2G0UA

Solution structure of monomeric bsal, the type iii secretion needle protein of burkholderia pseudomallei
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
MSNPPTPLLADYEWSGYLTGIGRAFDDGVKDLNKQLQDAQANLTKNPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDIDSSILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Monomeric BsaL, the Type III Secretion Needle Protein of Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Unknown function
molecule keywords type III secretion system needle protein
total genus 30
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2006-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2g0uA01
3N5LA 3P7IA 1LVFA 1QSDA 2CA5A 1IJ6A 4EYYR 2C5JA 1LRZA 4L0RA 4J2CA 2IC9A 2K48A 2XTLA 2MBGA 3S4UA 1Z0PA 2KWHA 3CVRA 3TKLB 1H7CA 3CKDA 1ZKEA 3FXEB 3FXDB 4DNDA 3QUJA 2X9XA 4FI5A 3QK6A 2C5KT 2X9YA 3L3PA 2C5IT 2X9WA 1IJ5A 2KWIB 4CQIA 3MXZA 2IC6A 4B6XA 2G0UA
chains in the Genus database with same CATH superfamily
3O9XA 5AQPB 3VKGA 2R6GF 1KEYA 1JNZA 4UV9B 1D1BA 3EAMA 2VKHA 1B7TA 4I4TE 3E0ZA 3CK6A 3MJXA 4O4IE 5H6RB 4ZI2C 3PURA 2W4XA 1XDPA 4HN9A 2KSRA 2X51A 5EK4A 4KX6A 2LKGA 4CZZB 1J5ET 2V7IA 3OPCA 3OVUA 3RIFA 4EYYR 4ZZBA 2FBWA 2W2UA 2X66A 2ES0A 4P1NA 3NVOA 5FXVA 4ZHQE 4TNWA 4X64T 3UULA 4LFAT 3ANWA 3AA7B 2V6XA 3CIRA 3I1AA 3P50A 1WR0A 3U3IA 4HKAA 2CWYA 5IHYA 5AQUB 2DLRA 4TWDA 3CKDA 5FVKA 2NW9A 5AQSB 2XQ8A 2XPKA 4UV8B 3N9MA 3PV0F 4AISA 3BQKA 4FI5A 2DNXA 4X1YE 4ZEYA 3VR9A 2Y6XA 1M7KA 4LF6T 1E2AA 4YT0A 2X9WA 4HGAA 4LFCT 2WDRA 3ZN1B 2K24A 2VVNA 5HXCA 1MNEA 2OV9A 1E1HB 1ZEEA 3UQ4A 4DR3T 5AQIB 2CEAA 4DR5T 4ILUA 3UUNA 1W0BA 4U74A 5H6QB 4GK5E 5HYAA 5JREA 4QX8B 4CN6A 1J1JA 2BDEA 2LRLA 3DTOA 3IF8B 1YKHB 4OHFA 4DBRA 2KT9A 2JMHA 2V7LA 2LJLA 3NKZA 1YQ4A 1VCTA 2UXNB 1IJ6A 1YW0A 4QH4A 1IBLT 4ILCA 3A8YC 4EOZB 3SWHA 3RIUA 5HXHA 2I0MA 2YEVC 2YOEA 2NWBA 4YHJA 3C4XA 2NR4A 1G73A 4QXCB 5AQQB 4O8SA 3TKLB 3UU3A 5CJ5A 5ADXL 2A72A 4L5GA 1WLXA 2JMKA 3FXEB 4B3RT 2DHRA 4P0AA 5JDFA 1MIWA 3NZQA 1FMWA 3QK6A 5LMNT 5LA6E 2MTQA 3F57A 4NXNT 2J62A 1QLBA 4M1PA 5F8PA 5L3BB 4PK4A 4JI0T 2DWGA 2QYWA 4HEAA 5FKYA 4BAYB 1XDOA 1MMDA 2LHNA 3AE4A 4IT4A 4JI3T 4H9PC 4TV9E 5ABHA 4DV5T 2PTFA 2WAUA 1U4QA 2XZEA 4UR9A 4H63H 1BR2A 5AQJB 4MALA 4CN4A 3AAAB 4HWDA 3RIUC 2UUCT 1D0XA 3OYXA 4DIDB 4UVCB 3F31A 4X5TA 5FVLA 5IYZE 5JQGE 3MZKB 2LSYA 4KP3C 3PDYA 2A3DA 2QA7A 3AXJB 2J1DG 3CQXC 4JUYA 3ETVA 3HKCE 3VR8A 5EK2A 2BBHA 3HR0A 3ZSTA 5LNKA 3E22E 1AJ3A 4PFOA 4DMWA 3FZLB 4DV1T 2CCQA 2KXPB 4UIGA 2IHR1 3Q2MA 2VURA 2WQYA 3FBLA 2WM9A 2FJDA 4TZ4C 3WI3A 1UX5A 2JRKA 1WFDA 4U2ZA 2D0TA 4IDZA 4ZXLA 3AAIA 4JYAT 1BR0A 3RPUA 4KMCA 3HL6A 4HFHA 2VKOA 3HA4A 3MXZA 5HAXA 2AE9A 3P4QA 1X79A 3PE0A 4I0UA 2W00A 4P09A 4U2YA 2Q9QB 2KLQA 5LGUB 5LXTE 5HXEA 3FZFB 4EYUA 4P0BA 3TLVA 5LGNB 4EEBA 4U72A 3ZC1A 5HXRA 2KINB 2DI4A 3UFGA 5L4EA 2CXLA 3VRBA 2KZ7B 4AXPA 3ONLC 2LE8A 2MBGA 3JAEA 1N32T 1WR6A 2DCFA 4NUVA 4ISSA 4X1IE 4X62T 1EZ3A 2NTXA 1SE7A 2A2FX 4JI5T 2CPTA 2NTYA 1Z0PA 2KWHA 1ZV4X 3AAEB 4GOUA 5LP6E 1XNRT 2VL8A 2CHOA 1UK5A 3KV4A 5HWXA 4L9IA 3FXDB 4TNVA 3B5MA 2Y48B 3G06A 1XMOT 2WCAA 2IDOB 3RC8A 4AQFC 1D1CA 5FXXA 2D9DA 4G63A 2WZHA 4H9QC 2VQFT 1W09A 2XAJB 3RQUA 4CXYA 4PJMA 3ZSSA 3DJBA 3SS1A 5FY0A 2P9BA 5LBMA 4B6XA 5L3GB 3C50A 1U5PA 5AQRB 5HEGA 1W0AA 1KK7A 3FBZA 3KVBA 3QB5A 5CGMA 5CB4E 3ZLIA 4ASKA 5BMVE 2SPCA 2QVAA 3KV9A 1I6ZA 4K0UA 3ZJ1A 1BR1A 1LKXA 2J4GA 2XJ7A 3JADA 3MA9A 1IZNB 4J2CA 2RA1A 2J47A 2K3WA 2VL0A 3AEBA 5AQHB 5LOVE 4UVBB 4GYRA 4YJ3E 5LG4A 1WRDA 3AE6A 4AKRB 2YKSA 2VQET 4ILBA 1UCUA 2KMFA 4DR4T 4AQFA 1T7SA 5J0ZA 1KNPA 2H3RA 5HCJA 1R8IA 5JDHA 4X65T 4OYKA 2JQ9A 3CQGB 2ACZA 3PUVF 2BBJA 2VKDA 4JLEA 1I94T 1OWAA 5L3DB 1UURA 2Y8DA 2LRKA 1US7B 2CXFA 2WP9A 2XAFB 2ACXA 4IGUA 4OYJA 3CMLA 4QHOA 3ZYMA 2UUAT 5KDMC 5JR9A 3KBUA 3T8OA 3UU8A 1HNWT 3N2KE 2WMNA 4ZI3D 2BS3A 2X0YA 3L09A 3LFMA 3AEFA 4LF8T 3UU4A 5IUXA 2V1DB 3TLUA 3UUXB 2DWKA 4PJJA 4EZ4A 1IAPA 3J9X1 2NW8A 2V7JA 5FMNA 4LF7T 2MOZA 1M62A 3OKQA 4EV6A 1T98A 5FYMA 4LFBT 4QH5A 2C5JA 3ETUA 1T8BA 2HN2A 4ANJA 5TAOA 2CMRA 2ODVA 2YINA 2WU5A 3CVRA 2LHRA 3K3OA 4V1Av 2MPKA 2ZM8A 3RYIE 3X1DA 4A5XA 2OA5A 2FJAA 5ABEA 4DV4T 2VK9A 5DABA 5JR9C 4HFBA 2M67A 2W66A 4H9NC 3SRZA 4AKGA 2E8IA 3GMIA 3EDUA 1HTJF 1UGOA 5EZYE 5JRCA 2CHNA 3F2EA 1GQEA 3TLWA 2KWIB 4CI3B 5LYJE 4G2AA 4CI2B 2LSKA 2X0HA 1MIVA 2B76A 2W63A 2YU2A 1L0VA 3UU6A 4YTPA 3Q9DA 3Q5DA 3MACA 3N5LA 3CX6B 3LJCA 4HFVA 2IIUA 5AQKB 1SHZC 2NP9A 4MLKA 2DL1A 2NOXA 5LHGB 4GK0E 1HCIA 4A56A 2H7OA 2BS2A 5C8YE 1FEWA 2CA5A 3PJAJ 3RGLA 2XQ6A 4HTEA 4YSXA 3T1HT 3KV5A 2K48A 3O4XE 2XTLA 2Q9QD 5AQFB 4B3ST 3S4UA 3WAJA 3O1JA 4I43B 5LBQB 1UUSA 1MIYA 4UF0B 3TLSA 2EHOA 5AQLB 4YLHA 3RRCA 2LOSA 2ZMAA 3AE1A 4HWHA 3FZHB 3O1HA 4B3MT 5BR8T 1FIOA 2C0SA 4FJOA 5EK3A 2JIWA 3AE7A 1V9DA 4QKNA 3LK42 1OEDB 2XAHB 2ZM0A 4OX9T 3PUXF 4HWFA 2BKOA 3AB3B 3QNUA 4IREA 4PFPA 1YQ3A 3TLTA 4IDOA 2OLTA 5L47A 4TV8E 1BR4A 1SUMB 2JJ9A 3M65A 4N78D 4XZCA 4BA9A 1D0ZA 1D0YA 3EHZA 2L3LA 4OFZA 1HF8A 1LVFA 4PJNA 4AIUA 5FL1A 3P8CD 3IHRA 1UX4A 3V5UA 4EXTA 3RIAA 2LSIA 1HNXT 4LF9T 4E7ZA 4U3CA 4NPPA 5C2TA 2EHOC 4XAXB 3VHLA 3LK3B 4PK6A 2PG8A 4LMKA 4LMLA 2MYSA 5L4HA 4HE8A 5LHIB 3I0OA 4YSZA 3CWZB 4DNDA 4YJ2E 4C90A 2BG9B 2CM0A 4HFDA 2ZLYA 4QXBB 4F6RC 3OBVE 4MFRA 1O3XA 3R6NA 4TN7B 3AVRA 1IJ5A 3ESLA 3PUGA 4GIWA 3LG7A 4PW8A 5CFBA 2F4VT 4Z8XA 2IC6A 2G0UA 4TUYE 2CXDA 3ANWB 3JCFA 2V26A 4ILAA 3RHWA 3I9WA 4JEHB 1QUUA 2YN6A 4EAHA 3R84B 4AKHA 4WZXA 4GKJT 2FJBA 2IMLA 3NZPA 5M4YA 1FJGT 3AEAA 5FNVE 5CA0E 1J5WA 2YDRA 3BQIA 1NEKA 5HEHA 3AE2A 4JI8T 3C64A 4K0KT 5JR9B 4QX7B 2RP4A 4C91A 5AQTB 4JI2T 3ZKRA 3RYFE 2NW7A 2IAKA 3AE5A 3HI2A 4Z91A 2M6BA 2LLYA 3GA8A 4WBOA 5FXZA 3RC3A 3MK7C 2WDVA 2YDQA 2FJEA 4NXMT 2BKNA 2L9QA 4JI7T 3ZMSB 2WBLA 4NUUA 4AI6A 2I6HA 4ZZCA 5C3JA 4AKIA 5HXSA 3ZMTB 3CX7B 3ZCJA 4E7SA 4PJLA 5L2LA 1ZP0A 3GN5A 3KV6A 3RI5A 4BJMA 4EZHA 4PAGA 2X0LB 5A1LA 5L3EB 5L3FB 2D5UA 4TX5A 3Q5XA 1IBMT 2XUEA 4JBWF 5AQGB 3V5SA 4IHJE 4L0RA 3NBXX 4X66T 2WSSV 1X9BA 3PUWF 2K5BB 2D2SA 5LJMA 4A98A 5FXWA 4LF5T 4X1KE 1E7PA 2XSBA 3FHNA 5JDMA 3GN5B 3PJAA 2E5VA 4CN1A 2UXXB 4HWIB 3PUSA 1ZOYA 3PU8A 2M6IA 5LHHB 4CI1B 3ABVA 2CLYC 2WWVA 3N9OA 3LK2B 4KUMB 4UELA 3UU5A 4TWFA 2JQKA 3A7MA 1MNDA 2V5DA 4GYSA 3P4WA 4UVAB 3RRWA 2X9HA 3AXJA 3FB2A 2EHOD 3UUMA 2YU1A 4IDQA 2WWUA 3ZEFB 4EB6E 5LB7B 4DR6T 4H9OC 2CBJA 3BK9A 3L39A 4X20E 3AECA 5FY1A 3D0TA 5LCYA 5KXJA 4CXWA 4DR7T 4ZI7E 5LG3A 1WCRA 5J2TE 3QC9A 4B3TT 3N9PA 2UXBT 2E9XB 3T1YT 2JQQA 5JRCB 3FZMB 2XQAA 4Q25A 5F5WA 2I59A 2LSGA 2LT3A 3C4ZA 3GWHA 4ZI2D 1XZYA 5FP3A 4MHCA 5E0OA 5JDNA 2VVSA 3RF1A 3W15B 2ODUA 3N9LA 1S35A 1KF6A 3AE3A 3PUAA 1ZKEA 3PUYF 5HWYA 3MKDA 4DMVA 3J7Yq 4ZS2A 3UFEA 3Q5WA 3EUHA 2W62A 2JPFA 4O4LE 4PK5A 3RKGA 3ZT6A 1FMVA 4HFCA 2N9DA 2E9XD 2XAQB 2XM1A 2X9YA 2CWOA 3JAFA 4F8HA 4ZI3C 5JTGA 5LMUT 1HS7A 2V7MA 3E08A 3AE9A 3VKHA 4HFEA 3CX8B 2V6YA 4OK0A 2LKHA 3RKOA 2WU2A 2E2AA 4JI1T 2UXDT 4QWNB 2XM2A 5AQOB 3K3QC 4HFIA 5ABGA 2LM2A 3BQLA 3H37A 2X68A 1QSDA 4IL9A 4IIJE 2MAWA 2VKJA 4UEMA 3KINB 4QH1A 1OEDA 4IE0A 2BG9C 2K9AA 4WNKA 3H3MA 1HG5A 2WS3A 3ONXA 3RYCE 3JC6C 3LBXB 4DV2T 2E5LT 1Z8UA 2GK9A 2IW5B 3I0QA 5AQNB 2PJQA 1OEDE 1YD8G 3KFWX 3EVYA 3SFDA 4DV7T 3QUJA 3PUQA 4NIQA 1WYBA 3P4SA 3PU3A 4U7IA 1JNRA 4WYVA 2RPAA 3JC6D 2C5KT 2V7KA 4U31A 4DV3T 2ZM6T 4AQYT 3IA3A 4I55E 4YY3T 4CQIA 3LBXA 4QXHB 5DQVA 1D1AA 3ZJ2A 3C98B 4I50E 2LSJA 3ZN0B 4IE5A 1OEDC 5F3JA 3IEEA 2BG9A 4COFA 2QGSA 2PFVA 3B13A 3N9NA 5AQMB 1KNZA 4KI0F 5AQVB 1YXRA 2XSAA 4DO0A 2LM9A 4EEDA 5LJNA 1SA0E 1S94A 5KX5E 1LRZA 3HKBE 4DR1T 2LOPA 5HEUA 3UUBA 3OJAA 3OYZA 4O4JE 1T72A 5KMGP 4LF4T 2CLYB 5HEOA 4DBQA 3A5XA 4PNIA 3NWIA 4H9RC 5FL0A 4IE4A 5AFUL 4U7YA 4YHHT 2YDSA 5HEJA 5ETWA 3OTOT 4ADZA 3C4WA 4IE7A 3L3PA 4IL4A 2BZBA 2XQYA 2WZIA 4ISTA 1HG2A 3NRXA 2XHEB 5JVDE 3AEEA 3AEDA 3AA6B 4DR2T 4EIWA 2PBIA 4YFSA 4KHPT 3FZKB 5J2UE 1VCSA 2E9XC 3LDQB 2YK0A 2BS4A 3NRYA 2BKPA 3VRAA 2UU9T 4IDNA 1HX8A 3KVAA 4ERRA 2AXDS 2Z6EA 2WY2A 2XQ7A 5HCMA 4WW0A 2IC9A 4CXXA 5DJQC 1HR0T 3ZPOA 1HX1B 4H63V 1MMGA 4DVDA 3KBTA 3K8PC 1HNZT 4JI6T 3ZMVB 2HH7A 1CUNA 2W67A 3AA0B 4DV0T 1H7CA 3EI0A 2N1GA 1XMQT 2H7VC 1G8XA 3Q5EA 4IDPA 3ZYLA 2E9XA 3RH3A 4YTNA 5FY7A 5IWAT 4JI4T 3N2OA 4XBFB 2V5CA 3LSVA 4ZOLE 3DP7A 3EABA 3N9QA 4O2BE 4Z90A 5DQWA 3I9YA 3ZMZB 5JDGA 1VOMA 2CRBA 2XQ5A 3O1IA 3P7IA 5CA1E 4DUZT 4EGWA 2XAGB 1MMAA 1N34T 4UF0A 3CQCB 4ZS3A 2CE7A 2EHOB 2QRXA 3PTRB 1VRBA 3P4PA 2CBIA 4TWHA 4AKLA 1NAFA 3RLFF 3SFEA 4UXNB 2A9UA 2XQ4A 1KFYA 3QB5K 2ZM2A 2D0UA 4IE6A 3RQWA 2XASB 1XWMA 3ZC0A 1CHUA 1N33T 3K3NA 3SOLA 3ZMUB 3WAKA 2KNDA 2B1EA 1HFAA 3KDSE 3P4RA 5J1GA 3VU7H 3L8RA 3ZT7A 2VASA 1W9RA 1YKEB 4KHZF 1LVKA 2Q9QA 3ZYKA 2WB5A 4YXDA 5JDLA 4DV6T 4GKKT 3C51A 2FUPA 2L8KA 5JDQA 5L3CB 2BVMA 2VB6A 4O4HE 1N36T 2XY8B 1NWMX 1Y64B 5JH7E 3AA1B 1DU2A 1OXZA 2HPJA 3RYHE 3UTKA 4O2AE 3ZCIA 3H3AA 4KBMB 5LGTB 3UT5E 1ZHCA 2XQ3A 2UXCT 2V8SV 3AVSA 4AQGA 2BVLA 1Y01A 2XQ9A 5ABFB 2X67A 2H88A 2H89A 3ZT5A 1NENA 4LMJA 1XNQT 2Q9QC 4JEUB 3U78A 2LEHA 2W61A 3HKEE 4BJNA 2V6YB 3N2GE 4U33A 3B57A 3IBPA 4MBQA 3RX6A 4DUYT 3ONJA 5ABFA 2JQHA 1WYCA 5GONE 4JV5T 2N2NA 2WMOA 3AEGA 3UQ7A 2HPLA 3M3ZB 3AE8A 2X9XA 3CPZA 3PUZF 2W0GA 4A97A 1MMNA 3QOFA 2C5IT 3HKDE 4YSYA 2VWAA 2WDQA 4H9SE 4HWCA 3EDVA 4WBNE 1IBKT 1KNRA 2BG9E 2HN1A 3K1SA 2HHHT 2UUBT 2IUBA 4YTMA
chains in the Genus database with same CATH topology
3O9XA 3VKGA 4UV9B 1D1BA 4I4TE 2VKHA 1B7TA 4O4IE 3E0ZA 3MJXA 5H6RB 4ZI2C 5HXHA 3PURA 4HN9A 5EK4A 2X51A 4CZZB 4AKIA 2V7IA 4EYYR 5HYAA 4ZHQE 2X66A 5FXVA 2ES0A 3UULA 3ANWA 3AA7B 3I1AA 3U3IA 4HKAA 2CWYA 5IHYA 2DLRA 2NW9A 3CKDA 4UV8B 3N9MA 3BQKA 4FI5A 2DNXA 4X1YE 2Y6XA 2X9WA 4HGAA 3ZN1B 2K24A 5HXCA 1MNEA 1E1HB 1ZEEA 2CEAA 4ILUA 3UUNA 4U74A 5H6QB 4GK5E 5JREA 4QX8B 2BDEA 3DTOA 3IF8B 1YKHB 4OHFA 4DBRA 2KT9A 2JMHA 2V7LA 2LJLA 2UXNB 1IJ6A 1YW0A 4EOZB 3SWHA 2YEVC 2NWBA 4YHJA 3C4XA 4QXCB 1G73A 3TKLB 5ADXL 4O8SA 2A72A 4L5GA 1WLXA 2JMKA 3FXEB 2DHRA 4P0AA 5JDFA 1MIWA 3NZQA 1FMWA 3QK6A 5LA6E 2MTQA 3F57A 4M1PA 5F8PA 5L3BB 4PK4A 2DWGA 4HEAA 4BAYB 1MMDA 2LHNA 4H9PC 4TV9E 2WAUA 1U4QA 4H63H 1BR2A 4MALA 3AAAB 1D0XA 3OYXA 4UVCB 3F31A 5JQGE 5IYZE 3MZKB 2LSYA 4KP3C 3PDYA 2A3DA 2QA7A 3CQXC 2J1DG 4JUYA 5EK2A 3ETVA 3HKCE 3HR0A 5LNKA 1AJ3A 3E22E 4PFOA 4DMWA 2CCQA 2KXPB 4UIGA 3Q2MA 3FBLA 2WM9A 4TZ4C 3WI3A 1UX5A 2JRKA 2D0TA 4IDZA 3AAIA 1BR0A 3RPUA 4KMCA 3HL6A 2VKOA 3HA4A 3MXZA 5HAXA 1X79A 3PE0A 4P09A 2W00A 2Q9QB 2KLQA 5LGUB 5LXTE 5HXEA 4EYUA 4P0BA 5LGNB 4U72A 3ZC1A 5HXRA 2KINB 2DI4A 2CXLA 2KZ7B 4AXPA 2LE8A 2MBGA 1WR6A 2DCFA 4NUVA 4ISSA 4X1IE 1EZ3A 2NTXA 2A2FX 2NTYA 3AAEB 1Z0PA 2KWHA 1ZV4X 4GOUA 5LP6E 2VL8A 3KV4A 5HWXA 4L9IA 3FXDB 2Y48B 3RC8A 4AQFC 1D1CA 5FXXA 4G63A 4H9QC 2XAJB 4CXYA 4PJMA 3DJBA 3SS1A 5FY0A 2P9BA 5LBMA 4B6XA 5L3GB 3C50A 1U5PA 1KK7A 3FBZA 3KVBA 5CB4E 4ASKA 2SPCA 3KV9A 4K0UA 3ZJ1A 1BR1A 1LKXA 3MA9A 1IZNB 4J2CA 2RA1A 5LOVE 5LG4A 4UVBB 4GYRA 4YJ3E 1WRDA 4AKRB 1UCUA 2KMFA 4AQFA 5JDHA 2H3RA 4OYKA 3CQGB 2VKDA 4JLEA 1OWAA 5L3DB 2Y8DA 4IGUA 1US7B 2CXFA 2XAFB 4OYJA 2ACXA 4QHOA 3ZMSB 3CMLA 3ZYMA 5KDMC 5JR9A 3KBUA 3T8OA 3N2KE 2WMNA 3L09A 3LFMA 2V1DB 3UUXB 2DWKA 4PJJA 4EZ4A 1IAPA 3J9X1 2NW8A 2V7JA 5FMNA 2MOZA 3OKQA 1T98A 5FYMA 2C5JA 3ETUA 4ANJA 5TAOA 2CMRA 2ODVA 2YINA 3CVRA 3K3OA 2LHRA 4V1Av 2ZM8A 3RYIE 2OA5A 2VK9A 5DABA 5JR9C 2M67A 4H9NC 3SRZA 4AKGA 2E8IA 3GMIA 3EDUA 1HTJF 5EZYE 5JRCA 4CI3B 3F2EA 5LYJE 2KWIB 4G2AA 4CI2B 2LSKA 1MIVA 2W63A 2YU2A 3Q9DA 3MACA 3N5LA 3CX6B 3LJCA 4HFVA 1SHZC 2NP9A 4MLKA 5LHGB 2NOXA 4GK0E 1HCIA 4A56A 2H7OA 5C8YE 1FEWA 2CA5A 4HTEA 3KV5A 2K48A 3O4XE 2XTLA 2Q9QD 3S4UA 3WAJA 3O1JA 4I43B 5LBQB 1MIYA 4UF0B 2EHOA 4YLHA 3RRCA 2LOSA 2ZMAA 3O1HA 1FIOA 2C0SA 4FJOA 5EK3A 1V9DA 4QKNA 3LK42 2XAHB 2ZM0A 3AB3B 4PFPA 4TV8E 1BR4A 3M65A 2JJ9A 4N78D 4XZCA 4BA9A 1D0ZA 1D0YA 2L3LA 4OFZA 1HF8A 1LVFA 4PJNA 3P8CD 3IHRA 1UX4A 3V5UA 4EXTA 2LSIA 4E7ZA 2EHOC 4XAXB 3VHLA 3LK3B 4PK6A 2PG8A 2MYSA 4HE8A 5LHIB 3I0OA 3CWZB 4DNDA 4YJ2E 4C90A 2CM0A 2ZLYA 4QXBB 3OBVE 4MFRA 1O3XA 3R6NA 4TN7B 3AVRA 1IJ5A 3ESLA 3PUGA 4GIWA 3LG7A 4PW8A 4Z8XA 2IC6A 2G0UA 4TUYE 3ANWB 2CXDA 2V26A 3I9WA 4JEHB 1QUUA 4EAHA 3R84B 4AKHA 3NZPA 5M4YA 5FNVE 5CA0E 3BQIA 3C64A 5JR9B 4QX7B 2RP4A 4C91A 3RYFE 2NW7A 2IAKA 3HI2A 3GA8A 4WBOA 5FXZA 3RC3A 3MK7C 2L9QA 2WBLA 4NUUA 4AI6A 5HXSA 3ZMTB 3CX7B 3ZCJA 4E7SA 4PJLA 5L2LA 3KV6A 3GN5A 4BJMA 4EZHA 5A1LA 5L3EB 4PAGA 2X0LB 5L3FB 2D5UA 4TX5A 3Q5XA 2XUEA 3V5SA 4IHJE 4L0RA 3NBXX 2WSSV 2K5BB 2D2SA 5LJMA 5FXWA 4X1KE 3FHNA 5JDMA 3GN5B 2UXXB 3PUSA 5LHHB 3PU8A 4CI1B 2CLYC 3N9OA 3LK2B 4KUMB 4UELA 4GYSA 1MNDA 4UVAB 3RRWA 3UUMA 2X9HA 3FB2A 2EHOD 3ZEFB 2YU1A 2WWUA 4EB6E 4H9OC 5FY1A 3BK9A 4X20E 5LCYA 3D0TA 4CXWA 4ZI7E 5J2TE 3QC9A 3N9PA 2E9XB 5JRCB 2JQQA 2I59A 2LSGA 2LT3A 3C4ZA 3GWHA 4ZI2D 5FP3A 4MHCA 5E0OA 5JDNA 3W15B 2ODUA 3N9LA 1S35A 3PUAA 5HWYA 3ZLIA 1ZKEA 4DMVA 5BMVE 3MKDA 3J7Yq 4ZS2A 3UFEA 3Q5WA 3EUHA 2W62A 2JPFA 4O4LE 4PK5A 4F6RC 1FMVA 2N9DA 2E9XD 2XAQB 2X9YA 2CWOA 4ZI3C 1HS7A 2V7MA 3E08A 3VKHA 3CX8B 4OK0A 3RKOA 4QWNB 3K3QC 3BQLA 4UEMA 3H37A 2X68A 1QSDA 4IIJE 2VKJA 3KINB 4IE0A 2K9AA 4WNKA 1HG5A 3ONXA 3RYCE 3JC6C 3LBXB 2GK9A 2IW5B 3I0QA 2PJQA 1YD8G 3KFWX 3EVYA 3QUJA 3PUQA 1WYBA 3PU3A 3JC6D 2C5KT 2V7KA 4I55E 4CQIA 3LBXA 4QXHB 5DQVA 1D1AA 3ZJ2A 3C98B 4I50E 2LSJA 3ZN0B 4IE5A 5F3JA 3IEEA 2QGSA 2PFVA 3B13A 3N9NA 1KNZA 4DO0A 2LM9A 5LJNA 1SA0E 1S94A 5KX5E 1LRZA 3HKBE 2LOPA 3OJAA 3OYZA 4O4JE 5KMGP 2CLYB 4DBQA 3A5XA 4PNIA 4H9RC 4IE4A 5AFUL 5ETWA 4ADZA 3C4WA 4IE7A 3L3PA 4ISTA 2BZBA 2XQYA 1HG2A 3NRXA 2XHEB 5JVDE 3AA6B 4EIWA 2PBIA 4YFSA 5J2UE 2E9XC 2YK0A 3NRYA 1HX8A 3KVAA 4ERRA 2Z6EA 4WW0A 2IC9A 4CXXA 5DJQC 3ZPOA 4H63V 1MMGA 4DVDA 3KBTA 3K8PC 3ZMVB 2HH7A 1CUNA 3AA0B 1H7CA 2N1GA 2H7VC 1G8XA 3ZYLA 2E9XA 3RH3A 5FY7A 3N2OA 4XBFB 3ZMZB 4ZOLE 3DP7A 3N9QA 4O2BE 5DQWA 5JDGA 3I9YA 1VOMA 3O1IA 3P7IA 2XAGB 1MMAA 4UF0A 3CQCB 4ZS3A 2CE7A 2EHOB 3PTRB 4AKLA 1VRBA 1NAFA 4UXNB 2ZM2A 2D0UA 4IE6A 3ZC0A 2XASB 3K3NA 3SOLA 3ZMUB 3WAKA 2KNDA 2B1EA 1HFAA 3KDSE 3VU7H 5J1GA 4ZI3D 5CA1E 2VASA 1YKEB 1LVKA 2Q9QA 3ZYKA 5JDLA 3C51A 2L8KA 5JDQA 5L3CB 2VB6A 2BVMA 4O4HE 1NWMX 1Y64B 5JH7E 3AA1B 1OXZA 2HPJA 3RYHE 3UTKA 4O2AE 3ZCIA 3H3AA 4KBMB 5LGTB 3UT5E 1ZHCA 3AVSA 4AQGA 2BVLA 2X67A 2Q9QC 4JEUB 3U78A 2LEHA 2W61A 3HKEE 4BJNA 3N2GE 3B57A 3IBPA 4MBQA 3RX6A 1WYCA 5GONE 2N2NA 2WMOA 2HPLA 2X9XA 3CPZA 2W0GA 1MMNA 2C5IT 3HKDE 2VWAA 4H9SE 4WBNE 3EDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N5L A;  3P7I A;  1LVF A;  1QSD A;  2CA5 A;  1IJ6 A;  4EYY R;  2C5J A;  1LRZ A;  4L0R A;  4J2C A;  2IC9 A;  2K48 A;  2XTL A;  2MBG A;  3S4U A;  1Z0P A;  2KWH A;  3CVR A;  3TKL B;  1H7C A;  3CKD A;  1ZKE A;  3FXE B;  3FXD B;  4DND A;  3QUJ A;  2X9X A;  4FI5 A;  3QK6 A;  2C5K T;  2X9Y A;  3L3P A;  2C5I T;  2X9W A;  1IJ5 A;  2KWI B;  4CQI A;  3MXZ A;  2IC6 A;  4B6X A;  2G0U A; 
#chains in the Genus database with same CATH topology
 3O9X A;  5AQP B;  3VKG A;  2R6G F;  1KEY A;  1JNZ A;  4UV9 B;  1D1B A;  3EAM A;  2VKH A;  1B7T A;  4I4T E;  3E0Z A;  3CK6 A;  3MJX A;  4O4I E;  5H6R B;  4ZI2 C;  3PUR A;  2W4X A;  1XDP A;  4HN9 A;  2KSR A;  2X51 A;  5EK4 A;  4KX6 A;  2LKG A;  4CZZ B;  1J5E T;  2V7I A;  3OPC A;  3OVU A;  3RIF A;  4EYY R;  4ZZB A;  2FBW A;  2W2U A;  2X66 A;  2ES0 A;  4P1N A;  3NVO A;  5FXV A;  4ZHQ E;  4TNW A;  4X64 T;  3UUL A;  4LFA T;  3ANW A;  3AA7 B;  2V6X A;  3CIR A;  3I1A A;  3P50 A;  1WR0 A;  3U3I A;  4HKA A;  2CWY A;  5IHY A;  5AQU B;  2DLR A;  4TWD A;  3CKD A;  5FVK A;  2NW9 A;  5AQS B;  2XQ8 A;  2XPK A;  4UV8 B;  3N9M A;  3PV0 F;  4AIS A;  3BQK A;  4FI5 A;  2DNX A;  4X1Y E;  4ZEY A;  3VR9 A;  2Y6X A;  1M7K A;  4LF6 T;  1E2A A;  4YT0 A;  2X9W A;  4HGA A;  4LFC T;  2WDR A;  3ZN1 B;  2K24 A;  2VVN A;  5HXC A;  1MNE A;  2OV9 A;  1E1H B;  1ZEE A;  3UQ4 A;  4DR3 T;  5AQI B;  2CEA A;  4DR5 T;  4ILU A;  3UUN A;  1W0B A;  4U74 A;  5H6Q B;  4GK5 E;  5HYA A;  5JRE A;  4QX8 B;  4CN6 A;  1J1J A;  2BDE A;  2LRL A;  3DTO A;  3IF8 B;  1YKH B;  4OHF A;  4DBR A;  2KT9 A;  2JMH A;  2V7L A;  2LJL A;  3NKZ A;  1YQ4 A;  1VCT A;  2UXN B;  1IJ6 A;  1YW0 A;  4QH4 A;  1IBL T;  4ILC A;  3A8Y C;  4EOZ B;  3SWH A;  3RIU A;  5HXH A;  2I0M A;  2YEV C;  2YOE A;  2NWB A;  4YHJ A;  3C4X A;  2NR4 A;  1G73 A;  4QXC B;  5AQQ B;  4O8S A;  3TKL B;  3UU3 A;  5CJ5 A;  5ADX L;  2A72 A;  4L5G A;  1WLX A;  2JMK A;  3FXE B;  4B3R T;  2DHR A;  4P0A A;  5JDF A;  1MIW A;  3NZQ A;  1FMW A;  3QK6 A;  5LMN T;  5LA6 E;  2MTQ A;  3F57 A;  4NXN T;  2J62 A;  1QLB A;  4M1P A;  5F8P A;  5L3B B;  4PK4 A;  4JI0 T;  2DWG A;  2QYW A;  4HEA A;  5FKY A;  4BAY B;  1XDO A;  1MMD A;  2LHN A;  3AE4 A;  4IT4 A;  4JI3 T;  4H9P C;  4TV9 E;  5ABH A;  4DV5 T;  2PTF A;  2WAU A;  1U4Q A;  2XZE A;  4UR9 A;  4H63 H;  1BR2 A;  5AQJ B;  4MAL A;  4CN4 A;  3AAA B;  4HWD A;  3RIU C;  2UUC T;  1D0X A;  3OYX A;  4DID B;  4UVC B;  3F31 A;  4X5T A;  5FVL A;  5IYZ E;  5JQG E;  3MZK B;  2LSY A;  4KP3 C;  3PDY A;  2A3D A;  2QA7 A;  3AXJ B;  2J1D G;  3CQX C;  4JUY A;  3ETV A;  3HKC E;  3VR8 A;  5EK2 A;  2BBH A;  3HR0 A;  3ZST A;  5LNK A;  3E22 E;  1AJ3 A;  4PFO A;  4DMW A;  3FZL B;  4DV1 T;  2CCQ A;  2KXP B;  4UIG A;  2IHR 1;  3Q2M A;  2VUR A;  2WQY A;  3FBL A;  2WM9 A;  2FJD A;  4TZ4 C;  3WI3 A;  1UX5 A;  2JRK A;  1WFD A;  4U2Z A;  2D0T A;  4IDZ A;  4ZXL A;  3AAI A;  4JYA T;  1BR0 A;  3RPU A;  4KMC A;  3HL6 A;  4HFH A;  2VKO A;  3HA4 A;  3MXZ A;  5HAX A;  2AE9 A;  3P4Q A;  1X79 A;  3PE0 A;  4I0U A;  2W00 A;  4P09 A;  4U2Y A;  2Q9Q B;  2KLQ A;  5LGU B;  5LXT E;  5HXE A;  3FZF B;  4EYU A;  4P0B A;  3TLV A;  5LGN B;  4EEB A;  4U72 A;  3ZC1 A;  5HXR A;  2KIN B;  2DI4 A;  3UFG A;  5L4E A;  2CXL A;  3VRB A;  2KZ7 B;  4AXP A;  3ONL C;  2LE8 A;  2MBG A;  3JAE A;  1N32 T;  1WR6 A;  2DCF A;  4NUV A;  4ISS A;  4X1I E;  4X62 T;  1EZ3 A;  2NTX A;  1SE7 A;  2A2F X;  4JI5 T;  2CPT A;  2NTY A;  1Z0P A;  2KWH A;  1ZV4 X;  3AAE B;  4GOU A;  5LP6 E;  1XNR T;  2VL8 A;  2CHO A;  1UK5 A;  3KV4 A;  5HWX A;  4L9I A;  3FXD B;  4TNV A;  3B5M A;  2Y48 B;  3G06 A;  1XMO T;  2WCA A;  2IDO B;  3RC8 A;  4AQF C;  1D1C A;  5FXX A;  2D9D A;  4G63 A;  2WZH A;  4H9Q C;  2VQF T;  1W09 A;  2XAJ B;  3RQU A;  4CXY A;  4PJM A;  3ZSS A;  3DJB A;  3SS1 A;  5FY0 A;  2P9B A;  5LBM A;  4B6X A;  5L3G B;  3C50 A;  1U5P A;  5AQR B;  5HEG A;  1W0A A;  1KK7 A;  3FBZ A;  3KVB A;  3QB5 A;  5CGM A;  5CB4 E;  3ZLI A;  4ASK A;  5BMV E;  2SPC A;  2QVA A;  3KV9 A;  1I6Z A;  4K0U A;  3ZJ1 A;  1BR1 A;  1LKX A;  2J4G A;  2XJ7 A;  3JAD A;  3MA9 A;  1IZN B;  4J2C A;  2RA1 A;  2J47 A;  2K3W A;  2VL0 A;  3AEB A;  5AQH B;  5LOV E;  4UVB B;  4GYR A;  4YJ3 E;  5LG4 A;  1WRD A;  3AE6 A;  4AKR B;  2YKS A;  2VQE T;  4ILB A;  1UCU A;  2KMF A;  4DR4 T;  4AQF A;  1T7S A;  5J0Z A;  1KNP A;  2H3R A;  5HCJ A;  1R8I A;  5JDH A;  4X65 T;  4OYK A;  2JQ9 A;  3CQG B;  2ACZ A;  3PUV F;  2BBJ A;  2VKD A;  4JLE A;  1I94 T;  1OWA A;  5L3D B;  1UUR A;  2Y8D A;  2LRK A;  1US7 B;  2CXF A;  2WP9 A;  2XAF B;  2ACX A;  4IGU A;  4OYJ A;  3CML A;  4QHO A;  3ZYM A;  2UUA T;  5KDM C;  5JR9 A;  3KBU A;  3T8O A;  3UU8 A;  1HNW T;  3N2K E;  2WMN A;  4ZI3 D;  2BS3 A;  2X0Y A;  3L09 A;  3LFM A;  3AEF A;  4LF8 T;  3UU4 A;  5IUX A;  2V1D B;  3TLU A;  3UUX B;  2DWK A;  4PJJ A;  4EZ4 A;  1IAP A;  3J9X 1;  2NW8 A;  2V7J A;  5FMN A;  4LF7 T;  2MOZ A;  1M62 A;  3OKQ A;  4EV6 A;  1T98 A;  5FYM A;  4LFB T;  4QH5 A;  2C5J A;  3ETU A;  1T8B A;  2HN2 A;  4ANJ A;  5TAO A;  2CMR A;  2ODV A;  2YIN A;  2WU5 A;  3CVR A;  2LHR A;  3K3O A;  4V1A v;  2MPK A;  2ZM8 A;  3RYI E;  3X1D A;  4A5X A;  2OA5 A;  2FJA A;  5ABE A;  4DV4 T;  2VK9 A;  5DAB A;  5JR9 C;  4HFB A;  2M67 A;  2W66 A;  4H9N C;  3SRZ A;  4AKG A;  2E8I A;  3GMI A;  3EDU A;  1HTJ F;  1UGO A;  5EZY E;  5JRC A;  2CHN A;  3F2E A;  1GQE A;  3TLW A;  2KWI B;  4CI3 B;  5LYJ E;  4G2A A;  4CI2 B;  2LSK A;  2X0H A;  1MIV A;  2B76 A;  2W63 A;  2YU2 A;  1L0V A;  3UU6 A;  4YTP A;  3Q9D A;  3Q5D A;  3MAC A;  3N5L A;  3CX6 B;  3LJC A;  4HFV A;  2IIU A;  5AQK B;  1SHZ C;  2NP9 A;  4MLK A;  2DL1 A;  2NOX A;  5LHG B;  4GK0 E;  1HCI A;  4A56 A;  2H7O A;  2BS2 A;  5C8Y E;  1FEW A;  2CA5 A;  3PJA J;  3RGL A;  2XQ6 A;  4HTE A;  4YSX A;  3T1H T;  3KV5 A;  2K48 A;  3O4X E;  2XTL A;  2Q9Q D;  5AQF B;  4B3S T;  3S4U A;  3WAJ A;  3O1J A;  4I43 B;  5LBQ B;  1UUS A;  1MIY A;  4UF0 B;  3TLS A;  2EHO A;  5AQL B;  4YLH A;  3RRC A;  2LOS A;  2ZMA A;  3AE1 A;  4HWH A;  3FZH B;  3O1H A;  4B3M T;  5BR8 T;  1FIO A;  2C0S A;  4FJO A;  5EK3 A;  2JIW A;  3AE7 A;  1V9D A;  4QKN A;  3LK4 2;  1OED B;  2XAH B;  2ZM0 A;  4OX9 T;  3PUX F;  4HWF A;  2BKO A;  3AB3 B;  3QNU A;  4IRE A;  4PFP A;  1YQ3 A;  3TLT A;  4IDO A;  2OLT A;  5L47 A;  4TV8 E;  1BR4 A;  1SUM B;  2JJ9 A;  3M65 A;  4N78 D;  4XZC A;  4BA9 A;  1D0Z A;  1D0Y A;  3EHZ A;  2L3L A;  4OFZ A;  1HF8 A;  1LVF A;  4PJN A;  4AIU A;  5FL1 A;  3P8C D;  3IHR A;  1UX4 A;  3V5U A;  4EXT A;  3RIA A;  2LSI A;  1HNX T;  4LF9 T;  4E7Z A;  4U3C A;  4NPP A;  5C2T A;  2EHO C;  4XAX B;  3VHL A;  3LK3 B;  4PK6 A;  2PG8 A;  4LMK A;  4LML A;  2MYS A;  5L4H A;  4HE8 A;  5LHI B;  3I0O A;  4YSZ A;  3CWZ B;  4DND A;  4YJ2 E;  4C90 A;  2BG9 B;  2CM0 A;  4HFD A;  2ZLY A;  4QXB B;  4F6R C;  3OBV E;  4MFR A;  1O3X A;  3R6N A;  4TN7 B;  3AVR A;  1IJ5 A;  3ESL A;  3PUG A;  4GIW A;  3LG7 A;  4PW8 A;  5CFB A;  2F4V T;  4Z8X A;  2IC6 A;  2G0U A;  4TUY E;  2CXD A;  3ANW B;  3JCF A;  2V26 A;  4ILA A;  3RHW A;  3I9W A;  4JEH B;  1QUU A;  2YN6 A;  4EAH A;  3R84 B;  4AKH A;  4WZX A;  4GKJ T;  2FJB A;  2IML A;  3NZP A;  5M4Y A;  1FJG T;  3AEA A;  5FNV E;  5CA0 E;  1J5W A;  2YDR A;  3BQI A;  1NEK A;  5HEH A;  3AE2 A;  4JI8 T;  3C64 A;  4K0K T;  5JR9 B;  4QX7 B;  2RP4 A;  4C91 A;  5AQT B;  4JI2 T;  3ZKR A;  3RYF E;  2NW7 A;  2IAK A;  3AE5 A;  3HI2 A;  4Z91 A;  2M6B A;  2LLY A;  3GA8 A;  4WBO A;  5FXZ A;  3RC3 A;  3MK7 C;  2WDV A;  2YDQ A;  2FJE A;  4NXM T;  2BKN A;  2L9Q A;  4JI7 T;  3ZMS B;  2WBL A;  4NUU A;  4AI6 A;  2I6H A;  4ZZC A;  5C3J A;  4AKI A;  5HXS A;  3ZMT B;  3CX7 B;  3ZCJ A;  4E7S A;  4PJL A;  5L2L A;  1ZP0 A;  3GN5 A;  3KV6 A;  3RI5 A;  4BJM A;  4EZH A;  4PAG A;  2X0L B;  5A1L A;  5L3E B;  5L3F B;  2D5U A;  4TX5 A;  3Q5X A;  1IBM T;  2XUE A;  4JBW F;  5AQG B;  3V5S A;  4IHJ E;  4L0R A;  3NBX X;  4X66 T;  2WSS V;  1X9B A;  3PUW F;  2K5B B;  2D2S A;  5LJM A;  4A98 A;  5FXW A;  4LF5 T;  4X1K E;  1E7P A;  2XSB A;  3FHN A;  5JDM A;  3GN5 B;  3PJA A;  2E5V A;  4CN1 A;  2UXX B;  4HWI B;  3PUS A;  1ZOY A;  3PU8 A;  2M6I A;  5LHH B;  4CI1 B;  3ABV A;  2CLY C;  2WWV A;  3N9O A;  3LK2 B;  4KUM B;  4UEL A;  3UU5 A;  4TWF A;  2JQK A;  3A7M A;  1MND A;  2V5D A;  4GYS A;  3P4W A;  4UVA B;  3RRW A;  2X9H A;  3AXJ A;  3FB2 A;  2EHO D;  3UUM A;  2YU1 A;  4IDQ A;  2WWU A;  3ZEF B;  4EB6 E;  5LB7 B;  4DR6 T;  4H9O C;  2CBJ A;  3BK9 A;  3L39 A;  4X20 E;  3AEC A;  5FY1 A;  3D0T A;  5LCY A;  5KXJ A;  4CXW A;  4DR7 T;  4ZI7 E;  5LG3 A;  1WCR A;  5J2T E;  3QC9 A;  4B3T T;  3N9P A;  2UXB T;  2E9X B;  3T1Y T;  2JQQ A;  5JRC B;  3FZM B;  2XQA A;  4Q25 A;  5F5W A;  2I59 A;  2LSG A;  2LT3 A;  3C4Z A;  3GWH A;  4ZI2 D;  1XZY A;  5FP3 A;  4MHC A;  5E0O A;  5JDN A;  2VVS A;  3RF1 A;  3W15 B;  2ODU A;  3N9L A;  1S35 A;  1KF6 A;  3AE3 A;  3PUA A;  1ZKE A;  3PUY F;  5HWY A;  3MKD A;  4DMV A;  3J7Y q;  4ZS2 A;  3UFE A;  3Q5W A;  3EUH A;  2W62 A;  2JPF A;  4O4L E;  4PK5 A;  3RKG A;  3ZT6 A;  1FMV A;  4HFC A;  2N9D A;  2E9X D;  2XAQ B;  2XM1 A;  2X9Y A;  2CWO A;  3JAF A;  4F8H A;  4ZI3 C;  5JTG A;  5LMU T;  1HS7 A;  2V7M A;  3E08 A;  3AE9 A;  3VKH A;  4HFE A;  3CX8 B;  2V6Y A;  4OK0 A;  2LKH A;  3RKO A;  2WU2 A;  2E2A A;  4JI1 T;  2UXD T;  4QWN B;  2XM2 A;  5AQO B;  3K3Q C;  4HFI A;  5ABG A;  2LM2 A;  3BQL A;  3H37 A;  2X68 A;  1QSD A;  4IL9 A;  4IIJ E;  2MAW A;  2VKJ A;  4UEM A;  3KIN B;  4QH1 A;  1OED A;  4IE0 A;  2BG9 C;  2K9A A;  4WNK A;  3H3M A;  1HG5 A;  2WS3 A;  3ONX A;  3RYC E;  3JC6 C;  3LBX B;  4DV2 T;  2E5L T;  1Z8U A;  2GK9 A;  2IW5 B;  3I0Q A;  5AQN B;  2PJQ A;  1OED E;  1YD8 G;  3KFW X;  3EVY A;  3SFD A;  4DV7 T;  3QUJ A;  3PUQ A;  4NIQ A;  1WYB A;  3P4S A;  3PU3 A;  4U7I A;  1JNR A;  4WYV A;  2RPA A;  3JC6 D;  2C5K T;  2V7K A;  4U31 A;  4DV3 T;  2ZM6 T;  4AQY T;  3IA3 A;  4I55 E;  4YY3 T;  4CQI A;  3LBX A;  4QXH B;  5DQV A;  1D1A A;  3ZJ2 A;  3C98 B;  4I50 E;  2LSJ A;  3ZN0 B;  4IE5 A;  1OED C;  5F3J A;  3IEE A;  2BG9 A;  4COF A;  2QGS A;  2PFV A;  3B13 A;  3N9N A;  5AQM B;  1KNZ A;  4KI0 F;  5AQV B;  1YXR A;  2XSA A;  4DO0 A;  2LM9 A;  4EED A;  5LJN A;  1SA0 E;  1S94 A;  5KX5 E;  1LRZ A;  3HKB E;  4DR1 T;  2LOP A;  5HEU A;  3UUB A;  3OJA A;  3OYZ A;  4O4J E;  1T72 A;  5KMG P;  4LF4 T;  2CLY B;  5HEO A;  4DBQ A;  3A5X A;  4PNI A;  3NWI A;  4H9R C;  5FL0 A;  4IE4 A;  5AFU L;  4U7Y A;  4YHH T;  2YDS A;  5HEJ A;  5ETW A;  3OTO T;  4ADZ A;  3C4W A;  4IE7 A;  3L3P A;  4IL4 A;  2BZB A;  2XQY A;  2WZI A;  4IST A;  1HG2 A;  3NRX A;  2XHE B;  5JVD E;  3AEE A;  3AED A;  3AA6 B;  4DR2 T;  4EIW A;  2PBI A;  4YFS A;  4KHP T;  3FZK B;  5J2U E;  1VCS A;  2E9X C;  3LDQ B;  2YK0 A;  2BS4 A;  3NRY A;  2BKP A;  3VRA A;  2UU9 T;  4IDN A;  1HX8 A;  3KVA A;  4ERR A;  2AXD S;  2Z6E A;  2WY2 A;  2XQ7 A;  5HCM A;  4WW0 A;  2IC9 A;  4CXX A;  5DJQ C;  1HR0 T;  3ZPO A;  1HX1 B;  4H63 V;  1MMG A;  4DVD A;  3KBT A;  3K8P C;  1HNZ T;  4JI6 T;  3ZMV B;  2HH7 A;  1CUN A;  2W67 A;  3AA0 B;  4DV0 T;  1H7C A;  3EI0 A;  2N1G A;  1XMQ T;  2H7V C;  1G8X A;  3Q5E A;  4IDP A;  3ZYL A;  2E9X A;  3RH3 A;  4YTN A;  5FY7 A;  5IWA T;  4JI4 T;  3N2O A;  4XBF B;  2V5C A;  3LSV A;  4ZOL E;  3DP7 A;  3EAB A;  3N9Q A;  4O2B E;  4Z90 A;  5DQW A;  3I9Y A;  3ZMZ B;  5JDG A;  1VOM A;  2CRB A;  2XQ5 A;  3O1I A;  3P7I A;  5CA1 E;  4DUZ T;  4EGW A;  2XAG B;  1MMA A;  1N34 T;  4UF0 A;  3CQC B;  4ZS3 A;  2CE7 A;  2EHO B;  2QRX A;  3PTR B;  1VRB A;  3P4P A;  2CBI A;  4TWH A;  4AKL A;  1NAF A;  3RLF F;  3SFE A;  4UXN B;  2A9U A;  2XQ4 A;  1KFY A;  3QB5 K;  2ZM2 A;  2D0U A;  4IE6 A;  3RQW A;  2XAS B;  1XWM A;  3ZC0 A;  1CHU A;  1N33 T;  3K3N A;  3SOL A;  3ZMU B;  3WAK A;  2KND A;  2B1E A;  1HFA A;  3KDS E;  3P4R A;  5J1G A;  3VU7 H;  3L8R A;  3ZT7 A;  2VAS A;  1W9R A;  1YKE B;  4KHZ F;  1LVK A;  2Q9Q A;  3ZYK A;  2WB5 A;  4YXD A;  5JDL A;  4DV6 T;  4GKK T;  3C51 A;  2FUP A;  2L8K A;  5JDQ A;  5L3C B;  2BVM A;  2VB6 A;  4O4H E;  1N36 T;  2XY8 B;  1NWM X;  1Y64 B;  5JH7 E;  3AA1 B;  1DU2 A;  1OXZ A;  2HPJ A;  3RYH E;  3UTK A;  4O2A E;  3ZCI A;  3H3A A;  4KBM B;  5LGT B;  3UT5 E;  1ZHC A;  2XQ3 A;  2UXC T;  2V8S V;  3AVS A;  4AQG A;  2BVL A;  1Y01 A;  2XQ9 A;  5ABF B;  2X67 A;  2H88 A;  2H89 A;  3ZT5 A;  1NEN A;  4LMJ A;  1XNQ T;  2Q9Q C;  4JEU B;  3U78 A;  2LEH A;  2W61 A;  3HKE E;  4BJN A;  2V6Y B;  3N2G E;  4U33 A;  3B57 A;  3IBP A;  4MBQ A;  3RX6 A;  4DUY T;  3ONJ A;  5ABF A;  2JQH A;  1WYC A;  5GON E;  4JV5 T;  2N2N A;  2WMO A;  3AEG A;  3UQ7 A;  2HPL A;  3M3Z B;  3AE8 A;  2X9X A;  3CPZ A;  3PUZ F;  2W0G A;  4A97 A;  1MMN A;  3QOF A;  2C5I T;  3HKD E;  4YSY A;  2VWA A;  2WDQ A;  4H9S E;  4HWC A;  3EDV A;  4WBN E;  1IBK T;  1KNR A;  2BG9 E;  2HN1 A;  3K1S A;  2HHH T;  2UUB T;  2IUB A;  4YTM A; 
#chains in the Genus database with same CATH homology
 3O9X A;  3VKG A;  4UV9 B;  1D1B A;  4I4T E;  2VKH A;  1B7T A;  4O4I E;  3E0Z A;  3MJX A;  5H6R B;  4ZI2 C;  5HXH A;  3PUR A;  4HN9 A;  5EK4 A;  2X51 A;  4CZZ B;  4AKI A;  2V7I A;  4EYY R;  5HYA A;  4ZHQ E;  2X66 A;  5FXV A;  2ES0 A;  3UUL A;  3ANW A;  3AA7 B;  3I1A A;  3U3I A;  4HKA A;  2CWY A;  5IHY A;  2DLR A;  2NW9 A;  3CKD A;  4UV8 B;  3N9M A;  3BQK A;  4FI5 A;  2DNX A;  4X1Y E;  2Y6X A;  2X9W A;  4HGA A;  3ZN1 B;  2K24 A;  5HXC A;  1MNE A;  1E1H B;  1ZEE A;  2CEA A;  4ILU A;  3UUN A;  4U74 A;  5H6Q B;  4GK5 E;  5JRE A;  4QX8 B;  2BDE A;  3DTO A;  3IF8 B;  1YKH B;  4OHF A;  4DBR A;  2KT9 A;  2JMH A;  2V7L A;  2LJL A;  2UXN B;  1IJ6 A;  1YW0 A;  4EOZ B;  3SWH A;  2YEV C;  2NWB A;  4YHJ A;  3C4X A;  4QXC B;  1G73 A;  3TKL B;  5ADX L;  4O8S A;  2A72 A;  4L5G A;  1WLX A;  2JMK A;  3FXE B;  2DHR A;  4P0A A;  5JDF A;  1MIW A;  3NZQ A;  1FMW A;  3QK6 A;  5LA6 E;  2MTQ A;  3F57 A;  4M1P A;  5F8P A;  5L3B B;  4PK4 A;  2DWG A;  4HEA A;  4BAY B;  1MMD A;  2LHN A;  4H9P C;  4TV9 E;  2WAU A;  1U4Q A;  4H63 H;  1BR2 A;  4MAL A;  3AAA B;  1D0X A;  3OYX A;  4UVC B;  3F31 A;  5JQG E;  5IYZ E;  3MZK B;  2LSY A;  4KP3 C;  3PDY A;  2A3D A;  2QA7 A;  3CQX C;  2J1D G;  4JUY A;  5EK2 A;  3ETV A;  3HKC E;  3HR0 A;  5LNK A;  1AJ3 A;  3E22 E;  4PFO A;  4DMW A;  2CCQ A;  2KXP B;  4UIG A;  3Q2M A;  3FBL A;  2WM9 A;  4TZ4 C;  3WI3 A;  1UX5 A;  2JRK A;  2D0T A;  4IDZ A;  3AAI A;  1BR0 A;  3RPU A;  4KMC A;  3HL6 A;  2VKO A;  3HA4 A;  3MXZ A;  5HAX A;  1X79 A;  3PE0 A;  4P09 A;  2W00 A;  2Q9Q B;  2KLQ A;  5LGU B;  5LXT E;  5HXE A;  4EYU A;  4P0B A;  5LGN B;  4U72 A;  3ZC1 A;  5HXR A;  2KIN B;  2DI4 A;  2CXL A;  2KZ7 B;  4AXP A;  2LE8 A;  2MBG A;  1WR6 A;  2DCF A;  4NUV A;  4ISS A;  4X1I E;  1EZ3 A;  2NTX A;  2A2F X;  2NTY A;  3AAE B;  1Z0P A;  2KWH A;  1ZV4 X;  4GOU A;  5LP6 E;  2VL8 A;  3KV4 A;  5HWX A;  4L9I A;  3FXD B;  2Y48 B;  3RC8 A;  4AQF C;  1D1C A;  5FXX A;  4G63 A;  4H9Q C;  2XAJ B;  4CXY A;  4PJM A;  3DJB A;  3SS1 A;  5FY0 A;  2P9B A;  5LBM A;  4B6X A;  5L3G B;  3C50 A;  1U5P A;  1KK7 A;  3FBZ A;  3KVB A;  5CB4 E;  4ASK A;  2SPC A;  3KV9 A;  4K0U A;  3ZJ1 A;  1BR1 A;  1LKX A;  3MA9 A;  1IZN B;  4J2C A;  2RA1 A;  5LOV E;  5LG4 A;  4UVB B;  4GYR A;  4YJ3 E;  1WRD A;  4AKR B;  1UCU A;  2KMF A;  4AQF A;  5JDH A;  2H3R A;  4OYK A;  3CQG B;  2VKD A;  4JLE A;  1OWA A;  5L3D B;  2Y8D A;  4IGU A;  1US7 B;  2CXF A;  2XAF B;  4OYJ A;  2ACX A;  4QHO A;  3ZMS B;  3CML A;  3ZYM A;  5KDM C;  5JR9 A;  3KBU A;  3T8O A;  3N2K E;  2WMN A;  3L09 A;  3LFM A;  2V1D B;  3UUX B;  2DWK A;  4PJJ A;  4EZ4 A;  1IAP A;  3J9X 1;  2NW8 A;  2V7J A;  5FMN A;  2MOZ A;  3OKQ A;  1T98 A;  5FYM A;  2C5J A;  3ETU A;  4ANJ A;  5TAO A;  2CMR A;  2ODV A;  2YIN A;  3CVR A;  3K3O A;  2LHR A;  4V1A v;  2ZM8 A;  3RYI E;  2OA5 A;  2VK9 A;  5DAB A;  5JR9 C;  2M67 A;  4H9N C;  3SRZ A;  4AKG A;  2E8I A;  3GMI A;  3EDU A;  1HTJ F;  5EZY E;  5JRC A;  4CI3 B;  3F2E A;  5LYJ E;  2KWI B;  4G2A A;  4CI2 B;  2LSK A;  1MIV A;  2W63 A;  2YU2 A;  3Q9D A;  3MAC A;  3N5L A;  3CX6 B;  3LJC A;  4HFV A;  1SHZ C;  2NP9 A;  4MLK A;  5LHG B;  2NOX A;  4GK0 E;  1HCI A;  4A56 A;  2H7O A;  5C8Y E;  1FEW A;  2CA5 A;  4HTE A;  3KV5 A;  2K48 A;  3O4X E;  2XTL A;  2Q9Q D;  3S4U A;  3WAJ A;  3O1J A;  4I43 B;  5LBQ B;  1MIY A;  4UF0 B;  2EHO A;  4YLH A;  3RRC A;  2LOS A;  2ZMA A;  3O1H A;  1FIO A;  2C0S A;  4FJO A;  5EK3 A;  1V9D A;  4QKN A;  3LK4 2;  2XAH B;  2ZM0 A;  3AB3 B;  4PFP A;  4TV8 E;  1BR4 A;  3M65 A;  2JJ9 A;  4N78 D;  4XZC A;  4BA9 A;  1D0Z A;  1D0Y A;  2L3L A;  4OFZ A;  1HF8 A;  1LVF A;  4PJN A;  3P8C D;  3IHR A;  1UX4 A;  3V5U A;  4EXT A;  2LSI A;  4E7Z A;  2EHO C;  4XAX B;  3VHL A;  3LK3 B;  4PK6 A;  2PG8 A;  2MYS A;  4HE8 A;  5LHI B;  3I0O A;  3CWZ B;  4DND A;  4YJ2 E;  4C90 A;  2CM0 A;  2ZLY A;  4QXB B;  3OBV E;  4MFR A;  1O3X A;  3R6N A;  4TN7 B;  3AVR A;  1IJ5 A;  3ESL A;  3PUG A;  4GIW A;  3LG7 A;  4PW8 A;  4Z8X A;  2IC6 A;  2G0U A;  4TUY E;  3ANW B;  2CXD A;  2V26 A;  3I9W A;  4JEH B;  1QUU A;  4EAH A;  3R84 B;  4AKH A;  3NZP A;  5M4Y A;  5FNV E;  5CA0 E;  3BQI A;  3C64 A;  5JR9 B;  4QX7 B;  2RP4 A;  4C91 A;  3RYF E;  2NW7 A;  2IAK A;  3HI2 A;  3GA8 A;  4WBO A;  5FXZ A;  3RC3 A;  3MK7 C;  2L9Q A;  2WBL A;  4NUU A;  4AI6 A;  5HXS A;  3ZMT B;  3CX7 B;  3ZCJ A;  4E7S A;  4PJL A;  5L2L A;  3KV6 A;  3GN5 A;  4BJM A;  4EZH A;  5A1L A;  5L3E B;  4PAG A;  2X0L B;  5L3F B;  2D5U A;  4TX5 A;  3Q5X A;  2XUE A;  3V5S A;  4IHJ E;  4L0R A;  3NBX X;  2WSS V;  2K5B B;  2D2S A;  5LJM A;  5FXW A;  4X1K E;  3FHN A;  5JDM A;  3GN5 B;  2UXX B;  3PUS A;  5LHH B;  3PU8 A;  4CI1 B;  2CLY C;  3N9O A;  3LK2 B;  4KUM B;  4UEL A;  4GYS A;  1MND A;  4UVA B;  3RRW A;  3UUM A;  2X9H A;  3FB2 A;  2EHO D;  3ZEF B;  2YU1 A;  2WWU A;  4EB6 E;  4H9O C;  5FY1 A;  3BK9 A;  4X20 E;  5LCY A;  3D0T A;  4CXW A;  4ZI7 E;  5J2T E;  3QC9 A;  3N9P A;  2E9X B;  5JRC B;  2JQQ A;  2I59 A;  2LSG A;  2LT3 A;  3C4Z A;  3GWH A;  4ZI2 D;  5FP3 A;  4MHC A;  5E0O A;  5JDN A;  3W15 B;  2ODU A;  3N9L A;  1S35 A;  3PUA A;  5HWY A;  3ZLI A;  1ZKE A;  4DMV A;  5BMV E;  3MKD A;  3J7Y q;  4ZS2 A;  3UFE A;  3Q5W A;  3EUH A;  2W62 A;  2JPF A;  4O4L E;  4PK5 A;  4F6R C;  1FMV A;  2N9D A;  2E9X D;  2XAQ B;  2X9Y A;  2CWO A;  4ZI3 C;  1HS7 A;  2V7M A;  3E08 A;  3VKH A;  3CX8 B;  4OK0 A;  3RKO A;  4QWN B;  3K3Q C;  3BQL A;  4UEM A;  3H37 A;  2X68 A;  1QSD A;  4IIJ E;  2VKJ A;  3KIN B;  4IE0 A;  2K9A A;  4WNK A;  1HG5 A;  3ONX A;  3RYC E;  3JC6 C;  3LBX B;  2GK9 A;  2IW5 B;  3I0Q A;  2PJQ A;  1YD8 G;  3KFW X;  3EVY A;  3QUJ A;  3PUQ A;  1WYB A;  3PU3 A;  3JC6 D;  2C5K T;  2V7K A;  4I55 E;  4CQI A;  3LBX A;  4QXH B;  5DQV A;  1D1A A;  3ZJ2 A;  3C98 B;  4I50 E;  2LSJ A;  3ZN0 B;  4IE5 A;  5F3J A;  3IEE A;  2QGS A;  2PFV A;  3B13 A;  3N9N A;  1KNZ A;  4DO0 A;  2LM9 A;  5LJN A;  1SA0 E;  1S94 A;  5KX5 E;  1LRZ A;  3HKB E;  2LOP A;  3OJA A;  3OYZ A;  4O4J E;  5KMG P;  2CLY B;  4DBQ A;  3A5X A;  4PNI A;  4H9R C;  4IE4 A;  5AFU L;  5ETW A;  4ADZ A;  3C4W A;  4IE7 A;  3L3P A;  4IST A;  2BZB A;  2XQY A;  1HG2 A;  3NRX A;  2XHE B;  5JVD E;  3AA6 B;  4EIW A;  2PBI A;  4YFS A;  5J2U E;  2E9X C;  2YK0 A;  3NRY A;  1HX8 A;  3KVA A;  4ERR A;  2Z6E A;  4WW0 A;  2IC9 A;  4CXX A;  5DJQ C;  3ZPO A;  4H63 V;  1MMG A;  4DVD A;  3KBT A;  3K8P C;  3ZMV B;  2HH7 A;  1CUN A;  3AA0 B;  1H7C A;  2N1G A;  2H7V C;  1G8X A;  3ZYL A;  2E9X A;  3RH3 A;  5FY7 A;  3N2O A;  4XBF B;  3ZMZ B;  4ZOL E;  3DP7 A;  3N9Q A;  4O2B E;  5DQW A;  5JDG A;  3I9Y A;  1VOM A;  3O1I A;  3P7I A;  2XAG B;  1MMA A;  4UF0 A;  3CQC B;  4ZS3 A;  2CE7 A;  2EHO B;  3PTR B;  4AKL A;  1VRB A;  1NAF A;  4UXN B;  2ZM2 A;  2D0U A;  4IE6 A;  3ZC0 A;  2XAS B;  3K3N A;  3SOL A;  3ZMU B;  3WAK A;  2KND A;  2B1E A;  1HFA A;  3KDS E;  3VU7 H;  5J1G A;  4ZI3 D;  5CA1 E;  2VAS A;  1YKE B;  1LVK A;  2Q9Q A;  3ZYK A;  5JDL A;  3C51 A;  2L8K A;  5JDQ A;  5L3C B;  2VB6 A;  2BVM A;  4O4H E;  1NWM X;  1Y64 B;  5JH7 E;  3AA1 B;  1OXZ A;  2HPJ A;  3RYH E;  3UTK A;  4O2A E;  3ZCI A;  3H3A A;  4KBM B;  5LGT B;  3UT5 E;  1ZHC A;  3AVS A;  4AQG A;  2BVL A;  2X67 A;  2Q9Q C;  4JEU B;  3U78 A;  2LEH A;  2W61 A;  3HKE E;  4BJN A;  3N2G E;  3B57 A;  3IBP A;  4MBQ A;  3RX6 A;  1WYC A;  5GON E;  2N2N A;  2WMO A;  2HPL A;  2X9X A;  3CPZ A;  2W0G A;  1MMN A;  2C5I T;  3HKD E;  2VWA A;  4H9S E;  4WBN E;  3EDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...