2G0YA

Crystal structure of a lumenal pentapeptide repeat protein from cyanothece sp 51142 at 2.3 angstrom resolution. tetragonal crystal form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
133
structure length
133
Chain Sequence
b'SASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTSFKGADLTNAVLTEAIMMRTKFDDAKITGADFSLAVLDVYEVDKLCDRADGVNPKTGVSTRESLRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pentapeptide repeat protein
publication title Characterization of two potentially universal turn motifs that shape the repeated five-residues fold - Crystal structure of a lumenal pentapeptide repeat protein from Cyanothece 51142
pubmed doi rcsb
source organism Cyanothece sp. atcc 51142
molecule tags Unknown function
total genus 57
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2006-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2g0yA00
5JMCB 2BM7A 5JLVC 2F3LA 2BM4A 2BM5A 2J8IA 3N90A 4JRAC 2G0YA 2BM6A 2W7ZA
chains in the Genus database with same CATH superfamily
1QA1A 4W8TA 4W8RA 1JRGA 4YZ0A 4NK8A 2QXZA 1OFLA 1PLUA 1O8GA 1IA5A 4YFOA 1IDJA 1TYXA 4XM3A 2O0WA 4XQFA 3VMWA 1LLZA 4YELA 3B4NA 1EA0A 4YZAA 1O8MA 2ODLA 2B0RA 2VJJA 2YUHA 2XTWA 4URRA 3P4GA 1X0CA 4XONA 4AVZA 2XTXA 2NT6A 2NSTA 3TH0A 1L1IA 1OFEA 2VBEA 4OM9A 3NAWA 4OZZA 2PECA 3H09A 4NK6A 1EE6A 2XC1A 2QYUA 2X3HA 3BH6B 4Z05A 5JMCB 1KCCA 3PSZA 5JLVC 1BHEA 3JURA 1TYWA 2BM4A 3LJYA 4YDTA 4XR6A 1O8FA 3ZSCA 4XKVA 4YZXA 1AIRA 4YZQA 1HF2A 2NT9A 4XN0A 1VBLA 4OPWA 4XLFA 3KRGA 4YCQA 2X6WA 1PXZA 1QA2A 2O04A 4Z06A 1IDKA 2NZMA 4XN3A 1QQ1A 2VBKA 1QCXA 2W7ZA 3PETA 4MXNA 4U49A 4XOPA 4XKWA 2NSPA 1O8DA 4EW9A 1HG8A 4Z03A 3PSSA 2VFQA 3VSUA 2IOUG 4C2LA 1WXRA 1O8JA 2O17A 1DBOA 4OJOA 1CZFA 1H80A 4XLCA 2INUA 4XOTA 2O1DA 3SQVA 4OJ6A 2XT4A 1OGOX 4W8SA 3LYCA 2O6WA 3GQ8A 1KCDA 2Z8GA 3N6ZA 1O8KA 1WMRA 2BM6A 1LLWA 2O0VA 2XT2A 3GRHA 1RWRA 1JTAA 4OJLA 1QA3A 2BM7A 2PYGA 2F3LA 2IQ7A 3B8YA 2PYHA 1IB4A 3SZEA 1OOCA 1O8IA 1RMGA 1TYVA 1O88A 4XLHA 1NHCA 1XG2A 1TSPA 2VFMA 2VFOA 2VBMA 2VJIA 2BM5A 3NB2A 3BH7B 2BX6A 4OZYA 4YEJA 3EQNA 3N90A 1EZGA 3VSVA 2QX3A 3RIQA 5AMVA 1OGMX 2QY1A 3JX8A 3VSTA 2NTQA 1K5CA 3GQ7A 2XTYA 1O8LA 3UW0A 4XORA 4XL9A 3SYJA 3ZPPA 1PE9A 4V02C 1RU4A 4XMYA 2J8IA 2X6XA 2BSPA 1O8EA 1DABA 3LMWA 2VFNA 4PMHA 4XNFA 3FY3A 1KQ5A 1CLWA 1K8FA 1KTWA 3VMVA 4W8QA 2NTPA 5C1EA 3WWGA 4U4BA 3GQ9A 2X85A 3ML3A 4MR0A 4YEIA 3AK5A 5C1CA 4HWVA 2V5IA 4KH3A 1LM1A 1GQ8A 5DNSA 1K4ZA 2X6YA 3DU1X 4OJPA 4YC5A 3B90A 3EQOA 1OFMA 1QRBA 2NTBA 4I84A 2G0YA 1O8HA 3T9GA 3SY2A 1QJVA 2UVFA 2EWEA 2J8KA 2QZAA 2VFPA 3GQAA 4OJ5A 4XLAA 1TYUA 1QRCA 1BN8A 1OFDA 2UVEA 4JRAC 1DBGA 2INVA 4XLEA 3SUCA
chains in the Genus database with same CATH topology
1HF2A 1QA1A 1QA3A 2VFNA 2BM7A 2F3LA 4OPWA 1KQ5A 1K8FA 1CLWA 1QA2A 3SZEA 1TYXA 1TYVA 1QQ1A 2W7ZA 3PETA 1TSPA 2VFMA 2VFOA 3ML3A 3AK5A 2B0RA 2BM5A 2V5IA 2YUHA 4KH3A 3BH7B 2BX6A 2VFQA 3N90A 2IOUG 3P4GA 3RIQA 1K4ZA 3JX8A 1WXRA 4OJOA 4OJPA 3TH0A 4OM9A 1QRBA 2G0YA 3H09A 4OJ6A 2XC1A 3BH6B 4OJ5A 3SYJA 5JMCB 2VFPA 3LYCA 4V02C 5JLVC 1TYUA 1QRCA 1TYWA 2BM4A 2J8IA 3LJYA 3N6ZA 4JRAC 2BM6A 1DABA 4OJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JMC B;  2BM7 A;  5JLV C;  2F3L A;  2BM4 A;  2BM5 A;  2J8I A;  3N90 A;  4JRA C;  2G0Y A;  2BM6 A;  2W7Z A; 
#chains in the Genus database with same CATH topology
 1QA1 A;  4W8T A;  4W8R A;  1JRG A;  4YZ0 A;  4NK8 A;  2QXZ A;  1OFL A;  1PLU A;  1O8G A;  1IA5 A;  4YFO A;  1IDJ A;  1TYX A;  4XM3 A;  2O0W A;  4XQF A;  3VMW A;  1LLZ A;  4YEL A;  3B4N A;  1EA0 A;  4YZA A;  1O8M A;  2ODL A;  2B0R A;  2VJJ A;  2YUH A;  2XTW A;  4URR A;  3P4G A;  1X0C A;  4XON A;  4AVZ A;  2XTX A;  2NT6 A;  2NST A;  3TH0 A;  1L1I A;  1OFE A;  2VBE A;  4OM9 A;  3NAW A;  4OZZ A;  2PEC A;  3H09 A;  4NK6 A;  1EE6 A;  2XC1 A;  2QYU A;  2X3H A;  3BH6 B;  4Z05 A;  5JMC B;  1KCC A;  3PSZ A;  5JLV C;  1BHE A;  3JUR A;  1TYW A;  2BM4 A;  3LJY A;  4YDT A;  4XR6 A;  1O8F A;  3ZSC A;  4XKV A;  4YZX A;  1AIR A;  4YZQ A;  1HF2 A;  2NT9 A;  4XN0 A;  1VBL A;  4OPW A;  4XLF A;  3KRG A;  4YCQ A;  2X6W A;  1PXZ A;  1QA2 A;  2O04 A;  4Z06 A;  1IDK A;  2NZM A;  4XN3 A;  1QQ1 A;  2VBK A;  1QCX A;  2W7Z A;  3PET A;  4MXN A;  4U49 A;  4XOP A;  4XKW A;  2NSP A;  1O8D A;  4EW9 A;  1HG8 A;  4Z03 A;  3PSS A;  2VFQ A;  3VSU A;  2IOU G;  4C2L A;  1WXR A;  1O8J A;  2O17 A;  1DBO A;  4OJO A;  1CZF A;  1H80 A;  4XLC A;  2INU A;  4XOT A;  2O1D A;  3SQV A;  4OJ6 A;  2XT4 A;  1OGO X;  4W8S A;  3LYC A;  2O6W A;  3GQ8 A;  1KCD A;  2Z8G A;  3N6Z A;  1O8K A;  1WMR A;  2BM6 A;  1LLW A;  2O0V A;  2XT2 A;  3GRH A;  1RWR A;  1JTA A;  4OJL A;  1QA3 A;  2BM7 A;  2PYG A;  2F3L A;  2IQ7 A;  3B8Y A;  2PYH A;  1IB4 A;  3SZE A;  1OOC A;  1O8I A;  1RMG A;  1TYV A;  1O88 A;  4XLH A;  1NHC A;  1XG2 A;  1TSP A;  2VFM A;  2VFO A;  2VBM A;  2VJI A;  2BM5 A;  3NB2 A;  3BH7 B;  2BX6 A;  4OZY A;  4YEJ A;  3EQN A;  3N90 A;  1EZG A;  3VSV A;  2QX3 A;  3RIQ A;  5AMV A;  1OGM X;  2QY1 A;  3JX8 A;  3VST A;  2NTQ A;  1K5C A;  3GQ7 A;  2XTY A;  1O8L A;  3UW0 A;  4XOR A;  4XL9 A;  3SYJ A;  3ZPP A;  1PE9 A;  4V02 C;  1RU4 A;  4XMY A;  2J8I A;  2X6X A;  2BSP A;  1O8E A;  1DAB A;  3LMW A;  2VFN A;  4PMH A;  4XNF A;  3FY3 A;  1KQ5 A;  1CLW A;  1K8F A;  1KTW A;  3VMV A;  4W8Q A;  2NTP A;  5C1E A;  3WWG A;  4U4B A;  3GQ9 A;  2X85 A;  3ML3 A;  4MR0 A;  4YEI A;  3AK5 A;  5C1C A;  4HWV A;  2V5I A;  4KH3 A;  1LM1 A;  1GQ8 A;  5DNS A;  1K4Z A;  2X6Y A;  3DU1 X;  4OJP A;  4YC5 A;  3B90 A;  3EQO A;  1OFM A;  1QRB A;  2NTB A;  4I84 A;  2G0Y A;  1O8H A;  3T9G A;  3SY2 A;  1QJV A;  2UVF A;  2EWE A;  2J8K A;  2QZA A;  2VFP A;  3GQA A;  4OJ5 A;  4XLA A;  1TYU A;  1QRC A;  1BN8 A;  1OFD A;  2UVE A;  4JRA C;  1DBG A;  2INV A;  4XLE A;  3SUC A; 
#chains in the Genus database with same CATH homology
 1HF2 A;  1QA1 A;  1QA3 A;  2VFN A;  2BM7 A;  2F3L A;  4OPW A;  1KQ5 A;  1K8F A;  1CLW A;  1QA2 A;  3SZE A;  1TYX A;  1TYV A;  1QQ1 A;  2W7Z A;  3PET A;  1TSP A;  2VFM A;  2VFO A;  3ML3 A;  3AK5 A;  2B0R A;  2BM5 A;  2V5I A;  2YUH A;  4KH3 A;  3BH7 B;  2BX6 A;  2VFQ A;  3N90 A;  2IOU G;  3P4G A;  3RIQ A;  1K4Z A;  3JX8 A;  1WXR A;  4OJO A;  4OJP A;  3TH0 A;  4OM9 A;  1QRB A;  2G0Y A;  3H09 A;  4OJ6 A;  2XC1 A;  3BH6 B;  4OJ5 A;  3SYJ A;  5JMC B;  2VFP A;  3LYC A;  4V02 C;  5JLV C;  1TYU A;  1QRC A;  1TYW A;  2BM4 A;  2J8I A;  3LJY A;  3N6Z A;  4JRA C;  2BM6 A;  1DAB A;  4OJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...