2G0UA

Solution structure of monomeric bsal, the type iii secretion needle protein of burkholderia pseudomallei
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
MSNPPTPLLADYEWSGYLTGIGRAFDDGVKDLNKQLQDAQANLTKNPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDIDSSILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords type III secretion system needle protein
publication title Solution Structure of Monomeric BsaL, the Type III Secretion Needle Protein of Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Unknown function
total genus 30
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2006-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2g0uA01
4CQIA 2KWHA 3N5LA 4J2CA 3CVRA 1QSDA 2X9WA 2C5KT 3QUJA 3CKDA 3FXEB 1Z0PA 1ZKEA 3QK6A 2C5JA 2CA5A 3L3PA 1H7CA 3FXDB 2K48A 1IJ5A 2X9XA 3P7IA 4B6XA 2KWIB 3TKLB 1LVFA 1IJ6A 3S4UA 1LRZA 2XTLA 3MXZA 2IC6A 4L0RA 4EYYR 2MBGA 4DNDA 2IC9A 4FI5A 2X9YA 2G0UA 2C5IT
chains in the Genus database with same CATH superfamily
4CN1A 3FBZA 4QH5A 1FMVA 4UVBB 3VR8A 4EV6A 3FZMB 4PAGA 3Q5WA 1GQEA 3RHWA 4HFVA 5LHHB 2D2SA 1YD8G 4X1YE 5CB4E 1UCUA 1HNZT 4HN9A 2JQQA 4KP3C 3UQ4A 3RI5A 2W63A 3AVRA 4JEUB 2W61A 4IDZA 4IHJE 2JQKA 2H88A 2XQAA 2W66A 4JI4T 1MMNA 4MLKA 4IT4A 1I94T 1LKXA 1QSDA 2VK9A 4U2ZA 1OWAA 5A1LA 3N9QA 5LHIB 2WDVA 3JC6C 2RPAA 4I4TE 3HKBE 2W62A 2WDQA 3AECA 2PBIA 4EGWA 3CIRA 2Q9QD 3IF8B 4DV0T 4JYAT 2N1GA 1T7SA 2VKHA 1ZP0A 2BBHA 2WAUA 3RIFA 4GIWA 4U3CA 2W0GA 2DLRA 5ETWA 4YHHT 5JR9B 3KV9A 4TN7B 3E22E 2IC9A 2E9XB 5JQGE 4DBQA 4A5XA 1WR6A 4E7SA 2CBJA 3N5LA 1WCRA 3PV0F 2MYSA 4BAYB 3JADA 3SFDA 4ERRA 4ISTA 4EIWA 4QX8B 1YW0A 2IUBA 5JH7E 3AEDA 4WZXA 4DNDA 2LEHA 1R8IA 3PTRB 4CXWA 2LSIA 1EZ3A 4QXCB 4GKKT 3WAJA 3P7IA 1OXZA 3FHNA 1J1JA 2MPKA 1VOMA 1IBKT 2WMNA 5FMNA 2X0HA 1HX1B 1WYCA 3HA4A 4E7ZA 2YDSA 1J5ET 2CHNA 2IIUA 4YJ2E 3RIAA 3H37A 3L3PA 5AQLB 5AQUB 2CLYB 2H89A 3OKQA 4YTNA 2C0SA 3PUWF 4NXNT 3F31A 2C5IT 2XQ6A 4UF0B 3Q5XA 4JI3T 3A5XA 4I0UA 5AQVB 3O9XA 4C90A 5F5WA 4JI2T 3OYZA 1QLBA 2E5LT 1XWMA 5F8PA 4NUVA 4PJMA 3ABVA 3F57A 5IUXA 4CI2B 3P4WA 2IHR1 1UURA 4NUUA 2XSAA 5DJQC 4K0UA 2D5UA 2YEVC 4WBNE 5JDQA 3J7Yq 3LK42 3F2EA 1W09A 2QRXA 1ZHCA 2MBGA 2XZEA 3PUQA 4WYVA 3H3AA 2D0UA 4HGAA 3B13A 1OEDA 4EB6E 1KFYA 3VR9A 2WMOA 2PFVA 2H3RA 2BKOA 4O4LE 2XQ4A 3C51A 3AE7A 2A72A 3OYXA 3N9PA 5LMUT 2MOZA 3CMLA 2WZHA 4UV9B 4WBOA 2XSBA 3SOLA 4ANJA 4MBQA 3EABA 3O1HA 1YXRA 4U74A 1NENA 4XAXB 4DV2T 3RLFF 4HWDA 3LK2B 2V7KA 3RRCA 4KUMB 5FKYA 5JRCB 4TNVA 2RP4A 3RKOA 2EHOA 3V5SA 3KV6A 4U7IA 5HEJA 1D0ZA 5E0OA 1SE7A 5CJ5A 1HG2A 3AEAA 1IBLT 2BKPA 2ACXA 3P50A 4M1PA 1D0YA 3E08A 3NVOA 2CHOA 2CBIA 1ZEEA 2GK9A 4DR6T 1U4QA 4TWDA 4BA9A 3UTKA 3J9X1 2LSJA 3KDSE 3HKCE 3PUSA 4TUYE 2AXDS 1D0XA 4JI5T 2IW5B 2WSSV 1NEKA 5IHYA 3L8RA 3Q5DA 5AQMB 4JV5T 3KV4A 2V1DB 2ODVA 1FJGT 2FJEA 2KZ7B 3AEBA 1MIYA 3PUGA 2LRLA 4O4JE 3PU8A 4DMWA 1N32T 2KNDA 1HG5A 4I50E 3WI3A 2KXPB 4PJLA 5LOVE 2V26A 2J62A 2BZBA 4ASKA 4EOZB 5AQIB 2WM9A 4KHZF 2CRBA 3HR0A 5ADXL 1S35A 3RYCE 4O4HE 2E8IA 5JVDE 1XDOA 4U7YA 2Y48B 4IE4A 4DV1T 1HS7A 4MALA 3DP7A 4QWNB 5JTGA 1N36T 1SHZC 1ZKEA 2W67A 2XASB 2VWAA 1N34T 5FVKA 2X68A 2E9XC 1Z8UA 1G8XA 2VKJA 1HNXT 4DR2T 4IE0A 3RIUC 4AQFC 4A56A 4JI1T 2DI4A 3ANWB 3GA8A 4KHPT 3TKLB 2YINA 2XQ8A 3RRWA 4NXMT 4C91A 3UUXB 2FJAA 4QH1A 3KBTA 4H9OC 2XAQB 1KF6A 2IDOB 3QOFA 2XQ7A 5LP6E 3IA3A 2L8KA 5FYMA 3RKGA 3ZMUB 4EYYR 4FJOA 5KXJA 2X0LB 3X1DA 2N2NA 4UF0A 4GK5E 5LNKA 3RYIE 3ZYKA 4OYJA 2VQFT 5IWAT 2BVMA 3B57A 2QVAA 4YSYA 1IJ6A 2VKOA 2N9DA 5M4YA 1WRDA 4TX5A 4OYKA 5H6RB 4P0AA 3P4QA 4AQYT 5ABHA 3FZHB 1VCTA 5C2TA 2WU5A 1YQ3A 1Y01A 2VQET 3TLSA 2JRKA 4EYUA 2NTYA 3AXJB 3LFMA 2JMKA 3CWZB 2HPLA 3NZQA 2X9WA 3ZMTB 3ZN1B 5JDHA 3CX6B 5H6QB 5KMGP 5L3GB 4KMCA 3QB5A 3ZMSB 4CI1B 3RX6A 2XQYA 2CXLA 3ZSTA 3ONJA 2ZM0A 3PUXF 2VVNA 2UXCT 3MACA 4ZS2A 2FJDA 5HEGA 3BK9A 1HCIA 4OHFA 4IIJE 4DR1T 2EHOD 2XJ7A 3N9OA 2CM0A 1MNDA 1XNRT 4Z8XA 2LLYA 4Z91A 5AQHB 5GONE 3M65A 3I9WA 2YDQA 3A7MA 2E2AA 5JRCA 3RQWA 2BDEA 2ZM8A 3T1YT 4EXTA 3RQUA 4GKJT 2V5DA 3AE6A 4LMKA 2CEAA 5DABA 2QYWA 3ZN0B 3OVUA 2PG8A 4U72A 5HAXA 4OX9T 3AEFA 3NRYA 3ONLC 4ADZA 5JDNA 2QGSA 3H3MA 4B3TT 1V9DA 5EZYE 5LCYA 4GYSA 1DU2A 2V6YB 3AA1B 1Z0PA 5J0ZA 2XQ3A 5JDLA 3AA0B 3ZCJA 1HR0T 5J1GA 3LBXB 5FL1A 5CFBA 4LFCT 2A3DA 3ZT7A 2BVLA 1HNWT 2WDRA 4MFRA 3C64A 3CX7B 5ABEA 4U2YA 3HL6A 1US7B 3PJAJ 2UXBT 3AB3B 4B6XA 4HFHA 3KVBA 2PTFA 4EEBA 4COFA 5HXSA 4ZZCA 2X66A 5DQWA 3CQGB 2NP9A 2SPCA 2C5KT 3LJCA 4YLHA 4YSZA 2BG9C 2CXDA 1MNEA 1JNZA 5L3EB 3EUHA 1YKEB 4ZI2D 4TV9E 4UEMA 1B7TA 2H7OA 3AA7B 2L9QA 3AE8A 2IAKA 4LMJA 5LMNT 3K3OA 2V6XA 3UU6A 2R6GF 5IYZE 4AISA 5HEHA 5AFUL 2MAWA 3I9YA 4IDOA 4UV8B 3PJAA 3M3ZB 4EZHA 1HF8A 1W9RA 4QXBB 4ZI3D 3DJBA 4AKLA 3SRZA 5HCMA 1Y64B 3I1AA 1LVKA 2A9UA 4L9IA 4HFBA 5FY1A 4ILAA 3FXEB 4B3RT 3N9LA 4AXPA 5CA0E 5FXVA 4L5GA 4PNIA 4AKIA 5HXCA 2BS4A 1XZYA 2F4VT 3VKGA 2V8SV 1XMQT 1L0VA 2XQ5A 4H9PC 2J47A 2NWBA 4OFZA 3SFEA 3MJXA 1WLXA 4J2CA 4I43B 2BS3A 1E7PA 1X9BA 3GN5B 3TLTA 2X0YA 2KMFA 2YDRA 3CQCB 1NWMX 5F3JA 2NW8A 5AQJB 2W4XA 2HPJA 4H63H 1T98A 2LKHA 5AQNB 3RPUA 3QUJA 3CK6A 3AAIA 2DWGA 4IE7A 2WQYA 3GMIA 2DHRA 4QHOA 4HTEA 3BQIA 1D1CA 4DR5T 4LFAT 2FBWA 1XMOT 1UGOA 4ZI7E 4EZ4A 2VL8A 4CXYA 5AQKB 5L4EA 4DV4T 3FZKB 5L3CB 3C4WA 1WYBA 2CCQA 2XY8B 3ZPOA 1YQ4A 2JPFA 4LFBT 2IC6A 1QUUA 3UQ7A 3AXJA 4AKRB 3ZC1A 5FXXA 3UU3A 5LGUB 4HWHA 2B76A 2E5VA 3RYFE 5LJNA 2YKSA 2DWKA 4JI7T 1D1BA 5ABFB 3EHZA 2VVSA 4X64T 5KX5E 3JC6D 4HWIB 2WWUA 3A8YC 3CX8B 5LA6E 1T72A 1N33T 2I6HA 2VB6A 2K3WA 3VHLA 3RYHE 3TLWA 4PJNA 3JAEA 3WAKA 5L2LA 2X9YA 2G0UA 4KX6A 3PE0A 5LG3A 2Q9QC 5HWYA 2HN1A 4IE6A 2KSRA 1BR2A 5LB7B 2BG9B 3SWHA 3CPZA 1X79A 4PJJA 1D1AA 4ZS3A 4PK6A 3N2GE 2JQ9A 5JREA 2CWOA 4AI6A 4HWCA 2VURA 4QXHB 1S94A 3K1SA 3AE9A 3AEGA 4QH4A 3SS1A 3PUYF 2CE7A 2IMLA 4XZCA 3PUZF 2DL1A 2YN6A 4IDQA 3ZLIA 4MHCA 5JR9A 3RF1A 5KDMC 4K0KT 3G06A 2E9XA 3CQXC 5L3FB 2UXDT 2KINB 2V6YA 4YTMA 3E0ZA 2ACZA 2Y6XA 5HCJA 4JUYA 4AKHA 3BQLA 4IDPA 3S4UA 4ISSA 3RIUA 4AQFA 2H7VC 3N9NA 2UU9T 3NBXX 4NPPA 3IEEA 3L39A 4XBFB 4H9NC 4PFOA 3AE5A 3N2KE 2BG9E 3HI2A 3TLUA 3QC9A 1CHUA 5LGTB 5FNVE 2P9BA 1W0AA 4ILCA 2VKDA 1HTJF 2WP9A 2XTLA 5EK3A 2KT9A 1NAFA 4DMVA 3ZJ1A 4CXXA 5AQRB 3LK3B 2XQ9A 3O1JA 2ES0A 3AAEB 2M6BA 1CUNA 1H7CA 4ZOLE 5HEUA 2AE9A 3FZLB 1SUMB 5BMVE 5HYAA 4X1IE 4YJ3E 2XAJB 2ZM6T 4HFCA 4P0BA 4JLEA 1VRBA 2XPKA 2PJQA 1IAPA 1ZOYA 5LHGB 4ZXLA 2KWIB 2XAHB 3AEEA 3QNUA 4DBRA 5L47A 2LKGA 5FXWA 1IBMT 4UELA 5DQVA 2Z6EA 2I0MA 3ZCIA 4LF5T 3LG7A 4Q25A 2ZM2A 3MK7C 3T1HT 3LSVA 2V7MA 2HH7A 4HE8A 2K5BB 3RC3A 4DR7T 3OBVE 4KBMB 4YHJA 4B3MT 4CN6A 4DIDB 5JDGA 3FBLA 2V7IA 2L3LA 4YTPA 3HKEE 2RA1A 1U5PA 1KK7A 2LHNA 3CVRA 2Q9QB 1MIWA 3NKZA 4GK0E 5AQOB 3ZSSA 4TZ4C 3PURA 3OJAA 4YT0A 3ONXA 4LF6T 3EVYA 3L09A 3PUAA 3AVSA 2V7JA 3N2OA 4UVCB 2Y8DA 4HKAA 2OV9A 4U31A 5CA1E 4O2BE 2WCAA 3ZT5A 2WBLA 3VKHA 2LT3A 5HWXA 5AQGB 4YSXA 1W0BA 2I59A 3RH3A 4UR9A 3R84B 3UFGA 3UU8A 3MZKB 4BJMA 1MIVA 4H9QC 5J2TE 2NW9A 2X9HA 2MTQA 5FY7A 3UUNA 2LHRA 2CMRA 2JJ9A 5ABFA 3O4XE 4X1KE 3W15B 4JEHB 3ZEFB 5HXEA 3AE1A 3N9MA 2B1EA 2UXXB 3I0OA 4NIQA 5BR8T 2OA5A 3VRAA 3P4RA 2VASA 3NWIA 1BR1A 4DUYT 2XAFB 3C98B 1E1HB 4IL9A 3FB2A 2CA5A 1T8BA 2BG9A 3ETVA 2WZIA 4A98A 2YU1A 2YK0A 3UU5A 3FZFB 1HX8A 3KVAA 3V5UA 4I55E 2E9XD 3HKDE 3C4ZA 2LJLA 5LXTE 4LF4T 2VL0A 3QB5K 4DV7T 3EDVA 4H63V 4HEAA 1KNRA 2FUPA 3ZT6A 3R6NA 5L3DB 1MMGA 2WS3A 2X67A 3MKDA 1WFDA 4LMLA 4BJNA 1IJ5A 5LJMA 5TAOA 2NTXA 2NW7A 4V1Av 2WWVA 3NRXA 4WNKA 3DTOA 4JBWF 4ZZBA 5FXZA 1VCSA 2XHEB 4CI3B 3KBUA 2LSYA 4B3ST 1M62A 1AJ3A 4IDNA 2YOEA 2ODUA 2LOSA 5LG4A 3Q9DA 4O2AE 5C8YE 3ANWA 1WR0A 2UXNB 2D0TA 5J2UE 1HFAA 3BQKA 3EAMA 3ESLA 1XNQT 4TV8E 1IZNB 4F8HA 5FY0A 4YY3T 3UU4A 4HFDA 5C3JA 2NR4A 4PFPA 2CPTA 5HEOA 4EEDA 1MMAA 1E2AA 3AE4A 2CWYA 4YFSA 3ZYMA 3CKDA 3U3IA 4PK4A 1MMDA 3AA6B 5HXRA 4AKGA 3FXDB 2LSKA 3AE3A 2XM1A 1OEDC 3UUMA 3RC8A 3AE2A 2WU2A 2X51A 1BR0A 4ILUA 3EDUA 5LBMA 4O4IE 2M6IA 2UUBT 2FJBA 1O3XA 5JDMA 4TWFA 3U78A 3OPCA 2WB5A 4H9RC 2KWHA 2CXFA 2A2FX 2UUCT 1YKHB 4DR3T 2BKNA 1ZV4X 5ABGA 5CGMA 4P09A 4DV3T 3MXZA 3ZJ2A 5FL0A 4CZZB 4QX7B 2J1DG 1J5WA 5FVLA 4HFEA 4PK5A 4DR4T 3ZKRA 2EHOC 2J4GA 1UX5A 2Q9QA 2ZMAA 3B5MA 2OLTA 3KINB 4L0RA 2JMHA 4WW0A 4JI0T 4ZHQE 4CN4A 5LBQB 3P8CD 4TWHA 4ZEYA 3OTOT 4U33A 2W00A 3K3QC 4G63A 4YXDA 4X65T 3ZMVB 3C4XA 3ZYLA 3I0QA 4A97A 4LF9T 4JI6T 2LM2A 4JI8T 3PUVF 3LDQB 4X62T 4KI0F 3Q5EA 4F6RC 4IE5A 4LF7T 2DNXA 3KFWX 4X20E 4N78D 1UUSA 5EK4A 2BS2A 3NZPA 1UX4A 3IBPA 4GOUA 2K24A 2X9XA 4EAHA 1FMWA 3Q2MA 1KEYA 5HXHA 3EI0A 3MA9A 4GYRA 2BBJA 4UXNB 5LGNB 4CQIA 2JIWA 4HFIA 2LM9A 2YU2A 3ZC0A 5L4HA 2W2UA 4DVDA 3VRBA 2M67A 4DO0A 4AIUA 2C5JA 3UULA 5LYJE 1BR4A 3KV5A 1FEWA 2XM2A 5AQFB 4LF8T 5L3BB 2UUAT 2V7LA 3LBXA 3UT5E 3O1IA 3K8PC 5JDFA 1UK5A 3GWHA 5AQSB 5JR9C 1XDPA 4ILBA 3JAFA 4UVAB 4PW8A 3PU3A 3D0TA 4OK0A 2LSGA 1LRZA 4ZI2C 2ZLYA 3K3NA 2LRKA 4H9SE 4P1NA 3IHRA 2HHHT 3UFEA 4X66T 1SA0E 1M7KA 2K48A 2XUEA 3UUBA 1FIOA 5AQQB 4IL4A 4G2AA 2LE8A 4IREA 4HWFA 1OEDB 3TLVA 4ZI3C 4TNWA 3RGLA 2D9DA 2NOXA 2K9AA 3JCFA 3VU7H 4AQGA 3QK6A 1I6ZA 3T8OA 2V5CA 5AQTB 5EK2A 2WY2A 2JQHA 4O8SA 2QA7A 4DV6T 3ETUA 3C50A 3PDYA 1JNRA 3P4SA 4QKNA 1KNPA 2CLYC 3ZMZB 2DCFA 1KNZA 3AAAB 2KLQA 1LVFA 3P4PA 2HN2A 4IGUA 4UIGA 4X5TA 4Z90A 4DUZT 2XAGB 5FP3A 2EHOB 3GN5A 5AQPB 1OEDE 2LOPA 1G73A 4DV5T 4FI5A
chains in the Genus database with same CATH topology
2YK0A 3FBZA 1FMVA 2Y48B 4IE4A 4UVBB 1HS7A 4MALA 1HX8A 3DP7A 4QWNB 1SHZC 3C4WA 1ZKEA 5L3CB 1WYBA 2XASB 3KVAA 2CCQA 2VWAA 3V5UA 4PAGA 3Q5WA 2E9XD 3HKDE 4I55E 3C4ZA 2LJLA 3ZPOA 5LXTE 2X68A 2JPFA 2IC6A 1QUUA 2E9XC 3EDVA 4H63V 4HEAA 4HFVA 5LHHB 2D2SA 1YD8G 4X1YE 5CB4E 3R6NA 1UCUA 4AKRB 5L3DB 1MMGA 2X67A 1G8XA 3ZC1A 3MKDA 4HN9A 5FXXA 2VKJA 5LGUB 2JQQA 4KP3C 4IE0A 3RYFE 4AQFC 2W63A 3AVRA 4JEUB 4A56A 4BJNA 2DI4A 2W61A 1IJ5A 5LJNA 3ANWB 5LJMA 3GA8A 5TAOA 4IDZA 3TKLB 2NTXA 2NW7A 2DWKA 2YINA 4IHJE 4V1Av 3NRXA 1D1BA 3RRWA 4WNKA 1MMNA 4C91A 3UUXB 4MLKA 3DTOA 5KX5E 3JC6D 5FXZA 1LKXA 2XHEB 4CI3B 3KBTA 2WWUA 1QSDA 2VK9A 4H9OC 1OWAA 3KBUA 2LSYA 2XAQB 5A1LA 3CX8B 3N9QA 5LA6E 5JVDE 5LHIB 3JC6C 4I4TE 1AJ3A 3HKBE 2W62A 2VB6A 5LP6E 2ODUA 3VHLA 2LOSA 5LG4A 2L8KA 3RYHE 5FYMA 4PJNA 2PBIA 3Q9DA 4O2AE 3ZMUB 4EYYR 3ANWA 5C8YE 4FJOA 2Q9QD 3WAKA 3IF8B 5L2LA 2UXNB 2X9YA 2D0TA 2G0UA 5J2UE 2X0LB 1HFAA 3BQKA 3PE0A 2N2NA 3ESLA 4UF0A 2Q9QC 1IZNB 4GK5E 4TV8E 3RYIE 3ZYKA 5HWYA 5LNKA 5FY0A 4OYJA 4IE6A 2N1GA 2VKHA 2WAUA 1BR2A 2BVMA 3B57A 3SWHA 4GIWA 3CPZA 1IJ6A 1X79A 2W0GA 2DLRA 2VKOA 4PFPA 5ETWA 4PJJA 1D1AA 5JR9B 2N9DA 3KV9A 5M4YA 4ZS3A 4TN7B 1WRDA 3E22E 2IC9A 2E9XB 5JQGE 4PK6A 4TX5A 3N2GE 4DBQA 4OYKA 5H6RB 1WR6A 4E7SA 4P0AA 1MMAA 3N5LA 5JREA 2CWOA 4AI6A 2CWYA 4YFSA 2MYSA 3ZYMA 4QXHB 3CKDA 4BAYB 1S94A 3U3IA 4PK4A 1MMDA 3AA6B 5HXRA 4ERRA 4ISTA 4AKGA 3SS1A 3FXDB 4EIWA 2LSKA 4QX8B 2CE7A 1YW0A 5JH7E 4XZCA 3RC8A 2JRKA 3UUMA 4EYUA 2NTYA 4DNDA 3LFMA 2JMKA 2X51A 3CWZB 2LEHA 3ZLIA 4MHCA 3PTRB 4CXWA 2LSIA 1EZ3A 5JR9A 1BR0A 5KDMC 2HPLA 4ILUA 2E9XA 3NZQA 2X9WA 3ZMTB 3ZN1B 3CQXC 5JDHA 5L3FB 3CX6B 5H6QB 3EDUA 2KINB 4QXCB 5LBMA 3E0ZA 4O4IE 2Y6XA 5KMGP 5L3GB 3WAJA 3P7IA 1OXZA 3FHNA 4JUYA 4KMCA 4AKHA 3BQLA 1O3XA 3ZMSB 1VOMA 3S4UA 4ISSA 5JDMA 4AQFA 2WMNA 5FMNA 4CI1B 2H7VC 3N9NA 3U78A 3NBXX 3HA4A 1WYCA 3RX6A 4E7ZA 2XQYA 2KWHA 4H9RC 2CXLA 3IEEA 4XBFB 2CXFA 4H9NC 2A2FX 4PFOA 1YKHB 3N2KE 4YJ2E 2ZM0A 1ZV4X 3HI2A 3H37A 3L3PA 4P09A 3QC9A 2CLYB 3MACA 4ZS2A 5LGTB 3OKQA 5FNVE 2P9BA 3BK9A 2VKDA 1HTJF 2XTLA 3MXZA 3ZJ2A 5EK3A 4CZZB 1HCIA 4QX7B 2KT9A 1NAFA 4OHFA 4DMVA 2J1DG 4IIJE 2C0SA 3F31A 2EHOD 3ZJ1A 4CXXA 2C5IT 4UF0B 3Q5XA 4PK5A 3N9OA 3A5XA 2CM0A 1MNDA 4C90A 3LK3B 3O9XA 3O1JA 2ES0A 4Z8XA 3AAEB 1CUNA 2EHOC 5GONE 3OYZA 1H7CA 4ZOLE 3M65A 3I9WA 1UX5A 5F8PA 4NUVA 2Q9QA 4PJMA 5JRCA 2ZMAA 2BDEA 2ZM8A 5BMVE 3F57A 3KINB 4L0RA 5HYAA 4X1IE 4CI2B 2JMHA 4EXTA 4WW0A 4YJ3E 4ZHQE 5LBQB 2XAJB 2CEAA 3P8CD 4NUUA 4P0BA 4JLEA 1VRBA 5DABA 5DJQC 2W00A 3K3QC 4G63A 4K0UA 2D5UA 2PJQA 3ZN0B 1IAPA 3ZMVB 2PG8A 4U72A 5HAXA 3C4XA 3ZYLA 2YEVC 3I0QA 5LHGB 3NRYA 4WBNE 2KWIB 5JDQA 3J7Yq 3LK42 3F2EA 4ADZA 1ZHCA 5JDNA 2XAHB 2MBGA 3PUQA 2QGSA 4F6RC 3H3AA 1V9DA 2D0UA 4HGAA 4IE5A 3B13A 5EZYE 5LCYA 2DNXA 3KFWX 4GYSA 4EB6E 4DBRA 3AA1B 4X20E 4N78D 1Z0PA 5EK4A 5FXWA 2WMOA 3NZPA 1UX4A 2PFVA 3IBPA 4GOUA 2K24A 2X9XA 4UELA 4EAHA 1FMWA 5DQVA 3Q2MA 2Z6EA 5JDLA 2H3RA 3AA0B 3ZCIA 3LG7A 2ZM2A 3ZCJA 3MK7C 5J1GA 3LBXB 4O4LE 5HXHA 2V7MA 3C51A 2A3DA 3MA9A 4GYRA 4UXNB 5LGNB 2BVLA 2HH7A 2A72A 4CQIA 4HE8A 3OYXA 3N9PA 2K5BB 3RC3A 2LM9A 2MOZA 2YU2A 3C64A 3CMLA 4MFRA 4DVDA 3ZC0A 2M67A 3OBVE 3CX7B 4UV9B 4DO0A 4WBOA 4KBMB 3HL6A 2C5JA 1US7B 3SOLA 4YHJA 3UULA 4ANJA 5LYJE 4MBQA 3AB3B 4B6XA 1BR4A 3KVBA 5JDGA 3KV5A 3O1HA 1FEWA 4U74A 3FBLA 2V7IA 4XAXB 2L3LA 5HXSA 3HKEE 5L3BB 2RA1A 1U5PA 2X66A 5DQWA 3CQGB 2V7LA 3LBXA 1KK7A 2LHNA 3UT5E 2NP9A 3LK2B 2SPCA 2V7KA 3CVRA 2C5KT 3O1IA 3K8PC 3LJCA 4KUMB 3RRCA 5JDFA 3GWHA 2Q9QB 4YLHA 2CXDA 1MNEA 5JRCB 1MIWA 4GK0E 5L3EB 3EUHA 1YKEB 4ZI2D 4TV9E 2RP4A 1B7TA 3PURA 4TZ4C 4UEMA 3RKOA 2H7OA 3OJAA 5JR9C 2EHOA 3AA7B 2L9QA 4UVAB 2IAKA 4PW8A 3ONXA 3KV6A 3V5SA 3PU3A 3D0TA 4OK0A 1D0ZA 3K3OA 3EVYA 2LSGA 1LRZA 3L09A 3PUAA 5E0OA 4ZI2C 2ZLYA 3K3NA 1HG2A 3AVSA 2V7JA 3N2OA 4H9SE 4UVCB 5IYZE 5AFUL 2Y8DA 4HKAA 3I9YA 3IHRA 5CA1E 4UV8B 3UFEA 2ACXA 1SA0E 4M1PA 1D0YA 4EZHA 1HF8A 2K48A 2XUEA 3E08A 4O2BE 4QXBB 4ZI3D 1FIOA 3VKHA 2WBLA 4G2AA 3DJBA 2LT3A 2LE8A 1ZEEA 4AKLA 5HWXA 3SRZA 2GK9A 1Y64B 2I59A 3I1AA 1LVKA 4L9IA 4ZI3C 1U4QA 3RH3A 3R84B 5FY1A 2NOXA 4BA9A 3UTKA 3J9X1 2LSJA 3KDSE 2K9AA 3FXEB 3VU7H 3MZKB 3HKCE 3N9LA 4AQGA 3QK6A 4AXPA 5CA0E 4BJMA 5FXVA 4L5GA 3PUSA 4PNIA 4TUYE 3T8OA 4AKIA 5EK2A 1MIVA 1D0XA 5HXCA 4O8SA 4H9QC 2QA7A 5J2TE 3VKGA 2IW5B 3ETUA 2NW9A 4H9PC 2WSSV 3C50A 2X9HA 5IHYA 2MTQA 3PDYA 5FY7A 2NWBA 2LHRA 3UUNA 4OFZA 2CMRA 2JJ9A 3KV4A 3MJXA 3O4XE 1WLXA 4J2CA 4I43B 2V1DB 4X1KE 2ODVA 3W15B 4JEHB 4QKNA 3GN5B 3ZEFB 5HXEA 3N9MA 2B1EA 2CLYC 2KZ7B 2KMFA 3ZMZB 2UXXB 3I0OA 3CQCB 1NWMX 5F3JA 2DCFA 1MIYA 2NW8A 1KNZA 3AAAB 3PUGA 2KLQA 2OA5A 1LVFA 4O4JE 3PU8A 4DMWA 2VASA 2HPJA 4H63H 1BR1A 1T98A 2KNDA 1HG5A 4IGUA 4UIGA 4I50E 3RPUA 3WI3A 2KXPB 2XAFB 4PJLA 3C98B 5LOVE 1E1HB 2V26A 3QUJA 2XAGB 3AAIA 2DWGA 4IE7A 2BZBA 3FB2A 4ASKA 4EOZB 3GMIA 2CA5A 2DHRA 4QHOA 5FP3A 2EHOB 4HTEA 3BQIA 1D1CA 3GN5A 2WM9A 4ZI7E 3HR0A 4EZ4A 2LOPA 5ADXL 1S35A 2VL8A 4CXYA 3RYCE 4O4HE 2E8IA 1G73A 3ETVA 4FI5A 2YU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CQI A;  2KWH A;  3N5L A;  4J2C A;  3CVR A;  1QSD A;  2X9W A;  2C5K T;  3QUJ A;  3CKD A;  3FXE B;  1Z0P A;  1ZKE A;  3QK6 A;  2C5J A;  2CA5 A;  3L3P A;  1H7C A;  3FXD B;  2K48 A;  1IJ5 A;  2X9X A;  3P7I A;  4B6X A;  2KWI B;  3TKL B;  1LVF A;  1IJ6 A;  3S4U A;  1LRZ A;  2XTL A;  3MXZ A;  2IC6 A;  4L0R A;  4EYY R;  2MBG A;  4DND A;  2IC9 A;  4FI5 A;  2X9Y A;  2G0U A;  2C5I T; 
#chains in the Genus database with same CATH topology
 4CN1 A;  3FBZ A;  4QH5 A;  1FMV A;  4UVB B;  3VR8 A;  4EV6 A;  3FZM B;  4PAG A;  3Q5W A;  1GQE A;  3RHW A;  4HFV A;  5LHH B;  2D2S A;  1YD8 G;  4X1Y E;  5CB4 E;  1UCU A;  1HNZ T;  4HN9 A;  2JQQ A;  4KP3 C;  3UQ4 A;  3RI5 A;  2W63 A;  3AVR A;  4JEU B;  2W61 A;  4IDZ A;  4IHJ E;  2JQK A;  2H88 A;  2XQA A;  2W66 A;  4JI4 T;  1MMN A;  4MLK A;  4IT4 A;  1I94 T;  1LKX A;  1QSD A;  2VK9 A;  4U2Z A;  1OWA A;  5A1L A;  3N9Q A;  5LHI B;  2WDV A;  3JC6 C;  2RPA A;  4I4T E;  3HKB E;  2W62 A;  2WDQ A;  3AEC A;  2PBI A;  4EGW A;  3CIR A;  2Q9Q D;  3IF8 B;  4DV0 T;  4JYA T;  2N1G A;  1T7S A;  2VKH A;  1ZP0 A;  2BBH A;  2WAU A;  3RIF A;  4GIW A;  4U3C A;  2W0G A;  2DLR A;  5ETW A;  4YHH T;  5JR9 B;  3KV9 A;  4TN7 B;  3E22 E;  2IC9 A;  2E9X B;  5JQG E;  4DBQ A;  4A5X A;  1WR6 A;  4E7S A;  2CBJ A;  3N5L A;  1WCR A;  3PV0 F;  2MYS A;  4BAY B;  3JAD A;  3SFD A;  4ERR A;  4IST A;  4EIW A;  4QX8 B;  1YW0 A;  2IUB A;  5JH7 E;  3AED A;  4WZX A;  4DND A;  2LEH A;  1R8I A;  3PTR B;  4CXW A;  2LSI A;  1EZ3 A;  4QXC B;  4GKK T;  3WAJ A;  3P7I A;  1OXZ A;  3FHN A;  1J1J A;  2MPK A;  1VOM A;  1IBK T;  2WMN A;  5FMN A;  2X0H A;  1HX1 B;  1WYC A;  3HA4 A;  4E7Z A;  2YDS A;  1J5E T;  2CHN A;  2IIU A;  4YJ2 E;  3RIA A;  3H37 A;  3L3P A;  5AQL B;  5AQU B;  2CLY B;  2H89 A;  3OKQ A;  4YTN A;  2C0S A;  3PUW F;  4NXN T;  3F31 A;  2C5I T;  2XQ6 A;  4UF0 B;  3Q5X A;  4JI3 T;  3A5X A;  4I0U A;  5AQV B;  3O9X A;  4C90 A;  5F5W A;  4JI2 T;  3OYZ A;  1QLB A;  2E5L T;  1XWM A;  5F8P A;  4NUV A;  4PJM A;  3ABV A;  3F57 A;  5IUX A;  4CI2 B;  3P4W A;  2IHR 1;  1UUR A;  4NUU A;  2XSA A;  5DJQ C;  4K0U A;  2D5U A;  2YEV C;  4WBN E;  5JDQ A;  3J7Y q;  3LK4 2;  3F2E A;  1W09 A;  2QRX A;  1ZHC A;  2MBG A;  2XZE A;  3PUQ A;  4WYV A;  3H3A A;  2D0U A;  4HGA A;  3B13 A;  1OED A;  4EB6 E;  1KFY A;  3VR9 A;  2WMO A;  2PFV A;  2H3R A;  2BKO A;  4O4L E;  2XQ4 A;  3C51 A;  3AE7 A;  2A72 A;  3OYX A;  3N9P A;  5LMU T;  2MOZ A;  3CML A;  2WZH A;  4UV9 B;  4WBO A;  2XSB A;  3SOL A;  4ANJ A;  4MBQ A;  3EAB A;  3O1H A;  1YXR A;  4U74 A;  1NEN A;  4XAX B;  4DV2 T;  3RLF F;  4HWD A;  3LK2 B;  2V7K A;  3RRC A;  4KUM B;  5FKY A;  5JRC B;  4TNV A;  2RP4 A;  3RKO A;  2EHO A;  3V5S A;  3KV6 A;  4U7I A;  5HEJ A;  1D0Z A;  5E0O A;  1SE7 A;  5CJ5 A;  1HG2 A;  3AEA A;  1IBL T;  2BKP A;  2ACX A;  3P50 A;  4M1P A;  1D0Y A;  3E08 A;  3NVO A;  2CHO A;  2CBI A;  1ZEE A;  2GK9 A;  4DR6 T;  1U4Q A;  4TWD A;  4BA9 A;  3UTK A;  3J9X 1;  2LSJ A;  3KDS E;  3HKC E;  3PUS A;  4TUY E;  2AXD S;  1D0X A;  4JI5 T;  2IW5 B;  2WSS V;  1NEK A;  5IHY A;  3L8R A;  3Q5D A;  5AQM B;  4JV5 T;  3KV4 A;  2V1D B;  2ODV A;  1FJG T;  2FJE A;  2KZ7 B;  3AEB A;  1MIY A;  3PUG A;  2LRL A;  4O4J E;  3PU8 A;  4DMW A;  1N32 T;  2KND A;  1HG5 A;  4I50 E;  3WI3 A;  2KXP B;  4PJL A;  5LOV E;  2V26 A;  2J62 A;  2BZB A;  4ASK A;  4EOZ B;  5AQI B;  2WM9 A;  4KHZ F;  2CRB A;  3HR0 A;  5ADX L;  1S35 A;  3RYC E;  4O4H E;  2E8I A;  5JVD E;  1XDO A;  4U7Y A;  2Y48 B;  4IE4 A;  4DV1 T;  1HS7 A;  4MAL A;  3DP7 A;  4QWN B;  5JTG A;  1N36 T;  1SHZ C;  1ZKE A;  2W67 A;  2XAS B;  2VWA A;  1N34 T;  5FVK A;  2X68 A;  2E9X C;  1Z8U A;  1G8X A;  2VKJ A;  1HNX T;  4DR2 T;  4IE0 A;  3RIU C;  4AQF C;  4A56 A;  4JI1 T;  2DI4 A;  3ANW B;  3GA8 A;  4KHP T;  3TKL B;  2YIN A;  2XQ8 A;  3RRW A;  4NXM T;  4C91 A;  3UUX B;  2FJA A;  4QH1 A;  3KBT A;  4H9O C;  2XAQ B;  1KF6 A;  2IDO B;  3QOF A;  2XQ7 A;  5LP6 E;  3IA3 A;  2L8K A;  5FYM A;  3RKG A;  3ZMU B;  4EYY R;  4FJO A;  5KXJ A;  2X0L B;  3X1D A;  2N2N A;  4UF0 A;  4GK5 E;  5LNK A;  3RYI E;  3ZYK A;  4OYJ A;  2VQF T;  5IWA T;  2BVM A;  3B57 A;  2QVA A;  4YSY A;  1IJ6 A;  2VKO A;  2N9D A;  5M4Y A;  1WRD A;  4TX5 A;  4OYK A;  5H6R B;  4P0A A;  3P4Q A;  4AQY T;  5ABH A;  3FZH B;  1VCT A;  5C2T A;  2WU5 A;  1YQ3 A;  1Y01 A;  2VQE T;  3TLS A;  2JRK A;  4EYU A;  2NTY A;  3AXJ B;  3LFM A;  2JMK A;  3CWZ B;  2HPL A;  3NZQ A;  2X9W A;  3ZMT B;  3ZN1 B;  5JDH A;  3CX6 B;  5H6Q B;  5KMG P;  5L3G B;  4KMC A;  3QB5 A;  3ZMS B;  4CI1 B;  3RX6 A;  2XQY A;  2CXL A;  3ZST A;  3ONJ A;  2ZM0 A;  3PUX F;  2VVN A;  2UXC T;  3MAC A;  4ZS2 A;  2FJD A;  5HEG A;  3BK9 A;  1HCI A;  4OHF A;  4IIJ E;  4DR1 T;  2EHO D;  2XJ7 A;  3N9O A;  2CM0 A;  1MND A;  1XNR T;  4Z8X A;  2LLY A;  4Z91 A;  5AQH B;  5GON E;  3M65 A;  3I9W A;  2YDQ A;  3A7M A;  2E2A A;  5JRC A;  3RQW A;  2BDE A;  2ZM8 A;  3T1Y T;  4EXT A;  3RQU A;  4GKJ T;  2V5D A;  3AE6 A;  4LMK A;  2CEA A;  5DAB A;  2QYW A;  3ZN0 B;  3OVU A;  2PG8 A;  4U72 A;  5HAX A;  4OX9 T;  3AEF A;  3NRY A;  3ONL C;  4ADZ A;  5JDN A;  2QGS A;  3H3M A;  4B3T T;  1V9D A;  5EZY E;  5LCY A;  4GYS A;  1DU2 A;  2V6Y B;  3AA1 B;  1Z0P A;  5J0Z A;  2XQ3 A;  5JDL A;  3AA0 B;  3ZCJ A;  1HR0 T;  5J1G A;  3LBX B;  5FL1 A;  5CFB A;  4LFC T;  2A3D A;  3ZT7 A;  2BVL A;  1HNW T;  2WDR A;  4MFR A;  3C64 A;  3CX7 B;  5ABE A;  4U2Y A;  3HL6 A;  1US7 B;  3PJA J;  2UXB T;  3AB3 B;  4B6X A;  4HFH A;  3KVB A;  2PTF A;  4EEB A;  4COF A;  5HXS A;  4ZZC A;  2X66 A;  5DQW A;  3CQG B;  2NP9 A;  2SPC A;  2C5K T;  3LJC A;  4YLH A;  4YSZ A;  2BG9 C;  2CXD A;  1MNE A;  1JNZ A;  5L3E B;  3EUH A;  1YKE B;  4ZI2 D;  4TV9 E;  4UEM A;  1B7T A;  2H7O A;  3AA7 B;  2L9Q A;  3AE8 A;  2IAK A;  4LMJ A;  5LMN T;  3K3O A;  2V6X A;  3UU6 A;  2R6G F;  5IYZ E;  4AIS A;  5HEH A;  5AFU L;  2MAW A;  3I9Y A;  4IDO A;  4UV8 B;  3PJA A;  3M3Z B;  4EZH A;  1HF8 A;  1W9R A;  4QXB B;  4ZI3 D;  3DJB A;  4AKL A;  3SRZ A;  5HCM A;  1Y64 B;  3I1A A;  1LVK A;  2A9U A;  4L9I A;  4HFB A;  5FY1 A;  4ILA A;  3FXE B;  4B3R T;  3N9L A;  4AXP A;  5CA0 E;  5FXV A;  4L5G A;  4PNI A;  4AKI A;  5HXC A;  2BS4 A;  1XZY A;  2F4V T;  3VKG A;  2V8S V;  1XMQ T;  1L0V A;  2XQ5 A;  4H9P C;  2J47 A;  2NWB A;  4OFZ A;  3SFE A;  3MJX A;  1WLX A;  4J2C A;  4I43 B;  2BS3 A;  1E7P A;  1X9B A;  3GN5 B;  3TLT A;  2X0Y A;  2KMF A;  2YDR A;  3CQC B;  1NWM X;  5F3J A;  2NW8 A;  5AQJ B;  2W4X A;  2HPJ A;  4H63 H;  1T98 A;  2LKH A;  5AQN B;  3RPU A;  3QUJ A;  3CK6 A;  3AAI A;  2DWG A;  4IE7 A;  2WQY A;  3GMI A;  2DHR A;  4QHO A;  4HTE A;  3BQI A;  1D1C A;  4DR5 T;  4LFA T;  2FBW A;  1XMO T;  1UGO A;  4ZI7 E;  4EZ4 A;  2VL8 A;  4CXY A;  5AQK B;  5L4E A;  4DV4 T;  3FZK B;  5L3C B;  3C4W A;  1WYB A;  2CCQ A;  2XY8 B;  3ZPO A;  1YQ4 A;  2JPF A;  4LFB T;  2IC6 A;  1QUU A;  3UQ7 A;  3AXJ A;  4AKR B;  3ZC1 A;  5FXX A;  3UU3 A;  5LGU B;  4HWH A;  2B76 A;  2E5V A;  3RYF E;  5LJN A;  2YKS A;  2DWK A;  4JI7 T;  1D1B A;  5ABF B;  3EHZ A;  2VVS A;  4X64 T;  5KX5 E;  3JC6 D;  4HWI B;  2WWU A;  3A8Y C;  3CX8 B;  5LA6 E;  1T72 A;  1N33 T;  2I6H A;  2VB6 A;  2K3W A;  3VHL A;  3RYH E;  3TLW A;  4PJN A;  3JAE A;  3WAK A;  5L2L A;  2X9Y A;  2G0U A;  4KX6 A;  3PE0 A;  5LG3 A;  2Q9Q C;  5HWY A;  2HN1 A;  4IE6 A;  2KSR A;  1BR2 A;  5LB7 B;  2BG9 B;  3SWH A;  3CPZ A;  1X79 A;  4PJJ A;  1D1A A;  4ZS3 A;  4PK6 A;  3N2G E;  2JQ9 A;  5JRE A;  2CWO A;  4AI6 A;  4HWC A;  2VUR A;  4QXH B;  1S94 A;  3K1S A;  3AE9 A;  3AEG A;  4QH4 A;  3SS1 A;  3PUY F;  2CE7 A;  2IML A;  4XZC A;  3PUZ F;  2DL1 A;  2YN6 A;  4IDQ A;  3ZLI A;  4MHC A;  5JR9 A;  3RF1 A;  5KDM C;  4K0K T;  3G06 A;  2E9X A;  3CQX C;  5L3F B;  2UXD T;  2KIN B;  2V6Y A;  4YTM A;  3E0Z A;  2ACZ A;  2Y6X A;  5HCJ A;  4JUY A;  4AKH A;  3BQL A;  4IDP A;  3S4U A;  4ISS A;  3RIU A;  4AQF A;  2H7V C;  3N9N A;  2UU9 T;  3NBX X;  4NPP A;  3IEE A;  3L39 A;  4XBF B;  4H9N C;  4PFO A;  3AE5 A;  3N2K E;  2BG9 E;  3HI2 A;  3TLU A;  3QC9 A;  1CHU A;  5LGT B;  5FNV E;  2P9B A;  1W0A A;  4ILC A;  2VKD A;  1HTJ F;  2WP9 A;  2XTL A;  5EK3 A;  2KT9 A;  1NAF A;  4DMV A;  3ZJ1 A;  4CXX A;  5AQR B;  3LK3 B;  2XQ9 A;  3O1J A;  2ES0 A;  3AAE B;  2M6B A;  1CUN A;  1H7C A;  4ZOL E;  5HEU A;  2AE9 A;  3FZL B;  1SUM B;  5BMV E;  5HYA A;  4X1I E;  4YJ3 E;  2XAJ B;  2ZM6 T;  4HFC A;  4P0B A;  4JLE A;  1VRB A;  2XPK A;  2PJQ A;  1IAP A;  1ZOY A;  5LHG B;  4ZXL A;  2KWI B;  2XAH B;  3AEE A;  3QNU A;  4DBR A;  5L47 A;  2LKG A;  5FXW A;  1IBM T;  4UEL A;  5DQV A;  2Z6E A;  2I0M A;  3ZCI A;  4LF5 T;  3LG7 A;  4Q25 A;  2ZM2 A;  3MK7 C;  3T1H T;  3LSV A;  2V7M A;  2HH7 A;  4HE8 A;  2K5B B;  3RC3 A;  4DR7 T;  3OBV E;  4KBM B;  4YHJ A;  4B3M T;  4CN6 A;  4DID B;  5JDG A;  3FBL A;  2V7I A;  2L3L A;  4YTP A;  3HKE E;  2RA1 A;  1U5P A;  1KK7 A;  2LHN A;  3CVR A;  2Q9Q B;  1MIW A;  3NKZ A;  4GK0 E;  5AQO B;  3ZSS A;  4TZ4 C;  3PUR A;  3OJA A;  4YT0 A;  3ONX A;  4LF6 T;  3EVY A;  3L09 A;  3PUA A;  3AVS A;  2V7J A;  3N2O A;  4UVC B;  2Y8D A;  4HKA A;  2OV9 A;  4U31 A;  5CA1 E;  4O2B E;  2WCA A;  3ZT5 A;  2WBL A;  3VKH A;  2LT3 A;  5HWX A;  5AQG B;  4YSX A;  1W0B A;  2I59 A;  3RH3 A;  4UR9 A;  3R84 B;  3UFG A;  3UU8 A;  3MZK B;  4BJM A;  1MIV A;  4H9Q C;  5J2T E;  2NW9 A;  2X9H A;  2MTQ A;  5FY7 A;  3UUN A;  2LHR A;  2CMR A;  2JJ9 A;  5ABF A;  3O4X E;  4X1K E;  3W15 B;  4JEH B;  3ZEF B;  5HXE A;  3AE1 A;  3N9M A;  2B1E A;  2UXX B;  3I0O A;  4NIQ A;  5BR8 T;  2OA5 A;  3VRA A;  3P4R A;  2VAS A;  3NWI A;  1BR1 A;  4DUY T;  2XAF B;  3C98 B;  1E1H B;  4IL9 A;  3FB2 A;  2CA5 A;  1T8B A;  2BG9 A;  3ETV A;  2WZI A;  4A98 A;  2YU1 A;  2YK0 A;  3UU5 A;  3FZF B;  1HX8 A;  3KVA A;  3V5U A;  4I55 E;  2E9X D;  3HKD E;  3C4Z A;  2LJL A;  5LXT E;  4LF4 T;  2VL0 A;  3QB5 K;  4DV7 T;  3EDV A;  4H63 V;  4HEA A;  1KNR A;  2FUP A;  3ZT6 A;  3R6N A;  5L3D B;  1MMG A;  2WS3 A;  2X67 A;  3MKD A;  1WFD A;  4LML A;  4BJN A;  1IJ5 A;  5LJM A;  5TAO A;  2NTX A;  2NW7 A;  4V1A v;  2WWV A;  3NRX A;  4WNK A;  3DTO A;  4JBW F;  4ZZB A;  5FXZ A;  1VCS A;  2XHE B;  4CI3 B;  3KBU A;  2LSY A;  4B3S T;  1M62 A;  1AJ3 A;  4IDN A;  2YOE A;  2ODU A;  2LOS A;  5LG4 A;  3Q9D A;  4O2A E;  5C8Y E;  3ANW A;  1WR0 A;  2UXN B;  2D0T A;  5J2U E;  1HFA A;  3BQK A;  3EAM A;  3ESL A;  1XNQ T;  4TV8 E;  1IZN B;  4F8H A;  5FY0 A;  4YY3 T;  3UU4 A;  4HFD A;  5C3J A;  2NR4 A;  4PFP A;  2CPT A;  5HEO A;  4EED A;  1MMA A;  1E2A A;  3AE4 A;  2CWY A;  4YFS A;  3ZYM A;  3CKD A;  3U3I A;  4PK4 A;  1MMD A;  3AA6 B;  5HXR A;  4AKG A;  3FXD B;  2LSK A;  3AE3 A;  2XM1 A;  1OED C;  3UUM A;  3RC8 A;  3AE2 A;  2WU2 A;  2X51 A;  1BR0 A;  4ILU A;  3EDU A;  5LBM A;  4O4I E;  2M6I A;  2UUB T;  2FJB A;  1O3X A;  5JDM A;  4TWF A;  3U78 A;  3OPC A;  2WB5 A;  4H9R C;  2KWH A;  2CXF A;  2A2F X;  2UUC T;  1YKH B;  4DR3 T;  2BKN A;  1ZV4 X;  5ABG A;  5CGM A;  4P09 A;  4DV3 T;  3MXZ A;  3ZJ2 A;  5FL0 A;  4CZZ B;  4QX7 B;  2J1D G;  1J5W A;  5FVL A;  4HFE A;  4PK5 A;  4DR4 T;  3ZKR A;  2EHO C;  2J4G A;  1UX5 A;  2Q9Q A;  2ZMA A;  3B5M A;  2OLT A;  3KIN B;  4L0R A;  2JMH A;  4WW0 A;  4JI0 T;  4ZHQ E;  4CN4 A;  5LBQ B;  3P8C D;  4TWH A;  4ZEY A;  3OTO T;  4U33 A;  2W00 A;  3K3Q C;  4G63 A;  4YXD A;  4X65 T;  3ZMV B;  3C4X A;  3ZYL A;  3I0Q A;  4A97 A;  4LF9 T;  4JI6 T;  2LM2 A;  4JI8 T;  3PUV F;  3LDQ B;  4X62 T;  4KI0 F;  3Q5E A;  4F6R C;  4IE5 A;  4LF7 T;  2DNX A;  3KFW X;  4X20 E;  4N78 D;  1UUS A;  5EK4 A;  2BS2 A;  3NZP A;  1UX4 A;  3IBP A;  4GOU A;  2K24 A;  2X9X A;  4EAH A;  1FMW A;  3Q2M A;  1KEY A;  5HXH A;  3EI0 A;  3MA9 A;  4GYR A;  2BBJ A;  4UXN B;  5LGN B;  4CQI A;  2JIW A;  4HFI A;  2LM9 A;  2YU2 A;  3ZC0 A;  5L4H A;  2W2U A;  4DVD A;  3VRB A;  2M67 A;  4DO0 A;  4AIU A;  2C5J A;  3UUL A;  5LYJ E;  1BR4 A;  3KV5 A;  1FEW A;  2XM2 A;  5AQF B;  4LF8 T;  5L3B B;  2UUA T;  2V7L A;  3LBX A;  3UT5 E;  3O1I A;  3K8P C;  5JDF A;  1UK5 A;  3GWH A;  5AQS B;  5JR9 C;  1XDP A;  4ILB A;  3JAF A;  4UVA B;  4PW8 A;  3PU3 A;  3D0T A;  4OK0 A;  2LSG A;  1LRZ A;  4ZI2 C;  2ZLY A;  3K3N A;  2LRK A;  4H9S E;  4P1N A;  3IHR A;  2HHH T;  3UFE A;  4X66 T;  1SA0 E;  1M7K A;  2K48 A;  2XUE A;  3UUB A;  1FIO A;  5AQQ B;  4IL4 A;  4G2A A;  2LE8 A;  4IRE A;  4HWF A;  1OED B;  3TLV A;  4ZI3 C;  4TNW A;  3RGL A;  2D9D A;  2NOX A;  2K9A A;  3JCF A;  3VU7 H;  4AQG A;  3QK6 A;  1I6Z A;  3T8O A;  2V5C A;  5AQT B;  5EK2 A;  2WY2 A;  2JQH A;  4O8S A;  2QA7 A;  4DV6 T;  3ETU A;  3C50 A;  3PDY A;  1JNR A;  3P4S A;  4QKN A;  1KNP A;  2CLY C;  3ZMZ B;  2DCF A;  1KNZ A;  3AAA B;  2KLQ A;  1LVF A;  3P4P A;  2HN2 A;  4IGU A;  4UIG A;  4X5T A;  4Z90 A;  4DUZ T;  2XAG B;  5FP3 A;  2EHO B;  3GN5 A;  5AQP B;  1OED E;  2LOP A;  1G73 A;  4DV5 T;  4FI5 A; 
#chains in the Genus database with same CATH homology
 2YK0 A;  3FBZ A;  1FMV A;  2Y48 B;  4IE4 A;  4UVB B;  1HS7 A;  4MAL A;  1HX8 A;  3DP7 A;  4QWN B;  1SHZ C;  3C4W A;  1ZKE A;  5L3C B;  1WYB A;  2XAS B;  3KVA A;  2CCQ A;  2VWA A;  3V5U A;  4PAG A;  3Q5W A;  2E9X D;  3HKD E;  4I55 E;  3C4Z A;  2LJL A;  3ZPO A;  5LXT E;  2X68 A;  2JPF A;  2IC6 A;  1QUU A;  2E9X C;  3EDV A;  4H63 V;  4HEA A;  4HFV A;  5LHH B;  2D2S A;  1YD8 G;  4X1Y E;  5CB4 E;  3R6N A;  1UCU A;  4AKR B;  5L3D B;  1MMG A;  2X67 A;  1G8X A;  3ZC1 A;  3MKD A;  4HN9 A;  5FXX A;  2VKJ A;  5LGU B;  2JQQ A;  4KP3 C;  4IE0 A;  3RYF E;  4AQF C;  2W63 A;  3AVR A;  4JEU B;  4A56 A;  4BJN A;  2DI4 A;  2W61 A;  1IJ5 A;  5LJN A;  3ANW B;  5LJM A;  3GA8 A;  5TAO A;  4IDZ A;  3TKL B;  2NTX A;  2NW7 A;  2DWK A;  2YIN A;  4IHJ E;  4V1A v;  3NRX A;  1D1B A;  3RRW A;  4WNK A;  1MMN A;  4C91 A;  3UUX B;  4MLK A;  3DTO A;  5KX5 E;  3JC6 D;  5FXZ A;  1LKX A;  2XHE B;  4CI3 B;  3KBT A;  2WWU A;  1QSD A;  2VK9 A;  4H9O C;  1OWA A;  3KBU A;  2LSY A;  2XAQ B;  5A1L A;  3CX8 B;  3N9Q A;  5LA6 E;  5JVD E;  5LHI B;  3JC6 C;  4I4T E;  1AJ3 A;  3HKB E;  2W62 A;  2VB6 A;  5LP6 E;  2ODU A;  3VHL A;  2LOS A;  5LG4 A;  2L8K A;  3RYH E;  5FYM A;  4PJN A;  2PBI A;  3Q9D A;  4O2A E;  3ZMU B;  4EYY R;  3ANW A;  5C8Y E;  4FJO A;  2Q9Q D;  3WAK A;  3IF8 B;  5L2L A;  2UXN B;  2X9Y A;  2D0T A;  2G0U A;  5J2U E;  2X0L B;  1HFA A;  3BQK A;  3PE0 A;  2N2N A;  3ESL A;  4UF0 A;  2Q9Q C;  1IZN B;  4GK5 E;  4TV8 E;  3RYI E;  3ZYK A;  5HWY A;  5LNK A;  5FY0 A;  4OYJ A;  4IE6 A;  2N1G A;  2VKH A;  2WAU A;  1BR2 A;  2BVM A;  3B57 A;  3SWH A;  4GIW A;  3CPZ A;  1IJ6 A;  1X79 A;  2W0G A;  2DLR A;  2VKO A;  4PFP A;  5ETW A;  4PJJ A;  1D1A A;  5JR9 B;  2N9D A;  3KV9 A;  5M4Y A;  4ZS3 A;  4TN7 B;  1WRD A;  3E22 E;  2IC9 A;  2E9X B;  5JQG E;  4PK6 A;  4TX5 A;  3N2G E;  4DBQ A;  4OYK A;  5H6R B;  1WR6 A;  4E7S A;  4P0A A;  1MMA A;  3N5L A;  5JRE A;  2CWO A;  4AI6 A;  2CWY A;  4YFS A;  2MYS A;  3ZYM A;  4QXH B;  3CKD A;  4BAY B;  1S94 A;  3U3I A;  4PK4 A;  1MMD A;  3AA6 B;  5HXR A;  4ERR A;  4IST A;  4AKG A;  3SS1 A;  3FXD B;  4EIW A;  2LSK A;  4QX8 B;  2CE7 A;  1YW0 A;  5JH7 E;  4XZC A;  3RC8 A;  2JRK A;  3UUM A;  4EYU A;  2NTY A;  4DND A;  3LFM A;  2JMK A;  2X51 A;  3CWZ B;  2LEH A;  3ZLI A;  4MHC A;  3PTR B;  4CXW A;  2LSI A;  1EZ3 A;  5JR9 A;  1BR0 A;  5KDM C;  2HPL A;  4ILU A;  2E9X A;  3NZQ A;  2X9W A;  3ZMT B;  3ZN1 B;  3CQX C;  5JDH A;  5L3F B;  3CX6 B;  5H6Q B;  3EDU A;  2KIN B;  4QXC B;  5LBM A;  3E0Z A;  4O4I E;  2Y6X A;  5KMG P;  5L3G B;  3WAJ A;  3P7I A;  1OXZ A;  3FHN A;  4JUY A;  4KMC A;  4AKH A;  3BQL A;  1O3X A;  3ZMS B;  1VOM A;  3S4U A;  4ISS A;  5JDM A;  4AQF A;  2WMN A;  5FMN A;  4CI1 B;  2H7V C;  3N9N A;  3U78 A;  3NBX X;  3HA4 A;  1WYC A;  3RX6 A;  4E7Z A;  2XQY A;  2KWH A;  4H9R C;  2CXL A;  3IEE A;  4XBF B;  2CXF A;  4H9N C;  2A2F X;  4PFO A;  1YKH B;  3N2K E;  4YJ2 E;  2ZM0 A;  1ZV4 X;  3HI2 A;  3H37 A;  3L3P A;  4P09 A;  3QC9 A;  2CLY B;  3MAC A;  4ZS2 A;  5LGT B;  3OKQ A;  5FNV E;  2P9B A;  3BK9 A;  2VKD A;  1HTJ F;  2XTL A;  3MXZ A;  3ZJ2 A;  5EK3 A;  4CZZ B;  1HCI A;  4QX7 B;  2KT9 A;  1NAF A;  4OHF A;  4DMV A;  2J1D G;  4IIJ E;  2C0S A;  3F31 A;  2EHO D;  3ZJ1 A;  4CXX A;  2C5I T;  4UF0 B;  3Q5X A;  4PK5 A;  3N9O A;  3A5X A;  2CM0 A;  1MND A;  4C90 A;  3LK3 B;  3O9X A;  3O1J A;  2ES0 A;  4Z8X A;  3AAE B;  1CUN A;  2EHO C;  5GON E;  3OYZ A;  1H7C A;  4ZOL E;  3M65 A;  3I9W A;  1UX5 A;  5F8P A;  4NUV A;  2Q9Q A;  4PJM A;  5JRC A;  2ZMA A;  2BDE A;  2ZM8 A;  5BMV E;  3F57 A;  3KIN B;  4L0R A;  5HYA A;  4X1I E;  4CI2 B;  2JMH A;  4EXT A;  4WW0 A;  4YJ3 E;  4ZHQ E;  5LBQ B;  2XAJ B;  2CEA A;  3P8C D;  4NUU A;  4P0B A;  4JLE A;  1VRB A;  5DAB A;  5DJQ C;  2W00 A;  3K3Q C;  4G63 A;  4K0U A;  2D5U A;  2PJQ A;  3ZN0 B;  1IAP A;  3ZMV B;  2PG8 A;  4U72 A;  5HAX A;  3C4X A;  3ZYL A;  2YEV C;  3I0Q A;  5LHG B;  3NRY A;  4WBN E;  2KWI B;  5JDQ A;  3J7Y q;  3LK4 2;  3F2E A;  4ADZ A;  1ZHC A;  5JDN A;  2XAH B;  2MBG A;  3PUQ A;  2QGS A;  4F6R C;  3H3A A;  1V9D A;  2D0U A;  4HGA A;  4IE5 A;  3B13 A;  5EZY E;  5LCY A;  2DNX A;  3KFW X;  4GYS A;  4EB6 E;  4DBR A;  3AA1 B;  4X20 E;  4N78 D;  1Z0P A;  5EK4 A;  5FXW A;  2WMO A;  3NZP A;  1UX4 A;  2PFV A;  3IBP A;  4GOU A;  2K24 A;  2X9X A;  4UEL A;  4EAH A;  1FMW A;  5DQV A;  3Q2M A;  2Z6E A;  5JDL A;  2H3R A;  3AA0 B;  3ZCI A;  3LG7 A;  2ZM2 A;  3ZCJ A;  3MK7 C;  5J1G A;  3LBX B;  4O4L E;  5HXH A;  2V7M A;  3C51 A;  2A3D A;  3MA9 A;  4GYR A;  4UXN B;  5LGN B;  2BVL A;  2HH7 A;  2A72 A;  4CQI A;  4HE8 A;  3OYX A;  3N9P A;  2K5B B;  3RC3 A;  2LM9 A;  2MOZ A;  2YU2 A;  3C64 A;  3CML A;  4MFR A;  4DVD A;  3ZC0 A;  2M67 A;  3OBV E;  3CX7 B;  4UV9 B;  4DO0 A;  4WBO A;  4KBM B;  3HL6 A;  2C5J A;  1US7 B;  3SOL A;  4YHJ A;  3UUL A;  4ANJ A;  5LYJ E;  4MBQ A;  3AB3 B;  4B6X A;  1BR4 A;  3KVB A;  5JDG A;  3KV5 A;  3O1H A;  1FEW A;  4U74 A;  3FBL A;  2V7I A;  4XAX B;  2L3L A;  5HXS A;  3HKE E;  5L3B B;  2RA1 A;  1U5P A;  2X66 A;  5DQW A;  3CQG B;  2V7L A;  3LBX A;  1KK7 A;  2LHN A;  3UT5 E;  2NP9 A;  3LK2 B;  2SPC A;  2V7K A;  3CVR A;  2C5K T;  3O1I A;  3K8P C;  3LJC A;  4KUM B;  3RRC A;  5JDF A;  3GWH A;  2Q9Q B;  4YLH A;  2CXD A;  1MNE A;  5JRC B;  1MIW A;  4GK0 E;  5L3E B;  3EUH A;  1YKE B;  4ZI2 D;  4TV9 E;  2RP4 A;  1B7T A;  3PUR A;  4TZ4 C;  4UEM A;  3RKO A;  2H7O A;  3OJA A;  5JR9 C;  2EHO A;  3AA7 B;  2L9Q A;  4UVA B;  2IAK A;  4PW8 A;  3ONX A;  3KV6 A;  3V5S A;  3PU3 A;  3D0T A;  4OK0 A;  1D0Z A;  3K3O A;  3EVY A;  2LSG A;  1LRZ A;  3L09 A;  3PUA A;  5E0O A;  4ZI2 C;  2ZLY A;  3K3N A;  1HG2 A;  3AVS A;  2V7J A;  3N2O A;  4H9S E;  4UVC B;  5IYZ E;  5AFU L;  2Y8D A;  4HKA A;  3I9Y A;  3IHR A;  5CA1 E;  4UV8 B;  3UFE A;  2ACX A;  1SA0 E;  4M1P A;  1D0Y A;  4EZH A;  1HF8 A;  2K48 A;  2XUE A;  3E08 A;  4O2B E;  4QXB B;  4ZI3 D;  1FIO A;  3VKH A;  2WBL A;  4G2A A;  3DJB A;  2LT3 A;  2LE8 A;  1ZEE A;  4AKL A;  5HWX A;  3SRZ A;  2GK9 A;  1Y64 B;  2I59 A;  3I1A A;  1LVK A;  4L9I A;  4ZI3 C;  1U4Q A;  3RH3 A;  3R84 B;  5FY1 A;  2NOX A;  4BA9 A;  3UTK A;  3J9X 1;  2LSJ A;  3KDS E;  2K9A A;  3FXE B;  3VU7 H;  3MZK B;  3HKC E;  3N9L A;  4AQG A;  3QK6 A;  4AXP A;  5CA0 E;  4BJM A;  5FXV A;  4L5G A;  3PUS A;  4PNI A;  4TUY E;  3T8O A;  4AKI A;  5EK2 A;  1MIV A;  1D0X A;  5HXC A;  4O8S A;  4H9Q C;  2QA7 A;  5J2T E;  3VKG A;  2IW5 B;  3ETU A;  2NW9 A;  4H9P C;  2WSS V;  3C50 A;  2X9H A;  5IHY A;  2MTQ A;  3PDY A;  5FY7 A;  2NWB A;  2LHR A;  3UUN A;  4OFZ A;  2CMR A;  2JJ9 A;  3KV4 A;  3MJX A;  3O4X E;  1WLX A;  4J2C A;  4I43 B;  2V1D B;  4X1K E;  2ODV A;  3W15 B;  4JEH B;  4QKN A;  3GN5 B;  3ZEF B;  5HXE A;  3N9M A;  2B1E A;  2CLY C;  2KZ7 B;  2KMF A;  3ZMZ B;  2UXX B;  3I0O A;  3CQC B;  1NWM X;  5F3J A;  2DCF A;  1MIY A;  2NW8 A;  1KNZ A;  3AAA B;  3PUG A;  2KLQ A;  2OA5 A;  1LVF A;  4O4J E;  3PU8 A;  4DMW A;  2VAS A;  2HPJ A;  4H63 H;  1BR1 A;  1T98 A;  2KND A;  1HG5 A;  4IGU A;  4UIG A;  4I50 E;  3RPU A;  3WI3 A;  2KXP B;  2XAF B;  4PJL A;  3C98 B;  5LOV E;  1E1H B;  2V26 A;  3QUJ A;  2XAG B;  3AAI A;  2DWG A;  4IE7 A;  2BZB A;  3FB2 A;  4ASK A;  4EOZ B;  3GMI A;  2CA5 A;  2DHR A;  4QHO A;  5FP3 A;  2EHO B;  4HTE A;  3BQI A;  1D1C A;  3GN5 A;  2WM9 A;  4ZI7 E;  3HR0 A;  4EZ4 A;  2LOP A;  5ADX L;  1S35 A;  2VL8 A;  4CXY A;  3RYC E;  4O4H E;  2E8I A;  1G73 A;  3ETV A;  4FI5 A;  2YU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...