2G13A

Csos1a with sulfate ion
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
95
structure length
95
Chain Sequence
VTGIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major carboxysome shell protein 1A
publication title Structural Analysis of CsoS1A and the Protein Shell of the Halothiobacillus neapolitanus Carboxysome.
pubmed doi rcsb
source organism Halothiobacillus neapolitanus
molecule tags Carboxysome
total genus 25
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2006-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g13A01
4P7VA 4AXIA 2A10A 4P2SA 3H8YA 3PACA 5L38A 4RBTA 2A18A 4QIVA 3SSRA 5DJBA 4PPDA 4LIWA 3SSQA 4OLOA 3VCDA 4OX6A 3IA0A 3CIMA 2G13A 3CGIA 3BN4A 2EWHA 3MPYA 4DDFA 3NGKA 4AXJA 4RBVA 3NWGA 4P7TA 3N79A 4OX8A 3DNCA 3I6PA 4QIGA 4QIFA 4OX7A 3MPWA 4OLPA 4RBUA 2A1BA 3I96A 4QIEA 3SSSA 3DN9A
chains in the Genus database with same CATH superfamily
4Q7AA 1FRKA 5LJ5Y 3HD1A 3DHXA 4OJHA 2VFRA 5F8MA 3MTKA 1HW8A 4X64F 2G1DA 3DLKA 1VQ8S 3LP0A 2H51B 1KFDA 3SDEB 1IXKA 4LRDA 4YDXA 2C3UA 2EK1A 3FRZA 4E2FB 4TYAA 1KDNA 3BGUA 1V6HA 1ZBTA 2BM0A 2ZKTA 2Z57B 2FHOB 4J37A 1RA7A 4QWEA 2XS7A 2OO4A 1LWEB 3JS9A 3T5JA 2EWHA 3PNIA 2KFZA 3TO8A 2HURA 4IO1A 3KJQB 1YG0A 2PD1A 2U2FA 3I5CA 5T7LB 1N4LA 2YPYA 4F8RA 4C9DA 3W9HA 3RAQA 1ZA2B 3HSZA 1VI7A 2HLTA 2C2RA 3FCHA 4Y3CA 3B54A 3E01B 2HGNA 5BR8F 3I0SB 3R5CA 1DLOA 5DM7Q 1U4BA 5B0AA 2JVOA 4HI1A 1Q53A 3FCVA 2GJ2A 4OZ1A 4RW6B 1SL2A 5K9FA 5EWEA 3H5YA 5L1LA 1GTHA 1U0SA 5ETPA 2JSXA 3JQJA 5I3UA 4B3TJ 3M4XA 3TZYA 5KFSA 2H3EB 1H73A 3SSRA 2YX1A 1CS4A 5KG1A 4DV1J 3GV7B 3N4WA 4GC7A 1DURA 3CCJS 1N32F 3G82A 4XPEA 1XTZA 3G71S 2DR7A 4WU2A 5KFUA 3FQLA 2M0GB 3V6DB 1RAIB 2JJ4D 3L3CA 3LAKA 1HKAA 5L46A 1XMOF 1JQGA 3CD0A 1FFGB 1CG2A 3OQ2A 3MM7A 1HBUB 1R8HA 1NDPA 3AA9A 3CVKA 2NSBA 1KP6A 2CWXA 4RWXA 4WP9A 3M8PA 2ZE2B 2OPQB 4LQ3A 2DVIA 5KG5A 1D3WA 4RBVA 4OX8A 4AE5A 2HRUA 4Q44A 3DOMB 4QIGA 4I68A 1T8EA 2GNKA 3M2UA 2VKRA 2V2KA 4C8LA 2WSEC 3PJ9A 2YX4A 3M8WA 3QLHB 4QWAA 1Q8IA 4WE1B 4ZITA 3NRBA 4JYAJ 4NLTA 2WCXA 4PG5A 3OR1A 2V8VA 2HS0A 1P1TA 1FO1A 1Z2ZA 4WTYA 1FJEB 3PYDA 4OQJA 1XEZA 3KK3B 2QX0A 2HHHJ 5L1IA 2HVIA 3KUEA 1APSA 2I5JB 2ZM6J 1RTZA 3DFEA 1T9TA 1WHWA 1O0PA 3D6FB 4A8WA 2RF2B 5CHCB 4IG0B 3SXLA 1VQMS 1F2HA 2XMTA 4R8UB 4DR2J 1TKXB 2L9NA 1SH2A 1NPPA 4RNHA 1JNZB 5CA5A 3AT1B 5HROA 1K8AT 4X84A 2HLUA 3IP0A 1VQKS 2XULA 4HTIA 5C25B 3TA1A 3QFWA 2VU5A 2HW3A 3RAMA 4NI2A 1Y00A 3C15A 5KFPA 1WSVA 3CC4S 4ZCIA 1QTMA 2W9AA 2CPEA 5C24B 4RW4B 1KQFB 1M1KT 2KB2A 1BQMB 3KDNA 4NZ7A 7FDRA 2BOAA 3QWPA 2OFGX 2IJFA 3VV2B 2VPWB 3A8KA 4IFYB 4DU8A 3TI0A 1LWXA 3KLVA 1RAGB 1ZAVA 2QFIA 5GADI 3CJ5A 2XMVA 1RHQB 1DQ9A 3A4TA 1YBUA 5IV3A 5IT9U 2OPSB 3T1AA 3LOUA 2N4CA 3K7RA 2YWWA 2NYIA 2YH0A 2IVYA 1MN7A 4RU2A 3KJVB 2ZWOA 3BGRB 1FEHA 2HG4A 4OI3A 5FDLB 4NXMJ 4U96A 2QFJA 1T05A 1U45A 4RZRA 2NUUG 2LMIA 4HHHA 1HNVB 3U1LA 1PC4A 1AFIA 2QA4S 3OVBA 5HQMA 1RHMB 2LDYA 2ROEA 2RUGA 1NEEA 4O44B 4FF1A 1U02A 3C6UB 2UXBF 1OQ3A 1SIWB 2KM8C 3MMAA 3HHLB 3RBDA 3LA0A 4Y2AA 3Q2SC 4HH0A 1HPZB 4XAKA 1HBOA 2WHOA 4M63A 1X4FA 4ZP7A 1X4CA 2XSFA 4BC7A 1BY9A 5D15A 2ZITA 4LT6A 4DSLA 4DUYF 1YX2A 1ZAXA 3DLLQ 5C5JA 2ATCB 4PG4A 1TL7A 3ZFVA 5A0YB 4KFBA 5D6GA 1ZZNA 1XNQF 4AXIA 4DL2A 2FHJD 3AY0A 4YQWA 1GNKA 2AMCB 2CDRB 5B08A 1JLEA 2KDOA 3CJ3A 1TV6A 2WVEA 2AYBA 2EBGA 1WDTA 1AUDA 3E8OA 4LSLB 1NK4A 1RBOB 3O5TB 3K0JA 3KDOA 2RE1A 1FRIA 2VQFF 2ADBA 4JOUA 1MROB 1CULA 4QIFA 4C0OC 3RAXA 2HQDA 3K5MA 1W2BR 3R2DJ 2V4RA 2JEIA 4HACA 1RWKB 1MG7A 1K9MT 3IWNC 2F4FA 2NR0A 3PX4A 1RWNB 1IN0A 4USJC 2C1EB 1WSRA 3VALA 2PMZD 1GMVA 2W1BA 4K50A 3TUZC 2H4YB 4B9NA 1N5SA 1NB2A 2POKA 4RUHA 5DG7A 1SV5A 2FUG9 3V2UC 3T9NA 2AD9A 3QGPA 2C42A 1TR0A 2MMYA 2CNKB 4NMXA 1F5BA 1HBMB 4ZVHA 2LEPA 3RRHA 1T9VA 4YB5A 5ETVA 1SUQB 1AT1B 1H2UX 4FF2A 1WHVA 2MJUA 2KZMA 1LV5A 3MMCA 1XR7A 1NLKL 3VAKA 4PYDA 3WDOA 3UVJB 3JSRA 5HO4A 1JXEA 2GIQA 4UQTA 1FT8A 1S6PA 1B0VA 3EDRB 4DWIA 2H48B 4B3RJ 1YJ7A 2WOMA 2W7PA 3W8GA 3OPKA 4MJKA 3EDQB 3DRSB 5LMNJ 3J80U 1WG5A 3EGWB 1NHUA 2O5DA 3G86A 4UZBA 2ZJRQ 3QQCD 1RT1B 2GMLA 4NEYA 4KC5A 2NXNA 3HKZD 1AYEA 1XQIA 3GCXP 2B43A 4K59A 1Z1ZA 2HZAA 1JLQA 2KL8A 2HMIB 2MKSA 2BQ3A 2VPZB 2UXCF 3CIZA 4LF2A 2J0SD 2WSCC 2DXDA 2GGPA 1WOSA 1VQ7S 3RB6A 4DV0F 3NMRA 2GZOA 1N33J 3KTQA 1U7LA 1RACB 3JB9k 2CXEA 1X4DA 3I31A 5GADU 2CQ2A 3IBFB 3GWCA 3HFZB 1PIEA 4DQQA 3PVXA 1X4HA 4N47A 6FDRA 2ZHAA 2UUAF 2DGXA 4F50A 2BJ1A 4OYOA 1I1GA 2IY5B 2OPRA 3EE3A 4RW8B 3T5KA 4MK9A 3LTOA 3UN2A 4NL5A 1XR6A 1C4CA 2HFNA 2FGOA 4ZCLA 4Z2XA 3IMQJ 4CLKA 3B82A 2JEFA 5D4OA 4IDKB 2AZ1A 2DHHA 5KG6A 3HM9A 2XNQA 4NXNF 2X1AA 2OHDA 1SC4B 3W65A 1URRA 1DTTB 2GHPA 2W25A 2KH9A 3CULA 3HHNB 1CJVA 1JLBA 1EIYB 3GCWP 4TU8A 4NX9A 2Y1RI 4HH1A 2DO4A 4CTAA 5J2QB 2XTJP 3OXLA 4LUBA 4G1QB 4ID5B 4LJMA 2FLOA 2HVZA 1RWUA 2PT0A 4JI8F 3G8SA 4ZCKA 4FKXA 4ITSA 1MMDA 3FGVA 4UT4A 3H4DA 3QBCA 3OTEA 1S1TA 1TKZB 1WACA 3P8BB 1RT5B 1HNZF 1N0UA 4ZPCA 1N56A 3ISZA 4M5IA 1RXOB 2R8IA 2D74B 3R97A 4KPYA 4ZLNA 2APOA 3VAGA 3GB0A 4GVBB 4IOAQ 3CW2C 1VRUA 5HMWA 4V19X 3HKWA 1I94F 1HWIA 3GYXB 3RW6A 2BW7A 4NYPA 4DV5J 4Y28C 4ZMMA 2FHKA 4LFCF 1EETB 2YKMB 2K1RA 1HQEB 1W26A 4DS5A 3BB5A 3NCRA 2V63A 4ECWA 3LPYA 2VG7B 4ZVUB 3TW0A 1KNZA 3EVWA 4RLEA 4O4GB 2HWTA 1UZDA 2W7OA 1JLAA 4LFAF 9RUBA 3CJKA 1G4CA 4Z7CA 5HBMB 1NU4A 3DGPB 5LL6d 4A8KA 3RR8A 3MPUB 2W9CB 3MUVP 3J7ZT 2KO1A 1RU1A 3D66A 1T9XA 3NBPA 2G0JA 5E3CA 1X60A 4OI1A 1KQGB 4F26A 1FWPA 3HSJA 1NKCA 4DLEA 1I3OB 4X4QA 2WONA 1ZM2A 1PGZA 2H4WB 1LWFB 2GS8A 3SV4A 2WB1D 1PJ6A 2MSSA 2ZZMA 2DGSA 5DJBA 2MGZA 4NLRA 1U09A 1L5UA 2OFHX 1F2GA 2LA6A 4IFVB 4ED1A 1K1SA 2NXJA 2WVBA 4IG3B 2XMKA 2D9OA 2OEJA 1KFSA 4C3KA 4ZK7M 2RMLA 2ALZA 5F0UA 1CEZA 4CLZA 3C6TA 3D6TB 3GR1A 3D5MA 3SFUA 3GQCA 2GC8A 4PUOA 1BXNA 1KSPA 1F9HA 8ATCB 5LSLA 1FD8A 2DNGA 3QJLA 2QMUB 1TVRB 4OJ1A 2DR5A 5B0EA 4I2QB 4L74A 4X65F 1AW0A 1F3FA 4NLDA 3SYZA 1Q8KA 1C4AA 3DN9A 5L38A 2ZDPA 5KFMA 3U7JA 2W8KA 4C8OA 3IR6B 3L7OA 3DDIA 4KO0B 2MZQA 3T6JA 2FY8A 4K8RA 5CYMB 4OYMA 3CC2S 3KLHB 1VQ6S 4DSKA 3CDUA 1NH8A 4K5RA 1NK7A 4NCBA 2C22A 1U1LA 2M2BA 3BEGB 5T7LA 1YIJS 4GMKA 2C2ZB 1YRUA 3BSAA 2V2ZA 2WK4A 4JI6J 5E3AA 2L08A 3LANA 3MAQA 4LF4F 3EICA 3CDBA 1EZZB 1S10A 1GMWD 4JV5J 3MEDA 3G2XA 2PFFB 3I0SA 2IDEA 3LGMA 3CCUS 2Y3YA 2ZBRA 1Q79A 1VHIA 1L3UA 4OYAA 4DR3J 3V81A 3KK2A 3OL7A 1I51B 2IBKA 4KGXB 2B8QA 4DSIA 4PKDB 2P2CB 2W4CA 1DY3A 2XLJA 4U67Q 1L3VA 3I87A 3J81j 4FYXB 1RLDA 2ZNZA 1TFWA 2EXUA 4NWBA 3UO0A 4OHYA 2EBEA 2I1RA 1XMQJ 3MR7A 1JJHA 1IKYB 4JI4F 2OMOA 1HD1A 3D67A 3BN7A 3KLIA 4P73A 4B9TA 2IM1A 5HATA 2MQQA 2NXUA 4Y2IA 1JLCA 2KHCA 2ZJQQ 4ICLA 2ZD1B 4M5GA 1HL6A 4YEAA 2XGQA 3R5JB 3GSIA 4MIBA 2W2PP 3PJWA 5G0RA 3AFGA 3FCWA 2PSZA 3MOZA 1UAWA 1SIZA 3K89A 1DQ8A 3DOLA 2DNPA 2FJBB 5HJYA 1YGYA 3M6XA 3DYAB 3VAHA 5F41A 1YJWS 3AD8C 4LF5J 3AODA 1FTRA 4JV2A 1U8SA 2E66A 3AJ2A 4NZ0A 4FF3A 1IVZA 2CIMA 4I2PA 1HMVB 1IBLF 3ENVA 2C3OA 4PG8A 2CPJA 5KT2A 2YBVA 2YKOA 3ZTSA 1YHQS 2NLWA 1LNQA 2PA8D 1V3SA 1IR2A 4U8VA 1UJ6A 3DRYA 5B7WA 1D9AA 1VJWA 2DGTA 4ID8A 3C3LA 2KM8B 1XC9A 4WFXA 5D0EA 4PZVA 3UD3P 3M2VA 1SJ3P 1EB0A 2QIFA 4RU9A 4F04B 3D1HA 2VZ9A 4IG0A 1VGYA 2HAIA 5RUBA 3WZ0A 2RDJA 2LLZA 1FNXH 1WKLA 5F3ZA 4R8UA 3I9ZA 4FVMA 5H1SV 3FBFA 5IQQA 2AF6A 2K7JA 2HRTA 3ISND 2I8EA 1VS3A 2CYYA 3DLJA 3MCOA 4M95A 5C25A 2DGWA 1Y3KA 5DZ6A 5MLCV 1OPZA 1XJWB 4I0WA 3I56S 3C16A 1C0TA 2Y0SD 3H90A 3BYPA 4Q43A 4RW4A 1P6TA 1BQMA 4J9SA 3K57A 1NAQA 4DI6A 4JI3F 2UVWA 2OAUA 1WKKA 2A10A 1GX5A 4HT7A 3D28A 4OV6A 5DGBA 3JAMU 4LFBF 1ZM4A 1S0OA 2VJVA 1MW7A 2OIHA 3GJTB 1KHVA 4KQZA 1HNXF 4MIWA 1D1UA 3OW2R 2AKWB 1QTNB 4J91A 4U7UD 4L3NA 2DY1A 1H7WA 3KJVA 3OD2A 5DG8A 2DK2A 2GVZB 3F73A 4ERDA 2GO9A 1G3OA 1RT6A 2WBMA 2Z2ZA 3QT5A 1S5ZA 3TUIC 2CKWA 2R7RA 1Q82T 1HNVA 5AJ3J 1DFDA 4KR0B 4QYRA 4X4RA 4PXEA 2R7XA 4O44A 3I4HX 2R7TA 2DNLA 4P74A 2R42A 2NXCA 3P3DA 2C2KB 4WFBQ 4V19J 2BW2A 4KGKA 1AB8A 5DRKA 4OJ3A 4PG7A 2XGPA 2GJIA 3PCOB 3P4UB 4BHQA 4K7QA 2VBZA 3OTOF 3M30B 3MPYA 4ES3A 3DNCA 4MH8A 2EKNA 4KPCA 2F8MA 5A2QU 4EEYA 1RT3B 2VONA 1SVDA 1UP1A 2W2QP 3KHGA 3TZWA 4URSA 4OZNA 1S9EB 1N8RT 4H4KA 1RTDA 4N41A 3AHPA 2HRYA 4WKYA 2DXEA 2LU2A 1JNRB 4OLPA 1IQTA 2P6SA 1HW9A 3ADAC 2HFVA 2FGCA 2VDIA 1Q78A 5C42B 3D54A 5KFNA 4ZA1A 5EHHA 2CPIA 2CJKA 3NS5A 1RT4B 4LBIA 4DJBA 3AOAA 2RKIB 3CNQP 3B4DA 2Z56B 5DM6Q 2MJNA 1SH0A 2R2TA 2JLGA 4C2MA 4LF9J 3GR0A 3M8YA 5K5MA 2HZCA 2DHAA 3FJ2A 3QSYB 1H38A 1WC3A 4YB1P 2DB1A 2DCUB 1UEKA 2EFNA 3KK1B 2M70A 4HHUA 4DX5A 2MHEA 4DX7A 5ETTA 5FJ4A 3RW7A 3EWGA 4WXWA 5J2NB 1JK9B 2GFFA 3W64A 2BV3A 4DR5J 5JUMA 2CRLA 5KFOA 3DLEA 3BGFA 1SUQA 3OT9A 1RGVA 3MM9A 1VLOA 2OPPB 4ZVSB 5CXTA 2ASLA 1RAJA 2AJ1A 2ZVIA 2XWXA 5AXNA 1FJ7A 2MZ1A 2V4JB 1N36J 4H4OB 4ZP9A 3QFHA 4FXDA 4ANEA 3BQ2A 1LKZA 4CM2A 4Y65A 4H4MB 5K8MA 3NWGA 5ETLA 3M9MB 4KGMA 3TX0A 3GTYX 4IRDA 2VICA 3CJ4A 4UY8T 5AXMA 1N88A 4RBTA 4NCAA 4OHZA 3W5XA 4B9UA 3I0RA 1BLUA 2DNRA 3THVA 4DV3J 4C8NA 2DIVA 4MKYA 4ZDNA 1LOUA 1RTJB 4NA3A 4K4UA 3ENWA 2XI3A 4NASA 3LW5C 3CJ0A 4RUBA 4JB8B 2LQ8A 2LXFA 4QU7A 1IWAA 2VASA 3OLAA 2Q43A 2E1PA 4A4JA 3DI6B 2DISA 4WP3A 1VQOS 4B3OB 4H54A 4DSJA 5H9EK 3NCQA 5IM0A 2LA4A 4GKJF 5I42A 3T41A 5K8NA 1RKJA 4ZLPA 1FKPB 1X5TA 2VG6B 1FJCA 3F44A 4EGLA 4PG6A 1M1HA 1CPZA 3CMAS 1DJ0A 4OJGA 4V1Ak 3BN4A 1OYDA 1S1UB 2VOOA 1S0VA 3QAUA 3F0NA 4IRKA 2Z30B 4EBCA 3KG4A 1Q0NA 4WF9Q 1R3NA 4MYUA 3CCLS 5JVHQ 3G96A 2Q6CA 2E5LJ 4DS4A 3KYLA 1Q86T 1YTYA 3CCRS 3CCQS 4IDKA 4CYUB 2CNNB 1N6QA 4DQRA 1UKUA 3TAQA 3CCTA 4DPWA 1RBLA 4BWMA 2DBBA 3OHAA 3BF4A 2ZBIA 3OR2B 5KFHA 2E9TA 4ILMA 2VUGA 2DKOB 2QA1A 3I9V9 2FIUA 3MR3A 4ZVOB 2V34A 2Y1LB 1CVJA 1YK9A 2UUTA 5A6PA 3HHEA 2BRLA 2CNLB 1Q8LA 3M8QA 5JXSA 3MR6A 4OHVA 3DRPB 1RT5A 2BRKA 1KOOA 1PBUA 3CE8A 3CO0P 2XLIA 5IXUA 4QW8A 2IIHA 1Z4UA 3GP9A 4J9VA 3AB2B 1VQNS 1RU2A 3V6JA 4YP3A 4ES2A 1N5YB 4Q0BA 2RU3A 3HXMA 3IRWP 3CD5A 3J81Y 1IKVB 1QSLA 1RCXB 4X66J 5KT7A 3Q89A 3QYYA 1O51A 5GMDA 4DR1F 4L6V3 3OV7A 3N79A 3L95X 3MURP 2DHGA 4BS2A 2W01A 4O4GA 3IBCB 3VVUA 1B7FA 3OVAA 2BJ3A 3FBCA 4FN5A 4X62J 1SL1A 4P9SA 5HLFB 3H20A 4USIA 3GG0A 1HWJA 1NSPA 3DGPA 5E3RA 1KBRA 4OYZA 1X5SA 1M5OC 2HHSA 2DPJA 3LUYA 2FVRA 2BJ7A 3TOQA 4TY8A 1X31C 2BUNA 2KN4A 4PQUB 3IC1A 5CZXA 5D4NA 2AHOB 4I6WA 5D3GA 2BEFA 1J27A 1FFSB 4P2MA 1U1RA 3OFFA 5AE2A 1ULRA 4HI2A 3RRGA 2HNZA 5J2PA 4DR7J 3TAMB 2J9EA 1D09B 3PYEA 1QLNA 2QJ3A 2ZH7A 2CPZA 1JJ4A 4FF4A 1QAXA 4JI7F 2CQCA 1ZTWA 2HVEA 3BDEA 1UVJA 2Z2MA 3PYGA 3N9UC 5DDRC 3JYTA 3BKUA 4F36A 3NL0A 4JI0F 3AD9C 2YNIB 2LDIA 3BGOP 4LIRA 3R5GA 3VF0B 5B0DA 4U7UK 3PHTA 1X4GA 2B5JA 5A8WB 2N4DA 5IC6B 3UDVA 2A3JA 4X4SA 4S0MA 5BR8J 1IKXB 3R7BB 2X1GA 1MMNA 5HSPA 2BJ8A 4LSNB 3T9ZA 1TVRA 4I2QA 1E6YB 4O3SA 2RDIA 4DCPB 2GX8A 3DM2B 4CLLA 3ZZUA 5K14B 2LECA 2YH1A 4KY3A 5ETQA 3PIPQ 2YKNB 4ZHRB 1L3TA 1JX4A 4KO0A 2QLWA 3MR2A 3L7PA 4L76A 4KE5A 5DQGA 2QLXA 2W2OP 2Y8WA 2B56A 3NGTA 3LH2S 5AXKA 2G4BA 3Q0AA 4IR9A 5CCLA 1N32J 4QU6A 2CG8A 1FDBA 2KG0A 1DZ5A 2A1BA 1KONA 2CPXA 4DPXA 3HT3A 2XHWA 1XMOJ 2O66A 2RQMA 3TANA 2YNHA 2Z2LA 1TL1B 3ETOA 5LM7E 3LQVA 2ERRA 3SI8A 3T3FA 2HBZB 2CWKA 2JZ5A 1VQPS 4I6YA 2IA0A 3N5BA 2HVDA 2A2DA 4M5NA 1RWWB 4OYPA 4I67A 4B08A 3MMBB 1X9MA 1FVQA 1OY9A 4RNMA 3A8JA 3ET6B 1S1WB 4ELVA 3QGGA 2B9EA 3S01A 4KB7A 1OQ6A 2Q3PA 3FFIA 2QMWA 4A47A 1O5JA 1H7XA 4OI6A 4F0HA 3POTB 2DD8S 2EG2A 3JTOA 1UFWA 2ZOGA 1SQEA 2BQRA 1HYSA 4HL9A 3EVMA 1FE0A 2X3GA 4C0HA 1B0PA 3HVTB 3GLJA 4DFMA 1WF0A 1P9QC 3M1VB 4F25A 1XNRF 4CLPA 1TP7A 2HHHF 1T95A 4Y00A 2ZNYA 3W63A 1U6ZA 2R8HA 4I69A 4ECVA 2VBYA 4OIXA 5I3QA 2ROGA 4MTPA 5GAHI 2E7VA 2E1RA 3QMQA 3T1HJ 1NK8A 2BE7D 5J1PA 3NS6A 2HHUA 3K5NA 4QWCA 4U7CA 3D2WA 4C98A 1U1OA 5A8RA 3U02A 4DR2F 2PIIA 4IUFA 3QPIA 1F9EB 2NXEA 3TJ8A 5IT9Y 2J9DA 1PJ5A 3C8YA 4J9UE 3BKTA 3CJTA 3RU0A 3QT6A 1VQLS 2PDAA 1HMVA 2QLBB 2E5GA 2XO7A 5K20B 1RTIB 1HBNB 3OBIA 4K4YA 1KTQA 4C11A 4DZ6A 3IG1B 3MD3A 5L39A 4AL5A 5F0WA 2YKAA 4AT1B 4Y6IA 4CNYA 1KVKA 1FTCA 4K0KF 1BMQB 4M5DA 4NRUA 1IM4A 3LWMA 4RNNA 5A76A 1S76D 3VAIA 3GIIA 3FEXB 2ZUGA 4I6AA 5LMUF 3CGIA 4MK7A 3R7NB 2B6AA 4TXSA 1MNEA 4A8OA 1H72C 3VQSA 1FESA 4NLUA 2CQHA 4F3OA 2CA9A 2LQ9A 4C3LA 4ZPVR 4P2FA 3THPA 2J7WA 3UNGC 4NA1A 1S99A 2BKPA 2K3KA 5M2PA 4ZN1A 2RVJA 4J9LA 2UXBJ 1YBAA 4OHWA 2LXUA 4LBHA 1CJUA 1RCOB 4ZIWA 3ZTPA 4QCLA 5HK4A 2BJEA 3GJSB 4K4SA 5EUHA 2NZ4A 3KOAA 1MU2A 2AV5A 4JI1F 3D68A 3WHIA 1SXLA 3H8YA 4CNZA 4DUYJ 1OY6A 4KBIA 3DU6A 4UUWA 2FHMA 2G2OA 1R0AA 3AAWB 3GIRA 2MQ8A 1U48A 1J5EF 5A8KA 4YDDB 2H9ZA 3C2PA 3GG1A 1XNQJ 1TTHB 3RB4A 2JHEA 3KMQA 3K17A 3QT8A 2BE9B 4LRFA 1Q7LB 2MLYA 1N5QA 4NYZA 1X7VA 5EGYA 2VQFJ 1M5KC 3BO3A 2GMJA 1CC8A 3V5RA 1VBKA 4P75A 4FYWB 4G1IA 5EX3A 3LP1A 2P9CA 2JLFA 4K2JA 1K0VA 2DH7A 2L9DA 1Q81T 4CLUA 4EMDA 5D78A 3VAJA 4R0EA 1RB0A 2CADA 1GTEA 2N7YA 4RO0A 4GKKF 3BO2A 2ZC3A 2GCFA 4ED8A 3OXFA 1UL3A 3PIOQ 1FVSA 3EGVA 3OHBA 2LQJA 3PRBA 3AJ1A 2HNDA 4L73A 4KIAA 1JKHB 3PHEA 3W8PA 4CM0A 2D9PA 1RWMB 2FTRA 1TFYA 1UWBA 3PJXA 2EC2A 3VGTA 2CJXB 4JI2F 1N52B 5AXLA 3FRYA 4DFJA 2FJXA 4CH7A 1J5OB 3MEGA 1P8GA 1A6LA 2LEAA 4CP5A 4F4XA 2RQKA 3Q8QB 3OJUA 2CNOB 3M8ZA 1QAYA 2OEMA 3K8VA 4B3RF 3QAEA 3QIPB 3KLEA 2VH7A 2CUYA 3MECA 4YB6A 4C8MA 3OJSA 2J0WA 2EVZA 5CZVA 4ZPBA 2DNKA 3QATA 1HLWA 1N34F 5GAHU 2CDQA 3K58A 3U1MA 1ZETA 2W4PA 4F0KA 2BKNA 5HAOA 4ANDA 2MQMA 1R27B 1S1VB 4ELUA 2AJ2A 1OMSA 2UXCJ 5I4MA 2XWYA 1S6UA 4ZVQB 2W4DA 4B02A 1NJYA 2EEYA 4R5PB 4C8YA 1ZM3A 5D4LA 1K47A 1GT8A 3EXCX 2XSJA 3L09A 3VWSA 4EZ9A 4NLYA 2F8HA 3BBFA 2HHWA 1VRTB 5THWA 4DCJB 1LW2A 2HHVA 3NEKA 2ZBQA 2M9KA 1B4SA 4K2XA 1N33F 1K1QA 2AU0A 1QSYA 3KNAA 2JEJA 2UUAJ 1LWCB 1BGXT 2D7SA 3RGIA 1EJ7L 3D0HE 1C1CB 3IRXA 4Q2MA 3IS9B 4NYOA 3VAFA 5E7OB 2HNYB 1Y5LB 3R8YA 3THTA 4U6PA 4IOBA 4Y0FA 3V4IA 4U95A 2YKQA 4AFFA 4XDCA 1FE4A 2DTJA 5IZHA 3NLCA 2WAQD 3FBBA 2CQDA 4NXNJ 2H54B 4TY9A 3TA2A 2OD6A 2D3UA 4WIIA 1NSAA 4LF6F 1UMJA 3ZZYA 4RBUA 3GIKA 4OI0A 3Q8UA 1U47A 1NPKA 2H65B 2VV5A 4DUZF 1C0UB 2QA2A 3MZIA 1CJTB 1NJXA 1HWUA 1IKWB 4NLWA 2V5HG 2KFNA 2B3TB 2AWZA 1O8BA 1NSQA 2ZWPA 2XY7A 4JI8J 5F8IA 1WNEA 5IFMA 3FBEA 4OZJA 2CQPA 4NE9C 3NGUA 4XPCA 4CZCA 2DYAA 2W7AA 3DDNA 4R25A 1HNZJ 4QR1A 1QVFR 1NK9A 2E1AA 3KHLA 2I9SA 1WC5A 4J9NA 1YRXA 3PO4A 2FPHX 4TQSA 2JOQA 2JWNA 2MZSA 3PW2A 3GE9A 3J81U 2D69A 1I94J 2GVDB 4CYUA 1SJ1A 4UOHA 3JSMA 2R2UA 3EGZA 2R2SA 2B4UA 4ZIVA 2BMBA 3AOBA 4AYBD 5L9XA 4Y2CA 3KHRA 3UD4P 4IYQA 3W9JA 1WEZA 2BKOA 4ZS6A 1HARA 4LFAJ 3G8TA 2LVWA 1WUUA 1CJKB 2KJWA 3E51A 1LFWA 2J9DE 3TRGA 3UR3C 3MWBA 3T6BA 4J9QA 3EMTA 1WHXA 3UWTA 2WBRA 1RHJB 3CC7S 3LP2A 4DV2F 4DUTA 2R7UA 3DRPA 3W3SA 3HHLD 5HN0A 4CO3A 5CABA 3IAS9 4FPRA 4QYZJ 3LP0B 4ED7A 5M2RA 3F41A 2XHCA 1N54B 5LSRA 1ZH5A 2QT7A 4ZPWR 2A2CA 2QMXA 5DDQC 2OTJS 3SCIE 4DFKA 1S9GA 4CO2A 3RB0A 4WKRA 1FK9A 5EWGA 4ELTA 3K5LA 1FXRA 3OVSA 1RJJA 2KTQA 3OL9A 5HJXA 3MI7X 3IO1A 1PJ7A 3CEDA 5CCMA 1WWHA 3BBCA 1W7WA 1SBRA 2V4QA 3MAAA 1UVMA 1WC4A 2DPIA 5KT4A 4YB7A 2FD2A 2DH9A 1H2VZ 4ES1A 4ZKAA 1OPIA 1RT7A 3CSKA 1R89A 2KT2A 1JXLA 2M88A 2V68A 1S1XB 2Z2YB 1DLOB 1RLCL 1U24A 1EAYC 3PZPA 1AXQA 3MFIA 4ECYA 4FKYA 5IOLA 1FNMA 3VZHA 4DR6F 3D0IE 3B78A 1QD1A 2P5VA 5KFEA 5I3UB 3MCSA 5SZTA 3NGRA 4KHRA 1FEEA 1TZ0A 2UXDF 1FXLA 3ONQA 3PW5A 3LGHA 4PYAA 1CS4B 2L3MA 1ZTTA 2VDHA 4NCGB 3HDSA 2B4PA 1L3SA 5DDPC 5ETSA 3G82B 2CZ9A 3LF0A 3WBZA 4LF4J 1X5PA 5KFZA 2ZEJA 3IWLA 5J2MA 3M6VA 2J0XA 4DR4F 3MM8A 3DMJA 1TL3A 3NNCA 4KV8A 2NPIA 2DNMA 1LQ9A 3C46A 1JWWA 2J7KA 3MEEA 1X0PA 2IC3B 3RZAA 2DNNA 2RUSA 3LAMA 3O2IA 1MN9A 4HHJA 4P72A 3M8PB 2YKNA 2RAQA 3DC2A 5D0HA 3ZNJ1 2LXIA 4MKBA 1FKAF 3M2UB 5L9NA 3G4SS 1NKEA 1HNWF 2R8GA 2EC0A 4P6QA 8RUCA 4OL8A 2HYIB 3EVOA 4JI4J 1HR0J 1N48A 1OO0B 5LXYA 1QSSA 2N3OA 3OR1B 5MAOA 5E0OA 2DRAA 2GIFA 5FIIA 2YWEA 3NCPA 4QOTA 1VR6A 2B4OA 2AT1B 3TUJC 4DPUA 1FNOA 2DNYA 2AGPA 4Q8EA 3S7RA 1ZPWX 2NUHA 2CQGA 2BE2A 2FVCA 2G0CA 4N56A 5J1EA 1SH3A 4JUZA 1E6VA 1LK7A 3RR7A 4QW9A 3CUNA 1M1GA 1IJEB 1F1BB 4LR9A 4URQU 4XTTA 4KKOA 1WORA 1B7YB 3G9CA 3MMBA 4FVCA 1Y0HA 4A8YA 4A8QA 4OYXA 2HGMA 3S8SA 2AJ0A 3H4BA 1S1WA 3FUYA 5B0BA 3FMWA 2GJFA 1B64A 1Z2LA 2IMWP 4G3IA 5HROB 2QA4G 3K8WA 2IM2A 1XERA 1IBLJ 4PXDA 4HYKA 1A9NB 2CJBA 4NI2B 3C15B 1SC3B 2XQCA 4WIQA 3BH7B 3VTIA 5F8JA 1F6TA 2XZTB 5E33A 2QL7B 4HEA9 3Q8PB 1NKBA 5E41A 1PKUA 1YVFA 1TELA 2XMAA 2WVCA 4KGZB 1TKTA 3OFHA 3CT9A 4HTJA 4B3SF 2H1YA 4WK1A 5KTQA 1NSKL 2QO3A 3FSXA 3LPEA 2U1AA 2QG9B 2DJWA 2DNOA 1PYOB 2LFVA 2F40A 1HQUA 2XO6A 4Q5VA 2UP1A 3JAMY 3EXYA 1T05B 3BO4A 5KFVA 3IR7B 1NK6A 3RG6A 5BYQA 4USTA 4ILLA 4U8YA 3FDSA 3W5ZA 2H5EA 5GMEA 1S6QA 4ECRA 1T02A 2ZZNA 2F9JA 2RB7A 4J5OA 1RWPB 4I56A 4Q2LA 3MMAB 3FNNA 1H0HB 1FI4A 1KEKA 3IG1A 4JI3J 3QJJA 2L41A 3WC0A 2A6OA 1SCJB 2ACYA 2DRBA 2CZVC 4LFBJ 2IAJA 4D3GA 4DN9A 3CXCR 1T9UA 2AQ4A 2HSEB 4DG1A 1HNXJ 5B0GA 2W9BA 3BJYA 4J9OA 1TAQA 4OMFG 2D3O1 4F67A 3QWUA 2UVVA 3FEZA 2B7CB 2C2EA 5IS2A 4NZ6A 4KFBB 1WD6A 5A2QY 1YZ6A 1S49A 4FS1A 1TV6B 5AT1B 3GMGA 2I0XA 3AQOA 1WC0A 3M32A 2G2ZA 3NGKA 2E7WA 2QRRA 1KVJA 1CULB 3ELHA 3K59A 3NAHA 1NJWA 3M2RB 3OL8A 2AJQA 1RHUB 3TUPA 4DL5A 1C1BA 5HI7A 4UUXA 1QE1A 2E5HA 4OX6A 4HACB 3OTOJ 1BQXA 2FZKB 4ZOSA 1SJQA 1YJ9S 2FJWA 2V2VA 3BGLA 1KD1T 4PRFA 4C0BA 1FRMA 3ENAA 3JXOA 2W2NP 2W8LA 2OLWA 1SV5B 3OSPA 2VL1A 2XY6A 2KFYA 2GW8A 4MYTA 4ILRA 4NLOA 1J2VA 4P2XA 5IQ6A 3KUGA 4MKAA 1NZ8A 2YNFA 1Y5IB 1CBKA 4DN0A 1JJCB 4C6AA 2YNGA 4C8ZA 2NZCA 1U2FA 3Q86A 2NS1B 5CD4A 4F4WA 4E0DA 2CVIA 1S6PB 1S7IA 2FVSA 1EHWA 5JVGQ 4E8UA 2F63A 5HP1A 2CZ4A 4CI0B 1RT2B 2C2NA 5IWAF 3AQPA 2KJVA 2WOMB 4H4KC 3J7AN 4PWDB 2UUCF 1ICEB 1NJZA 2E7XA 3D1QA 4M5LA 1Q5YA 4ZJQA 2CQBA 1IJFB 3MM5B 1VC5A 4AD6A 2Q1LA 3R5DA 5KFIA 3UDCA 4MFBB 1M5SA 4ENOA 4IH7A 4ECXA 1IR0A 2P6TA 4ECZA 1MWZA 3NG8A 3TQEA 4NLXA 1AUSL 1UWAA 2HHQA 1GQEA 2YWGA 4CO5A 1Y10A 3NNHA 3IGVA 5ETOA 2RH3A 1J5OA 2M7SA 5DGAA 1N36F 3PACA 5DDOC 6AT1B 1B99A 2OSQA 4PAAA 2FLLA 2F4VF 2JFKA 3QZ7A 1OJ4A 4QWDA 3WIVA 3TYTA 1Y11A 5KT6A 2OPRB 4O23A 1D0EA 4NLVA 3CTRA 3VHQA 1SC6A 2MKYA 2RRBA 1GMUA 1WJ9A 2HBYB 2HFZA 3PRVA 1N5TA 1OIAA 1RWOB 1NUEA 1TMJA 4MKVA 5KFQA 4F4ZA 1SL0A 1WI8A 2Y9HA 5T41A 3OSNA 2HIQA 4AXJA 3CCES 4RR5A 3CMQA 2R2RA 4GKJJ 4LVOP 1QDUB 1CJVB 1JLBB 2V2QA 1DTQA 2UUBF 4R0JA 3N0VA 1PCAA 4HR2A 2IVMA 4LVNP 1NHVA 3A1YG 1SI9A 4C7QA 2XC9A 1HNIA 3BBBA 4W90B 2M52A 3QO9A 2RSQA 3D4JA 3KLGA 2BANB 4IQMA 3R1LA 3HP6A 2QN6B 4KSEB 1S1TB 2QGFB 1BUXA 2M3DA 1VDHA 3TWZA 4B9MA 2HQCA 4YMEA 5DG9A 2MPUA 4Y2MA 4DFPA 4K4XA 2GIRA 3A8EA 3PKYA 3FZ2A 1REGX 2KKHA 3W2VA 1RTHB 3W2WA 5LT5A 2MLZA 3W1YC 3DRRB 4F3QA 3I55S 1YRTA 2HHTA 3BV8A 4WK3A 4Q8FA 2V9KA 2WTFA 4EI2A 1F60B 3K2YA 1FJGF 3AOCA 5BYSA 1C0UA 1WOOA 2K1RB 3OUYA 1FA0A 5DLFA 5CYQA 2R7VA 2HS3A 1M5VC 2CFXA 3KLFA 3D6MB 1JJ2R 1H98A 2V69A 4PWUA 2DT9A 3OTCA 1JLAB 3C14A 3RYLA 3ITHB 1RDRA 1FX4A 4I7FB 2QV6A 4J9KA 4DV6F 3CD7A 2XZDB 2FC8A 2DITA 3CB4A 2ZH5A 2G9OA 2V0NA 2ZH3A 1ZZFA 3NBPB 3A3OB 3CDEA 1X4AA 4U9RA 2WSFC 4M5MA 1OS5A 2GQ2A 2DXFA 2WONB 2QTWA 3SDEA 2DGOA 2CJAA 2VPXB 1V5IB 4OLOA 3DU5A 3R5BA 1S97A 4TQRA 4DR1J 1I6JA 1GXLA 4DU7A 3K5OA 2X7IA 1OSDA 1UEUA 3SSSA 3AB4B 2LEBA 2F3JA 1LWEA 4YS2A 5HVGA 3ZTQA 3ILOA 2Z0GA 1CJKA 4NLGA 2XY5A 2N7CA 3C6TB 2K2PA 4B3MF 1VFJA 5FLXU 2XEXA 3FQKA 4X62F 1SKUB 1KLNA 3R6LB 3TA0A 5KFKA 3CJSA 1L3KA 4PUOB 2L48A 3HK2A 2GAHC 2VBXA 1VYAA 3MGJA 4DPYA 1JMTA 2KZZA 5KFBA 3IN5A 5HVHA 4DV7F 4HVZA 3KMSA 3CJQA 4L75A 5KAKA 4C97A 1YBTA 3E01A 9ATCB 4DBQA 4RUCA 3BQ0A 1NXIA 1B3TA 3UR0A 4DEZA 2FDNA 1KHWA 4YR2A 3NOGA 2F9DA 2YX7A 1LXJA 4M5HA 2V67A 4ZJOA 5C2GA 4AL6A 4JI7J 4RW6A 4DPOA 4DR7F 2X3DA 1V5VA 2FVQA 3SV3A 1X4BA 3UNYA 4JI0J 4YR3A 3KUHA 3HT0A 2CVEA 1R0CB 5FD1A 4RNOA 4ETZA 4IRCA 2EFGA 4WCEQ 4DV4F 1UFKA 4AL7A 1S77D 3JQMA 4MK8A 3LALA 4QIWD 4O3OA 3MEDB 2IDLA 5M2UA 3V6DA 2WVDA 1S1XA 1UETA 4ZN3A 3PFOA 3GU0A 3M9OB 2KXHA 2E9RX 2AYMA 1ZS6A 3BZQA 2IYGA 3MDFA 4DX8H 3V81B 1K0TA 3KK2B 2RD5C 1HBUA 3GV5B 4FP9A 2BACA 4EU0A 5B0CA 3NAIA 2EFOA 4WYLA 3BYRA 2ZE2A 2OPQA 5LXRA 4NOHA 1S48A 3DOMA 4CH1A 3W61A 2DHXA 2PMHA 1FHTA 4NCGA 2HPUA 2DO0A 3QNWB 4YHHF 3FK4A 3QLHA 1WI6A 4WE1A 4AQYJ 3HHKA 4DDFA 3KLIB 4FYYB 5HVFA 1TUVA 1T3NA 3U27A 3MOJB 4CT8A 2EKYA 3I5AA 2GV1A 2LCWA 1JLCB 3O44A 3KK3A 2MTLA 4ICLB 4KH0B 4X4TA 1TU0B 1TL4A 3H25A 1RP5A 4OV1A 2RQCA 2IC3A 3SQGB 2I5JA 4IO9Q 5G0RB 3SIPB 4TN2A 1KLMB 3ZZ0A 3DOLB 3OTBA 4CO1A 2RF2A 2AYGA 1S7HA 3JTPA 4USVA 3I6PA 1IR1A 4EO8A 1TKXA 4Y2KA 2ZH9A 2DIUA 3KKFA 1R8BA 3SSQA 2PI4A 4USKA 4I2PB 3EM1A 3EZ5A 3DXSX 4OZ3A 1XNRJ 2EG1A 4KGVB 2PEHA 1FERA 3VCDA 5C24A 5KFJA 4DSFA 1R8PA 4IH5A 2VPYB 2AYEA 3BS9A 1Q8BA 4IFYA 2B4VA 3EX7B 5ADZA 3H5XA 3M2VB 4RWWA 1HIYA 1R31A 1TUWA 1GX6A 1FDDA 2OPSA 2IA6A 2PFDA 2VQEF 1EQMA 1WC6A 3I4PA 4DMZA 3T1HF 1M90T 3BGRA 1KVIA 4O3PA 3GFZA 3SCJE 2MKKA 4FBUA 4ED2A 1ITPA 3W62A 4B17A 5FDLA 4CT9A 5D8HB 5IT4A 3DOKB 3FC9A 3T5LA 3RBEA 3C16B 2MB0B 1NJIT 3R2CJ 1C0TB 4KH1B 5KT3A 4ECQA 1RUSA 1BE4A 1ZOTA 3EUNA 4P71A 1NMEB 4DL0C 1S6OA 3TZXA 3C6UA 4LF7F 3GJRB 4K0KJ 3HSDA 3HHLA 2CPFA 4KHPF 2VJUA 3ZTRA 3VAMA 2XCPA 1HPZA 4DXLA 4P52A 2FYXA 1TK8A 4ZPTR 3H0PA 1VIXA 5LMUJ 1IBMF 2I38A 2MY8A 1B0TA 4ZVPB 1RHKB 4K4ZA 2QE5A 3R5AA 2DHSA 2EW9A 2FY1A 4PABA 2R7WA 2OH2A 3JSBA 1RT6B 1BWVA 3VQTA 4CIOA 5A0YA 3ZTOA 5I3PA 1XIQA 1UJ4A 2RIJA 4DPTA 2XS2A 1VK3A 2Y0BB 4DSEA 2K3IA 5KG0A 1OY8A 3NY0A 4PPDA 2JNJA 4LSLA 1U1NA 1WHYA 4LRCA 5K8PA 4LQ9A 2N3LA 3AD7C 1MROA 1OSCA 2EK6A 2EFQA 2E29A 4ZP8A 2W24A 3A3PB 4JI1J 4B9VA 2G2YA 3NNAA 2GQQA 1IBKF 1HD0A 2B7BB 4DLGA 5C7PA 3H5SA 1H74A 1QUVA 4OZ5A 2R7QA 4ZVFA 1T03B 3DLHA 3TEGA 3N28A 4OHXA 3TJAA 1J5EJ 2DRDA 1RHRB 3FSIA 3HF5A 3T1YF 1RTDB 3L9ZA 1PC5A 2B51A 2KRBA 1RI7A 3PX6A 1R43A 3JQKA 3MMJA 3FEYB 1DQAA 1JLFB 4ZPAA 2BOPA 2MZRA 1HBMA 2PMWA 4QIEA 4GO5X 5ITHA 2YQ3A 2D1CA 2NYHA 4I64A 1UFLA 3PKMA 4ZVRB 3EPIA 4BLGA 1Q1KA 1T9YA 1YJNS 1T0TV 1X9SA 3FZBA 4YY3F 5AE1A 1YZ7A 4NEZA 4F2SA 4ETXA 3JTNA 2AEFA 1LK5A 3M2RA 3TX8A 2R7OA 3UVJA 4N5SA 1SKWA 1A0OB 1VJQA 1O6XA 4K5SA 2OUGA 4M5KA 3AXKA 4E98A 4PXBA 1GK8A 4P7TA 4OX9F 1AROP 5KOXA 3NGDA 3QSIA 2J7UA 3HMJG 2QL5B 3UCUP 2CJ9A 4GKKJ 1IWGA 2MQNA 2V6AA 3DRSA 1F5AA 1ZAWA 2MKIA 2BXJA 2D3OR 3SZ2A 1S79A 2OELA 3H98A 2DR9A 3WC2A 5HANA 1PYSB 5KFTA 3IXQA 4DL7A 4M8LA 5EWFA 3RBXA 1H2TZ 4AUKA 5KFFA 1RT1A 2AX0A 1LW0B 3DLEB 2HQ3A 2V8DA 2H5JB 3MM9B 2HMIA 4JI2J 2VC1A 3E2EA 3UD5A 2KT5A 3UDLA 5ETKA 3P5TL 2W2MP 5D77A 2UU9J 1S4EA 1KR4A 1ROFA 3Q23A 3PX0A 4RW9B 1CQNA 4JI5F 1WG4A 1FWLA 4N77A 1FD2A 1RT2A 3A3NB 2C2DA 2M8HA 3NWRA 4PWDA 1WG1A 1N34J 5CQGA 1REVB 4KHMA 2ZH4A 3I0RB 3N5FA 3U1NA 2BQUA 2IJNA 1RAFB 4EO6A 3MM5A 4A8FA 2LP4A 3MPWA 2D41A 3ZZZA 2HVHA 1VLYA 2KVIA 2CPDA 4MFBA 4RW8A 3WIUA 3ZZTA 1VCTA 2QLFB 1WKJA 1U26A 2HS4A 2JVRA 4LF8F 1NK0A 4OZ2A 2JC1A 3KXDA 4KTQA 1MWYA 1YQHA 2MQOA 1HHSA 2OEKA 4FBTA 4LIWA 2XYGB 4PCQA 1TUGB 2MZJA 1DTTA 1R8CA 2EPIA 5KFAA 1Q7YT 1S0NA 5IM0B 5I42B 2MKJA 4C8KA 2DNZA 3D6HB 1QM9A 4NRTA 3G6YA 4ANCA 1HHQA 4QR0A 3BQ1A 2B8PA 1LXNA 4QJVA 1Q4RA 3VGVA 3WX8A 5J2QA 3R7SB 2K8GA 2IVFB 3N6MA 1YI2S 1QY7A 1T9WA 4G1QA 1BWEA 4ID5A 1YITS 2V9WA 4IOCQ 1JIHA 2V8HA 2DEJA 4DX6A 2YY3A 1IM6A 3BSOA 2OD4A 4EZ6A 1QAJA 1TKZA 1WEYA 2Q66A 3KJNB 4LF6J 4M94A 1N6QB 2FB0A 2XS5A 3J7Z5 2Z4PA 3ETMA 3N01A 4GVBA 1D9FA 2BR0A 2XMJA 5LJ3Y 4USMA 3GONA 4DUZJ 2JEGA 1D8ZA 1WDDA 1UW9A 3OL6A 4X4PA 2FJEB 3CJRA 2G0IA 3FVYA 5KG7A 3TP2A 5JJBA 1EETA 2YKMA 2UV8G 2HEKA 3TVZA 2B9YA 1HQEA 2J8AA 2IHR1 2VG7A 2HIYA 3Q83A 3AH6A 2LKZA 3M8QB 3N6LA 5GVQA 2M4MA 3EPGA 2BANA 2KRRA 5HBMA 4F7VA 2HQIA 3GYNA 4L72B 4X64J 3MPVA 1TAUA 1VBXA 2W9CA 3ISNC 1PAUB 4CDIA 1KQKA 5AE3A 1RTHA 4PWWA 3DRRA 4HDGA 2HHPA 1HI0P 2VA3A 4Q0BB 4OYIA 4ED0A 4F0MA 1T7PA 2MKHA 2WRMA 1LWFA 3SCKE 4BC9A 2QEXS 4Q45A 4CH0S 5KFDA 1VBZA 1YDLA 1PYTA 4A48A 1KWMA 3IBWA 4PPZA 3CJ8A 2BYCA 3TVYA 3GYGA 1R6VA 2DR6A 4MAKA 2AJ4A 3M6UA 3BH6B 1X0FA 3TZZA 4A8XA 2KVQE 2ZH2A 4IFVA 3ITHA 3W60A 4IG3A 4EK2A 4I7FA 1T94A 4DV2J 1VOMA 5B0FA 1NDKA 4W4MA 2E1MC 3PW7A 3OLBA 3GV8B 3SEOA 1WEXA 3TJ9A 3FMBA 4TY8B 1KKHA 1U1MA 4WXOA 4WFYA 5H9FK 2EI5A 3PY8A 5D3GB 4DCOB 5F9NA 1SJRA 3PFEA 5ETNA 1M5HA 4C48A 2HNZB 5J2PB 1YSJA 2ZVSA 3VGUA 1F3VA 3R3TA 2VB6A 1PO6A 1VQYA 2AGQA 2YKPA 5CYMA 3KLHA 3R27A 2O3DA 1Y9OA 3EZOA 3JYTB 4B3TF 3PG9A 2CPHA 1HWKA 4MMOA 2WB4A 4XK8C 3MR5A 1YJTA 3TAPA 2DEIA 4NLSA 4OZ0A 4GO7X 2XZWA 2AGOA 3GPAA 1DBDA 2B5JB 3TARA 4O0IA 4GVLA 1S12A 3BKFA 1K44A 4O0NA 4DV1F 2KYXA 2MYFA 4CLFA 5BXIA 1P9YA 2O01C 3GFXA 2KI2A 1R0BG 2M8DB 3KG1A 2XMWA 2KYZA 2JRSA 1X9WA 3DCAA 1VQ9S 4UW2A 2OP5A 4DR6J 1UCNA 2OKQA 5KFYA 1RZMA 2JC0A 1RABB 4JV1A 1F9FA 2UXDJ 1VHFA 2DNHA 1HQ2A 1FDNA 1LEOA 2C3YA 4DHVA 3QJPA 2ADCA 3H40A 3IWXA 1Q16B 2ZDOA 3W5YA 4IR1A 4BDPA 3MD1A 3BPDA 2HBRB 1U1KA 1PG5B 2HBQB 4OYWA 3N6NA 4ZP6A 2YWKA 4F4YA 1BHNA 2Q79A 2X51A 5F8HA 5E3PA 1IKYA 2MZTA 1EKRA 2ROPA 1DAXA 3V6HA 5CH7B 4OYBA 1UVLA 4JYAF 5DO2A 5EDWA 4DR4J 4G65A 4XO0A 1GXUA 3SCLE 1UEVA 2QLJB 2YNHB 2QYCA 2HWIA 2BVZA 4RNFA 2PO4A 3EYZA 3T5HA 1U1QA 2ATLA 2ZD1A 1KN6A 2UZAA 4P10A 4KT0C 4PEOA 2ZM6F 3BSNA 3MM6B 2VFUA 1WF2A 3GFYA 1FKOB 4NMLA 4ZPDA 4A8SA 3PM9A 1WF1A 2SXLA 1KTVA 1HNWJ 3DLGB 3FFIB 2KXFA 3DYAA 2FZCB 2RS8A 2VC0A 3SFGA 4RUAA 4N7TA 4RJVA 4B9LA 2BZ2A 5F3TA 1HYSB 2XMMA 3HPOA 1HR0F 3PR5B 3MFHA 1XWLA 3NP5A 3L4BC 5DS7A 3RTVA 4ZLLA 3M8SA 2FQQB 2AX1A 2HHXA 1YWXA 2ZZTA 2GO8A 3IM9A 4ED5A 3DLBA 3NOCA 5HMYA 4QWBA 4KJIA 1RBAA 4ALZA 1WTFA 2DR8A 3P6YC 3CCSS 2ACMA 1VQ5S 3SQGA 3HJFA 4RX6A 1FRLA 4TLRA 3TNVA 1KLMA 2A18A 3DHWC 3OFGA 2NREA 1T3OA 4KYZA 5A8RB 4UF4A 3QT7A 1U25A 3HO1A 5L1JA 3J7YI 4Z37A 3UW1A 1AFJA 5DQIA 1S57A 2E44A 4NXMF 2F5GA 4N8NA 2EFVA 1VMBA 3W66A 1NH7A 4YUDA 1MLAA 2VG5B 4F4AA 4C11B 1UVKA 1UA1A 1CC7A 2V94A 2KG1A 2QZ8A 4PXCA 3QZ8A 4M5DB 1SPBP 1UW4A 1R6YA 3HX9A 4B3SJ 4X4UA 3NXZA 5K8OA 2B0GA 1ZYQA 4IKAA 1U8WA 4KAIA 2B6AB 1NPRA 2HK2A 3KJFB 2OJ3A 1RWXB 4UQGA 4K4TA 3UI3A 2GVZA 1NNDA 3V4MA 1BQNB 3TQ1A 3GJQB 5L1KA 4URGA 2RRNA 2VFTA 1UPMB 4Y34A 1XBWA 3DOKA 5CAAA 2UUWA 2XMUA 1RA6A 1CJUB 2FLNA 2P8IA 2OI2A 4YOEA 4QZVB 5D0GA 4WYWA 3ILJA 1SB6A 4RPFA 3HZEA 3CWJA 2P9EA 1UJ5A 2YWHA 1PAEX 1EP4B 1MU2B 1U6BA 1U1PA 4ECSA 5F8GA 4X2BA 1DARA 4DL6A 2OTLS 4XIUA 1YJVA 1UTAA 3M30A 1U6FA 5KFXA 2GQCA 2XYHB 1TK5A 4F02A 1R0AB 4QR2A 4X4OA 1RT3A 1S4FA 5A8KB 4FPIA 3EGNA 4ED3A 2VBWA 3IAM9 3TEHB 2X1FA 4USHA 1S9EA 4JV0A 3ZZPA 5C2CA 1V3ZA 5KFCA 4JP8A 2PN6A 1JLGB 3EJMA 3O1LA 3CO9A 1IUJA 3PTWA 2KXNB 2IYIA 3OFEA 5J1NA 5C42A 2IM0A 2ZBPA 3GFHA 1RT4A 3LP1B 2RKIA 3RB3A 3QRPA 2MLXA 3A13A 3HLUA 2CQ1A 3RJMB 5DETA 4CWBA 3CPWR 1U0HB 4DL4A 3UDEA 2Q6BA 1T03A 1ZPVA 4PR6A 1NDCA 4B9SA 3KK1A 3BDPA 4UY85 5LMNF 3L7UA 2IM3A 1YJUA 3HFKA 2O67A 1AZSB 3DRXA 4I1TA 5J2NA 1WTBA 1VQ4S 1ELOA 2DY9A 2HNDB 1JLFA 3US5A 2CG4A 5HMXA 5DZ7A 5LOQA 2ZBCA 3J7A1 1UWBB 2NPFA 3Q24A 1W25A 4TU7A 3VZIA 2VF3A 2XNRA 7FD1A 2VKZG 3O8WA 3MEGB 2OPPA 1QJHA 2BJDA 4DOZA 5IWAJ 3MAHA 5F8LA 5EN1A 4DV0J 2V4JA 2R7SA 4H4OA 2UUCJ 3H2VE 2BX6A 1A7GE 3SMZA 4FYDA 2O1PA 3CIMA 4D3HA 4QYZK 4H4MA 3M7VA 2PC6A 2XCAA 3KLEB 1KC8T 1FWKA 3MECB 1B70B 1Y5NB 3VGSA 3NGSA 5KG4A 2IJRA 1RYRA 3BSCA 2K06A 1KOHA 2QC3A 3BPSP 2IBOA 2B9XA 1RTJA 1ZA1B 3J7YU 3QIDA 1LW0A 1QAIA 3B4MA 3IM8A 4J7CA 4ECTA 2HWHA 4LRAA 2DCLA 1UVNA 2XSJB 2MXYA 3GIMA 4KRWA 1MSWD 1EARA 4RW9A 2I6WA 2J76E 3DI6A 3D3CJ 2MHNA 4B3OA 1YLXA 2ZHOA 4I4BA 1LW2B 1P1LA 2FLPA 2Y1JA 2RQ4A 4OI2A 2F4VJ 1FKPA 1WELA 2VD3A 4RW7B 1EX8A 2AZ3A 3CD6S 2VG6A 4W98A 1REVA 1P27B 1Y4ZB 3IRXB 2DGQA 5HQLA 1S1UA 4EWTA 3G6VA 5JMNA 1NDLA 3V4IB 2HAFA 3ULHA 3F56A 3NMAA 3X1LB 2BJ9A 3CCWA 4F3MA 4DL3A 1AA1B 2B9WA 3MPDA 2BABA 4WU3A 3UE2A 3HJVA 5KFWA 3IFEA 1TKDA 5KFLA 2UUBJ 4LFCJ 1TK0A 5B09A 3Q8RB 2RT3A 4BCAA 2IRYA 4TNOA 2BM1A 5KT5A 3HSGA 1G1XA 2AW0A 4C4WA 4DV5F 3UN5A 4Z7YA 4YR0A 3OR2A 1GAOA 4CO0A 1FFWB 4GRSA 1RADB 3KNGA 3UCZP 3NS7B 3SBMA 2Z58B 5E5NA 2R3VA 4WZMA 1IQZA 1G6BA 2QSWA 1R7IA 2OGUA 3W7BA 2LYVA 2PE8A 4N8OA 1JXVA 4PQAA 4NA2A 4ZVEA 2LQ5A 4HT5A 3IR5B 3DLKB 2YQ0A 2VOPA 3G87A 3HI9A 3ZO7A 3JSMB 3GILA 2WZ1A 1FJGJ 5SUHA 5GAEI 4ZLJA 5GAGI 4WBFA 3OXGA 1N5YA 4ED4A 2V50A 4P7VA 1IKVA 4FXVA 3MEKA 2A0FB 1Q5VA 3FSYA 8AT1B 3ICLA 4J9RA 4DZDA 1FRJA 3X3UA 4WP8A 4DV6J 3UQSA 1RAHB 4CLSA 2YXLA 1U2CA 5HLFA 4EUVA 2BA9A 2MSTA 3LP2B 4LF1A 1C2PA 2COLA 3H2UB 2X1BA 5KOWA 3CDAA 3WQPA 3I96A 2AIRB 3TVKA 4O3QA 3CDWA 5FLXY 2XBPA 2ASDA 2R9LA 4QPTA 4X65J 1HFEL 3MXHP 7AT1B 1RQ0A 3IGNA 4PQUA 3MF5A 1GXTA 2JDJA 5IV4A 2OSRA 4DF4A 1SC1B 2FHJA 1NZAA 1S9GB 2HK3A 2Y1IA 1FK9B 3AJDA 1DRZA 3B8HA 1HWLA 1VRQC 3TAMA 3PEHA 2FZGB 1KS2A 2HGLA 2E5IA 3KWMA 2KU7A 1RWVB 3B6BA 1N0VC 2QSFA 1S72S 1RYSA 4B3MJ 4C3MA 3O3LA 5GMKa 3DXBA 2ALYB 2J6UA 2CQ4A 1FRXA 4ZCMA 3MAAB 3WX4A 3I5BA 2YNIA 2GHWA 4YFUA 1MMLA 2ZH1A 1FX2A 5H9EJ 4DV7J 5A8WA 1F5CA 2J9CA 4TVAB 1RT7B 4JI6F 1IKXA 2CQ0A 1XR5A 2E9ZA 2F65A 3G6XA 4LSNA 2IPOB 4JV5F 4L3KA 2C3MA 3MM7B 1E6YA 5HL7Q 2AP6A 3DM2A 5K14A 4DR3F 3BREA 4ZHRA 3PO5A 1NM2A 6FD1A 3VR1A 1UVIA 1X5OA 4FNHA 1WC1A 2HFUA 3MCNA 4DV4J 3RUBL 4F2RA 2IRXA 4WWSA 1CSJA 2G13A 5DQHA 2GA7A 4WFAQ 3ZZOA 1XMQF 2QYGA 2RU9A 1RAEB 2J5AA 1VK8A 3RBZA 1LFPA 5J2MB 3MM8B 5KFGA 2C28A 3DMJB 1TL3B 3P49B 2ZH8A 4KV8B 2JFDA 3D7SB 1NHKL 2ABYA 3H5UA 1TL1A 4DQSA 3MEEB 2RS2A 3BR8A 3BM7A 5KFRA 4JBCA 4LR7A 2AJFE 3KHHA 2A6MA 4QIVA 1R8AA 1TQLA 4UOFA 2WVFA 2DNQA 1V9OA 4FDFA 1U2RA 4YN3B 3PXGa 3R9LA 1URNA 2FC9A 2RHQB 1NO8A 3ET6A 3HZGA 2D3ZA 2P9GA 2FJDB 2J6SA 2PEBA 1FF2A 4YHHJ 2V8GA 1EKSA 1BD6A 1FRHA 2JL9A 3DDKA 3QGHA 2RDDA 2UVUA 5G4DA 4LF5F 3BR9A 3POTA 2Y8YA 3GSDA 3CCMS 1G2EA 1PBAA 4ECUA 2BBEA 3Q8VA 4LSZB 4F4KA 2C2MB 3W9IA 4AQYF 5HQ8A 5GAEU 4OI4A 4WPAA 5GAGU 3UPFA 3HVTA 2NQPA 2BE2B 1VC0A 3M1VA 4M5JA 2XYPB 2ZH6A 5J1EB 1E6VB 1XK8A 3D3BJ 3HCXA 1DHMA 1U49A 4TU9A 3VVTA 3M6WA 4KKOB 4DF8A 2E5JA 4CRJA 3MM6A 1HA1A 4HKQA 3MHYA 1FKOA 4TKTA 2ZOMA 3LGNA 3K5PA 2C2OB 3DLGA 2WW8A 1OYEA 4A8MP 4J9MA 4ZVGA 2R8KA 3P96A 5A6WA 1VIOA 2R8JA 3ZXWA 2J8SA 2QL9B 4FZVA 1HI8A 2J6TA 1SKSA 1IBCB 5EX0A 1UZHA 1S59A 1RTIA 4ZJLA 1HBNA 4X4VA 1SQGA 1CQMA 1RE1B 4FYVB 1Y3JA 1Q95G 1RKIA 1TL5A 1S9FA 4EBDA 2RHSB 2ZFHA 1HBOB 3PW4A 4EFAC 1TKTB 1FDAA 3DKDA 3CJ2A 3R1HA 3QRRA 4WFNQ 2C3PA 4G6VB 2PI5A 5F8NA 3D9BA 2VQEJ 4FS2A 1NK5A 1HQUB 3MUTP 3KG0A 1D9DA 2OMLA 2ZJPQ 4O3NA 4J90A 1TL7B 3Q8SB 3RRKA 5H9FJ 3ILIA 4NLQA 3KFWX 2LQBA 3LO3A 1JLEB 4EBEA 2I2YA 1QUPA 3QGIA 2N82B 5L8RC 1S6QB 4WFZA 1NB7A 4HLBA 2HQFA 2HQGA 2WW4A 5ETRA 4MT1A 4FXWA 4LMZA 4LF7J 5AJ3F 5T14A 2VFVA 2VG5A 1H3DA 2JX2A 4P2SA 2RRAA 4KHPJ 4LR8A 4LRBA 4DQIA 3QRQA 5BJRA 2IAJB 2M5YA 5LSOA 1EQ0A 1JB0C 2ZKUA 4CLTA 4DQPA 1IBMJ 1M0SA 3PEJA 2CJQA 4USWA 4DG1B 4IQXA 3PDNA 2W9BB 1RSCA 1PILA 4K4WA 2RILA 3OTDA 4M1KA 1KQSR 4ZVTB 2DH8A 3UFCX 3TR5A 2RNEA 3ENQA 3UCGA 3ZNUA 4K4VA 3HHLC 1BQNA 2IMOA 3HULA 3M32B 2F8EX 4BBYA 1SKRA 1H6KX 3MMCB 5KG2A 2ASYA 4EYHB 4UZCA 4UTGA 4HDHA 5IC4B 3NKYA 4ER8A 1SJFA 2JH3A 1C1BB 1TMMA 4QBUA 4UOCA 2VODA 1QE1B 2MQLA 1IBKJ 2HFSA 4QPXA 4CQ1A 3D0GE 1UA0A 2MKCA 1YJRA 1EP4A 2G1HA 5IT0A 4XDDA 2K7KA 3FKBA 3MCMA 2IRUA 4CLWA 1I5OB 4LF9F 2DGVA 3JSYA 3T1YJ 3M8RA 1RK8A 2FVPA 3HHDA 1GH8A 3GIJA 2VIHA 1HI1A 3A8IA 4IH6A 2ZUAA 2YPZA 2UVRA 4O3RA 2YNFB 2F1FA 3PR4A 1JLQB 3ZZRA 2YVSA 2YNGB 4DR5F 4LREA 1JKHA 2AEJA 1JLGA 1SQFA 2MY7A 2ASJA 4YY3J 4ED6A 2VHGA 1VC6A 1FXDA 4FNIA 4GC6A 3I82A 3O6QA 3P45B 2ZOFA 5HP1B 2GGPB 3PW0A 2HFOA 2IFXA 4OX9J 3CF5Q 2L9WA 1N5VA 3HVAA 2XM3A 2CQIA 4RKUC 2HKEA 1NRKA 4ATNA 4N76A 2CAJA 3G6ES 3CCVS 1GEHA 1T11A 1GMWA 2CQ3A 2RJZA 3QIPA 5U47A 2ZHBA 1OWXA 1U0HA 4CCHA 3H2LA 2XLKA 3ILLA 3M9NB 2J0QD 2AEMA 4UOGA 1AZSA 4DV3F 3J80Y 4CO4A 1S1VA 3S6EA 4A46A 4LBPA 4WTOB 2ZC4A 3I32A 3M05A 2MEWA 1XMBA 1M5PC 1BC6A 4R5PA 1W2IA 3HVRA 2KT3A 2VFSA 2EFPA 4JI5J 1RAOA 1F0XA 1VBYA 2UU9F 3Q22A 4USUA 2CJYB 3UN3A 2ILZA 1ZM9A 4J9PA 1CLFA 1VRTA 1V3RA 1NBEB 3SQOP 4CTAB 2DGUA 3HVWA 2XI2A 2HZVA 3H59A 1MWQA 5HMZA 1LWCA 2ILYA 4RL1A 1S0MA 4WJBA 3T19A 1C1CA 5KG3A 1SJ4P 3Q2TC 2PA3A 2E1CA 3IS9A 4LF8J 4OFZA 5CD4H 2HNYA 2YWFA 3MUMP 2MDAA 3R6GB 3GZ7A 2E5LF 1QVGR 1XN9A 2H5IB 2GMHA 2NSCA 3MTJA 5D4PA 2UV8A 1VRUB 1VISA 3E3XA 2CPYA 1DTQB 1FCAA 5E3QA 3HFVA 2XG8A 3CCZA 1VQSA 1CJTA 1WOPA 2Z8QA 4EYIB 3CMES 3Q8YA 2JLEA 3P5BP 1IKWA 1NCLA 1KRPA 2R4FA 1HNIB 4TYBA 4RW7A 3LWLA 2V8PA 3DGVA 2XB2D 3AA8A 3QO9B 4NLPA 2YTCA 1D8YA 4WZQA 2LU1A 2BDPA 1Y7PA 3IA0A 3KLGB 3CJKB 3V6KA 4X4NA 1X4EA 1X8DA 1UPPA 3A12A 4MIAA 3S1TA 2FJVA 4G1PA 4NPOA 3W2VB 3W2WB 5CYJA 1G7CB 4OX7A 1PSDA 2GVDA 3H7HB 4OZLA 2KHDA 5F9LA 3H42A 2F7VA 2GAGC 4BWJA 3AXMA 5D0RA 3C66A 5ETMA 3HD2A 1HHTP 1RISA 5E2QA 3EZUA 3OUYB 5CYQB 1GFWB 4CLYA 2YQ1A 4X66F 1K73T 3ZC4A 5DLGA 2MGZB 2VA2A 3D1OA 3G8QA 5BYRA 3KLFB 3PYFA 2NCKL 2PGCA 2FJAB 4QQBA 1ACMB 4O4RA 3PV8A 3C14B 3PRDA 2GHVC 1RAAB 4TLQA 3C19A 4W92B 1YKWA 2MQPA
chains in the Genus database with same CATH topology
3CJ4A 4Q7AA 1FRKA 5E3PA 4UY8T 1KEKA 3IG1A 1IKYA 3QJJA 2MZTA 2ROPA 5AXMA 1DAXA 3WC0A 1N88A 5CH7B 5LJ5Y 2L41A 4RBTA 2ACYA 2DRBA 1UVLA 4JYAF 4NCAA 5DO2A 5EDWA 4XO0A 2CZVC 4OHZA 3DHXA 4B9UA 4OJHA 1GXUA 2IAJA 3I0RA 3SCLE 4D3GA 1BLUA 2DNRA 1UEVA 4DN9A 3CXCR 3THVA 2AQ4A 2YNHB 2VFRA 4C8NA 2DIVA 5F8MA 2QYCA 2HWIA 2BVZA 3MTKA 1HW8A 4RNFA 2PO4A 4X64F 4MKYA 2G1DA 4ZDNA 4DG1A 3DLKA 1VQ8S 5B0GA 2W9BA 1LOUA 3BJYA 3EYZA 3LP0A 1RTJB 3T5HA 1KFDA 4NA3A 3SDEB 1IXKA 1TAQA 4J9OA 1U1QA 4K4UA 4YDXA 2ATLA 2C3UA 4OMFG 2ZD1A 2EK1A 3ENWA 2XI3A 4F67A 1KN6A 3FRZA 3QWUA 2UZAA 3FEZA 2B7CB 4TYAA 2UVVA 4KT0C 3LW5C 2ZM6F 3BSNA 3CJ0A 3MM6B 2C2EA 5IS2A 4NZ6A 2VFUA 1WF2A 4KFBB 3BGUA 3GFYA 1FKOB 4NMLA 4ZPDA 2LXFA 1V6HA 1WD6A 5A2QY 4A8SA 1ZBTA 2BM0A 4QU7A 2ZKTA 3PM9A 2VASA 3OLAA 2Q43A 1S49A 1WF1A 2FHOB 2SXLA 1KTVA 4FS1A 4J37A 1RA7A 3DLGB 1TV6B 4A4JA 3FFIB 3DI6B 2DISA 2KXFA 4QWEA 3GMGA 2I0XA 2OO4A 3AQOA 3DYAA 1LWEB 1VQOS 2XS7A 4B3OB 4H54A 3M32A 3T5JA 4DSJA 2RS8A 2VC0A 2EWHA 3NGKA 3NCQA 5IM0A 2E7WA 2LA4A 3PNIA 4GKJF 2KFZA 2QRRA 5I42A 1KVJA 3SFGA 3TO8A 4RUAA 5K8NA 4IO1A 1RKJA 3K59A 3NAHA 4ZLPA 1FKPB 1NJWA 3M2RB 3OL8A 1YG0A 4B9LA 2PD1A 2BZ2A 2U2FA 2AJQA 1X5TA 2VG6B 3I5CA 4DL5A 3F44A 1FJCA 1C1BA 4PG6A 4EGLA 5T7LB 1CPZA 5HI7A 4UUXA 1QE1A 5F3TA 2E5HA 1HYSB 2XMMA 3HPOA 4OX6A 3CMAS 3PR5B 3MFHA 1N4LA 1HR0F 1XWLA 1DJ0A 3NP5A 4OJGA 5DS7A 1BQXA 3BN4A 3RTVA 4ZOSA 1SJQA 1YJ9S 1S1UB 3M8SA 4F8RA 2FJWA 4C9DA 2AX1A 3BGLA 3RAQA 2VOOA 2HHXA 1YWXA 1KD1T 1S0VA 3QAUA 2GO8A 1VI7A 4ED5A 3DLBA 4IRKA 2HLTA 4PRFA 4EBCA 3KG4A 4C0BA 5HMYA 4QWBA 4WF9Q 1FRMA 1R3NA 4MYUA 3CCLS 5JVHQ 3G96A 2C2RA 4KJIA 3FCHA 4Y3CA 4ALZA 3E01B 2Q6CA 1WTFA 4DS4A 2DR8A 3KYLA 2HGNA 2OLWA 2W8LA 1Q86T 1SV5B 5BR8F 3I0SB 3P6YC 1YTYA 3OSPA 2VL1A 3CCRS 3R5CA 3CCQS 1DLOA 2KFYA 3CCSS 2XY6A 5DM7Q 1U4BA 1VQ5S 2GW8A 4MYTA 3SQGA 4IDKA 4ILRA 3HJFA 4RX6A 1FRLA 4NLOA 5B0AA 1N6QA 4DQRA 1J2VA 4TLRA 2JVOA 4HI1A 1UKUA 3TNVA 1Q53A 5IQ6A 1KLMA 2GJ2A 2A18A 3TAQA 3DHWC 4MKAA 2YNFA 3OFGA 4OZ1A 2NREA 1Y5IB 3CCTA 1T3OA 4DN0A 4RW6B 1SL2A 5K9FA 5A8RB 2YNGA 4BWMA 5EWEA 3H5YA 4C8ZA 5L1LA 2DBBA 1U25A 3OHAA 3HO1A 1GTHA 3BF4A 1U2FA 2JSXA 5I3UA 5L1JA 2NS1B 3J7YI 2ZBIA 4Z37A 3UW1A 1TFYA 3M4XA 1AFJA 3OR2B 5KFHA 2E9TA 4ILMA 5DQIA 4F4WA 5KFSA 2CVIA 2VUGA 4E0DA 3SSRA 2E44A 4NXMF 2YX1A 1S6PB 2FVSA 5JVGQ 2QA1A 3I9V9 4E8UA 4N8NA 2EFVA 5HP1A 2CZ4A 1VMBA 4CI0B 1RT2B 2FIUA 1NH7A 5KG1A 4YUDA 3MR3A 5IWAF 3AQPA 3GV7B 2KJVA 2VG5B 2WOMB 3N4WA 4H4KC 4GC7A 1CVJA 1DURA 2UUTA 5A6PA 4PWDB 2UUCF 3HHEA 1UVKA 4C11B 2BRLA 3CCJS 1UA1A 1N32F 1CC7A 1NJZA 4XPEA 1Q8LA 3M8QA 2E7XA 2V94A 3D1QA 2KG1A 5JXSA 2QZ8A 4PXCA 3QZ8A 1XTZA 3G71S 2DR7A 4WU2A 3MR6A 5KFUA 3FQLA 4M5DB 2M0GB 3V6DB 1UW4A 2CQBA 2JJ4D 3L3CA 4OHVA 1R6YA 3DRPB 3HX9A 1IJFB 3MM5B 1VC5A 1RT5A 2BRKA 4X4UA 3LAKA 1KOOA 2Q1LA 3CE8A 1XMOF 3R5DA 5KFIA 3CD0A 3UDCA 4MFBB 1M5SA 2XLIA 1CG2A 3OQ2A 5K8OA 5IXUA 4IH7A 2B0GA 4QW8A 1ZYQA 4IKAA 3MM7A 1Z4UA 4ECXA 1IR0A 2P6TA 3AB2B 4KAIA 4ECZA 1VQNS 1HBUB 1R8HA 2B6AB 3V6JA 1MWZA 4YP3A 3NG8A 3AA9A 4ES2A 3CVKA 1N5YB 2NSBA 4Q0BA 2OJ3A 2RU3A 4NLXA 3HXMA 2HHQA 3IRWP 1GQEA 2YWGA 4CO5A 3CD5A 3J81Y 1IKVB 1QSLA 4RWXA 5KT7A 3NNHA 3M8PA 4UQGA 3QYYA 2ZE2B 4K4TA 2OPQB 3IGVA 2DVIA 1O51A 3UI3A 4LQ3A 1NNDA 3V4MA 2RH3A 1BQNB 4DR1F 5KG5A 3TQ1A 1D3WA 4L6V3 1J5OA 4RBVA 3OV7A 3N79A 4OX8A 5L1KA 4AE5A 2HRUA 4Q44A 3L95X 4URGA 2M7SA 4QIGA 4I68A 3MURP 2RRNA 2DHGA 2VFTA 1T8EA 4Y34A 2GNKA 4BS2A 1XBWA 3M2UA 3DOKA 2UUWA 4O4GA 5DGAA 2XMUA 2VKRA 2V2KA 4C8LA 1RA6A 2WSEC 1N36F 1B7FA 3PACA 2FLNA 3OVAA 4YOEA 4QZVB 2YX4A 3QLHB 4FN5A 5DDOC 1Q8IA 4QWAA 4WE1B 1SL1A 3NRBA 2OSQA 5HLFB 3H20A 4WYWA 4USIA 3GG0A 1SB6A 1HWJA 3HZEA 2FLLA 3CWJA 4NLTA 2WCXA 3DGPA 4PG5A 2P9EA 3OR1A 2F4VF 1UJ5A 2V8VA 2YWHA 2HS0A 2JFKA 5E3RA 1P1TA 3QZ7A 1EP4B 1X5SA 1MU2B 4QWDA 1FO1A 3TYTA 1U6BA 1Z2ZA 1U1PA 4WTYA 1FJEB 4ECSA 4OQJA 5KT6A 2OPRB 5F8GA 1M5OC 2HHSA 1XEZA 4O23A 3KK3B 1DARA 1D0EA 4NLVA 4DL6A 3CTRA 3LUYA 2DPJA 2OTLS 1SC6A 4XIUA 2RRBA 5L1IA 2FVRA 1YJVA 2HFZA 3M30A 1U6FA 5KFXA 2GQCA 2HVIA 3TOQA 1TK5A 4TY8A 4F02A 1R0AB 2BUNA 2KN4A 1APSA 4PQUB 3IC1A 2I5JB 5CZXA 4QR2A 3DFEA 1N5TA 5D4NA 1RT3A 1OIAA 1S4FA 5A8KB 4X4OA 1WHWA 3EGNA 4I6WA 5D3GA 4ED3A 2VBWA 3IAM9 1O0PA 5KFQA 2X1FA 4USHA 1S9EA 4A8WA 4F4ZA 1SL0A 1U1RA 1WI8A 2RF2B 3OFFA 4JV0A 3ZZPA 1V3ZA 5AE2A 1ULRA 5T41A 5CHCB 4HI2A 5KFCA 2HIQA 4IG0B 4AXJA 2HNZA 3SXLA 3OSNA 3CCES 5J2PA 1VQMS 3RRGA 2PN6A 2XMTA 3TAMB 2R2RA 4R8UB 1JLGB 4LVOP 2J9EA 3O1LA 1QLNA 1JLBB 1TKXB 3CO9A 2ZH7A 1IUJA 2CPZA 2L9NA 2KXNB 1DTQA 1SH2A 1JJ4A 4RNHA 4FF4A 2UUBF 1QAXA 4R0JA 2IYIA 3OFEA 3N0VA 5J1NA 5C42A 4JI7F 1JNZB 5CA5A 2IM0A 2CQCA 1ZTWA 2IVMA 5HROA 4LVNP 1K8AT 3BDEA 1NHVA 4X84A 1UVJA 2Z2MA 3A1YG 3GFHA 2HLUA 1SI9A 3N9UC 1VQKS 1RT4A 4C7QA 5DDRC 3JYTA 2XULA 4HTIA 3LP1B 5C25B 3TA1A 2RKIA 3NL0A 2XC9A 1HNIA 2HW3A 4JI0F 3RB3A 3RAMA 1Y00A 2YNIB 2LDIA 4LIRA 4W90B 3VF0B 5KFPA 5B0DA 2M52A 4U7UK 3QO9A 4ZCIA 3CC4S 3HLUA 1QTMA 1X4GA 2B5JA 5A8WB 2N4DA 2RSQA 2W9AA 2CPEA 2CQ1A 2BANB 4IQMA 5C24B 3KLGA 3R1LA 4RW4B 1KQFB 3HP6A 5DETA 4KSEB 1M1KT 2A3JA 2KB2A 1BQMB 4X4SA 1S1TB 3CPWR 4NZ7A 7FDRA 2M3DA 3QWPA 4DL4A 1IKXB 4B9MA 2Q6BA 1T03A 4YMEA 1ZPVA 4PR6A 2OFGX 5DG9A 2MPUA 2IJFA 4Y2MA 4B9SA 3KK1A 3BDPA 4DFPA 2VPWB 4IFYB 4UY85 3TI0A 2X1GA 1MMNA 5LMNF 4K4XA 2GIRA 3A8EA 3PKYA 3FZ2A 2IM3A 1YJUA 3KLVA 4LSNB 3T9ZA 3HFKA 1TVRA 1ZAVA 2KKHA 5GADI 3CJ5A 4I2QA 3W2VA 2XMVA 2O67A 3DRXA 1RTHB 4I1TA 3W2WA 5LT5A 1DQ9A 5J2NA 1WTBA 1E6YB 4O3SA 1VQ4S 3DRRB 1ELOA 2RDIA 4F3QA 3I55S 1YRTA 2GX8A 3DM2B 2HHTA 2OPSB 3T1AA 2HNDB 3ZZUA 1JLFA 4WK3A 3LOUA 2N4CA 3K7RA 5K14B 3US5A 2LECA 2V9KA 2WTFA 2YH1A 4Q8FA 1F60B 2CG4A 5HMXA 2NYIA 2YH0A 2IVYA 3K2YA 2ZBCA 3KJVB 4RU2A 3J7A1 3PIPQ 3BGRB 1FJGF 1UWBB 2YKNB 4ZHRB 1FEHA 2NPFA 3Q24A 5BYSA 4KO0A 1W25A 2QLWA 4TU7A 2HG4A 3MR2A 4OI3A 1C0UA 3L7PA 5FDLB 3VZIA 4KE5A 5DQGA 2K1RB 2XNRA 2QFJA 7FD1A 2QLXA 2VKZG 1T05A 3O8WA 3OUYA 1FA0A 3MEGB 2OPPA 5DLFA 1U45A 5CYQA 4RZRA 2HS3A 1M5VC 2R7VA 1QJHA 2B56A 2BJDA 2LMIA 2NUUG 1HNVB 3U1LA 1PC4A 4DOZA 3MAHA 5F8LA 1AFIA 2QA4S 3LH2S 2CFXA 3KLFA 3OVBA 5EN1A 1JJ2R 5AXKA 1H98A 2V4JA 3Q0AA 4IR9A 2G4BA 4PWUA 4H4OA 2R7SA 2LDYA 2ROEA 2DT9A 3H2VE 2RUGA 1NEEA 3OTCA 4O44B 1JLAB 1A7GE 5CCLA 3RYLA 4QU6A 3SMZA 4FYDA 2O1PA 3ITHB 3CIMA 1RDRA 4D3HA 4FF1A 4I7FB 2QV6A 3C6UB 4H4MA 4J9KA 1OQ3A 1SIWB 2KM8C 2UXBF 4DV6F 1FDBA 2PC6A 2XCAA 3CD7A 3MMAA 3KLEB 2KG0A 1KC8T 2FC8A 1DZ5A 2DITA 3CB4A 3MECB 3HHLB 3RBDA 2A1BA 1KONA 1Y5NB 2ZH5A 2G9OA 2V0NA 2CPXA 3HT3A 2XHWA 4Y2AA 5KG4A 3Q2SC 4HH0A 1HPZB 2O66A 2RQMA 4XAKA 4DR7F 3TANA 1HBOA 2WHOA 2ZH3A 4M63A 1ZZFA 1X4FA 4ZP7A 3NBPB 1RYRA 1X4CA 3BSCA 2YNHA 2Z2LA 2XSFA 4BC7A 1BY9A 1TL1B 1KOHA 3ETOA 3CDEA 1X4AA 3LQVA 2ZITA 2IBOA 2WSFC 4U9RA 2ERRA 4LT6A 4DSLA 2B9XA 1OS5A 3SI8A 2GQ2A 1RTJA 4DUYF 3T3FA 2JZ5A 2WONB 3J7YU 3SDEA 1VQPS 2DGOA 4I6YA 3QIDA 2CJAA 1LW0A 2IA0A 2VPXB 3N5BA 2A2DA 1QAIA 4OLOA 1ZAXA 3DU5A 3DLLQ 3B4MA 3R5BA 1S97A 4ECTA 4I67A 4B08A 5C5JA 4PG4A 2HWHA 3MMBB 4TQRA 3ZFVA 1X9MA 2DCLA 1I6JA 1GXLA 1UVNA 5A0YB 3K5OA 4KFBA 2XSJB 2MXYA 1FVQA 1OSDA 5D6GA 3GIMA 1UEUA 4RNMA 3SSSA 3AB4B 4KRWA 1ZZNA 1XNQF 4AXIA 1S1WB 4DL2A 2FHJD 3AY0A 4YQWA 1GNKA 1MSWD 4ELVA 3QGGA 5B08A 2LEBA 1JLEA 2KDOA 3S01A 3CJ3A 4KB7A 4RW9A 1OQ6A 1TV6A 2AYBA 2EBGA 2Q3PA 3FFIA 2J76E 3DI6A 1AUDA 2F3JA 3E8OA 2MHNA 4LSLB 1LWEA 1NK4A 4B3OA 2QMWA 4A47A 2ZHOA 4I4BA 1LW2B 1O5JA 1H7XA 3O5TB 1P1LA 3K0JA 2RE1A 4OI6A 3POTB 2FLPA 1FRIA 2VQFF 2ADBA 4JOUA 2DD8S 2Z0GA 1MROB 2EG2A 2Y1JA 2RQ4A 4QIFA 4C0OC 3JTOA 3RAXA 1UFWA 4OI2A 4NLGA 3K5MA 1FKPA 2XY5A 1W2BR 1WELA 2VD3A 2N7CA 4RW7B 2ZOGA 3CD6S 3C6TB 2VG6A 2K2PA 4B3MF 1VFJA 2XEXA 1SQEA 3FQKA 4X62F 1KLNA 2V4RA 2BQRA 3TA0A 2JEIA 1HYSA 5KFKA 1REVA 1P27B 1L3KA 4HL9A 4PUOB 1Y4ZB 1FE0A 2L48A 2X3GA 3IRXB 3HK2A 2DGQA 4C0HA 1K9MT 1B0PA 3HVTB 3IWNC 2NR0A 1S1UA 2VBXA 4DFMA 3PX4A 1WF0A 1P9QC 3MGJA 4EWTA 3G6VA 3M1VB 1IN0A 4USJC 1JMTA 4F25A 1XNRF 2KZZA 5KFBA 3IN5A 4DV7F 4HVZA 1TP7A 3KMSA 3VALA 3V4IB 2HHHF 2PMZD 1T95A 4K50A 3ULHA 3F56A 3TUZC 5KAKA 4Y00A 4C97A 3NMAA 2ZNYA 3X1LB 4X2BA 4B9NA 1N5SA 3E01A 3CCWA 4F3MA 2POKA 4DL3A 4RUHA 5DG7A 1SV5A 4DBQA 2FUG9 3V2UC 3T9NA 2AD9A 3QGPA 4RUCA 2B9WA 2C42A 3BQ0A 1TR0A 1U6ZA 2MMYA 1F5BA 1HBMB 2BABA 4WU3A 3UE2A 3UR0A 4DEZA 2FDNA 2R8HA 1KHWA 4I69A 4YR2A 4ECVA 2VBYA 4OIXA 5I3QA 2ROGA 4MTPA 4ZVHA 5GAHI 2F9DA 2LEPA 1LXJA 2YX7A 3IFEA 5KFWA 2E1RA 3QMQA 3RRHA 1TKDA 1NK8A 4YB5A 5KFLA 1SUQB 4AL6A 5J1PA 3NS6A