2G16A

Structure of s65a y66s gfp variant after backbone fragmentation
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Understanding GFP Posttranslational Chemistry: Structures of Designed Variants that Achieve Backbone Fragmentation, Hydrolysis, and Decarboxylation.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 11
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.40 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2g16A00
2A56A 3CFHL 2G3DA 2G5ZA 2A52A 5EXCA 2G2SA 3CFAL 3LF4A 2GW4A 3CFFL 2A53A 2A50A 2A54A 2G16A
chains in the Genus database with same CATH superfamily
3UA0A 4MQ6A 2A88A 3UK2A 2A86A 2RETA 3IVGA 1N2HA 1N2JA 3MUEA 4MULA 2G5ZA 4FZJA 1MOPA 2A56A 4MUIA 2G2SA 1UFVA 3AG6A 3CI0K 2A50A 1N2OA 4MUKA 2GR8A 1N2GA 2GW4A 3EMOA 2EJCA 4DDKA 4G5FA 3CFFL 3CI0I 1N2EA 1IHOA 3MXTA 4MUHA 2GR7A 4MUEA 2I52A 2G16A 4EFKA 4DE5A 2A52A 4DDHA 3IUBA 2A7XA 4EF6A 3IVXA 3Q12A 5HG0A 3N8HA 3IMEA 5BW0B 4MUGA 5G2FA 4DDMA 3IMCA 3COYA 3QTTA 3AG5A 4IXJA 3COVA 3COWA 2A53A 5KWVA 3UY4A 1N2BA 2A84A 3IOBA 3COZA 4MUJA 2OGFA 2X3FA 4MUNA 3ISJA 5EXCA 3CFAL 3LF4A 1N2IA 3IOEA 1V8FA 3CFIA 3IODA 3Q10A 4BHRA 4G5YA 2A54A 3CFHL 2G3DA 2IECA 3IMGA 3HL6A 3IVCA 3LE8A 2LMEA 3INNA 3IOCA 3IUEA 4MUFA
chains in the Genus database with same CATH topology
3UA0A 4MQ6A 2A88A 3UK2A 2A86A 3IVGA 1N2HA 1N2JA 3MUEA 4MULA 2G5ZA 4FZJA 1MOPA 2A56A 4MUIA 2G2SA 1UFVA 3AG6A 2A50A 1N2OA 4MUKA 2GW4A 1N2GA 2EJCA 4DDKA 4G5FA 3CFFL 1N2EA 1IHOA 3MXTA 4MUHA 4MUEA 2G16A 4EFKA 4DE5A 2A52A 4DDHA 3IUBA 2A7XA 4EF6A 3IVXA 3Q12A 5HG0A 3N8HA 3IMEA 4MUGA 5G2FA 4DDMA 3IMCA 3COYA 3QTTA 3AG5A 4IXJA 3COVA 3COWA 2A53A 5KWVA 3UY4A 1N2BA 2A84A 3IOBA 3COZA 4MUJA 2X3FA 4MUNA 3ISJA 5EXCA 3CFAL 3LF4A 1N2IA 3IOEA 1V8FA 3IODA 3Q10A 4BHRA 4G5YA 2A54A 3CFHL 2G3DA 3IMGA 3HL6A 3IVCA 3LE8A 3INNA 3IOCA 3IUEA 4MUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A56 A;  3CFH L;  2G3D A;  2G5Z A;  2A52 A;  5EXC A;  2G2S A;  3CFA L;  3LF4 A;  2GW4 A;  3CFF L;  2A53 A;  2A50 A;  2A54 A;  2G16 A; 
#chains in the Genus database with same CATH topology
 3UA0 A;  4MQ6 A;  2A88 A;  3UK2 A;  2A86 A;  2RET A;  3IVG A;  1N2H A;  1N2J A;  3MUE A;  4MUL A;  2G5Z A;  4FZJ A;  1MOP A;  2A56 A;  4MUI A;  2G2S A;  1UFV A;  3AG6 A;  3CI0 K;  2A50 A;  1N2O A;  4MUK A;  2GR8 A;  1N2G A;  2GW4 A;  3EMO A;  2EJC A;  4DDK A;  4G5F A;  3CFF L;  3CI0 I;  1N2E A;  1IHO A;  3MXT A;  4MUH A;  2GR7 A;  4MUE A;  2I52 A;  2G16 A;  4EFK A;  4DE5 A;  2A52 A;  4DDH A;  3IUB A;  2A7X A;  4EF6 A;  3IVX A;  3Q12 A;  5HG0 A;  3N8H A;  3IME A;  5BW0 B;  4MUG A;  5G2F A;  4DDM A;  3IMC A;  3COY A;  3QTT A;  3AG5 A;  4IXJ A;  3COV A;  3COW A;  2A53 A;  5KWV A;  3UY4 A;  1N2B A;  2A84 A;  3IOB A;  3COZ A;  4MUJ A;  2OGF A;  2X3F A;  4MUN A;  3ISJ A;  5EXC A;  3CFA L;  3LF4 A;  1N2I A;  3IOE A;  1V8F A;  3CFI A;  3IOD A;  3Q10 A;  4BHR A;  4G5Y A;  2A54 A;  3CFH L;  2G3D A;  2IEC A;  3IMG A;  3HL6 A;  3IVC A;  3LE8 A;  2LME A;  3INN A;  3IOC A;  3IUE A;  4MUF A; 
#chains in the Genus database with same CATH homology
 3UA0 A;  4MQ6 A;  2A88 A;  3UK2 A;  2A86 A;  3IVG A;  1N2H A;  1N2J A;  3MUE A;  4MUL A;  2G5Z A;  4FZJ A;  1MOP A;  2A56 A;  4MUI A;  2G2S A;  1UFV A;  3AG6 A;  2A50 A;  1N2O A;  4MUK A;  2GW4 A;  1N2G A;  2EJC A;  4DDK A;  4G5F A;  3CFF L;  1N2E A;  1IHO A;  3MXT A;  4MUH A;  4MUE A;  2G16 A;  4EFK A;  4DE5 A;  2A52 A;  4DDH A;  3IUB A;  2A7X A;  4EF6 A;  3IVX A;  3Q12 A;  5HG0 A;  3N8H A;  3IME A;  4MUG A;  5G2F A;  4DDM A;  3IMC A;  3COY A;  3QTT A;  3AG5 A;  4IXJ A;  3COV A;  3COW A;  2A53 A;  5KWV A;  3UY4 A;  1N2B A;  2A84 A;  3IOB A;  3COZ A;  4MUJ A;  2X3F A;  4MUN A;  3ISJ A;  5EXC A;  3CFA L;  3LF4 A;  1N2I A;  3IOE A;  1V8F A;  3IOD A;  3Q10 A;  4BHR A;  4G5Y A;  2A54 A;  3CFH L;  2G3D A;  3IMG A;  3HL6 A;  3IVC A;  3LE8 A;  3INN A;  3IOC A;  3IUE A;  4MUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...