TT5B 1N6HA 2JASA 4DT1B 4GT1A 2WMNB 3L2OB 3OH8A 1KO8A 5DCUA 3KQLA 4LRTB 2O8BA 4PHFA 3W90A 4PLYA 1NL3A 2Q1WA 5TQVA 4F4CA 2IYQA 3NKLA 1T2DA 1U8FO 2IYUA 4UEOA 2V55B 4I1UA 5F5NA 3GVXA 2OAQ1 2W00A 1GDHA 2P9EA 1QRAA 1KK2A 3AM1A 4MITA 2VWHA 4AI6A 4BL5A 1RZ3A 4JVMA 1WDLA 3VDRA 4ZCIA 3DBHB 1ADGA 1XTSA 4R54A 3DEYX 4NU0A 2V3CC 3VOSA 4IGEA 5ENVA 5DH9A 4B7CA 1EG7A 4TMWA 4CQMA 1C1XA 3NAQA 3FI9A 4A2QA 2J0QA 4JZKA 3DMYA 3PHGA 3AEZA 3AKYA 1QVAA 3GJ5A 3DEFA 4BUCA 1XSEA 3JQAA 4J16A 4O0LA 2NIPA 1DBVO 4KVAA 2GO1A 3TGPA 4Q3NA 1R4NB 4YAKA 5KU1A 5FTMA 3DBRB 5EZ6B 4A82A 1IONA 3EZLA 4BV9A 3GH3A 4WLEA 2WICA 4M8SA 4PPGA 5JCZA 2IE0A 1JTVA 2GBLA 3Q1LA 3UKOA 3A4LA 1ZD1A 4M22A 3C5CA 4F6CA 4OK3A 3VU9A 1JR3A 2DT5A 3PCRB 1T25A 1P1RA 4PLVA 1JEEA 2ZCVA 2JLSA 1BIFA 1SKYB 4IM7A 5CLQA 2C20A 1PGJA 4B3CA 3PFFA 1CWUA 1SEPA 3UK6A 2Y68A 2YJTD 4CM5A 4QJ3A 4J7XA 3CNLA 1AKEA 4K28A 5A9TA 2OCBA 1CERA 5AQ1A 3H4VA 1OHHA 4D2IA 5CAEA 4O1MA 1UJMA 1KOFA 1N92A 2JATA 1P1HA 1HZJA 4J6FA 1IHXA 3OZXA 3IP3A 4DTIA 3S2FA 3GEDA 1VIAA 1QF9A 1XTRA 5DI3B 2P6NA 4TKMA 2PH5A 4KWHA 3IDQA 1J8MF 2B6HA 5F3RA 2D4HA 3CH5A 3AK4A 3Q72A 3CEAA 3JQ8A 4NHEA 1MXHA 3U5ZB 3WNBA 3BMOB 4HAZA 3RC7A 5C2JB 1RJWA 4TVBA 5C46F 1WZIA 1TADA 4W7HA 3C1OA 1VG1A 3OAAA 4URFA 3BTUA 3OEED 5JDIA 1HEIA 4QBFA 1DHTA 2Z95A 5JS8A 4UVHA 4BNWA 4BQSA 1G4UR 2Q1TA 1VIYA 4Z0TA 1ZNWA 2NTJA 3BXZA 2XPCA 2D59A 2X0NA 1WAMA 2X2EA 4B44A 1E2JA 1NLYA 2Q99A 1ZEMA 2BMJA 4DYDA 2Y0CA 4D4KA 2V6BA 1QMGA 4ESHA 1PS8A 2ZB4A 3CIOA 5JCJD 4CM6A 2W90A 3G79A 4I5FA 3PIRA 2WJJA 4IDBA 1T3HA 1H93A 3IL2A 3F9IA 1IY8A 4MPDA 2GN8A 1HSOA 4F3YA 3LDAA 1MFPA 3NDRA 1LA2A 5KNLA 1NHGA 2DBQA 1HLPA 1HYEA 3DQPA 4EITA 2ZIAA 1N1GA 1XEFA 1FQJA 2D62A 1ZMTA 5AK0A 3TQFA 4PAOA 1E9BA 1WDMA 3EC7A 3MZ0A 3G82C 4R2HA 2EWVA 3PUYA 3JQ9A 4GX1A 5FFMA 1U2DA 1VM6A 1Z6ZA 1MLDA 3ZWBA 1RFLA 1B0AA 4RVHA 5HWSA 4A0HA 2EYQA 4I5GA 3C8UA 5BN4A 3I9KA 2GJSA 4DCTA 4FFOA 2W8ZA 4EPYA 5EP3A 1MH1A 1E2KA 3WNVA 2HXYA 1E7WA 4BNVA 1WRBA 2AKYA 4C2TA 1WMAA 2MSCB 3PVZA 4FMDF 1BSVA 4BO7A 3NDIA 3OJ0A 2OILA 4HUQA 2HRZA 1XQ6A 4U5XA 1P9WA 1DLJA 2QL6A 2XJ9A 3RIHA 3RUEA 1Z47A 1U9JA 4NBWA 1KVQA 3FHLA 1OSNA 3TOZA 4W9NA 4BFSA 3JQ8B 3U49A 2ZI4A 3DZ8A 3AUSA 2AKAB 4G01B 2IYPA 4RKEA 4RF4A 1ZJ6A 1YDWA 1MUUA 5HZHA 2DPXA 4KI0A 2FA9A 2ZJ5A 2QTHA 2F43A 4LV6A 1R4NA 5FR2A 4Z54A 5UKDA 1YO6A 4TQ9A 5HA5A 2DLDA 5F9HA 4DUGD 1GTMA 4ZU3A 4RLSA 5DP2A 4ND3A 3ZI0A 3ZWMA 2XEXA 1ONPA 2ZI9A 2ATVA 3OQ1A 3H8VA 1P75A 4URYR 4TLAA 4C0QC 3OJLA 1LS1A 3QVWA 4CLDA 4XQGA 4AURA 4F91B 4TTQA 4YAEA 4ZKDA 1GM5A 3T1QA 1VKOA 4OGWA 1C0PA 2PLFA 4RFVA 3A4MA 2ZE7A 1MA0A 2QUZA 4IGFA 5KSOA 5KNDA 4RFSA 3GR6A 4PN3A 3ICEA 3M2PA 2YKGA 4TL8A 5F5LA 1DXYA 3W5IA 1DEHA 4Q9KA 4B7XA 2ZVPX 1W4RA 4RZHA 2VRBA 3NHAA 1HDYA 3Q7PA 2GZAA 4MRVA 4DB4A 4YTEA 4UVIA 2RAPA 2DPHA 2CEAA 1U8ZA 2VP6A 4QNMA 4OQMA 1KOLA 5JDCC 4ZGWA 4NI5A 4M49A 1F17A 3NG1A 5G4KB 1XP8A 1SXJB 1H2HA 3THYA 1IM2A 3PEUA 3BZUA 2O52A 3ZN2A 3C1TA 3O03A 3EW7A 5AYVA 3KJHA 3FHOA 4UNNA 1YZGA 1YZLA 2VRCD 4HV4A 2R00A 5J5CA 2GF2A 1ARZA 1ZAKA 1G7TA 3KYBA 1KDTA 3C16C 2YHUA 1P2VA 2V7PA 2WJVA 1E79A 1W0JD 2JDID 4PLGA 5A1TA 2WM3A 5G0TA 3VPGA 3M0EA 1NQOA 4MH0R 4IFEA 1DBSA 4ZDJA 4CF7A 3R9XA 4IDNA 3RHFA 1X8JA 3WYFA 1MG5A 5I9LA 4EAQA 4XEHA 1J7KA 3W1VA 1YQGA 1I8TA 3WHKA 1JLLA 3X1ZA 1W4CA 3A1SA 2IYXA 2J5QA 4IOKA 1M66A 5L7TA 2QI9C 4XH9B 4XWKA 5FUYA 3DHYA 4WOJA 2BD0A 2C54A 1GKUB 1U2GA 4F7WA 3RBXA 4R1UA 4Q7LA 1KC1A 5HZKA 2WWWA 1XDBA 1C0KA 3W6PA 4TLDA 1E7QA 3T4XA 1IQPA 5B57C 4ZRMA 3L82B 3G0OA 3EASA 1E2EA 4OK5A 2OHXA 1K89A 5FPKA 4DSNA 2PZGA 2V6GA 4PXAA 4LX0A 4CM4B 2A3RA 1XEWY 1FX0B 4PPFA 3RYTC 2D5CA 4YMSA 1A1VA 3ZH2A 1COWD 1M2OB 2ONKA 3A4NA 1S3SA 5FPHA 1XTKA 2V4ZA 2CBZA 4HAVA 1E1MA 3QLJA 4FINA 3STHA 1ZNXA 3JQ6A 1CU1A 3KUDA 3ABIA 1IBRA 1HURA 2WSSA 1P1FA 1G64A 1JPJA 4EJSC 1KK0A 1XR3A 2QM8A 5KJCA 3G0HA 5T6BA 1DAEA 1R10A 4CM1A 1H6AA 1UBEA 4QGFA 4D41A 2ZYWX 1UXJA 4LHXA 4YQZA 1OXVA 4A15A 2BGMA 1TQ2A 4XB2A 4B75A 1HXHA 2NADA 1KBZA 3G1UA 2HT1A 2ZATA 3GHHA 5L53A 3JD1A 4DC9A 1X8KA 1AA9A 1YGYA 2B7BA 2VL7A 1SB9A 4K1LA 2XXAB 1SVOA 4KU4A 2GJ9A 3QE0A 2OMEA 4U7WA 2YWHA 4YBZA 4XWOA 3CF0A 2GN9A 1YJQA 5BNIA 2VOJA 4TN1A 1GCOA 4G2NA 2CMKA 1TEVA 4A26A 4QL3A 3EAQA 1HE1C 2VP9A 3C7DB 4PX9A 3NC1C 4D43A 5COQA 4BMSA 4D0LB 4MP8A 3LT2A 5CJPA 3PFIA 4PVCA 4N0DA 1EUDA 1VCIA 2XX3A 3CRW1 3VKWA 3CKYA 2HMSA 4A0RA 4AJIA 1JKFA 3X2EA 3WTBA 2Q1UA 4CV1A 3I1FA 1COWA 1YB5A 4QXAA 4EIWA 3I8XA 3ZLJA 3HHPA 4CUKA 2I3BA 4E5MA 2PZFA 4B2IA 1GZ6A 4OAQA 1F2TB 5ANRB 5T57A 3VNVA 3AI2A 2GN6A 2BI8A 221PA 1CTQA 2HMTA 1DAKA 1U4SA 1ZKMA 1Y3AA 4R98A 4YMVA 3TH5A 2FR1A 3OIVA 4AJPA 1ZD9A 3A1WA 1P1IA 1EK5A 3WYCA 3CX6A 5IZCA 3K9NA 1DTSA 2GDJA 2JLXA 4FCCA 3AOEA 1SEVA 1TB4A 1JXOA 5GZ6A 2FSVA 2OT3B 4C9BA 4CDGA 3ZQJA 5FBVB 3LVQE 1S9HA 1TTTA 1E3IA 1HUQA 5L8VA 1QRRA 3WYBA 2QPAA 1OXXK 2VSXA 3CTMA 3KB6A 1GD1O 5CB8A 2GF9A 1YL6A 1G16A 1MRNA 1OB2A 1RJ9A 3CUKA 4EPXA 5ICMA 2BEKA 4ZCLA 4E22A 3E03A 1ZJYA 5TMPA 3I32A 1E5LA 1W8DA 1ZUHA 2A9FA 3DPUA 5EQDA 2ZR0A 4AJLA 3NHBA 2A7QA 3MAAC 3KXIA 3I9NA 4JNKA 3HFSA 5IXYA 1HYQA 3GLGB 2C5LA 2D5AA 3OEEA 1NQAO 5GJBA 1YBAA 4RKFA 3K0AA 1F48A 3A1UA 2FU5C 2GAAA 3AF1A 4XYLA 1D2EA 2WWFA 1VG8A 1NFQA 2VQ3A 5I8WA 5CM9C 4PFJA 1YRLA 2R62A 4BO4A 1KI1A 4C0HA 3R8CA 3X1DA 4CR6A 1BYUA 3BFXA 4URXR 1E1QA 4MKZA 4PSVA 1IXRC 4PLWA 1DDOA 5DNAA 4AFNA 4Z0HO 5U4QA 2ZTVA 1V0JA 3RNLA 2A5FA 2QW8A 1W2GA 3CONA 3SYKA 3VZPA 1Q0QA 4HFNA 5JAQA 1C9KA 1XMSA 4XRGA 4CYMA 3QQPA 1N6NA 4YVFA 4IIVA 2FNAA 3GC6A 2H5EA 4A36A 3FE2A 1XELA 1GZSA 5KHOC 1H8ED 1ZBDA 3QHAA 1C0IA 4CMIB 1HTWA 1E5QA 1G8GA 1NJFA 2A78A 3ZIAD 4ITUA 5TS3A 1XZPA 3NTOA 1AGNA 3KZVA 3ZU3A 4DSTA 3WOHA 4LSWA 1I4TD 1HKUA 3B9PA 4ALMA 4DC1A 2HF9A 2PD6A 4NKRA 4BNXA 1X7GA 4AVYA 3JQBC 2QROA 4MVJP 4WNCA 2QGZA 4F93B 1EZ4A 1YJ8A 5C5IA 2DBYA 3NDJA 4FJ0A 4ITRC 1ZNYA 4B3BA 2PT7A 3PENA 1YR6A 4NZYA 3JD0A 4L0QA 2AEMA 3QXHA 3ZVMA 1PZEA 1E0DA 3CLVA 1K3TA 1ODFA 3WTCA 4E2ZA 1T8TA 3B70A 1Z6AA 1QHHA 2IK8A 2ODNA 2ZAOA 3GLQA 1QLHA 4KQXA 1WWKA 4GZLA 1HRDA 1U94A 3ANLA 3HN2A 2ZS7A 4PANA 1QXSA 2YOGA 4AKHA 2OO5A 2DU8A 2AW5A 1E9FA 3LQFA 5DYIA 2ZRGA 4CMBA 3VH3A 1MT0A 3GQVA 1B14A 3BD9A 4M1QA 3GGOA 3GGGA 3O8CA 1X7DA 2PMDA 1R5NA 4JJZA 1UXHA 5EP2A 4OKIA 4NJMB 4A7PA 2OUIA 1O9BA 1E3SA 1QHSA 3KSZO 5KTKA 2J5KA 1U99A 3X2FA 3EC1A 3OETA 1DIAA 3RVBA 5LPNA 3DMTA 1BTOA 3RFXA 3C8MA 4R5HA 4JBHA 3GLIE 4D46A 5TY0A 4HKTA 2ZRJA 1RVDA 3IIJA 3LBHA 1P31A 1CF2O 1M6WA 1E4VA 3H0KA 2OFXA 3TW8B 3W6ZA 2OFOA 2IYOA 4LJYA 1NIPA 1YOVB 4P4LA 4BRUA 5CP8A 1F8FA 2BH9A 4MP6A 3MRSA 2IEYA 1DIRA 5FPYA 2GNOA 2E37A 2ZE8A 3S8MA 1OYWA 1PWZA 4EQ6A 3ZWNA 2EWMA 4M1WA 2WJHA 3V2UA 4OHWA 2Q2VA 2AXPA 3GGPA 4GH5A 2QP9X 1V3VA 3TSWA 1PJLA 3BK7A 4BLQA 4RD4A 2O3TA 3GD7A 1WNTA 1Y7TA 3WFIA 4HDOB 3PUXA 4LY6A 4YJFA 3NTRA 4HI0E 3UXMA 4HB0A 4M8NE 1OFHA 4MVJF 2POQX 4R1TA 1SXJE 1PS9A 1H6CA 2NZ8A 4PR0A 3K0FB 1G8FA 2RHDA 4JT4A 1TPZA 5IG2A 2J3HA 4B34A 2HYDA 5FL7D 3P2YA 3K8ZA 4MIYA 2F9LA 1H8HD 2BMDA 4Q3EA 2VHVA 4E5KA 1KIMA 1VSVA 2VTKA 3MCVA 2ZM5A 4ND4A 1DJNA 4C0AC 1ZUNB 1ZH8A 4TZ6A 3AB3A 1KAGA 1E2NA 3CMCO 3KKMA 2NOAA 3GFTA 4CLOA 3AM3A 2HEIA 3THWA 3WQSB 3BXXA 5KKAA 3WGQA 3INRA 4E21A 3F5FA 4B47A 5EXSA 4EW6A 2C99A 2QA5A 3WQQA 1T3LA 2ZRMA 1OFTA 2FPPA 1KMQA 1CJKC 1A27A 4HAWA 3GG2A 5JBQA 1VHLA 1NN5A 5CEFA 4RQTA 1W0KA 3GPIA 3TOXA 2EXXA 2HDHA 4US2R 3VR5A 3D7LA 3DVLA 1OIXA 1KVTA 2VUUA 3KYDA 1E4YA 2FN7A 3CMMA 3WYAA 1W0CA 4BS9A 3WGOA 4E12A 4Y6PA 2IUUA 4D79A 2BMEA 5L7WA 1PL6A 1HSZA 1YOVA 5B2ZA 3ZWPA 1ZC3A 5FFFA 2KBFA 5DI9A 1XTQA 2QRJA 3PI7A 4C4PA 1VYVA 3TKLA 3RRYA 2ANCA 1CULC 3LX8A 2FSHA 3HSKA 3MCAA 4TL9A 2WSSD 2DTEA 2QPTA 4RF2A 2ZSEA 3FD8A 3D7MA 1RRFA 3JYNA 2JD2A 4YACA 3A6PC 2DFKB 5CJ2A 4XTCS 1YWGO 3HWRA 4KV9A 3NX4A 1NP6A 2NQTA 2GXSA 3MTGA 3QKSB 2ZUCA 4TSFD 3BTSA 1BRMA 4H9GA 2KJQA 2Y1CA 2FSFA 3UMFA 2EHDA 3TIFA 5E3HA 4FW8A 3ZVRA 1GCUA 2Y1EA 5EPOA 3C41J 3LV8A 4FQ8A 3GFGA 4UXIA 2PY6A 1EBFA 3BOSA 4ZO4A 1Z0DA 1XG5A 5B12A 2OM2A 4NYJQ 2VUTA 3WSWA 3LNCA 3K70B 2EFHB 3RJ5A 4V0OA 5JDIC 5C4MA 1XGKA 4B6EA 4YJGB 3JSAA 4YT5A 4Q01A 1G3RA 1RIFA 4EJMA 2EIHA 5CB6A 4CMEA 2B4TO 5FOXA 2AXNA 1NYTA 3WGHA 4NYIR 2NQ2C 1TUEA 1OB5A 2ZE5A 3I73A 1XFAA 4WZBE 3H2YA 1A7JA 4NU5A 3WMEA 3HDTA 3BAFA 4XD2A 5SZIA 2RIRA 1GKIA 2CL0X 3H86A 2IW3A 3W4KA 5L4LA 3FGNA 2IYVA 1NG9A 1TAGA 2VTEA 3LW7A 4B4VA 2Q9BA 1TU3A 3TDKA 3RJ9A 2R44A 4S35A 4BKOA 1Z7BA 1GL9B 1Z83A 1JQBA 5E4FA 2I65A 2V7QD 4WXPA 4Z9FA 4MRRA 4Q3BA 4K8OA 3F6YA 5EINA 4E3ZA 5EJ2A 3MJ4A 2QSZA 3HP1A 1CRQA 1IULA 3GCGA 3CINA 4OKSA 2RGBA 4RD3A 5TT1A 2ZJYA 3I83A 3U7GA 1L7DA 3U44A 3W8FA 1R5OA 4PRLA 5T67A 3J81k 2G6BA 2JLQA 1W1WA 5TXGA 3GDOA 4XWAA 1YR7A 1Y8QB 4N54A 4PSAA 4II3A 1I4LD 2XAAA 1P2UA 4RJLA 1LTQA 4A5OA 2JHGA 2O4UX 1PV4A 1E2LA 3VKGA 4BFWA 5KVQA 2JLUA 4AL4A 3NEJA 2J5RA 1DG3A 2ZIZA 2Z5FA 1GUYA 5HTOA 2JLYA 4X8OA 3CBQA 4RPKA 1MGOA 1NP3A 3ZDFA 4R9RA 5KDOA 5C37A 2A92A 4OHVA 4BGVA 1T2EA 4URUR 4LCEA 4CMJA 1Y5MA 5TC4A 1DFGA 1UZLA 4GMXA 5FPSA 2VZ0A 1D9ZA 1N7HA 1PVOA 3QG1A 5L3SA 3RS3A 4YDHB 2ZQ5A 1CDOA 1ENZA 1YVDA 1OE0A 3SYNA 4FPXA 2C0CA 2ILTA 3IHLA 3NYWA 4M89A 2IL1A 3OHMA 1G4AE 3QPUA 2O8DA 1X15A 5E95A 3MFYA 1G41A 2G77B 4CV2A 3RBVA 4EFLA 4R71A 1FMJA 3ZIAA 4PQRA 4LW8A 4HEJA 3LT0A 3GRKA 1RM0A 4P4UA 1P2SA 4GMFA 5F1KA 2BBWA 1VC2A 1Z6GA 5LDHA 2RH8A 1PQUA 1JALA 4JK3A 4QOSA 4QXMA 4HNHA 1J49A 4DLSA 2IEZA 2NACA 4HSEA 1UKVY 2A5DA 1B0UA 1EUCA 4TTPA 3OIDA 2RCYA 1A4IA 4MKIA 4V0ME 4TRRA 1Z22A 4MUAA 3L4SO 2RGDA 1HZZA 4J2OA 1A4UA 3THOA 4GZMA 3SI7A 3SLGA 1X13A 2CVQA 2PGDA 4XJSA 1JAXA 1P0CA 1BDMA 1YH3A 2PA3A 1UAYA 1M8PA 5H70A 1LDNA 5DE3A 3KEQA 2CCKA 1PLJA 5AJYA 2AFIE 2QZ4A 4YJFB 2P4HX 3K70D 4YLGA 4A8JA 3DZJA 1SKYE 2ODEA 2Z0MA 4CMHA 3LF2A 3TZCA 2JD0A 1KZGB 4QBHA 1BXGA 4N5MA 3OHSX 1SGWA 1JECA 1ZRHA 4Q48A 3A1VA 1HDRA 4Q66C 1U9IC 4HLDA 1JJ7A 3ONDA 4TYPA 4M55A 1VDZA 1II9A 5JLJA 2ZSBA 4IW3B 1NVXQ 1N5JA 3I4FA 1CRPA 3UWOA 3QI2A 4CQLB 2O8EA 2VYND 1EFKA 1XDWA 4B7UA 1X1EA 1V6AA 2WKPA 1JVSA 2OXRA 1XXHE 2X7HA 1CS4C 4PAMA 1DS6A 5TRTA 4QFCA 3ZW8A 2PZMA 4Z8XA 1WQ1R 3C14C 1LFDB 4B35A 2AE2A 2NQ8A 4D0NA 2EW8A 3FWNA 4I1SA 2HT6A 1TT7A 4QECA 2P9CA 2W2XA 1OFIA 1Z0FA 1R2QA 3GJ8A 5BN3A 1VE9A 3JCZA 1KDPA 3LT4A 3E70C 3VQTA 1OOEA 1X0XA 4EEXA 5CG1A 1AM4D 3OFNA 3IUYA 1CQJA 2GHIA 2BBOA 4TMFA 2F1KA 1EFLA 3VKVA 4JL5A 4QFDA 1ML3A 3O8BA 2C95A 3K2BA 5AOVA 2R6JA 4CQMD 1XEWX 2AD5A 5JSZA 5IF3A 1XMVA 2LKCA 1PR3A 1MFZA 3GRPA 2QMUA 1OV4A 5HTKA 4BO0A 1M6NA 3KKOA 1FUKA 4PLCA 3DFZA 5AJVB 1XCMA 2WWGA 3RKRA 1R4MA 1T5LA 4DIEA 2QN6A 4DLZA 1NVGA 1UDWA 3HU3A 2K5UA 1ZCBA 3I5YA 3ITKA 4D25A 3C7CB 3G49A 2ZCUA 2FPKA 4YXFA 3E8XA 1E6UA 5T5QA 1E99A 3AY6A 3TRFA 1LU9A 3DBHA 3OBBA 3I72A 2DFLA 2KB0A 2UAGA 2YWGA 3F3SA 3PXGA 2J3KA 4IDFA 4ND1A 1QYWA 5GY7A 2R9VA 4WUVA 1U7TA 3T1VA 5EESA 4A0FA 2AQIA 4PLPA 2GTPA 3NBXX 5CM8B 2PT5A 4BOYA 3RKUA 3PP8A 2BFMA 4I1VA 3AM5A 3AV0B 1VJ0A 4I81A 3CWZA 3AY3A 2VSFA 1AGRA 3TNLA 4Q9IA 5AVOA 4Y0AA 1G5PA 3DWFA 1Q1BA 2C8VA 5GJWC 5L3SB 1RYDA 3VVCA 4O2LA 2AQ8A 4PO8A 4J1NA 3S2EA 3CE6A 1TQ4A 1WMSA 2HYIC 2FFHA 3E2IA 1FDWA 2FE4A 3QUSA 3CO5A 2TMKA 3QG5A 3F47A 2FOLA 3L9WA 3AWDA 3ZU4A 2V6JA 1SCUA 1DB3A 5AR1A 3FDIA 4KYUA 1S1CA 4LUCA 4JLKA 2FDCA 4KDFA 3KTAA 4RPJA 3I62A 1TXGA 3ROKA 1LDBA 3BIOA 4MKGA 3AVWA 3D64A 2WPDD 2YV5A 2WKRA 3NBFA 5KIAA 2WOOA 3TN7A 1Z74A 4JYBA 4MGZR 1JA9A 4JJIA 3RRMA 1DJQA 1LS6A 2C7GA 1VPLA 2XAUA 1US8B 2TMDA 2ZRIA 4MVJA 3U4CA 4B4WA 5CDSA 4IVPA 1T91A 3QKTA 2WEKA 4LHVA 4UQOA 2O3RA 2YFQA 1D2MA 4IQGA 4XGIA 2QG4A 3GLHA 2X58A 2D2FA 3NVAA 2F1IA 4CM7A 2VBCA 2ERXA 1T3SA 1WE2A 4BZXA 2YV2A 3Q3JB 5EE0A 3WMFA 4RJTA 3ADOA 1DSSG 4WJZA 4JIMA 1LLCA 3QKRA 4DXAA 3F5SA 2QQ0A 1Y8QA 3MJVA 3VR6A 2IYWA 5DI3A 3KFXA 1JBKA 2KE5A 2X5KO 1R6BX 2AG8A 3NKVA 1G8YA 1S96A 1S4QA 3KQUA 5LDGA 2AMFA 2OP0A 3LD9A 2HKIA 5HKKA 3IDSA 1MO6A 4CLRB 4RZIA 4L75A 2E82A 3M2TA 1NBMA 4K81B 2ONJA 3D4PA 2ZRCA 3DZHA 5KSYA 1RE0A 2GVDC 1XJCA 3IOYA 5KSZA 4ARZA 2ATXA 1M7GA 1T6NA 2HO5A 1QHHB 1T4DA 1FDTA 4CODB 4PG5A 2FH5B 5B30A 5H8WA 3GP8A 5JC1A 5M04A 2QAJA 5CDFE 1E1LA 3OECA 3LWNA 1Q3HA 4NCIA 2A4KA 3BB3A 1ISMA 1ORRA 5F2EA 1YE3A 1HETA 5G3ZA 3ZZ0A 2H57A 1LI4A 5AJWA 4MRSA 4GSYA 2F7SA 3KBOA 4L9RA 2AG5A 1XBTA 4BNUA 4RVSA 5G0SA 5LD2C 3PZBA 3PWSA 3GEIA 2XXJA 2IF0A 1ZM9A 3ZS9A 1N5LA 1F3OA 3FTQA 2VT2A 4N5LA 4ALLA 4Q00A 4DIOA 2O7QA 3G3EA 3AOGA 3DL0A 1FDUA 4UREA 2PZLA 5GADl 2F1JA 3U7EB 3PUZA 5A4JA 5CDGA 2O50A 2BBTA 3U3MA 2P6RA 3SBDA 3AP1A 4MIEA 3QJYA 5CG2A 1EVYA 5G0UA 1HA3A 3SX2A 4DBLC 2HMVA 3K6JA 5IHPA 4MVJE 1LVGA 2HV8A 2XNDD 2BWJA 3SZRA 5IF9A 4NBTA 2JFGA 3DTTA 4E2WA 4C7OA 2NSDA 3EZ7A 3OQ6A 4PTLA 5ILGA 3RUAA 2PJZA 2IHYA 1NVTA 5CIQA 2O5VA 4URWR 4O59O 5HBRA 4Z0PA 2OBMA 4TMVA 2IXAA 2WHXA 5AJZA 4AJHA 1TX4B 4DIFA 5JEDA 4BWYA 4Q9NA 2BFOA 1H65A 2JFFA 5CEEA 3FF4A 3QVSA 4XQEA 3VFDA 1DC4A 3RUHA 4NYJR 3W34A 2O2SA 5FBWB 1KTVA 3LU1A 1HYGA 2X0JA 3OJFA 1GNQA 5JRZA 2VWQA 5L95A 3FPCA 3ZV5A 3K0CC 3U3JA 2ZRBA 1YU9A 2QZZA 4DRZA 1MO3A 4A92A 3P5SA 3IKTA 2BLLA 1DC6A 5JFGA 2NVUA 4FCVA 2ZXUA 1E79D 4LC1A 3MWYW 2IYYA 1QBKC 2VP0A 1JJVA 1IYZA 1E7MA 1EEHA 3KDSE 1FZQA 3AVYA 1KJZA 4R3NA 2B36A 4DDTA 1TUIA 2W58A 4M2LA 3H6KA 4JL6A 2I1QA 2LWIA 1W4ZA 4B3DA 1XU9A 2OESA 2O7SA 4JJFA 1R66A 4PO1A 2G76A 4PZLA 4AG6A 3C85A 1N0WA 1BW9B 4MYCA 2EU8A 2DKNA 3GG9A 1Q22A 2FSSA 2PEYA 1J4AA 1JW9B 1NMZA 4AICA 1NAIA 1BG6A 3DM5A 4YT8A 4S1VA 4IJUA 4OK6A 3SNHA 4UNRA 2CDCA 1OPXA 3V9PA 2HSDA 1ID1A 2RB4A 3E6AA 1P6XA 1SKQA 3QKUA 1XTJA 1DE0A 1E2FA 4UNSA 3O4RA 4B2PA 2GKSA 4FJ1A 1U3UA 1JI0A 4GOXA 2SCUA 4XVQA 2B4RO 4BFTA 1MB4A 4TMTA 2PTGA 4B3IA 1UXIA 4R4JA 4CMGA 3KYDB 1Z28A 4M9SA 4NONA 1KO7A 1JWBB 1E0AA 2WYWA 1YONA 4Z8YA 4IOLA 3F1LA 2ZUDA 1YHNA 1BXZA 2BKUA 3U61B 3ZV3A 5HCIA 3TFQA 4X8LA 3LW8A 2WYVA 1OI7A 4W82A 5TV2A 1M6HA 1KK1A 4CV3A 2ZUBA 4B3GA 4CIDA 1WVGA 3KSUA 3BA1A 4UXJA 3VC7A 2EP7A 4MA4A 2P2LA 1O89A 3UN1A 3CR8A 3MOIA 1XPUA 5G40A 3PZRA 2O8FB 3H9QA 4C4OA 4G5SA 3E5RA 2ZE6A 1FX0A 5FUWA 1DFHA 2RGGA 3RSOA 3W8NA 5IDXA 3KM0A 1E1KA 1GRNA 1DAGA 4HB3A 3QVOA 2EGGA 3DM9B 2ZK7A 2BM0A 1B26A 4XGNA 1JR6A 1IN5A 1G1MA 4BQRA 2N46A 1SVSA 2PEZA 1N0UA 3WY9A 2YHIB 3PGXA 2O8BB 3HPRA 5FF9A 5I7VA 2PLRA 5J47A 1Q0LA 3FVQA 4I99A 2ZB3A 4Q9LA 1ZW6A 4NE2A 2OSBA 2WAYA 3IKVA 4IMRA 4UUMA 1X3SA 3K96A 1NVVR 4CJXA 1AXEA 3DR3A 4DDVA 3WGTA 3L0IB 2C7VA 4EJ6A 3EPJA 1IPFA 3MWLA 1DIGA 3AUAA 4ILEA 1P62B 2HCBA 3KRTA 4P31A 1CR2A 1EDZA 4KLZA 1G6OA 1X6VA 2NO6A 1UADA 1XA0A 2GZDA 4LN1A 3T35A 1IAQA 5LC1A 3DO5A 4QO7A 3T1TA 3U7FB 2NU8A 2X9VA 5KKCA 2FMXA 2AHOA 4GPTA 3OESA 2CL6X 1F06A 5KSPA 2AHRA 4WEOA 3S2IA 2RGCA 4KLNA 2XXBA 1GPJA 5L4NA 3JZMA 3N7UA 4CUZA 3RANA 3AUUA 1N3BA 3C5HA 2CFCA 4EJ0A 4U7DA 1GNRA 1OLOA 3PGJA 5B1YA 4GDFA 2DWQA 2YDXA 4YAIA 2I3GA 1B15A 4LYHA 3HUDA 1ISGA 1MO4A 2J7PA 3ZS8A 4TRNA 1KI4A 1YZTA 4RQUA 4YR9A 4ALJA 2WJYA 4R41A 1KI2A 3U44B 3BHIA 4P3YA 4DCVA 4DDWA 4UVGA 4GP6A 1EBUA 2PWZA 4RD2A 1H0KA 2E4AA 1N2CE 4Q7JB 3VHLB 4CL3A 3KSDO 3BB4A 1ZK0A 2ZTSA 4PZYA 3OIYA 3NDBB 2H16A 2FY8A 3TNFA 1Q44A 3KZ1E 5JS6A 3MMPA 3VX4A 1G19A 1Y63A 1ZSNA 3D3WB 4PIVA 4JP2A 3JV7A 1KK3A 1SC6A 5KTYA 4UNPA 2VRWA 4D0SA 1D7OA 5K8TA 2Z1MA 5A5EA 2ZEJA 3JTMA 3GF4A 5L40A 1GADO 4H7PA 3AF3A 4NL4H 5GVSA 4BNKA 521PA 3C7AA 3PXXA 1UDAA 4B76A 3KLPX 3P27A 3L9XA 4CEHB 1EX7A 1N5DA 1DC3A 3TVTA 4GWGA 4BZPA 2LDBA 2NM0A 5C4GB 4JKYA 2X0IA 2AFHE 4DCUA 2C78A 4D3SA 2NG1A 3EG5A 5BYJA 1SVMA 3DC2A 1LC3A 4L73A 2NTYC 3F4LA 4FMBB 1W4AA 1OFGA 3VKHA 4HUTA 1NQ5A 4U00A 3RS7A 4GP7A 3BFVA 1OJLA 2RKOA 3EC2A 4PG8A 1KMHB 1RC8A 2D1YA 1PTJA 3KQNA 2YJZA 3FHCB 2LKDA 4XKJA 2YQ4A 5KWEA 3H3FA 1NBMD 2J7PD 4HAUA 5LB4A 3I9JA 1RWBA 1IY2A 3LA6A 2CJWB 4GQAA 4ALIA 4LHZA 1TEHA 4XYBA 2HDNB 3JQFA 2IEDA 3PIIA 3NBYC 2CUKA 2ZTLA 2MSDB 3KLMX 4HLCA 2W2TA 1W4BA 5DN6A 3ZCXA 2Q9AA 4OM8A 4Q4AB 3ONEA 4OQNA 2VA8A 1BXGB 5C7LO 4WK6A 2O3JA 2W83A 1NQTA 3L0SA 1FP6A 1HWYA 2V9PA 4J7UA 4YMTA 2PX3A 3BHMA 2BFAA 3ASZA 2O48X 4DLRA 1YZQA 1ADFA 1E2IA 1S9DA 4EPWA 4WZ6A 2ZJ1A 2TMGA 4IDQA 1XLTA 3WR5A 3OJEA 5J23A 1PL7A 1HTBA 1J70A 3ZD6A 1CR1A 4P8RA 1HDOA 4LPSA 2PKRA 5KDDA 2RCNA 2OOSA 3T06B 4A6PA 2EV9A 1Z6TA 4YQFA 4ZRNA 2QP3A 4HXYA 3FKQA 4JKIA 2HLDA 2VOEA 3MLEA 4B4UA 4L4UA 1NFRA 2WMOB 1SMKA 3NGXA 3B1FA 4UVDA 4A4DA 3T15A 3RRNA 4ZQFA 1TQDA 5ELXA 3VR2A 4UNQA 3BBPA 4J49A 2XGJA 1JR3E 3GJ0A 3RUIA 3ZVLA 2VEDA 1WDTA 2OBNA 1E3WB 5IN4A 2GA8A 5C18A 4OL9A 2A5GA 2DFDA 1JKJA 2FRDA 4UAGA 1I2ZA 1B16A 3REFA 2GWHA 1D4FA 1U9IA 1OH8A 2J3JA 2H1SA 3GJXC 2C5EA 2F55A 4DVJA 5JBIA 3R6DA 1R4MB 2IA5A 2FZWA 2XOXA 3SS8A 1QYDA 4CUJA 4RV9A 1CIPA 2D7CA 3NTUA 2GBLC 2UKDA 4Q4HA 1JNYA 2C9YA 3LY5A 3WP1B 1PJRA 2Y66A 1FNMA 2X5OA 3UAGA 2ZU0C 2CLCX 5AXDA 4Q7KA 3FMOB 1WB9A 1FMCA 5ADHA 5FL7A 4JT2A 4UUOA 1HT1E 3QIAA 5JLAA 1HH4A 1W46A 3MJHA 1U2RA 5DBGA 2QMOA 2PK3A 1FPMA 3BMNA 3DXFA 2Q49A 4UJ5A 2XZOA 2ZQZA 3MJCA 5DHAA 3JYLA 5HRUA 3RD5A 4FGWA 4KYIB 1PS0A 4LYAA 3SU8A 4EQ6B 2Y99A 2GEVA 2Z1NA 3INGA 3AVVA 3NH9A 5FPTA 3H5RA 2QE7D 2YHSA 4RPGA 5EE1A 3SHWA 3CPJB 3E9NA 3U9LA 3IBGA 1YDEA 5GJVC 1PJTA 4MDFA 3SC3A 3IJRA 5FTLA 3B60A 2WWRA 1FK8A 1I24A 3WGIA 3QWIA 3JD3A 1OMOA 2PCLA 4L5BA 3E82A 5L3RA 1ISJA 3Q5DA 1YR9A 3MUFA 4Q3CA 4WKGA 5TJ9A 2FFAA 2CF5A 3I9LA 1UM8A 4TZ0A 4HX5A 3Q11A 1SXJA 4PLFA 3ZHBA 5D3MA 2BJVA 1HQCA 4LBYA 1GFSA 2O2YA 1SHZA 1GWNA 3C1AA 1EXMA 4BGIA 4TQUS 5JY6A 2QM7A 5FUXA 5AXAA 2Q1SA 1UP4A 5I7FA 1DIHA 3UUWA 1LNZA 1M76A 5TB5A 3W4IA 5K8UA 3WICA 1Q1EA 3ZD7A 1AHHA 4LJ8A 1FJHA 1JB1A 4DPMA 3JYPA 4WAUA 3SLKA 4U6SA 4BPBA 5FUVA 1EESA 1NPDA 4FR5A 5JMPA 4XB1A 4YDSA 1NN0A 2JJ8A 3GJ3A 3SVTA 4II7A 1I3MA 5JWOA 3ROQA 4FFRA 4ND5A 1GZ4A 2KI5A 4Q3AA 4TMXA 1C1DA 1V3UA 4DZZA 2YQ5A 1J2JA 2GXQA 4TSFA 5J40A 8ADHA 4QKQA 4TMZA 2AD1A 5L45A 3I23A 1ZUIA 2HCJB 4M54A 3OA0A 5A0FA 4M1KA 3RCBA 4FD2A 1F60A 1U81A 3SJUA 2OV2A 1CIVA 1N25A 4M9ZA 3VR3A 5JO0A 5ILOA 4OSPA 2XOKA 2GETA 2QBYB 3KV3O 2FEOA 4ROSA 1GQ2A 2UUPA 4MKRA 4LJ5A 1MOZA 3UF0A 4A8JB 2ZR9A 3FBTA 4IUYA 3M6IA 4G5HA 1N6OA 4AIIA 2I66A 5L7YA 3FMPB 3LC2O 2HXSA 1UR5A 4MVJH 4Q4LA 3AGQA 3K8YA 3PYLA 4G5RA 2P9GA 4DL9A 4TMKA 1E9AA 1ZVMA 3RS0A 3EXAA 4D42A 2G9NA 3MJEA 2RH4A 1I5RA 3UOGA 4IFBA 2E87A 2CDBA 3R3SA 1CJVC 3TMKA 1E0JA 3I92A 4Q1BA 2WDZA 3KEOA 4Q5IA 3M1AA 1NHWA 2QAGC 1UZNA 5T8KC 3DTYA 3BE4A 2Y1DA 3GPLA 1S3GA 3DMDA 1GEGA 4QO8A 2FX3A 3AQ4A 3WNCA 1WP9A 2P0EA 3HB5X 1Z63A 2IODA 1E77A 2QORA 2ZRDA 1R8QA 1KMHA 3E5HA 5DISB 1T2CA 1ZW1A 2ZRFA 3KKPA 4GFDA 2PD4A 1T5IA 1HE3A 4QC2A 1R0XA 1ZP6A 1QHNA 4B33A 3B1YA 3JQ7A 2IEBA 4I9HA 1DLIA 3KUCA 3BFKA 1TF2A 4IXWA 3SE0A 3PYXA 3ZWAA 3KO8A 4MVJD 3B13B 2EGHA 4EUHA 2G1KA 1PQPA 4FN5A 1LSUA 821PA 2OE2A 2JKVA 3JQGA 1E2HA 4QJ5A 3Q2IA 3H5AA 1Q1ZA 4DBVO 1GIAA 3NV9A 3QSYA 4ALNA 2AK3A 3FN4A 4AD8A 4IVQA 2GNAA 4IDEA 1A9YA 4TYYA 2DBVO 5FOTA 2ZSDA 1JN0A 3LK7A 3C7KA 2IBMA 3LQRA 1DRVA 4K6CA 4HWKA 3SJBA 3NRCA 1QKIA 1TF7A 1G3MA 3TRIA 3K9QO 2EP5A 1LV7A 5HKKD 4RPHA