2G13A

Csos1a with sulfate ion
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
95
structure length
95
Chain Sequence
b'VTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major carboxysome shell protein 1A
publication title Structural Analysis of CsoS1A and the Protein Shell of the Halothiobacillus neapolitanus Carboxysome.
pubmed doi rcsb
source organism Halothiobacillus neapolitanus
molecule tags Carboxysome
total genus 25
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2006-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g13A01
3H8YA 5DJBA 2G13A 3MPYA 4AXJA 5L38A 3PACA 3I6PA 4RBTA 4AXIA 3IA0A 4OX6A 2A1BA 4LIWA 3VCDA 4P2SA 2A18A 3SSQA 4P7TA 3SSRA 3CGIA 4OX8A 4DDFA 3DNCA 4QIGA 3DN9A 4QIVA 4P7VA 3NGKA 3NWGA 4RBUA 3I96A 3MPWA 4OLOA 2A10A 4RBVA 3BN4A 4OX7A 4PPDA 4QIEA 4QIFA 3N79A 2EWHA 3CIMA 3SSSA 4OLPA
chains in the Genus database with same CATH superfamily
2BDPA 1LW0B 4BWMA 1KDNA 1K73T 2FZCB 3QFHA 3IR7B 1KKHA 5L39A 2VG5B 4U7UK 4YQWA 2ATLA 2DHGA 4LR8A 2DIUA 4O4RA 4OHVA 4CLKA 4PR6A 4ZVHA 3W2WA 1VQ5S 2F3JA 2DITA 1N5TA 1RT7A 1Q8LA 4K4UA 1CVJA 5GAGI 4LF5J 1KEKA 1CBKA 4DX8H 4ZJOA 2FVCA 2XGQA 3ZO7A 3MEEB 3FSYA 3IRXA 1NPKA 3TAMA 1MWYA 4DV6J 1NSQA 1QTNB 3DOMB 3CCJS 3PR5B 2EG2A 2G0IA 1OPIA 2GVDB 2YH1A 3FMBA 1C2PA 1DY3A 1EB0A 5IT9U 2JVOA 3CF5Q 2UVVA 3BDEA 4NLGA 2XMTA 3G6VA 1E6VB 3ETMA 2GO9A 2PO4A 3G96A 4WE1B 3AD8C 3SDEA 1DFDA 3C6TB 4EGLA 3DNCA 4NZ7A 2Z30B 3JQKA 2MY8A 2QG9B 3OFFA 4ECXA 2E1CA 3E8OA 1NK7A 2VC0A 1XNQF 3DFEA 3UDCA 5KFDA 1MN9A 3HD1A 1PYTA 3O44A 2RHSB 4ZN1A 1TVRA 3D6MB 1X4HA 1TP7A 1DTTB 5G4DA 1S1TB 3TJAA 3OUYB 4ES2A 3J81U 1WACA 2DNGA 5KFPA 2B4OA 3QZ8A 2LDYA 3WDOA 4Z37A 3CIZA 1O8BA 4IUFA 3KNGA 2LXFA 4EO6A 2LP4A 4Q5VA 3IRWP 4ZPBA 3RR8A 1SXLA 3M2VA 2DNNA 3RAXA 2LKZA 4LF9J 2E7XA 5KFXA 1T7PA 2GQ2A 1HYSB 5K8OA 2KL8A 2B7CB 2ZH2A 2QV6A 4DX6A 1IKVB 1UFLA 2R7UA 2ZH7A 5KFTA 1ZA2B 2O3DA 3DGPA 1RTJA 3DC2A 4ED7A 3GCWP 3HFZB 1VYAA 4CO5A 4ZP8A 2GGPA 2XHCA 4KFBA 2ZH3A 1LKZA 2NYHA 2AF6A 4ZPDA 4YFUA 4TXSA 1KLNA 3R97A 1RT6A 2GGPB 4KFBB 5I3UB 4DG1B 2LU1A 1HQ2A 3K5OA 4MFBA 3SV3A 1NH8A 1VHIA 3F44A 3QYYA 4LFAF 3JB9k 5F41A 1RJJA 2FLPA 4NLOA 2RH3A 1FJEB 4CQ1A 4NA2A 2CFXA 4XPEA 2V68A 2ZBRA 3OR1A 4RBUA 3HJFA 1TMJA 4UOCA 2V94A 3HVWA 2KZMA 2F7VA 1ULRA 5K14B 2JHEA 5I42A 1SQFA 1DTQB 2AYEA 2FJDB 2EC0A 5HROB 1ACMB 1SC6A 3OL7A 3KMSA 2W25A 2KXFA 4J9KA 3RBDA 4TLQA 1KFDA 2EFNA 3T1HF 2UUAJ 2JZ5A 4UY8T 2Q6BA 3G87A 2K2PA 5E3RA 4ED5A 4ZN3A 5D15A 3JTNA 1B3TA 1YSJA 1A9NB 2OH2A 4CIOA 2RS2A 1K1SA 2QRRA 3M8SA 2XCPA 1NCLA 1NSKL 3CJ8A 2B6AA 1X4GA 4DL6A 2FVSA 3BQ1A 1B64A 2WSFC 3SQGB 4ZPWR 1ROFA 2IY5B 2K7KA 1RISA 2HLTA 1IXKA 1VQNS 2FUG9 2LQ8A 4JV1A 1NK6A 1OJ4A 4O23A 4ZK7M 3U7JA 3KDNA 2W01A 2X1AA 5GAGU 2EG1A 3I4HX 2ZBQA 4WTYA 2CPJA 1K44A 2B56A 3KUHA 3BR8A 5EX3A 2C22A 2ASYA 2AGOA 5KG2A 1AB8A 1RT5B 5DLGA 3NNHA 2PEHA 1N5YA 5H1SV 4WTOB 4TKTA 4NE9C 4OZ2A 2ZNYA 1K0TA 3PCOB 2E7VA 4KKOB 3S6EA 3NCRA 3EGZA 3DLLQ 1N5YB 4RWWA 3OPKA 5AXLA 1N48A 4B3SF 1ZZFA 3QT7A 2X7IA 3QSYB 4U8VA 4DV4F 4LF8J 1Y7PA 1SI9A 3CCES 4GVBA 5FDLB 3QIPA 3X1LB 1CJKA 3ICLA 2UVUA 3BB5A 5L38A 4GVBB 2AJ0A 2XNQA 1HNZF 2EVZA 3PJWA 5LXYA 1NNDA 1RHUB 4ELVA 4KO0A 4LFCF 3QJLA 2CQBA 3DHXA 3K5NA 3GILA 3N79A 1HQEA 1RCXB 5IFMA 3RG6A 5F3TA 3N5BA 1VBXA 1UWBB 4XDCA 2EK1A 2ZBIA 4QWBA 1EARA 1U48A 3DLJA 1GH8A 4AL5A 1KR4A 2Q43A 2YNFB 4UW2A 5HP1B 2UUCJ 5HBMA 2J7UA 1U1LA 2HVDA 3PFEA 3NP5A 1NJYA 2GMJA 3HFKA 4J90A 3MM5B 3CE8A 1FVSA 3M32A 2YWWA 3C19A 3J80Y 1WEZA 5A2QU 3CMQA 3ZZRA 5KFQA 1LWCB 2K1RB 3AJDA 4NRUA 2OFGX 4OIXA 4YY3J 4ZVTB 4OV6A 4YR3A 4R0EA 5DDOC 5KFVA 5ETMA 3IN5A 1JLFB 3R8YA 2DNRA 3IGNA 2ASDA 4IFVA 2BACA 1D9FA 3BO2A 3BREA 3W64A 3CCLS 4PQUB 4U9RA 1FD2A 2RQ4A 3Q0AA 1ZYQA 2LEBA 4CO4A 4TU7A 1ELOA 4EBCA 3BGFA 3O1LA 4UT4A 3A8IA 1X4BA 2DHAA 1YBAA 3W8PA 3KK1B 3MECA 1SL2A 1EETA 4JI2F 4DR4F 3OVSA 2ZVSA 2R7TA 4LVNP 4PKDB 5JVHQ 3SXLA 3KXDA 1MLAA 2MTLA 1VOMA 4F4ZA 2ZEJA 4JUZA 5DQHA 4Y6IA 4DDFA 2DTJA 3MEKA 2XZWA 3QBCA 4CH1A 2H4YB 3OL9A 1EIYB 4A8OA 1JLCB 1QAJA 4DPYA 4ZITA 1XR5A 3G82A 1D8YA 3HI9A 3WZ0A 1TAQA 2XY6A 4USVA 1LWEB 2HK3A 4ECZA 4DF4A 2ZM6F 2QMUB 5HL7Q 3UD4P 4JI8F 2MKIA 2MZQA 2V6AA 1RAIB 3GE9A 2MLYA 2YY3A 5E3AA 2W4CA 3MR3A 3GV8B 2EKNA 1SC4B 2DGOA 2WCXA 2J9CA 4JI3J 4N56A 3FDSA 2W2MP 3C15A 5HVHA 2HNYB 2DRAA 2Y3YA 3US5A 3L9ZA 4F3OA 3BO4A 2CDQA 2W7PA 5AE2A 4JI6J 2RDIA 4DR1J 1NHVA 3KLIA 2HBZB 2XYGB 2HHSA 3D9BA 1WELA 1NJIT 1GMVA 4PXCA 4F2RA 4P7TA 2B8QA 3I0SB 2ZE2A 2C1EB 1TL7A 5A8RB 4BDPA 4WYWA 5C5JA 1T3OA 3UN2A 1IBCB 5F8NA 1FXRA 3BYPA 2ASLA 2Z4PA 2IC3A 2CQ2A 4KSEB 3GB0A 3T9ZA 4AT1B 4ANCA 4IR1A 1RBOB 1Q53A 1VRUB 2ZOFA 2AEJA 2FJVA 2R8GA 3D54A 4RLEA 1Q78A 1O6XA 2G2OA 2MXYA 2C2NA 4JI0J 2PA3A 3CWJA 3D4JA 1O0PA 4IDKB 4ELTA 2C42A 4NA3A 4IH5A 2ZZNA 4LSNB 1CPZA 4TNOA 3ZZZA 4WIIA 1DURA 2OSQA 3IA0A 2XO7A 2FYXA 1MNEA 3VALA 1F1BB 3IBCB 3J7YU 2M88A 3CJKB 4YUDA 1WHVA 2J5AA 3TA2A 5D4LA 1PYSB 4I7FA 3TWZA 4NX9A 1Q82T 3ILJA 5EWFA 1HBOA 4B9UA 2OEKA 1LWFA 2CZ9A 4USMA 1HNWF 3SCIE 2RSQA 4WU3A 1FT8A 1PC4A 2FC9A 4HLBA 1T9XA 3BEGB 2WB4A 4WXWA 1RTDB 4FF1A 2LXUA 4RBTA 4X4SA 2I9SA 3HSJA 3EZOA 2HAIA 1PJ7A 1AYEA 3MAAB 4I2PB 1YJ9S 2XMKA 5HMXA 4URGA 5HN0A 3MM6B 4ID5A 5EWGA 3NEKA 3GR0A 2QIFA 2CJYB 4F0MA 3M30A 4O4GB 5CZVA 3FBFA 5J1EA 3BGRB 2BEFA 1VS3A 3GV5B 1UZDA 4GRSA 5HLFA 4C3MA 1R43A 5IXUA 3MCMA 1T94A 1IBLF 1BC6A 4X2BA 4ILRA 4QJVA 4N7TA 4JI7F 2WSEC 2W24A 3OTCA 2BANA 1YJ7A 1TKXB 1Q86T 4DSLA 1HWJA 1X4EA 2CQ4A 1YITS 1S57A 2EK6A 2MZ1A 3U1MA 2VPXB 2AYBA 1T0TV 2MZRA 5KG7A 1XJWB 2ZVIA 4IQMA 1WC3A 3ZNJ1 4YB6A 3CD6S 5I3QA 4I56A 5AXNA 1HR0F 1ZAVA 3TQEA 3RW7A 4ZPTR 1HI8A 1XMOJ 3W66A 3MMAA 1ZM2A 3VAIA 2B4UA 2Y8WA 3THTA 3KJNB 1NK5A 2V0NA 2R7XA 3MMAB 1WOSA 2V69A 3A4TA 5G0RB 1M90T 3H5SA 4EO8A 3JQJA 3ENWA 1XBWA 9RUBA 3EUNA 4NI2A 4DOZA 3KUGA 2R2UA 1R8HA 2KU7A 2A3JA 4L72B 1KOOA 2YNIB 2FLLA 3PM9A 3QLHA 4DR3J 4K5RA 4RW7B 1EX8A 3CULA 3HHLB 2FHMA 4UOGA 1TV6A 3MI7X 3M8PA 3NGKA 1BMQB 1FJ7A 4P6QA 1FNXH 2CPIA 3PKYA 3V4MA 3E01A 1RA7A 5T7LA 4ZOSA 4U7CA 2XCAA 4DR2F 4TYBA 3GU0A 4I69A 2GQQA 2I38A 4X64F 3ZZOA 1RWKB 2DR7A 2YQ0A 5A8WA 4A8FA 2RU3A 1S1UB 4NLTA 3W61A 5A6PA 3K5LA 2ZFHA 4ZVSB 3S8SA 4CLSA 3TUZC 2C2MB 1LV5A 1TKTB 1X0FA 1GQEA 4ZCKA 5DDPC 3SZ2A 2OD6A 2ZZMA 3OFEA 4I0WA 2M8DB 4KGMA 3OTEA 4LRCA 1ZETA 1S6QB 3AB4B 1JKHA 3DRYA 4DL3A 4WP3A 4BCAA 2QTWA 3QWPA 3HHLC 3D67A 2EFGA 1RT2A 2HWTA 1AROP 2RQCA 4OJHA 5KG6A 3OLAA 3A12A 1NJXA 5K8NA 5EHHA 2I0XA 2V8DA 5F9LA 4DUZJ 2HHUA 5LSLA 1ZAWA 3JYTB 4TN2A 4YHHJ 2ZDPA 4TQSA 2ZDOA 3OW2R 4ECVA 4ZP6A 5B09A 3MAHA 2PIIA 1Q4RA 3T41A 3CJ2A 4A8YA 1HNVA 1MG7A 2UXCJ 1VQPS 4DCJB 1T3NA 4I64A 3M6UA 1HMVA 4RKUC 2JLGA 4NWBA 4TVAB 2G0JA 3OXFA 5BYSA 1M5SA 2ZH6A 1DLOA 4N8NA 3IO1A 1IUJA 3CUNA 1HNVB 3ISND 1HMVB 2Y1JA 4C8YA 3WHIA 1T9TA 2BYCA 1TKZA 2C2OB 4L76A 4OI6A 2ZD1A 3R6GB 3KLFB 3ZTSA 4A46A 4OMFG 1B7YB 1UKUA 4K2JA 1TKZB 2Y9HA 4DR7F 2CUYA 2DB1A 2MB0B 3OHAA 4WU2A 3EMTA 2YWFA 4Q43A 1JLEB 4FNHA 3ZFVA 4M5DA 4TU9A 4K4WA 3VVUA 5GADU 1VQ7S 1UCNA 2PE8A 2OI2A 3ILLA 1WF2A 1F3VA 1HQUB 1UEUA 3HKWA 4W92B 2Y1IA 1ZOTA 5D3GA 2X1GA 3C14A 1IM6A 2AKWB 3NBPA 3CCRS 2WVDA 3TOQA 3UDVA 5B0EA 5KFZA 5CYQB 2HZAA 3KTQA 3T5KA 2IA6A 1WC0A 3AXKA 1ZM3A 2BE2A 3AA8A 1S6PB 1BQMB 4IOAQ 2QT7A 1CQNA 3SYZA 2OO4A 3CNQP 3G6ES 2CZ4A 3H4DA 4X65F 1RU2A 3IG1B 3WX4A 2CPFA 2YNGB 5CQGA 2RRAA 3DLKB 3S1TA 3MF5A 1SJ4P 1RK8A 2ZJQQ 1NHKL 4N47A 2CRLA 2KRBA 2CPYA 2FY1A 3DYAA 3PHTA 4YB7A 2KXNB 3D1QA 4Q2MA 2QLXA 4IFYB 3W60A 5B0AA 4AQYF 1AT1B 3MUMP 3EWGA 2APOA 2FGOA 1S10A 1BD6A 5FIIA 1HWUA 3VQSA 3G9CA 3POTA 1ZS6A 3Q8QB 2HVHA 4LFBF 2RU9A 1DQAA 3BSNA 3GFZA 2UVWA 1JB0C 2JC0A 1WDTA 2UXDF 5E3PA 5EDWA 2DY1A 4I4BA 4C4WA 3SEOA 3POTB 2L9WA 4DF8A 1HBUA 4F7VA 1UW9A 2HFUA 4I6WA 1T11A 1VLOA 3LGMA 4CM2A 5DZ7A 2RRNA 1H7XA 2VC1A 1ZZNA 2QEXS 4NXMF 1HBNA 2DT9A 4FYDA 2P9EA 4F50A 2BA9A 3OQ2A 2HPUA 3KG4A 3HT3A 1JX4A 2QLBB 3PW7A 4UF4A 4WK3A 4UTGA 2W9CA 2L9DA 3QO9B 4NLUA 1QJHA 3EZ5A 4LFAJ 2ZITA 3MZIA 2BJ9A 1H2TZ 4KHRA 1T05A 1S49A 2YNHA 3J81Y 1GEHA 1U2CA 4DV7J 1WUUA 1N56A 4RW9B 4KGZB 4DV5F 4LF7J 5D0GA 3LP1B 3CCQS 5DDRC 5DM6Q 2JLFA 1U25A 3LPYA 2B0GA 2YNHB 3EXCX 2KO1A 4EK2A 2HVIA 2MKYA 1KC8T 4XAKA 4DU8A 3J81j 5L8RC 5BR8F 4ED8A 1S6UA 4M5LA 4X4OA 1UJ5A 2HQGA 3GG1A 4JI1J 4IG0B 4ECQA 2B5JA 4Y2KA 1FWPA 4C97A 1RU1A 4YOEA 2W1BA 4OJ3A 4RUAA 2QSWA 1VQ9S 1GX6A 3PRDA 2HGNA 2DNMA 1B0TA 3T1HJ 3QNWB 2HHWA 3FSXA 4KY3A 1R8PA 3BKTA 3HLUA 4LF5F 1FEHA 4LQ3A 1OY8A 1UEVA 1RWVB 3FFIB 4UUXA 3Q22A 1Y3KA 2AX0A 5ETRA 2VF3A 3D7SB 2WTFA 1S0MA 1VMBA 5KFCA 1VQSA 3GZ7A 5KOXA 2WVFA 3T9NA 4ZCIA 2PFFB 1I3OB 2PSZA 2D74B 4CLYA 1JLAA 4QR0A 4V1Ak 3SSQA 2X3GA 2HHTA 1R3NA 2V4RA 3ISZA 1E6YB 2ZUAA 2UU9F 4F8RA 2XHWA 1VI7A 1VC0A 2AIRB 2VZ9A 3S01A 1H38A 1C4AA 2R7VA 2MZJA 2OMOA 4NLVA 3NNAA 1SV5B 1U6ZA 1JXVA 1LNQA 2RQMA 1XK8A 2FGCA 3UR3C 1RT4A 2P8IA 3DM2B 2FB0A 2ZHOA 3IS9B 3RYLA 2XS2A 3V6DA 1W25A 3K58A 4B3SJ 2YWHA 1F5BA 1FDBA 3DLBA 1U7LA 4XTTA 4CNYA 1JJ2R 2PDAA 4OZ0A 2VQFF 2V34A 1FERA 4GO5X 3BBFA 5SZTA 3P8BB 4LF9F 3QJPA 4Z7YA 4QQBA 3R9LA 2C2ZB 2RD5C 5J2PA 3DMJB 2W2PP 4BC9A 1HNZJ 5DETA 4IO9Q 1MROB 2HBYB 3CDBA 2IMOA 2IM2A 2J8SA 4ZS6A 1NPPA 4LFCJ 1QD1A 4UQTA 2UV8A 1SJFA 1RWUA 4O0IA 1WHXA 1JQGA 1S9EA 3FCHA 3IAS9 1RWWB 3LANA 4B9LA 1NRKA 1U2RA 3ENVA 3CTRA 4WWSA 3ZC4A 3C6UA 1S9EB 4EBDA 2IYGA 1U4BA 4ES3A 5A0YB 3IR6B 1SJQA 3T1AA 3PEHA 3J7AN 4P7VA 4MH8A 2M5YA 4M8LA 2MQQA 3JXOA 3GSDA 2ZH5A 1URNA 1T8EA 1P6TA 2W4PA 2G13A 4HI1A 4LBHA 2V63A 1RAOA 5THWA 3A3PB 2W9BA 1MSWD 4CH7A 2OEMA 2OHDA 3H59A 3CC2S 4C9DA 2BE9B 3PYDA 4KV8A 1MWZA 4ZLJA 2IIHA 4LSLA 1SKRA 4USJC 2FJAB 1FFWB 2C2DA 3TR5A 1PJ6A 4N77A 2IVYA 1GX5A 1H74A 4OYPA 3IP0A 3TYTA 2X1FA 4H4KA 1FNMA 2OJ3A 1MU2B 3O3LA 2G0CA 3EX7B 2KJVA 4F36A 2YWGA 2LA6A 4A8KA 1PG5B 1WTFA 2CVIA 4HVZA 3CJ5A 2MLXA 1IKXA 2IDLA 1KD1T 3DXSX 4DSKA 5BYRA 2YVSA 3ZZTA 1UL3A 1REVA 4L73A 1FXLA 1TL3B 2ZBPA 5KFOA 3HX9A 3I55S 1HWLA 3CEDA 2VOPA 3MEDB 2JJ4D 4JI8J 2WAQD 1NZAA 4FZVA 4BBYA 4CI0B 4H4MA 1GXUA 3H2LA 4DFKA 1AFJA 2AEMA 1SUQA 4OYBA 3L7PA 4IR9A 3H2VE 3LAKA 3W2VA 3C3LA 1IWGA 1F9HA 3H20A 3LWLA 3M1VA 5L1LA 3N9UC 2V4JB 1R0CB 3BBCA 3W2VB 1QVFR 1N5QA 3PEJA 3J80U 5CYJA 3QWUA 1FRJA 3NLCA 1LEOA 3GYXB 2OPPB 2MKHA 5HMZA 4LF8F 4AXJA 3H90A 4X84A 4OZ1A 3I6PA 1TL4A 1TAUA 1JLBB 4M5GA 4ECWA 1S4FA 2CKWA 2R42A 4GMKA 3KJVB 1KSPA 1WHWA 5KT3A 4X66F 5ETVA 4MK7A 1U1RA 2N4DA 2V8VA 2F4VJ 2WSCC 1KVIA 3MM9A 4NYOA 1W26A 4RNMA 4H4OA 5ETTA 3GYGA 3GIIA 3M6VA 3IBFB 4EYIB 2HFOA 2ZJRQ 3WX8A 4J9QA 3BKUA 2VFUA 2HHVA 1OQ6A 4H4OB 2LQJA 3Q8VA 2J0XA 1N33J 1BXNA 4WFBQ 2BQRA 3R5JB 1R8CA 3G4SS 4L6V3 1F2GA 3TA0A 3HCXA 1RWXB 3WIVA 4PUOA 1S59A 4HDHA 2R3VA 4ZHRA 2NS1B 2XTJP 2OPQA 3BV8A 2GHPA 2XY7A 1T02A 1RADB 3W62A 4TY8A 5IQ6A 1RT1A 4IH7A 1S9GA 4RJVA 3HPOA 3DCAA 3ZTQA 4X62J 1OPZA 4TY8B 5KFKA 5KG5A 2GVZB 4W90B 4YMEA 1Q8IA 1WG5A 2IJRA 3M9NB 1WF0A 5CD4A 4DPOA 2HMIA 4ANDA 1FX4A 4YR0A 2GZOA 4C8MA 5DO2A 2ACMA 2DH8A 3LO3A 5M2UA 3UVJB 2C3MA 2OELA 2M9KA 4Y34A 1M0SA 3PG9A 1RT3A 3MM8A 4QU7A 2AV5A 3AQPA 4F25A 4OJ1A 2E1PA 1S4EA 2F40A 4PXDA 2KM8B 1HLWA 1NK9A 2HG4A 2MSTA 3VAFA 4FXDA 1QSYA 1RQ0A 2VASA 2VFVA 2J6TA 4S0MA 1SQEA 1FD8A 2VONA 3KLVA 4JI7J 1WG4A 3LAMA 1SCJB 5K9FA 2QX0A 3RB4A 1CJUA 1UAWA 4QIVA 1H98A 1X8DA 2KDOA 3CCMS 4JI4J 1RTZA 3P5TL 2BJ3A 3R7SB 4B17A 2IA0A 1C4CA 2DRBA 3I0RA 1Y5IB 3K8WA 2CNOB 3GIRA 4FP9A 3LWMA 1WSRA 2ADCA 3A8EA 2J6UA 2BJ8A 1HR0J 3U27A 3D3BJ 4C0HA 4R5PA 1MMLA 3ELHA 4DR1F 4CTAA 4B3OB 3HXMA 4BS2A 3QAEA 3G6YA 4OZ3A 2KM8C 1HHSA 4P73A 4WP9A 1JXEA 5LMNF 2FDNA 2BE7D 3O2IA 1YZ7A 1PSDA 5GMKa 1BQNA 4OYAA 3H4BA 1Q16B 3C16B 1F2HA 2CPDA 3GONA 1L3SA 3TVZA 2QA2A 5J2QA 3M8WA 2XMAA 1CSJA 3PHEA 1AZSA 1FK9A 4HDGA 2FHOB 4USHA 4U7UD 1I5OB 5J2QB 4OI2A 1X9WA 2I2YA 4J9OA 1VIXA 4DV3F 4NCAA 3NCQA 5EUHA 1PC5A 1EP4B 3OHBA 1S1XA 4ZLPA 1XEZA 3ENQA 2BVZA 1ZPVA 5DGAA 1NB7A 2MQ8A 3NGDA 2Z0GA 4JI0F 2WW4A 4W4MA 5GVQA 4B9TA 3W9JA 2UVRA 3AHPA 5B7WA 2B51A 4FN5A 3BGOP 4X64J 2YPYA 1YIJS 2DKOB 3P45B 3QRQA 2QLFB 4ITSA 2MGZB 3OXLA 2GCFA 2RMLA 1OQ3A 1RLDA 1U6BA 1C0TB 3H7HB 4LF6F 1B0VA 2WOMA 2DCLA 1DBDA 4CLUA 4HTIA 1JK9B 3W63A 2J0QD 2IDEA 3M2RB 5J2MA 1FCAA 4RW8A 5F8LA 4MYUA 4W98A 2QZ8A 2DO0A 5L9XA 2Y0SD 5J2MB 3JSYA 4ID8A 3BN7A 4FYVB 2O67A 1SVDA 4J9RA 4XO0A 2P6TA 4O3PA 1FI4A 2YWKA 4KIAA 1F6TA 4DQSA 3ADAC 2J9EA 4KGXB 5B0BA 3R3TA 3DOKA 5JVGQ 2NSBA 2U2FA 3ILOA 3VZHA 2V4QA 1Q5VA 4YEAA 4IG3B 4C2MA 1S97A 5D0EA 1CS4B 1G4CA 2B8PA 2ZUGA 3E2EA 3PX0A 3G71S 2Q6CA 1F60B 1ICEB 2IHR1 3NCPA 2IM3A 3DRSB 2C28A 2DHSA 3CDWA 2JDJA 2YKMA 2I8EA 3HMJG 2DJWA 5B0GA 1VK3A 4IOBA 4ZCLA 4LF4J 2LEAA 4CP5A 3LOUA 5ETQA 1WC4A 2OP5A 1UFKA 3B4DA 3L7OA 5A8KB 4NASA 1S6OA 1NKCA 3CGIA 4ETZA 4ANEA 4CWBA 1X7VA 3MM7B 1HIYA 4DR7J 3MEGA 1VQ6S 3GP9A 3TEGA 4ED6A 3JS9A 4NMLA 3ENAA 3ITHB 4HT7A 2VBXA 1SKSA 2NCKL 1MW7A 1VC6A 1S7HA 4DFMA 1VDHA 8RUCA 4CT9A 1NJWA 5EN1A 4N8OA 2IAJB 1D09B 2E66A 2VG7A 2K3IA 3HULA 3EDRB 2ZNZA 1XMOF 2CA9A 4GC6A 1HPZB 4MKVA 1UA0A 5LOQA 2NREA 2KG1A 2ROGA 1HBMB 2F1FA 3UDLA 3H5YA 2J7KA 4QU6A 3ET6B 4OI4A 3P5BP 2XO6A 1RGVA 2ROPA 1RDRA 3KHHA 2JEFA 3OR2B 3CC4S 5D0HA 4QPTA 4UZBA 1N4LA 1N8RT 1YJVA 4X65J 3T1YJ 2MMYA 4PYAA 4RW6A 2JFDA 1CG2A 5CCMA 2ZWOA 2OKQA 4NLWA 2Q1LA 4ZPCA 3OLBA 3R7NB 5D8HB 4MMOA 2CPZA 1IWAA 4DR6J 2JWNA 1RTHB 3RBEA 5KT2A 4Q0BA 4Q2LA 2AWZA 1L5UA 3QPIA 2B9WA 1CQMA 3ONQA 1GMWA 2HZCA 3AXMA 5K20B 4HHJA 3LP2A 2WVBA 1PKUA 3K57A 1X9MA 1SJ1A 4AQYJ 2DCUB 5C42A 4DV0J 1VRTA 1SPBP 4Q8EA 1CULA 4DQIA 2DNHA 1Q8KA 1FKOA 4N5SA 4DQRA 3QT8A 1KQGB 1TL1B 2AJ2A 1RKIA 3ISNC 2BM1A 3HSZA 3NRBA 2EBGA 2HNZA 4OX6A 1Y3JA 1XR7A 3Q24A 1SIZA 2IBOA 4DUZF 3PKMA 1RAFB 1D8ZA 3DI6B 1F3FA 1FDAA 4YHHF 3CT9A 3UCUP 3ETOA 2MJUA 5FJ4A 3FBEA 4RU9A 1HARA 1M5OC 5E3CA 2VBYA 2GNKA 4L3KA 3UO0A 1X5SA 3AOCA 2UXCF 4R8UA 1IKYB 4G65A 2VKRA 2B9EA 1YK9A 3SQOP 2JEGA 1T03B 1FF2A 3DKDA 1OMSA 4DU7A 4F2SA 4C11B 1ZM4A 4F4KA 1YJNS 3MMCB 4E0DA 5BR8J 2MQOA 1Z1ZA 4PXEA 5AXKA 2LVWA 1U0HB 4ZVRB 6AT1B 1U1QA 3GG0A 1M1GA 1NUEA 3RRGA 1DQ8A 2ZH4A 1VJWA 2ADBA 4ICLA 1R7IA 2VA2A 2VU5A 4F02A 2POKA 1RI7A 4L75A 1RTIA 4USIA 3D0HE 2DR8A 3G8TA 5KG4A 2XZTB 3DDNA 3W2WB 4RNNA 3LTOA 3D0GE 1X0PA 1RT7B 4HR2A 1WTBA 3FSIA 1U1NA 3MR2A 2GS8A 1SIWB 4IRDA 4ZLNA 2MQMA 2GIRA 1RAEB 2R7RA 4ZVOB 3IRXB 3TAMB 1U1OA 2Y1RI 4D3GA 3MUVP 1GTEA 2UU9J 1U8WA 3JSMA 4GKJJ 4N41A 1PJ5A 4DL7A 1QLNA 2ALYB 5L1IA 4B9MA 3PACA 4YP3A 4OYMA 2A6MA 1BWVA 1TK0A 4CLPA 2CQCA 2DK2A 4E98A 3PDNA 2A10A 1S12A 4G1PA 2YX7A 4C3KA 4NEZA 3SDEB 4FS2A 1HFEL 5KFRA 3DLEA 4ZLLA 3FBBA 2FY8A 3M8RA 1QVGR 1P8GA 3Q2TC 5KAKA 2CQ1A 4ECTA 2VHGA 3NWRA 1TVRB 3OFHA 4JBCA 3OT9A 4KGKA 4AYBD 5K5MA 2F9DA 4EI2A 2VQFJ 5LSRA 3THVA 2COLA 1C1CA 1TU0B 1UEKA 2GFFA 2DR5A 1NPRA 4LBIA 1HW8A 4MAKA 4DV1J 3MXHP 1AXQA 1JIHA 2GO8A 1QY7A 3M2VB 3EPGA 1YRXA 3D6HB 5A76A 1F9FA 1S99A 3JQMA 5H9EJ 3L4BC 5MLCV 3PW4A 2K06A 3K5PA 3AH6A 4O3QA 1VHFA 4OYXA 2XSFA 1LK5A 1XNRF 3MDFA 3V81A 2DNYA 3DGPB 1RTJB 4DEZA 4IH6A 1EQ0A 2N7CA 3J7A1 1OY6A 3NGTA 4DCOB 2H65B 1RT6B 4JV0A 1YVFA 5F8GA 5HATA 3MMBA 2GJIA 3DRRA 2QFJA 4WP8A 1FKPA 4MFBB 4DV7F 4P2SA 4LF7F 4DSFA 1C0UA 2DGQA 2KI2A 2KFZA 4DFPA 2ERRA 3KDOA 2QLWA 3TP2A 4HKQA 2B7BB 1YJUA 3ILIA 2RE1A 3KJFB 3FC9A 3OR1B 1OY9A 1J5OA 1FHTA 2IRUA 4ES1A 2HHPA 1ZTTA 4JI1F 2V9KA 3V4IA 3AJ2A 2AJ1A 4OHXA 1U45A 2AZ3A 1HD0A 3WQPA 2M3DA 1L3KA 1NEEA 2W7OA 4NEYA 5I42B 3LQVA 5AE1A 1WJ9A 3CMES 2WB1D 2J8AA 1RSCA 5KFWA 2W4DA 1NMEB 3QATA 2KKHA 1N6QA 3H8YA 3A13A 4FF4A 1WKJA 5CYMA 5ETSA 5CA5A 4Q44A 3R2CJ 3TUJC 2AYGA 1YJTA 5HAOA 3N4WA 2NSCA 2BBEA 5HQ8A 3Q8UA 5LSOA 5IM0A 2HW3A 3KFWX 2B6AB 3AODA 8ATCB 1PAEX 1WOPA 2ASJA 4H54A 2E5LF 3V6HA 4MIAA 2D69A 2AJFE 3GIKA 2P5VA 4AXIA 4C0OC 4WFXA 4JI5F 5IS2A 3TO8A 4G1IA 3SV4A 3I9ZA 4ZP9A 5D78A 4DL0C 4Q45A 1IKWA 1MMDA 5HJXA 2HURA 4NCGA 3D5MA 2A18A 2CWXA 4OX8A 4UZCA 3OSPA 2LEPA 3MR5A 4X4RA 2MKKA 4Z2XA 3KLHA 1APSA 2HVEA 5F8MA 2N3LA 2C2EA 3UDEA 2K8GA 5KT4A 4Z7CA 1KHVA 3MR7A 1W7WA 2HFSA 3EVMA 3PVXA 4HH1A 4V19J 4X66J 1B70B 4LREA 1LK7A 2K3KA 1A7GE 4NZ0A 1YJWS 3QIPB 4QIWD 3GTYX 1CJKB 2J9DA 4DI6A 1XN9A 3DLGA 3TAPA 3C2PA 2KFNA 2Q66A 3B82A 2CPEA 4WXOA 1EHWA 4KO0B 3J7YI 2RRBA 2O1PA 1U1PA 2LDIA 1RYSA 1HQEB 2KH9A 1HNIA 2NXUA 3HHKA 1C1BA 2EW9A 2H51B 3KLEA 1CJVA 3FKBA 5AXMA 3EICA 4LF2A 4FXVA 2F4FA 3EM1A 2DNPA 4ZIWA 5HBMB 1R27B 1MMNA 2X51A 1FO1A 3IR5B 1X4AA 2UUBF 2LA4A 4CLTA 2HHHF 5F9NA 4LSZB 3WC0A 3M32B 1XIQA 3KHGA 2WONA 2UP1A 2HWIA 3TJ8A 8AT1B 3GPAA 4IRCA 4YB5A 2Y1LB 2R8IA 3CVKA 2CVEA 1BWEA 4WPAA 3R5AA 4IFVB 1R0AA 4PXBA 4FVMA 2OMLA 4F4WA 1R0AB 1W2BR 1ZPWX 2YKNA 4WF9Q 2BABA 1SJ3P 2RILA 1QE1A 2CNLB 3RBXA 4X4TA 2FHJD 2V9WA 3MECB 2FJXA 1EETB 1KLMA 1XC9A 2GIQA 2A2DA 2FLNA 2ILYA 4WFYA 2G9OA 3L09A 2DR9A 2OPSA 3R1LA 4HI2A 5DRKA 2AMCB 3MD1A 2O5DA 2VD3A 4TLRA 4YR2A 4K4YA 2HQIA 4ZVUB 3DN9A 1T95A 3Q86A 3QMQA 2VIHA 1NKEA 3DRPA 5B0FA 1BE4A 3GFHA 3HVRA 2H48B 2HHQA 3DOLA 3G82B 5F3ZA 4CYUA 1L3UA 4KC5A 1S7IA 4RUCA 3KK3A 6FDRA 2RF2A 4CYUB 3PX4A 5C25A 2C2RA 3SMZA 4ED2A 3KK3B 1VBZA 1L3TA 1B99A 4URQU 1LWXA 4OZJA 1S79A 4NXNF 1UTAA 4MKAA 2B3TB 3C15B 5H9FJ 2R7SA 3S7RA 2XSJA 5FLXU 3QFWA 5LMNJ 3R5DA 2Q3PA 4A47A 2AW0A 1WHYA 3KLIB 3NMRA 2N4CA 6FD1A 3A3NB 2MKCA 2EWHA 1VGYA 3HP6A 2ZE2B 3H40A 3UCZP 1TL7B 4IQXA 4C48A 2F4VF 4PWDA 4RNFA 1YKWA 1G7CB 4OV1A 3M6XA 2RUGA 2IC3B 4DV3J 5C2CA 4C8KA 4QWEA 1F5AA 3TZXA 3GFYA 2ILZA 1FFSB 2HLUA 1N33F 2BKNA 1CC8A 1UVLA 5LJ5Y 3UPFA 5KG3A 4B3RJ 5AT1B 3CD0A 1CJTA 3M8QA 2CWKA 2XNRA 3OTOJ 3NGUA 3HVTA 4F26A 3NS6A 4OHZA 2W2QP 2JLEA 1Q79A 1D1UA 1WEYA 4Y28C 1FRIA 3M8QB 2C3UA 4LF6J 2KB2A 2XWYA 3V2UC 2M0GB 2XMWA 1UFWA 3QZ7A 1TQLA 4X62F 4NMXA 3NMAA 5C2GA 1PCAA 2AJQA 4I7FB 1Z4UA 3PR4A 3TNVA 3OTBA 2VDHA 4U67Q 3IFEA 4AL6A 1HBOB 4M5HA 1LWFB 3CDUA 5IT0A 4FKYA 4DLGA 3H2UB 5F8IA 2QO3A 1WC5A 3ZTRA 2PT0A 4CDIA 1TFWA 5CD4H 2HGLA 2RVJA 2L9NA 2M4MA 3CO0P 2LQ5A 3UR0A 4DWIA 5IZHA 1N34J 2UV8G 2P9GA 2VG6A 5IWAJ 5KFSA 2HRYA 1TELA 4LF1A 2BQ3A 2QA1A 4O44A 1ZTWA 3GCXP 4ID5B 4DL4A 1IBMJ 2D41A 2QGFB 4CO1A 5LM7E 4X4UA 1K47A 2IMWP 3M30B 1S9FA 4PAAA 4ZKAA 4MK9A 1UMJA 1J27A 3W5ZA 4OZLA 5GADI 5J1EB 2YKAA 3LF0A 5HLFB 4AFFA 1LFWA 3MTKA 4FPRA 3RAQA 1L3VA 4KR0B 2D7SA 4AD6A 3GR1A 4U96A 4P10A 3WIUA 3G6XA 1PIEA 4JI4F 4P72A 3FQKA 3VZIA 2BANB 3TZZA 3M8YA 2GX8A 4RW4A 4WYLA 1KONA 1IBKJ 5HMWA 3ZZYA 4MIWA 1VK8A 1QSSA 1JLGA 3W7BA 4KH0B 2DGUA 1OWXA 1F9EB 1LW2A 1A6LA 2GAHC 2JRSA 3EVWA 2IRYA 2B9XA 1OSDA 2IVMA 5ADZA 1NSAA 1H7WA 4DUTA 3CIMA 2DD8S 3VR1A 3CDAA 1FESA 2BM0A 2DYAA 2DNOA 4A8QA 4CO3A 2MHNA 5FD1A 4PG8A 1FJGF 5J1NA 3PW2A 5CXTA 3HSGA 2HFVA 2XMJA 1QTMA 2BOPA 1SH2A 2P2CB 4BHQA 4NI2B 1R6VA 3PNIA 2XI2A 5CHCB 3W5XA 1LW0A 2LQBA 2GAGC 2UUTA 3MD3A 4RU2A 1JWWA 1IVZA 3M2UA 3QLHB 3B6BA 1NK4A 2FVRA 3SCJE 2P6SA 3MR6A 2E1AA 1H3DA 1TV6B 4WFZA 3ZTPA 1SKUB 2Z58B 2VG5A 3M8PB 4NL5A 3MPUB 4CLZA 3FRZA 5ITHA 3M2UB 4LUBA 4QOTA 4MKBA 5HJYA 3E01B 4MJKA 1U0SA 4RZRA 5T7LB 2K7JA 1TK5A 1FKAF 2RQKA 2BZ2A 3QGPA 4BWJA 2RDJA 3C8YA 2N7YA 2DEIA 5A8WB 4ENOA 4K50A 4UOFA 3EGVA 2BKPA 3PRBA 3MEEA 4WK1A 3HD2A 2VODA 3A8KA 2BJ7A 3NNCA 3DOMA 5BJRA 1D9DA 1YHQS 2E9RX 4L3NA 3BJYA 3EVOA 1S5ZA 1N32F 2XLKA 4WFNQ 2GVDA 1X4DA 3VQTA 1R8AA 2DNKA 3N6MA 4P2XA 3B54A 5DG9A 4MTPA 4KRWA 4OLPA 1JKHB 3PJ9A 4DZDA 3T5LA 1E6VA 4LRDA 1RT2B 4WE1A 2EEYA 3C6TA 3KHRA 4HH0A 3NXZA 2NQPA 2CQ3A 3VAJA 4LJMA 4JYAF 1NAQA 5K8PA 5EWEA 1FA0A 2PFDA 3CCUS 3T3FA 1S72S 1JNRB 5U47A 3BO3A 1DTTA 3SFGA 2QMWA 3TI0A 1YBUA 1S1TA 4LR7A 1WOOA 2VL1A 3OUYA 2F65A 1RAGB 1I6JA 1X5TA 3RBZA 1UETA 3MURP 4J37A 4LF4F 4C7QA 2M70A 2XMUA 2BX6A 1U24A 2V2KA 1DLOB 3H42A 1NDKA 1V9OA 2PMZD 5MAOA 2CQGA 5B0DA 3NOGA 2E44A 2MYFA 2YWEA 4QYZK 4NYZA 3LGNA 1DQ9A 1HYSA 2CAJA 3VTIA 2XQCA 2PC6A 1IKVA 1WC6A 5ETPA 1S0OA 2ZD1B 2MY7A 3EE3A 2MEWA 4WIQA 1GMWD 3AOAA 3BGLA 3QIDA 4NRTA 1RZMA 2DXDA 2KT3A 1QAIA 3IXQA 5BXIA 2VPWB 2XB2D 4KPYA 2AD9A 4M5DB 2MZSA 2J7WA 5KFIA 2HKEA 5I3UA 4DG1A 2B43A 1YG0A 1OO0B 5D3GB 3C14B 3FEXB 4KH1B 3NBPB 4YDDB 3NKYA 2ATCB 4WZMA 4DHVA 3Q8SB 3CCZA 3HHNB 1HI0P 2XWXA 4A4JA 2BE2B 3T1YF 4IKAA 2QMXA 2ZJPQ 2D3ZA 4PCQA 2D3UA 4LMZA 1YRTA 4ECUA 4WFAQ 4XK8C 1FRHA 5B0CA 4GO7X 2DO4A 3Q83A 1K1QA 2ACYA 3EGNA 1IR2A 2VFSA 3F0NA 1VFJA 3PO5A 3FK4A 1SKWA 2YBVA 5K14A 1QUVA 4DR6F 1UVIA 1TZ0A 2XYHB 1DTQA 1UZHA 3AY0A 1NKBA 2HSEB 5HROA 1PBAA 1S76D 2LMIA 3MFHA 4B9VA 2VQEJ 2Z2LA 3DRXA 3I5AA 2ZH8A 1U8SA 1VIOA 3DYAB 4DV0F 5GAHU 3TW0A 4M5KA 4PYDA 3HT0A 2HYIB 2V67A 1RBLA 3JSBA 5AJ3J 2HZVA 4YS2A 3JAMU 4OYIA 4WCEQ 4OX9F 1Q81T 4ILLA 3SQGA 2FJBB 1NK8A 2LFVA 1YQHA 1N88A 1GAOA 4KBIA 1HBUB 3JTOA 4P2MA 1WWHA 3I5BA 3TVKA 3L95X 3BPDA 5E3QA 3IWXA 1JLQA 3LUYA 2XLIA 1XNRJ 3EDQB 4QWDA 3ZTOA 4CO0A 4YN3B 5D0RA 1HBNB 1JLQB 2NYIA 1FWLA 2HK2A 1RT5A 1AUDA 2MHEA 4KKOA 2EFVA 1P9YA 2Y0BB 1NXIA 1FFGB 2ZC3A 1TUVA 2W9CB 1RLCL 3CCVS 2AJ4A 5KFUA 4HACA 4O0NA 2HHXA 1S1WA 2XBPA 4ZIVA 2F5GA 1T05B 2KJWA 4I2QA 4KHPF 2VJUA 4HACB 3VAMA 1BQXA 1S1WB 3UCGA 1VBYA 2NZ4A 2VB6A 2CQDA 5FDLA 3GV7B 2FZGB 3UWTA 2BXJA 4I2QB 1WEXA 4DL5A 2AEFA 2XYPB 2ZKUA 2KG0A 1U1MA 5M2RA 3GIMA 5E7OB 1WC1A 2BUNA 1RAJA 4DS5A 2XEXA 3H25A 2B5JB 5KFFA 3WBZA 4X4NA 3BBBA 1UWBA 4FBUA 4NZ6A 1WDDA 1RCOB 1O5JA 1BGXT 1KN6A 3ULHA 3M9MB 4B3MJ 3BPSP 1N5VA 2YNFA 5SUHA 3K89A 5HP1A 2Z2MA 3BYRA 3CCSS 2WW8A 4J9PA 5EGYA 3FMWA 4F3MA 2FJWA 2W2NP 2AP6A 4WJBA 2GJ2A 3MM5A 1PILA 2DRDA 1KVJA 4L74A 1DAXA 3QRRA 3HK2A 2O01C 1LWCA 5KOWA 2K1RA 1CEZA 2QFIA 2OTLS 1XMBA 2E5LJ 5F0WA 4GKJF 1I51B 1JLAB 1JJ4A 3HDSA 1NO8A 1HWKA 2HNDA 3TX8A 3RB0A 1YLXA 1JLFA 4JI5J 2N82B 2IJNA 1KRPA 5A6WA 4KYZA 3D28A 4LBPA 3K17A 4PQUA 2HNDB 4ZDNA 4YDXA 1HNXJ 2G4BA 5KT7A 4P71A 4G3IA 2M2BA 4Y2MA 2CQPA 3EGWB 4DFJA 4LIWA 3HJVA 4FVCA 3H98A 3N01A 3KK1A 2JEIA 3TRGA 1RT4B 2BJDA 1U26A 3V6DB 1N36J 1FRMA 4CO2A 1PGZA 2CJQA 3O5TB 1TUGB 1QAYA 1UVKA 4M95A 2AQ4A 2R8KA 4YB1P 2JX2A 4QBUA 4DV1F 1G6BA 4QW8A 2NPIA 2OLWA 2AGQA 3DU5A 3EYZA 1RUSA 3D68A 2RHQB 2LXIA 2J9DE 3FGVA 2E9TA 3MAQA 5J2PB 1XMQJ 2ZOGA 2ZWPA 1JLCA 5ETLA 4E2FB 4J9LA 3OBIA 2L48A 4ECSA 3IM9A 1S77D 4LRBA 4DV2J 1LWEA 1UPMB 2FD2A 3GYNA 5LMUJ 4FBTA 3KKFA 2FVPA 2DHHA 3MHYA 3I82A 3D66A 3I32A 3AJ1A 4USWA 4M5IA 3C6UB 2H5IB 3TX0A 1EJ7L 1H2UX 4QR1A 2VKZG 1UA1A 5DQGA 1YTYA 3ZXWA 3VHQA 2UUBJ 5HQMA 3P4UB 4PZVA 2HNYA 4Y3CA 4FYXB 2HHHJ 4NLYA 1LXJA 3R27A 1Q8BA 3K5MA 4UUWA 3FNNA 4HYKA 2J0WA 1NU4A 2UXBJ 2YX4A 2FZKB 1OS5A 4JV5F 3I0SA 2W9BB 5A8RA 1WKLA 1KVKA 3NG8A 5IV4A 3CC7S 3OFGA 2PI5A 3FZBA 4Y2CA 3CW2C 2QL9B 5KFEA 1SBRA 4DQPA 3VAKA 2EBEA 2HRTA 5T41A 3D6TB 4KV8B 4PG5A 3BQ2A 3ZZPA 4QPXA 2OTJS 3DDIA 1FWKA 4LSLB 4C8ZA 3NOCA 1J5EJ 1UVJA 4B9NA 1X9SA 1VRUA 3EXYA 1ZA1B 5E0OA 1HW9A 5LJ3Y 1T9YA 4KJIA 3TQ1A 2IPOB 1KHWA 3O6QA 5M2PA 1IR1A 3BF4A 1SQGA 1ITPA 2HBQB 1Z2LA 4ED3A 2FPHX 4IDKA 2KN4A 3JTPA 4V19X 4ETXA 3CJQA 4LSNA 4PRFA 4K0KJ 1IKXB 4DR5F 1DRZA 9ATCB 2QSFA 5JXSA 3G8SA 4ER8A 2E5IA 3NWGA 1REVB 5IQQA 4ECYA 4CLFA 4DPWA 2M52A 5H9EK 3MPDA 5KG1A 4D3HA 3CJKA 1KFSA 1U1KA 4I68A 2VH7A 2E29A 2F8MA 1VQ8S 2D9OA 2R2TA 2RS8A 3JSRA 3NL0A 2I5JA 4H4MB 3RGIA 2C3PA 2QA4G 3FVYA 1OIAA 3K2YA 2PMHA 3TAQA 4K4VA 1SUQB 4OZNA 3K7RA 2QYCA 4K4TA 2DGTA 2RUSA 1RTDA 4H4KC 4CM0A 4DMZA 2I5JB 4NXNJ 4F0HA 3M1VB 2CZVC 1WI8A 2FHJA 5T14A 2WHOA 3MAAA 4I2PA 1SL1A 4ZJLA 2CPHA 3CJ4A 3MM6A 4XDDA 3D0IE 4J9UE 3ZZUA 4QIGA 1ZH5A 4DLEA 3CJ0A 3F56A 1GK8A 4BLGA 4X4PA 2RDDA 3HF5A 4UQGA 2J6SA 3IMQJ 4Y2AA 4O4GA 2R2SA 4NLPA 4ZPAA 1JJHA 4JP8A 2NXEA 2IVFB 2NLWA 2VV5A 4ED1A 3BGRA 4K4SA 2H5EA 2RJZA 3H5UA 5E41A 2R8HA 1VBKA 4RUBA 1S0VA 4I67A 2PD1A 4UOHA 2WVEA 2BJ1A 4B08A 4EFAC 1JXLA 1SJRA 3MM9B 3VCDA 4O3OA 2BW2A 1QM9A 1RABB 4TY9A 1KNZA 1TKXA 1X31C 4NPOA 4CLLA 1X5PA 3G2XA 2KYXA 1LXNA 4KAIA 4ZVEA 2W8LA 3R5CA 1WD6A 3NAHA 2NPFA 2KHCA 1JJCB 4F3QA 1H2VZ 1RA6A 1FTCA 2HQDA 1GT8A 1OYDA 5D77A 4ERDA 1IM4A 1REGX 4PUOB 4ZHRB 3A3OB 3HHDA 3AB2B 4HT5A 3RTVA 3FBCA 5FLXY 2KFYA 4G6VB 4DX7A 2H5JB 4J5OA 1N54B 1DHMA 1T9UA 2OPQB 3UN5A 4N76A 2R7QA 4DX5A 4DN9A 2ZBCA 2VA3A 1RT1B 3PW5A 4C8LA 1S9GB 4F0KA 2I1RA 3SFUA 4Q8FA 4A8WA 1X5OA 5G0RA 3AQOA 4K8RA 2VPZB 3GJSB 3LALA 2LECA 2Y8YA 4PPZA 4O3SA 4ELUA 3AA9A 1V5VA 3CO9A 2YNIA 1TR0A 2GMLA 2U1AA 3J7Z5 3D3CJ 2MQLA 2EFPA 4RW7A 3HHLA 2BJEA 2H54B 2HMIB 4USUA 4DSJA 1W2IA 5KFYA 5CCLA 3NS7B 3KOAA 1RT3B 3MM8B 1I94J 4CH0S 2KXHA 2YH0A 5DG8A 1S1UA 1N0VC 4M94A 4M1KA 4R25A 5CZXA 4DQQA 2AZ1A 2KZZA 2MJNA 3KHLA 4J9MA 3RUBL 1TKTA 5HI7A 1GXTA 5F8JA 2ZKTA 5KFMA 1NM2A 1GXLA 4J7CA 3OD2A 2F8EX 3GIJA 3BS9A 1S6QA 4PG7A 1XQIA 2G2YA 3M9OB 5CABA 1CJUB 5DJBA 1NH7A 4OQJA 3MTJA 4GKKF 4ZA1A 2BOAA 3DDKA 2IM1A 4CLWA 4XIUA 1EQMA 1UJ6A 5ETOA 1TKDA 4RPFA 4NCBA 1MWQA 1RBAA 5IC4B 4RX6A 3GQCA 4ILMA 2HGMA 1M5VC 4A48A 1F5CA 3TZWA 3I0RB 2AX1A 3JYTA 4DSEA 3LH2S 2CDRB 2Z2YB 2CQIA 4DL2A 3U1NA 4R5PB 4J9VA 4CTAB 2DGSA 2CJAA 1WG1A 3CJSA 5I3PA 1HHQA 3PRVA 1Y00A 3CD5A 2OPRA 2V2ZA 1BQNB 2YKPA 1EAYC 2HAFA 1FJGJ 4AUKA 5ETKA 1O51A 2KVQE 1FX2A 1SH3A 1Q95G 4CZCA 4DS4A 2E5JA 1UPPA 2OPRB 1AZSB 1FK9B 2Q79A 2P9CA 4B3TJ 1Q1KA 3GSIA 5HSPA 5DGBA 3KLFA 2ROEA 1KTVA 4JB8B 4QIFA 1CLFA 2BQUA 1S1XB 3LW5C 2IM0A 1LFPA 1WSVA 3BSAA 4B3RF 2HFNA 4DUYF 1X4CA 3I31A 2VUGA 2YQ3A 1Q7LB 1JLEA 1YWXA 3KG0A 1UVMA 1LQ9A 3OTOF 4DBQA 3M6WA 3GJRB 1RB0A 3PX6A 2DPIA 3SCKE 1IN0A 5BYQA 3HZGA 1VCTA 3CCTA 1HQUA 2DY9A 2X3DA 2OFHX 1KBRA 1I1GA 5GMDA 1DJ0A 2OEJA 3RAMA 1N52B 3GWCA 2XMVA 2YKOA 3MMJA 3KG1A 4P74A 1NZ8A 4RNOA 5CYQA 2DVIA 3TARA 2NR0A 2HQ3A 2XM3A 1V3RA 4B02A 4USKA 4IRKA 1F0XA 2WOMB 1S6PA 1BQMA 4DPUA 1P9QC 1N32J 1X4FA 3FEZA 4KE5A 1SC1B 4HTJA 4ZVQB 1M5PC 1FEEA 3IBWA 2ZH9A 3VGUA 4RW8B 1VRQC 2BMBA 3MGJA 3GFXA 3PJXA 3IG1A 2WK4A 2Z8QA 2KT5A 2YNGA 4Y00A 2VJVA 3DLKA 3G8QA 2HFZA 1N34F 5JMNA 3RR7A 1T9WA 2EFQA 5IWAF 2HQCA 2BV3A 1YBTA 4JYAJ 3DOKB 4JV2A 5H9FK 1IBMF 2SXLA 1DZ5A 3UNGC 4IYQA 1SB6A 1XNQJ 3PIOQ 3RZAA 5F0UA 5DZ6A 4OHWA 1TFYA 1KQFB 4IFYA 1RWPB 1WNEA 3T5JA 4MT1A 1HHTP 2DPJA 2V8HA 5C7PA 3B78A 5C24A 4LVOP 3HVAA 2YKMB 4OJGA 4NLDA 5KG0A 1IJEB 1JMTA 2PGCA 3N28A 2R7OA 5C24B 3AAWB 2L41A 2NUHA 2MQPA 1B7FA 3EJMA 1SC3B 1IJFB 3O8WA 2RKIA 2CJ9A 2V5HG 3MEGB 3VF0B 1RE1B 2BKOA 3PW0A 1IBKF 5L46A 4HHUA 4WKRA 2RKIB 2C3OA 3R2DJ 3CJRA 2DNQA 3LGHA 1Y4ZB 4EU0A 2QLJB 1M1HA 5ETNA 3EPIA 5IT9Y 2JNJA 1R0BG 3MFIA 3KNAA 5KFLA 2M8HA 2DH7A 2DGXA 4DCPB 2HEKA 2VG7B 2VFTA 4EBEA 2C3YA 4GC7A 3Q8YA 3TUPA 3QO9A 4O3NA 2HBRB 4QWAA 4FYWB 3HZEA 2OAUA 2DXEA 1RAAB 2EPIA 1RACB 3KLGA 4RW9A 1X60A 2DGWA 3IM8A 4PWUA 2GC8A 3W9IA 1YGYA 2JSXA 3LP1A 3BM7A 3T6BA 2KT2A 2FTRA 4RL1A 4DJBA 2LU2A 3KLGB 2JOQA 2OGUA 3FQLA 4RW6B 5L9NA 3Q8RB 4U95A 2XC9A 3BN4A 1HI1A 3OJSA 4PEOA 4IG0A 1GFWB 3L3CA 3R6LB 2L3MA 2G1DA 2GV1A 3CSKA 4O3RA 3N0VA 4ECRA 3X3UA 4Q0BB 1KS2A 2E1RA 1M5KC 4OYWA 4K2XA 4ZVPB 4FS1A 2MLZA 5KFHA 2V8PA 5D6GA 4RR5A 3Q8PB 1HA1A 4OFZA 3LP2B 2DXFA 3GLJA 1G3OA 5C42B 1EZZB 3SIPB 3FFIA 1V6HA 1Y9OA 1VRTB 5IOLA 1CULB 1XR6A 5HANA 4OX9J 2IYIA 4F4AA 3RRHA 1FKOB 4DV6F 4P2FA 2IFXA 1OYEA 3A8JA 4LRFA 1B0PA 1E6YA 4KTQA 1GNKA 5KFJA 3T19A 1HD1A 3VAHA 3MUTP 2XLJA 2BRLA 4RWXA 1RYRA 1RWNB 1T9VA 2KHDA 2HNZB 4PG6A 5LXRA 1MN7A 1SV5A 1HKAA 3P6YC 3F41A 3OVAA 3UI3A 2EXUA 3DM2A 2C2KB 3PFOA 3RW6A 3QRPA 3IS9A 4RO0A 3BSCA 3RU0A 3SSSA 5IT4A 1JNZB 4NLQA 3BSOA 1NBEB 2JEJA 1QAXA 4R8UB 2R2RA 4KHPJ 3W1YC 2CQHA 3MOJB 2H9ZA 4DV4J 3JAMY 5KFAA 3DMJA 2H3EB 4B9SA 4LQ9A 4EUVA 4OI0A 3CMAS 3CJ3A 1Q0NA 5HQLA 3NAIA 1MROA 5DLFA 1EKRA 4E8UA 2B4PA 3N5FA 1ZM9A 2VICA 5HO4A 2LQ9A 2WBMA 4KQZA 2JH3A 3L7UA 1K8AT 3P96A 3HO1A 7AT1B 2MPUA 4ICLB 4EWTA 1VR6A 4G1QA 2BRKA 1VQ4S 4M5NA 2XS5A 2JC1A 1P27B 4WBFA 1RTIB 2N3OA 2LCWA 5A0YA 2DEJA 4G1QB 3KUEA 3I96A 3W5YA 4QZVB 2B9YA 3QAUA 1K9MT 4Y65A 4NOHA 1KQSR 3PYEA 1FDNA 3AFGA 3PO4A 4PG4A 1BLUA 3K0JA 3P3DA 3I56S 1PYOB 1J2VA 3J7ZT 3OL6A 1VLYA 3T6JA 2DNLA 2NUUG 4I6YA 1R31A 4J9NA 4A8SA 3CCWA 3HFVA 3JSMB 4EZ9A 1FE0A 1VQMS 1NJZA 3HHEA 3K59A 2OSRA 4I1TA 3PYGA 4X4QA 1YI2S 4FPIA 2R7WA 4ED0A 5CH7B 3NY0A 2WRMA 5L1KA 1NHUA 4FF2A 3OL8A 4K4ZA 3DXBA 1WKKA 2DNZA 2Z56B 2D3OR 1RXOB 2VQEF 2W7AA 3MPWA 4K7QA 1NDCA 4RBVA 1R8BA 2QJ3A 3DLEB 1V3ZA 3D1HA 1PO6A 3FZ2A 1D0EA 3AOBA 2FIUA 1MU2A 4CNZA 2KVIA 4JI2J 5HK4A 4DR4J 4C3LA 2UUAF 3SCLE 4F4XA 5AJ3F 3UNYA 1FXDA 1YZ6A 2GQCA 1XTZA 2CNKB 5D4PA 5E33A 3NGRA 3W8GA 1BHNA 2GHWA 5JUMA 2YX1A 1FNOA 3R1HA 3PV8A 3TEHB 3W65A 1RHJB 2FLOA 2CADA 4DPTA 1C1CB 2H1YA 4TQRA 3D2WA 3GJQB 2NXCA 3U1LA 2QL7B 3RJMB 1TL3A 4PABA 1AW0A 4DZ6A 2I6WA 3MEDA 5A2QY 4JOUA 2A1BA 4HHHA 4ED4A 1NK0A 7FD1A 5IC6B 7FDRA 5L1JA 3DLHA 2CXEA 1PBUA 2CQ0A 4F67A 2WVCA 2ZM6J 1M1KT 2QC3A 3V81B 1FDDA 4QWCA 1S0NA 2L08A 5I4MA 1N0UA 2VDIA 2AU0A 1LOUA 4M63A 2E5GA 1U6FA 2V4JA 2MKJA 3CD7A 3BDPA 2EFOA 1KWMA 2IBKA 1K0VA 2OPPA 2FJEB 1B4SA 3MMBB 3I5CA 3DRRB 3LP0A 4OHYA 3V6JA 2IRXA 3BQ0A 2XULA 1FKPB 1U49A 1JLBA 2DR6A 3Q2SC 4JV5J 4QR2A 1TK8A 2XI3A 1U2FA 2V2VA 4X4VA 3LP0B 3UFCX 4ALZA 3KJVA 1C0UB 3K8VA 1U02A 2HS0A 2QA4S 4AE5A 1V5IB 4LT6A 2ABYA 2GMHA 3QT5A 3KMQA 1YX2A 1IQZA 3FCVA 1J5OB 4NA1A 3DGVA 4K4XA 3QSIA 3V4IB 4FNIA 3U02A 3PXGa 5E2QA 4NLSA 2HRUA 3VAGA 3QT6A 4NLXA 4B3MF 3B4MA 3UD3P 1Q7YT 4LIRA 4Y2IA 3IGVA 2J76E 5KT6A 1N6QB 2OIHA 3TA1A 3W3SA 3VGTA 5CYMB 2UUCF 1ZAXA 2EI5A 3W9HA 3NGSA 2ZH1A 4DR5J 2EKYA 2JFKA 2XZDB 3C66A 4AL7A 4IOCQ 2IJFA 1OSCA 1FRXA 1QUPA 3BR9A 3MCSA 1UJ4A 2MZTA 2O66A 3QJJA 5IM0B 4ZCMA 3E51A 4U6PA 4CRJA 4HL9A 3UW1A 4YY3F 2MSSA 3MPVA 2HIYA 4FF3A 4XPCA 2AYMA 4QYRA 1HNXF 2V8GA 3KK2A 4FXWA 2VPYB 2FVQA 2GVZA 2X1BA 4I6AA 1FVQA 2VBWA 4QW9A 1NDPA 2AT1B 3R5BA 3WC2A 3IWLA 1HNWJ 2FC8A 4ZPVR 3KK2B 1IKWB 1BY9A 1VISA 4RNHA 3VWSA 2XY5A 5KT5A 4NCGB 1HWIA 4URSA 2V2QA 2ZHAA 1N36F 3D1OA 3KLHB 2W8KA 3QQCD 1NB2A 3I87A 3UVJA 3IWNC 2Z2ZA 3FCWA 5KFNA 3V6KA 4BC7A 2PMWA 4QIEA 2G2ZA 4ZVGA 4F04B 3OTDA 4DPXA 4LR9A 3E3XA 1Y0HA 2DIVA 3H0PA 1KQKA 2YQ1A 4LRAA 1SH0A 4C6AA 1AFIA 1XMQF 1GTHA 1TTHB 1NLKL 2EC2A 3NS5A 2DBBA 2YPZA 4EEYA 2F8HA 3UE2A 4ZJQA 4DV2F 4ATNA 3M05A 4A8MP 1A0OB 3DLGB 3CPWR 5LMUF 3ZNUA 1IBLJ 1KTQA 4TYAA 5J2NA 1HNIB 4C98A 4EYHB 1VQLS 1C1BB 4DSIA 3KLEB 3RB3A 3TJ9A 1CJVB 1NDLA 2QE5A 5IV3A 4OLOA 5J2NB 4C8NA 1YDLA 2ZOMA 3HKZD 1FTRA 5DM7Q 1P1TA 5GMEA 1Y5LB 4JI3F 2CIMA 4B3OA 1CC7A 2UXBF 2QL5B 1BUXA 3M7VA 3PTWA 2V50A 3GMGA 3FUYA 4JI6F 3TZYA 3MCOA 1RHKB 1ZBTA 1EKSA 1UW4A 3VGVA 2WONB 3M4XA 3C16A 2MDAA 3SSRA 1D9AA 3UD5A 2JVRA 2R8JA 2RT3A 1AUSL 2W9AA 1D3WA 3HSDA 3F73A 1VC5A 1J5EF 2FHKA 1R89A 4PWWA 1EP4A 4NYPA 4QYZJ 1IR0A 4P52A 2YKNB 1NSPA 1UWAA 4OZ5A 3KWMA 3IAM9 1QE1B 4MKYA 2D3O1 2KRRA 4KT0C 1KLMB 3N6NA 3P49B 3PZPA 4P75A 4RUHA 2CJKA 5JJBA 2MKSA 1KP6A 1KOHA 2OPSB 4K0KF 2MGZA 2NXJA 2CYYA 4DR2J 2UUWA 2F9JA 2DISA 2H4WB 4Y0FA 1G2EA 3Q23A 3G86A 1WI6A 5RUBA 1C0TA 1G1XA 3N6LA 3VVTA 2HS4A 3EZUA 5GAEI 1QDUB 5DDQC 2HVZA 2A0FB 3UQSA 4UY85 1GMUA 1Y11A 3DRPB 3AT1B 3A1YG 4MYTA 3M2RA 1R6YA 3DOLB 3BZQA 2BW7A 5AE3A 4GKKJ 3DU6A 4MIBA 1Q5YA 4ZP7A 4WZQA 1Z2ZA 1RHRB 1U09A 2HQFA 2HIQA 3UN3A 2HWHA 2RF2B 1TMMA 4ZVFA 5C25B 1M5HA 1Y10A 2PI4A 2RAQA 4FYYB 5LT5A 5DG7A 3MPYA 3VGSA 3QGIA 3OXGA 4EZ6A 2XGPA 4KB7A 4R0JA 2R4FA 4IG3A 1FJCA 4A8XA 2GA7A 2CPXA 1CS4A 2XMMA 2XSJB 2GJFA 4USTA 2ALZA 1RHQB 4J91A 5HMYA 3B8HA 3DRSA 1FRKA 4QCLA 3PYFA 5J1PA 3BKFA 4P9SA 2WZ1A 4PWDB 3OJUA 3CB4A 1VQKS 3I9V9 3PY8A 4F4YA 3ZZ0A 1H73A 3I4PA 2QN6B 2HS3A 2E7WA 1IQTA 2GIFA 3HHLD 5A8KA 1S1VA 3MCNA 3MWBA 1UP1A 3MM7A 3THPA 3CXCR 2LLZA 3V5RA 4TU8A 2LYVA 4C0BA 2E1MC 4FDFA 3TUIC 1S1VB 4DUYJ 5LL6d 2QYGA 2A2CA 4U8YA 3ITHA 5HVFA 2DHXA 1UVNA 4KHMA 4PQAA 1CJTB 5KTQA 2M7SA 4CCHA 1RAHB 2IAJA 4OYOA 4J9SA 1H72C 2DH9A 3HVTB 5K8MA 1TUWA 3RB6A 1HPZA 5EX0A 2KTQA 3M8ZA 4OYZA 3KYLA 3PIPQ 1HBMA 1RHMB 3TVYA 1N5SA 3ET6A 1S48A 3H5XA 2WBRA 3LPEA 2YKQA 4ZMMA 3GJTB 3QGGA 3OR2A 2GHVC 3TANA 3AD9C 3CJTA 4OI1A 1DARA 2UZAA 3DHWC 3R7BB 4DN0A 2D1CA 1RWOB 5KFBA 1SL0A 1H6KX 2XG8A 1WF1A 4IO1A 2PN6A 1YRUA 1YJRA 1RWMB 2GW8A 2CNNB 2RB7A 2RIJA 2AGPA 4OL8A 3RRKA 2MQNA 4DXLA 2E5HA 1RKJA 4DR3F 1RTHA 3BH6B 2PA8D 3OVBA 1XWLA 5KFGA 1FRLA 1V3SA 2VG6B 1VJQA 2B4VA 2PEBA 2CG8A 4KGVB 5E5NA 1VQYA 3IC1A 3LA0A 1I94F 1U47A 3MOZA 4MK8A 2DGVA 1XERA 4O44B 2ZHBA 2RNEA 1FE4A 2BR0A 2VOOA 3QGHA 2OD4A 2VBZA 4M5JA 2YXLA 5B08A 3HM9A 4C8OA 3FEYB 2FQQB 1TL5A 4GVLA 1RP5A 3OV7A 2ZZTA 1Y5NB 3AD7C 4KPCA 4Q7AA 3Q89A 3D6FB 2Z57B 4M5MA 1TL1A 4LFBJ 2D9PA 2OUGA 4OX7A 5DS7A 2NXNA 1VQOS 2UXDJ 3BH7B 1WORA 2A6OA 2XS7A 5HVGA 2E9ZA 3SI8A 5D4NA 4HEA9 4K5SA 2YTCA 4RW4B 4NLRA 5DQIA 4EMDA 3FJ2A 3FRYA 5GAEU 4CT8A 3DI6A 4NXMJ 2G1HA 2ZC4A 3SBMA 1HL6A 1JLGB 2NZCA 2F63A 5F8HA 4K59A 4OI3A 1URRA 5CAAA 4WKYA 2KYZA 1LW2B 2VFRA 3CDEA 5D4OA 3T5HA 2CG4A 1IKYA 1P1LA 3KJQB 2JL9A 3BGUA 2J0SD 3C46A 4FKXA 4PPDA 1T03A 1AA1B 3OSNA 3R5GA 3VV2B 5GAHI 2W2OP 1PAUB 2R9LA 4C11A 4DV5J 1H0HB 1QSLA 3MMCA 4B3TF 2CJXB 2CJBA 1U0HA 2AHOB
chains in the Genus database with same CATH topology
5F8JA 2HHHF 3UR3C 2ZKTA 2BDPA 1RT4A 5KFMA 1LW0B 4BWMA 3DM2B 5F9NA 1GXLA 2FB0A 2ZHOA 3WC0A 3M32B 2F8EX 1K73T 3GIJA 3BS9A 3IS9B 3RYLA 3KHGA 2XS2A 3V6DA 1W25A 3IR7B 3K58A 5L39A 2WONA 1S6QA 2UP1A 2VG5B 4U7UK 4PG7A 2HWIA 3M9OB 4YQWA 2YWHA 1F5BA 1FDBA 1NH7A 4OQJA 5DJBA 3MTJA 4YB5A 2ATLA 3DLBA 4IRCA 4GKKF 4ZA1A 2DHGA 3DDKA 2IM1A 2DIUA 2R8IA 1U7LA 3CVKA 4O4RA 2CVEA 4OHVA 4CNYA 4XIUA 1JJ2R 1UJ6A 2PDAA 4OZ0A 2VQFF 4PR6A 1BWEA 1FERA 4ZVHA 3W2WA 1TKDA 1VQ5S 3R5AA 4GO5X 4IFVB 5SZTA 1R0AA 4NCBA 2F3JA 2DITA 4LF9F 1N5TA 1RT7A 3QJPA 4QQBA 4PXBA 4RX6A 3GQCA 4ILMA 1Q8LA 4K4UA 4FVMA 2HGMA 1M5VC 2RD5C 1F5CA 4A48A 5J2PA 3DMJB 2OMLA 5GAGI 1CVJA 3I0RB 2AX1A 4BC9A 4F4WA 3JYTA 1KEKA 5DETA 4DX8H 4DSEA 3LH2S 4IO9Q 1MROB 1R0AB 2FVCA 1W2BR 3CDBA 1ZPWX 2CQIA 4DL2A 2XGQA 2IMOA 2IM2A 3U1NA 2YKNA 3MEEB 3FSYA 2BABA 3IRXA 4ZS6A 4R5PB 1SJ3P 2RILA 3TAMA 4WF9Q 1MWYA 4CTAB 2DGSA 2CJAA 1QE1A 1WG1A 4X4TA 4UQTA 2FHJD 2V9WA 3MECB 2UV8A 1SJFA 3CCJS 5I3PA 2FJXA 3PR5B 1RWUA 2EG2A 4O0IA 1EETB 1WHXA 1KLMA 1XC9A 1S9EA 2GIQA 3FCHA 2A2DA 3IAS9 2FLNA 2ILYA 4WFYA 3LANA 4B9LA 2G9OA 1OPIA 1Y00A 3CD5A 3L09A 2DR9A 1NRKA 1U2RA 3ENVA 2YH1A 2OPRA 3CTRA 1BQNB 3FMBA 2OPSA 2YKPA 1C2PA 4HI2A 4AUKA 3R1LA 5DRKA 3ZC4A 1O51A 3C6UA 1S9EB 2JVOA 3CF5Q 4EBDA 1SH3A 2UVVA 3BDEA 4CZCA 4NLGA 2IYGA 2XMTA 3MD1A 3G6VA 4DS4A 2O5DA 1U4BA 1E6VB 2E5JA 2VD3A 4TLRA 4ES3A 2GO9A 2PO4A 2OPRB 5A0YB 3G96A 3IR6B 1FK9B 4YR2A 4K4YA 2HQIA 4WE1B 1SJQA 3SDEA 1DFDA 3C6TB 3T1AA 4EGLA 2Q79A 2P9CA 3PEHA 3DNCA 4NZ7A 3DN9A 1Q1KA 4P7VA 4MH8A 1T95A 5DGBA 2M5YA 4M8LA 3KLFA 2ROEA 2MY8A 2MQQA 3OFFA 3QMQA 4ECXA 1KTVA 3GSDA 3E8OA 1NK7A 2VC0A 3DRPA 1NKEA 4QIFA 2E1CA 3DFEA 3UDCA 5KFDA 2ZH5A 1T8EA 5B0FA 1URNA 1P6TA 1XNQF 1CLFA 3GFHA 2W4PA 2BQUA 1S1XB 3HVRA 2G13A 3O44A 4HI1A 2HHQA 3LW5C 2IM0A 1LFPA 3DOLA 3BSAA 5F3ZA 4B3RF 5THWA 1L3UA 2W9BA 4KC5A 1TVRA 1X4HA 2HFNA 4RUCA 4DUYF 1TP7A 1DTTB 5G4DA 3KK3A 6FDRA 1X4CA 3I31A 1MSWD 4CH7A 1S1TB 2VUGA 2YQ3A 1Q7LB 3OUYB 4ES2A 1JLEA 1YWXA 1WACA 3KG0A 1LQ9A 1UVMA 3OTOF 2DNGA 4DBQA 5KFPA 3M6WA 2RF2A 3PX6A 3H59A 2B4OA 3PX4A 2DPIA 3QZ8A 5C25A 2C2RA 2LDYA 3WDOA 3CC2S 4Z37A 3CIZA 3SCKE 3SMZA 4C9DA 1IN0A 5BYQA 3HZGA 1O8BA 3KK3B 3KNGA 3CCTA 4ED2A 1VBZA 4IUFA 1HQUA 2LXFA 4EO6A 1L3TA 4KV8A 4Q5VA 1MWZA 3IRWP 2OFHX 4URQU 4ZPBA 1I1GA 4OZJA 3RR8A 1S79A 1DJ0A 1SXLA 4LSLA 1SKRA 3M2VA 4NXNF 2DNNA 1N52B 2LKZA 4USJC 3RAMA 3RAXA 3GWCA 2E7XA 2XMVA 2YKOA 3MMJA 2FJAB 4MKAA 2C2DA 3KG1A 3TR5A 5KFXA 1T7PA 2B3TB 2GQ2A 4RNOA 1HYSB 5K8OA 4N77A 5CYQA 2B7CB 2IVYA 2DVIA 3TARA 2ZH2A 2NR0A 1GX5A 2QV6A 2HQ3A 1IKVB 5H9FJ 1UFLA 2R7SA 3S7RA 1V3RA 3TYTA 4B02A 4IRKA 2XSJA 1F0XA 2WOMB 1S6PA 1BQMA 3R5DA 2ZH7A 2R7UA 2X1FA 2Q3PA 5KFTA 4H4KA 4A47A 1P9QC 1FNMA 1X4FA 2AW0A 1WHYA 2O3DA 3KLIB 2OJ3A 3NMRA 2N4CA 6FD1A 3FEZA 1MU2B 2MKCA 3DGPA 1RTJA 2EWHA 2G0CA 3DC2A 3O3LA 1VGYA 4KE5A 3EX7B 4HTJA 4ED7A 2KJVA 3HP6A 4CO5A 2YWGA 2LA6A 2ZE2B 3H40A 1M5PC 1FEEA 3UCZP 3IBWA 2ZH9A 4IQXA 4A8KA 4RW8B 4ZP8A 3MGJA 2GGPA 3GFXA 3PJXA 1WTFA 3IG1A 4KFBA 2WK4A 2ZH3A 2CVIA 2Z8QA 2KT5A 4HVZA 2F4VF 4PWDA 2YNGA 1LKZA 3CJ5A 4Y00A 4RNFA 1IKXA 2AF6A 1KD1T 4ZPDA 4YFUA 3DLKA 4TXSA 3G8QA 1G7CB 3DXSX 1KLNA 4DSKA 1RT6A 4OV1A 3M6XA 2RUGA 2HFZA 5BYRA 2YVSA 1N34F 3ZZTA 2GGPB 1UL3A 4KFBB 1REVA 2IC3B 3RR7A 2EFQA 5IWAF 5I3UB 4DG1B 2BV3A 4C8KA 2LU1A 4QWEA 1F5AA 3K5OA 4MFBA 3SV3A 1FXLA 1NH8A 3GFYA 3DOKB 4JV2A 2ILZA 1TL3B 3F44A 5KFOA 1IBMF 2HLUA 2SXLA 3QYYA 4LFAF 3HX9A 1DZ5A 1N33F 3UNGC 3I55S 1HWLA 3CEDA 2VOPA 1CC8A 3JB9k 3MEDB 4IYQA 1SB6A 5F41A 1UVLA 1RJJA 5LJ5Y 2FLPA 3PIOQ 3RZAA 2JJ4D 2WAQD 4NLOA 5F0UA 3UPFA 1NZAA 2RH3A 4FZVA 1FJEB 4CQ1A 4OHWA 5KG3A 1TFYA 1KQFB 4BBYA 4H4MA 1GXUA 4IFYA 4CI0B 4NA2A 3H2LA 2CFXA 3CD0A 4DFKA 1WNEA 3T5JA 4XPEA 1AFJA 1SUQA 1HHTP 3L7PA 3OR1A 2DPJA 3M8QA 4RBUA 2V8HA 4IR9A 3HJFA 3H2VE 3LAKA 3W2VA 3C3LA 3B78A 4UOCA 5C24A 4LVOP 2XNRA 2V94A 3HVAA 3HVTA 4F26A 2YKMB 3H20A 4OJGA 3LWLA 3NS6A 3HVWA 4OHZA 4NLDA 5KG0A 3M1VA 1IJEB 5L1LA 1JMTA 3N9UC 2KZMA 2F7VA 2JLEA 1Q79A 1D1UA 1WEYA 2V4JB 1ULRA 4Y28C 2PGCA 1FRIA 3M8QB 3N28A 2C3UA 5K14B 2R7OA 2JHEA 3W2VB 1QVFR 1N5QA 3AAWB 3PEJA 2NUHA 5C24B 2L41A 5CYJA 3QWUA 5I42A 1DTQB 2AYEA 2KB2A 1FRJA 3NLCA 2MQPA 2XWYA 1B7FA 3V2UC 3GYXB 2FJDB 2EC0A 2M0GB 5HROB 1IJFB 2OPPB 1SC6A 2MKHA 3O8WA 2XMWA 5HMZA 2RKIA 1UFWA 2CJ9A 3QZ7A 3OL7A 4LF8F 1TQLA 4AXJA 4X84A 4OZ1A 3I6PA 3KMSA 1TL4A 2W25A 2KXFA 4X62F 4J9KA 1TAUA 1JLBB 2V5HG 3RBDA 4TLQA 3NMAA 1KFDA 3MEGB 3VF0B 4ECWA 2EFNA 3T1HF 1S4FA 3PW0A 1IBKF 4I7FB 2AJQA 1Z4UA 2CKWA 2JZ5A 4UY8T 3PR4A 2Q6BA 4WKRA 2RKIB 2C3OA 2K2PA 3OTBA 4GMKA 5E3RA 3TNVA 3IFEA 4U67Q 3KJVB 4AL6A 1KSPA 1HBOB 2DNQA 4EU0A 1Y4ZB 4ED5A 1LWFB 3CDUA 5IT0A 1WHWA 4DLGA 5KT3A 3EPIA 3H2UB 4X66F 3JTNA 5IT9Y 5F8IA 3MFIA 3KNAA 2QO3A 1YSJA 4MK7A 2PT0A 1A9NB 2OH2A 4CIOA 1U1RA 5KFLA 2RS2A 1TFWA 1K1SA 2M8HA 5CD4H 2QRRA 2HGLA 2RVJA 2V8VA 2N4DA 3M8SA 2XCPA 2L9NA 2DH7A 2DGXA 2WSCC 1KVIA 2M4MA 3MM9A 4NYOA 2LQ5A 3UR0A 4DWIA 2VG7B 2B6AA 1X4GA 4H4OA 4RNMA 4DL6A 2VFTA 4EBEA 2C3YA 2FVSA 5IZHA 4GC7A 3BQ1A 3QO9A 1B64A 2WSFC 2UV8G 2P9GA 4O3NA 3M6VA 3GIIA 2VG6A 3SQGB 4ZPWR 4QWAA 4EYIB 2HFOA 5KFSA 2ZJRQ 4J9QA 2HRYA 1ROFA 2K7KA 1RISA 2HLTA 2VFUA 3HZEA 2OAUA 2EPIA 1IXKA 2HHVA 1OQ6A 4H4OB 3KLGA 2BQ3A 2QA1A 4O44A 4RW9A 2DGWA 1ZTWA 1VQNS 2FUG9 2LQJA 4ID5B 4DL4A 4PWUA 4JV1A 2GC8A 2D41A 2J0XA 1YGYA 1NK6A 2JSXA 3LP1A 4O23A 4CO1A 4ZK7M 3BM7A 4WFBQ 3U7JA 3T6BA 2X1AA 2KT2A 2IMWP 4X4UA 2FTRA 3M30B 5GAGU 2EG1A 4DJBA 3I4HX 1S9FA 2LU2A 3KLGB 4WTYA 2CPJA 2JOQA 2B56A 2BQRA 4ZKAA 3BR8A 1R8CA 5EX3A 3G4SS 2C22A 3FQLA 4MK9A 2ASYA 4RW6B 4L6V3 1UMJA 2AGOA 5L9NA 5KG2A 4OZLA 5GADI 5J1EB 3Q8RB 1F2GA 3TA0A 2YKAA 2XC9A 4PUOA 3BN4A 1RT5B 5DLGA 1HI1A 3NNHA 3LF0A 4HDHA 2PEHA 3OJSA 4ZHRA 2NS1B 5HLFB 4IG0A 1N5YA 5H1SV 4AFFA 1LFWA 4TKTA 3L3CA 3MTKA 4FPRA 2ZNYA 3RAQA 1L3VA 1K0TA 2OPQA 4KR0B 4KKOB 2D7SA 3S6EA 2L3MA 2G1DA 3NCRA 3EGZA 2GHPA 2XY7A 1T02A 2GV1A 3CSKA 4O3RA 3DLLQ 3GR1A 3N0VA 4ECRA 3X3UA 4Q0BB 1KS2A 2E1RA 1N5YB 1M5KC 4RWWA 4K2XA 3OPKA 5AXLA 4TY8A 1N48A 5IQ6A 4B3SF 1RT1A 3G6XA 4FS1A 4IH7A 1ZZFA 4JI4F 5KFHA 1S9GA 3FQKA 3HPOA 3VZIA 5D6GA 2BANB 3Q8PB 4DV4F 1HA1A 3DCAA 2GX8A 1OPZA 4RW4A 4WYLA 1I94F 1Y7PA 4OFZA 3LP2B 1SI9A 4TY8B 3CCES 1KONA 5HMWA 5KFKA 1G3OA 3ZZYA 5C42B 5KG5A 5FDLB 4MIWA 1VK8A 3QIPA 3X1LB 1QSSA 3FFIA 1JLGA 1V6HA 4W90B 1Y9OA 4YMEA 3W7BA 1Q8IA 1VRTB 3ICLA 1WG5A 2UVUA 2DGUA 3BB5A 1OWXA 1XR6A 5L38A 1LW2A 2AJ0A 2XNQA 3M9NB 1A6LA 1HNZF 2EVZA 2JRSA 3PJWA 2IRYA 1WF0A 2IYIA 4DPOA 2B9XA 1OSDA 2HMIA 2IVMA 5LXYA 1NNDA 4YR0A 5ADZA 3RRHA 4ELVA 1FKOB 4DV6F 4KO0A 4LFCF 2IFXA 5DO2A 4C8MA 2CQBA 3QJLA 3DHXA 3K5NA 3GILA 1H7WA 2DH8A 3CIMA 1HQEA 1B0PA 3N79A 2DD8S 1E6YA 3LO3A 3VR1A 1GNKA 3CDAA 5IFMA 5M2UA 5KFJA 4KTQA 1FESA 2BM0A 2C3MA 5F3TA 2M9KA 3N5BA 4Y34A 3T19A 1VBXA 1UWBB 4XDCA 1HD1A 1M0SA 2DNOA 1RT3A 2EK1A 3VAHA 4A8QA 3MM8A 3MUTP 4CO3A 4QU7A 2AV5A 3AQPA 2MHNA 4F25A 5FD1A 2BRLA 2ZBIA 4QWBA 2XLJA 4RWXA 4OJ1A 4PG8A 1U48A 1RYRA 2F40A 1FJGF 3DLJA 4PXDA 5J1NA 1GH8A 4AL5A 1KR4A 2Q43A 3PW2A 5CXTA 2KHDA 2HNZB 2YNFB 4UW2A 2KM8B 5HP1B 5HBMA 4PG6A 5LXRA 1NK9A 1SV5A 2HG4A 2XMJA 2J7UA 1U1LA 1QTMA 2BOPA 3P6YC 2MSTA 1SH2A 3VAFA 3PFEA 4BHQA 3NP5A 4FXDA 3F41A 1QSYA 3PNIA 1NJYA 2XI2A 1RQ0A 2GMJA 5CHCB 3HFKA 3OVAA 2VASA 3UI3A 1LW0A 3MM5B 2LQBA 3DM2A 2UUTA 3MD3A 4RU2A 3CE8A 1JWWA 3PFOA 2VFVA 1FVSA 3M32A 2J6TA 3M2UA 3RW6A 3QLHB 3IS9A 1SQEA 1NK4A 1FD8A 3J80Y 1WEZA 3BSCA 3RU0A 2FVRA 2VONA 3SCJE 3KLVA 3ZZRA 3SSSA 5KFQA 2P6SA 3MR6A 2E1AA 1H3DA 1LWCB 1TV6B 1WG4A 2K1RB 5IT4A 1JNZB 4NLQA 4WFZA 3BSOA 4NRUA 2OFGX 3LAMA 2VG5A 3M8PB 2JEJA 1QAXA 4OIXA 4NL5A 3FRZA 5K9FA 4R8UB 3M2UB 5ITHA 3RB4A 4LUBA 4QOTA 1UAWA 4MKBA 4QIVA 4YR3A 4R0EA 5DDOC 5KFVA 1H98A 2R2RA 3IN5A 3E01B 4MJKA 1X8DA 4RZRA 5T7LB 2K7JA 1JLFB 1TK5A 2CQHA 2DNRA 3IGNA 2ASDA 2KDOA 3CCMS 3MOJB 2H9ZA 3P5TL 4IFVA 2BACA 1D9FA 4B17A 1FKAF 3BO2A 3BREA 2RQKA 3CCLS 3JAMY 2BZ2A 3QGPA 4BWJA 2RDJA 4U9RA 4PQUB 2IA0A 3C8YA 5KFAA 1C4CA 1FD2A 2RQ4A 3Q0AA 2N7YA 3DMJA 2DRBA 4B9SA 3I0RA 4LQ9A 5A8WB 1ZYQA 4EUVA 1Y5IB 4OI0A 3CMAS 3K8WA 3CJ3A 2LEBA 4K50A 4FP9A 3LWMA 3NAIA 2ADCA 3A8EA 4CO4A 1MROA 1ELOA 4TU7A 4EBCA 2J6UA 5DLFA 3PRBA 3BGFA 4E8UA 3U27A 2B4PA 3MEEA 3O1LA 4WK1A 4C0HA 4R5PA 1X4BA 1MMLA 3N5FA 2DHAA 1YBAA 4CTAA 4DR1F 4B3OB 3HXMA 4BS2A 2VODA 1ZM9A 3QAEA 3G6YA 3KK1B 3MECA 2KM8C 3NNCA 3DOMA 5HO4A 1HHSA 2LQ9A 2WBMA 5BJRA 1D9DA 1SL2A 1EETA 1YHQS 4KQZA 2E9RX 4JI2F 2JH3A 5LMNF 1JXEA 1K8AT 4L3NA