2G0YA

Crystal structure of a lumenal pentapeptide repeat protein from cyanothece sp 51142 at 2.3 angstrom resolution. tetragonal crystal form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
133
structure length
133
Chain Sequence
SASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTSFKGADLTNAVLTEAIMMRTKFDDAKITGADFSLAVLDVYEVDKLCDRADGVNPKTGVSTRESLRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of two potentially universal turn motifs that shape the repeated five-residues fold - Crystal structure of a lumenal pentapeptide repeat protein from Cyanothece 51142
pubmed doi rcsb
source organism Cyanothece sp. atcc 51142
molecule tags Unknown function
molecule keywords pentapeptide repeat protein
total genus 57
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2006-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2g0yA00
4JRAC 2W7ZA 5JMCB 2BM5A 2BM7A 2G0YA 2J8IA 3N90A 5JLVC 2BM4A 2BM6A 2F3LA
chains in the Genus database with same CATH superfamily
2PYHA 2UVEA 1QJVA 2NTBA 1JRGA 4OJ6A 1RMGA 2X6YA 4XLHA 3RIQA 2F3LA 2VFQA 4XKWA 1O8KA 3PSZA 1QA3A 4V02C 2X85A 4XLAA 2J8KA 1JTAA 4MR0A 4XNFA 3ML3A 3GQ9A 1WMRA 2IOUG 1O8LA 1PLUA 1LLZA 4YEJA 3PETA 3KRGA 1O88A 3SUCA 4YEIA 4YDTA 3GQ8A 4NK8A 4XONA 5DNSA 3N6ZA 3DU1X 2VBKA 3GQ7A 3SYJA 3SZEA 3GQAA 1DBGA 2ODLA 2B0RA 2PYGA 5JLVC 1LLWA 2X6XA 3VMVA 3BH6B 4KH3A 1O8JA 4OJOA 3H09A 4W8QA 4YZAA 2NSPA 4YELA 2X3HA 4XR6A 4U4BA 3SQVA 2BM4A 4PMHA 2O0WA 1QRCA 3T9GA 2V5IA 2NTPA 1QA2A 3ZPPA 2BM5A 2NT6A 2Z8GA 2INUA 4YZQA 1HF2A 2NTQA 3AK5A 2NT9A 2VFOA 4U49A 3VMWA 2QXZA 3B8YA 4XOTA 4I84A 1OFLA 4YCQA 1O8EA 2VFPA 3BH7B 2VBEA 2XTYA 1EZGA 2UVFA 4OZZA 4W8SA 4XORA 4XN0A 2XT2A 1TYVA 3VSTA 1TSPA 1KQ5A 1O8MA 3TH0A 1K5CA 1KCCA 4YC5A 4YZXA 3VSVA 1DBOA 1O8GA 1BHEA 3GRHA 2QYUA 1TYUA 4Z05A 2QX3A 1QCXA 3LJYA 1CLWA 2BM6A 4NK6A 1IDJA 1VBLA 1OFMA 3LYCA 2EWEA 4XLEA 1NHCA 1DABA 1HG8A 2O17A 1O8FA 4YFOA 4XOPA 1OOCA 2VBMA 4OZYA 3EQOA 5C1EA 2O04A 1WXRA 1K8FA 2NSTA 3WWGA 2O0VA 2BM7A 1RU4A 4AVZA 1GQ8A 4MXNA 3NAWA 1AIRA 1O8DA 3SY2A 1QRBA 2O6WA 2QZAA 1H80A 4JRAC 4OJ5A 3ZSCA 4XLCA 1KCDA 2XT4A 2G0YA 2J8IA 3N90A 1IB4A 1L1IA 4XM3A 1OFEA 3EQNA 4Z03A 1X0CA 2INVA 1QA1A 1CZFA 2O1DA 4OJLA 1TYXA 1IA5A 4OM9A 3PSSA 4XMYA 2IQ7A 4XN3A 1OFDA 3VSUA 4W8TA 2YUHA 2VJJA 1EE6A 1TYWA 1O8HA 1OGOX 2PECA 2VFMA 2XC1A 2XTXA 3B4NA 1OGMX 3JX8A 3P4GA 1K4ZA 1QQ1A 1O8IA 2BSPA 4YZ0A 3LMWA 5C1CA 3UW0A 1EA0A 2W7ZA 1RWRA 1IDKA 2NZMA 1KTWA 2X6WA 1XG2A 2VJIA 2QY1A 4XL9A 3JURA 4C2LA 3NB2A 4XLFA 4XQFA 1PXZA 4Z06A 2VFNA 1BN8A 3B90A 5AMVA 4OPWA 5JMCB 1LM1A 4W8RA 4XKVA 2XTWA 3FY3A 4OJPA 4URRA 1PE9A 4HWVA 2BX6A 4EW9A
chains in the Genus database with same CATH topology
3BH6B 4KH3A 1QA1A 4OJOA 3H09A 4OJLA 1TYXA 4OJ6A 4OM9A 3RIQA 1TYUA 2BM4A 3LJYA 1CLWA 2F3LA 2BM6A 2VFQA 1QRCA 3LYCA 2V5IA 1QA2A 1QA3A 2YUHA 1TYWA 2XC1A 3JX8A 2VFMA 2BM5A 4V02C 1DABA 1HF2A 3AK5A 3P4GA 1K4ZA 3ML3A 2VFOA 1QQ1A 1WXRA 2IOUG 1K8FA 3PETA 2W7ZA 2BM7A 2VFPA 3BH7B 3N6ZA 2VFNA 1QRBA 4JRAC 4OPWA 4OJ5A 5JMCB 3SYJA 1TYVA 3SZEA 1TSPA 4OJPA 1KQ5A 2G0YA 2J8IA 3N90A 3TH0A 2B0RA 5JLVC 2BX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRA C;  2W7Z A;  5JMC B;  2BM5 A;  2BM7 A;  2G0Y A;  2J8I A;  3N90 A;  5JLV C;  2BM4 A;  2BM6 A;  2F3L A; 
#chains in the Genus database with same CATH topology
 2PYH A;  2UVE A;  1QJV A;  2NTB A;  1JRG A;  4OJ6 A;  1RMG A;  2X6Y A;  4XLH A;  3RIQ A;  2F3L A;  2VFQ A;  4XKW A;  1O8K A;  3PSZ A;  1QA3 A;  4V02 C;  2X85 A;  4XLA A;  2J8K A;  1JTA A;  4MR0 A;  4XNF A;  3ML3 A;  3GQ9 A;  1WMR A;  2IOU G;  1O8L A;  1PLU A;  1LLZ A;  4YEJ A;  3PET A;  3KRG A;  1O88 A;  3SUC A;  4YEI A;  4YDT A;  3GQ8 A;  4NK8 A;  4XON A;  5DNS A;  3N6Z A;  3DU1 X;  2VBK A;  3GQ7 A;  3SYJ A;  3SZE A;  3GQA A;  1DBG A;  2ODL A;  2B0R A;  2PYG A;  5JLV C;  1LLW A;  2X6X A;  3VMV A;  3BH6 B;  4KH3 A;  1O8J A;  4OJO A;  3H09 A;  4W8Q A;  4YZA A;  2NSP A;  4YEL A;  2X3H A;  4XR6 A;  4U4B A;  3SQV A;  2BM4 A;  4PMH A;  2O0W A;  1QRC A;  3T9G A;  2V5I A;  2NTP A;  1QA2 A;  3ZPP A;  2BM5 A;  2NT6 A;  2Z8G A;  2INU A;  4YZQ A;  1HF2 A;  2NTQ A;  3AK5 A;  2NT9 A;  2VFO A;  4U49 A;  3VMW A;  2QXZ A;  3B8Y A;  4XOT A;  4I84 A;  1OFL A;  4YCQ A;  1O8E A;  2VFP A;  3BH7 B;  2VBE A;  2XTY A;  1EZG A;  2UVF A;  4OZZ A;  4W8S A;  4XOR A;  4XN0 A;  2XT2 A;  1TYV A;  3VST A;  1TSP A;  1KQ5 A;  1O8M A;  3TH0 A;  1K5C A;  1KCC A;  4YC5 A;  4YZX A;  3VSV A;  1DBO A;  1O8G A;  1BHE A;  3GRH A;  2QYU A;  1TYU A;  4Z05 A;  2QX3 A;  1QCX A;  3LJY A;  1CLW A;  2BM6 A;  4NK6 A;  1IDJ A;  1VBL A;  1OFM A;  3LYC A;  2EWE A;  4XLE A;  1NHC A;  1DAB A;  1HG8 A;  2O17 A;  1O8F A;  4YFO A;  4XOP A;  1OOC A;  2VBM A;  4OZY A;  3EQO A;  5C1E A;  2O04 A;  1WXR A;  1K8F A;  2NST A;  3WWG A;  2O0V A;  2BM7 A;  1RU4 A;  4AVZ A;  1GQ8 A;  4MXN A;  3NAW A;  1AIR A;  1O8D A;  3SY2 A;  1QRB A;  2O6W A;  2QZA A;  1H80 A;  4JRA C;  4OJ5 A;  3ZSC A;  4XLC A;  1KCD A;  2XT4 A;  2G0Y A;  2J8I A;  3N90 A;  1IB4 A;  1L1I A;  4XM3 A;  1OFE A;  3EQN A;  4Z03 A;  1X0C A;  2INV A;  1QA1 A;  1CZF A;  2O1D A;  4OJL A;  1TYX A;  1IA5 A;  4OM9 A;  3PSS A;  4XMY A;  2IQ7 A;  4XN3 A;  1OFD A;  3VSU A;  4W8T A;  2YUH A;  2VJJ A;  1EE6 A;  1TYW A;  1O8H A;  1OGO X;  2PEC A;  2VFM A;  2XC1 A;  2XTX A;  3B4N A;  1OGM X;  3JX8 A;  3P4G A;  1K4Z A;  1QQ1 A;  1O8I A;  2BSP A;  4YZ0 A;  3LMW A;  5C1C A;  3UW0 A;  1EA0 A;  2W7Z A;  1RWR A;  1IDK A;  2NZM A;  1KTW A;  2X6W A;  1XG2 A;  2VJI A;  2QY1 A;  4XL9 A;  3JUR A;  4C2L A;  3NB2 A;  4XLF A;  4XQF A;  1PXZ A;  4Z06 A;  2VFN A;  1BN8 A;  3B90 A;  5AMV A;  4OPW A;  5JMC B;  1LM1 A;  4W8R A;  4XKV A;  2XTW A;  3FY3 A;  4OJP A;  4URR A;  1PE9 A;  4HWV A;  2BX6 A;  4EW9 A; 
#chains in the Genus database with same CATH homology
 3BH6 B;  4KH3 A;  1QA1 A;  4OJO A;  3H09 A;  4OJL A;  1TYX A;  4OJ6 A;  4OM9 A;  3RIQ A;  1TYU A;  2BM4 A;  3LJY A;  1CLW A;  2F3L A;  2BM6 A;  2VFQ A;  1QRC A;  3LYC A;  2V5I A;  1QA2 A;  1QA3 A;  2YUH A;  1TYW A;  2XC1 A;  3JX8 A;  2VFM A;  2BM5 A;  4V02 C;  1DAB A;  1HF2 A;  3AK5 A;  3P4G A;  1K4Z A;  3ML3 A;  2VFO A;  1QQ1 A;  1WXR A;  2IOU G;  1K8F A;  3PET A;  2W7Z A;  2BM7 A;  2VFP A;  3BH7 B;  3N6Z A;  2VFN A;  1QRB A;  4JRA C;  4OPW A;  4OJ5 A;  5JMC B;  3SYJ A;  1TYV A;  3SZE A;  1TSP A;  4OJP A;  1KQ5 A;  2G0Y A;  2J8I A;  3N90 A;  3TH0 A;  2B0R A;  5JLV C;  2BX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...