2G0YA

Crystal structure of a lumenal pentapeptide repeat protein from cyanothece sp 51142 at 2.3 angstrom resolution. tetragonal crystal form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
133
structure length
133
Chain Sequence
SASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTSFKGADLTNAVLTEAIMMRTKFDDAKITGADFSLAVLDVYEVDKLCDRADGVNPKTGVSTRESLRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pentapeptide repeat protein
publication title Characterization of two potentially universal turn motifs that shape the repeated five-residues fold - Crystal structure of a lumenal pentapeptide repeat protein from Cyanothece 51142
pubmed doi rcsb
source organism Cyanothece sp. atcc 51142
molecule tags Unknown function
total genus 57
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2006-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2g0yA00
2BM6A 3N90A 4JRAC 2W7ZA 2J8IA 5JMCB 2F3LA 5JLVC 2BM5A 2BM7A 2BM4A 2G0YA
chains in the Genus database with same CATH superfamily
4YZQA 4C2LA 1VBLA 2IOUG 1BN8A 1EE6A 1DABA 2XTXA 1QA3A 3GQ8A 2BM5A 4XQFA 1WMRA 2J8KA 1QA2A 3DU1X 4XLAA 1L1IA 1XG2A 2QZAA 4MR0A 1OFEA 1EA0A 1O8IA 2PYGA 3B4NA 4YDTA 4U49A 2XT2A 2QX3A 4OPWA 1PXZA 1TYXA 1K4ZA 1OFDA 2J8IA 3SY2A 2O17A 1OFMA 2F3LA 2O0WA 2VFMA 4YZXA 3LYCA 2UVFA 4EW9A 5C1CA 2QYUA 3EQOA 4OZZA 4XONA 4KH3A 4YCQA 4XORA 3JX8A 1TYVA 5JLVC 1AIRA 2B0RA 1TYWA 2NT9A 4V02C 4NK6A 2UVEA 2YUHA 2VFQA 4MXNA 1O8LA 1OGOX 1O8MA 2X6WA 2QXZA 1CLWA 5JMCB 1IDJA 1O8JA 1NHCA 2VFNA 4NK8A 4XNFA 4YFOA 4XLEA 3T9GA 1BHEA 4XLCA 2VBMA 2BM6A 2V5IA 4URRA 4XOTA 2VFPA 1O8GA 3SQVA 2W7ZA 4AVZA 4OM9A 1RWRA 1JRGA 1DBOA 4HWVA 2NSTA 1OOCA 4W8SA 3JURA 3PETA 4YC5A 3TH0A 2IQ7A 2XTYA 4XN3A 1QJVA 2INUA 1TYUA 2Z8GA 4XL9A 3SZEA 3B8YA 2NTPA 3PSSA 2NT6A 4W8TA 2XTWA 4YZ0A 4YEIA 3WWGA 4XM3A 2O6WA 2BX6A 3NAWA 2O1DA 3GQ9A 2BM4A 1O88A 1IDKA 4Z03A 1QRCA 1IA5A 2BSPA 2NTQA 3LJYA 4YEJA 3BH7B 1QRBA 3P4GA 3VMWA 1RU4A 1EZGA 2QY1A 1LM1A 1JTAA 2XT4A 2NTBA 1QCXA 2VBEA 3N90A 3VSVA 3ZPPA 2EWEA 2X3HA 2X6XA 3GQ7A 4W8QA 3FY3A 4W8RA 1QQ1A 4U4BA 3B90A 1HG8A 1OFLA 1KQ5A 1O8HA 2VBKA 3H09A 3ML3A 3SUCA 1KCCA 2ODLA 4XKWA 3RIQA 1IB4A 3ZSCA 2X85A 2X6YA 4Z05A 4YELA 1CZFA 3BH6B 4Z06A 3UW0A 1KCDA 3LMWA 2O0VA 2INVA 4OJOA 3VSTA 1O8KA 2BM7A 1H80A 3AK5A 4XOPA 4OJLA 4OJ6A 1OGMX 4OJ5A 4XR6A 5DNSA 2O04A 1WXRA 2NSPA 3VSUA 1X0CA 2NZMA 3KRGA 2PYHA 1O8DA 2PECA 3N6ZA 4XLFA 4XLHA 2XC1A 2VJIA 3EQNA 4XMYA 5AMVA 3GRHA 1HF2A 3NB2A 4PMHA 1K5CA 1QA1A 1LLZA 3GQAA 3SYJA 4OJPA 3VMVA 1PE9A 1KTWA 4I84A 4XN0A 1RMGA 4JRAC 1O8EA 2G0YA 1LLWA 2VJJA 5C1EA 1K8FA 4YZAA 1TSPA 1PLUA 1GQ8A 4OZYA 3PSZA 1DBGA 1O8FA 2VFOA 4XKVA
chains in the Genus database with same CATH topology
2VFQA 2IOUG 1WXRA 1DABA 1CLWA 3LJYA 5JMCB 1QA3A 4OJ6A 2BM5A 2VFNA 4OJ5A 1QA2A 4V02C 3BH7B 1QRBA 3N6ZA 3P4GA 2BM6A 2V5IA 2XC1A 2VFPA 1HF2A 3N90A 2W7ZA 4OM9A 4OPWA 1QA1A 1TYXA 1QQ1A 3SYJA 3PETA 3TH0A 4OJPA 1K4ZA 1KQ5A 2J8IA 3AK5A 2F3LA 2VFMA 1TYUA 3H09A 3ML3A 3RIQA 3LYCA 4JRAC 2G0YA 3SZEA 1K8FA 1TSPA 3BH6B 4KH3A 4OJOA 3JX8A 1TYVA 1TYWA 5JLVC 2B0RA 2BX6A 2BM7A 2BM4A 2VFOA 4OJLA 1QRCA 2YUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM6 A;  3N90 A;  4JRA C;  2W7Z A;  2J8I A;  5JMC B;  2F3L A;  5JLV C;  2BM5 A;  2BM7 A;  2BM4 A;  2G0Y A; 
#chains in the Genus database with same CATH topology
 4YZQ A;  4C2L A;  1VBL A;  2IOU G;  1BN8 A;  1EE6 A;  1DAB A;  2XTX A;  1QA3 A;  3GQ8 A;  2BM5 A;  4XQF A;  1WMR A;  2J8K A;  1QA2 A;  3DU1 X;  4XLA A;  1L1I A;  1XG2 A;  2QZA A;  4MR0 A;  1OFE A;  1EA0 A;  1O8I A;  2PYG A;  3B4N A;  4YDT A;  4U49 A;  2XT2 A;  2QX3 A;  4OPW A;  1PXZ A;  1TYX A;  1K4Z A;  1OFD A;  2J8I A;  3SY2 A;  2O17 A;  1OFM A;  2F3L A;  2O0W A;  2VFM A;  4YZX A;  3LYC A;  2UVF A;  4EW9 A;  5C1C A;  2QYU A;  3EQO A;  4OZZ A;  4XON A;  4KH3 A;  4YCQ A;  4XOR A;  3JX8 A;  1TYV A;  5JLV C;  1AIR A;  2B0R A;  1TYW A;  2NT9 A;  4V02 C;  4NK6 A;  2UVE A;  2YUH A;  2VFQ A;  4MXN A;  1O8L A;  1OGO X;  1O8M A;  2X6W A;  2QXZ A;  1CLW A;  5JMC B;  1IDJ A;  1O8J A;  1NHC A;  2VFN A;  4NK8 A;  4XNF A;  4YFO A;  4XLE A;  3T9G A;  1BHE A;  4XLC A;  2VBM A;  2BM6 A;  2V5I A;  4URR A;  4XOT A;  2VFP A;  1O8G A;  3SQV A;  2W7Z A;  4AVZ A;  4OM9 A;  1RWR A;  1JRG A;  1DBO A;  4HWV A;  2NST A;  1OOC A;  4W8S A;  3JUR A;  3PET A;  4YC5 A;  3TH0 A;  2IQ7 A;  2XTY A;  4XN3 A;  1QJV A;  2INU A;  1TYU A;  2Z8G A;  4XL9 A;  3SZE A;  3B8Y A;  2NTP A;  3PSS A;  2NT6 A;  4W8T A;  2XTW A;  4YZ0 A;  4YEI A;  3WWG A;  4XM3 A;  2O6W A;  2BX6 A;  3NAW A;  2O1D A;  3GQ9 A;  2BM4 A;  1O88 A;  1IDK A;  4Z03 A;  1QRC A;  1IA5 A;  2BSP A;  2NTQ A;  3LJY A;  4YEJ A;  3BH7 B;  1QRB A;  3P4G A;  3VMW A;  1RU4 A;  1EZG A;  2QY1 A;  1LM1 A;  1JTA A;  2XT4 A;  2NTB A;  1QCX A;  2VBE A;  3N90 A;  3VSV A;  3ZPP A;  2EWE A;  2X3H A;  2X6X A;  3GQ7 A;  4W8Q A;  3FY3 A;  4W8R A;  1QQ1 A;  4U4B A;  3B90 A;  1HG8 A;  1OFL A;  1KQ5 A;  1O8H A;  2VBK A;  3H09 A;  3ML3 A;  3SUC A;  1KCC A;  2ODL A;  4XKW A;  3RIQ A;  1IB4 A;  3ZSC A;  2X85 A;  2X6Y A;  4Z05 A;  4YEL A;  1CZF A;  3BH6 B;  4Z06 A;  3UW0 A;  1KCD A;  3LMW A;  2O0V A;  2INV A;  4OJO A;  3VST A;  1O8K A;  2BM7 A;  1H80 A;  3AK5 A;  4XOP A;  4OJL A;  4OJ6 A;  1OGM X;  4OJ5 A;  4XR6 A;  5DNS A;  2O04 A;  1WXR A;  2NSP A;  3VSU A;  1X0C A;  2NZM A;  3KRG A;  2PYH A;  1O8D A;  2PEC A;  3N6Z A;  4XLF A;  4XLH A;  2XC1 A;  2VJI A;  3EQN A;  4XMY A;  5AMV A;  3GRH A;  1HF2 A;  3NB2 A;  4PMH A;  1K5C A;  1QA1 A;  1LLZ A;  3GQA A;  3SYJ A;  4OJP A;  3VMV A;  1PE9 A;  1KTW A;  4I84 A;  4XN0 A;  1RMG A;  4JRA C;  1O8E A;  2G0Y A;  1LLW A;  2VJJ A;  5C1E A;  1K8F A;  4YZA A;  1TSP A;  1PLU A;  1GQ8 A;  4OZY A;  3PSZ A;  1DBG A;  1O8F A;  2VFO A;  4XKV A; 
#chains in the Genus database with same CATH homology
 2VFQ A;  2IOU G;  1WXR A;  1DAB A;  1CLW A;  3LJY A;  5JMC B;  1QA3 A;  4OJ6 A;  2BM5 A;  2VFN A;  4OJ5 A;  1QA2 A;  4V02 C;  3BH7 B;  1QRB A;  3N6Z A;  3P4G A;  2BM6 A;  2V5I A;  2XC1 A;  2VFP A;  1HF2 A;  3N90 A;  2W7Z A;  4OM9 A;  4OPW A;  1QA1 A;  1TYX A;  1QQ1 A;  3SYJ A;  3PET A;  3TH0 A;  4OJP A;  1K4Z A;  1KQ5 A;  2J8I A;  3AK5 A;  2F3L A;  2VFM A;  1TYU A;  3H09 A;  3ML3 A;  3RIQ A;  3LYC A;  4JRA C;  2G0Y A;  3SZE A;  1K8F A;  1TSP A;  3BH6 B;  4KH3 A;  4OJO A;  3JX8 A;  1TYV A;  1TYW A;  5JLV C;  2B0R A;  2BX6 A;  2BM7 A;  2BM4 A;  2VFO A;  4OJL A;  1QRC A;  2YUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...