2G1AA

Crystal structure of the complex between apha class b acid phosphatase/phosphotransferase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
209
structure length
209
Chain Sequence
b'SPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class B acid phosphatase
molecule tags Hydrolase
source organism Escherichia coli
publication title Crystal structure of the complex between Apha class B acid phosphatase/phosphotransferase
rcsb
total genus 76
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2006-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2g1aA00
5AM4A 3M1YA 4G9BA 4RETA 5AKKA 2YN4A 2P27A 5AM5A 1TJ4A 3QGMA 5ALTA 3UMGA 1QQ6A 5AVZA 5ALPA 4QQFA 5AVXA 2WF8A 3A1CA 1YS9A 2B1RA 3M9LA 1ZD2P 3U7EB 3QXGA 3UMBA 2O9JA 2CFRA 3PGLA 2HSZA 4UAVA 4UMDA 3QLEA 5IT4A 1ZJJA 1T9ZA 2RAVA 3SMVA 3WKDA 5AIBA 4UAUA 2C4NA 1QQ7A 2R8YA 3WK4A 3N1UA 3ZVMA 3DDHA 5AVUA 2OM6A 2Q5EA 3QU4A 4UM7A 1SWVA 1RLTA 2GHQA 2AH5A 2ZBGA 3NIWA 4YH1A 5AW9A 3EPRA 3MN1A 4Y2RA 2WF6A 2MU1A 4J2TA 1RMQA 3L1UA 4HGOA 4Y2VA 4KYTA 4UMVA 3F9RA 3PCTA 2G07A 3EWIA 1RQLA 3W5DA 1VJ5A 4F72A 5AHXA 1YJ5A 3B8EA 3DAOA 4BBJA 3QUQA 4YCLA 4ZEXA 1EK2A 5AIAA 2YMLA 3E8MA 1S8OA 4BX3A 3I28A 1X42A 5AW7A 2JAWA 5ALFA 2YY6A 3QYPA 3U7GA 2ZOSA 2ZBEA 5AVYA 4UMFA 2BY4A 3I6BA 5ALNA 3MPOA 1QQ5A 4I9FA 3I76A 2FPUA 4OCZA 5AVVA 3P96A 1U2SA 3NAMA 3NANA 3QUTA 1NF2A 2B8EA 5AI0A 3PGVA 4CF4A 2PQ0A 3ZWDA 3FZQA 2ZG6A 5AKHA 3A1EA 2PR7A 3L0CA 3OCUA 4Y2TA 3RF6A 3NALA 1YNSA 2P11A 2YBDA 1T5SA 2FEAA 3BA6A 3L8GA 5AM3A 3U7HB 2YMPA 1ZD4A 1LVHA 4RESA 5AM0A 5AM2A 3U19A 3QX7A 3AR8A 4OFZA 3BWVA 2EARA 3L8FA 5AI9A 2RB5A 3J7TA 2P69A 1XPJA 5ALZA 5ALUA 5AVTA 3MMZA 1YMQA 1RQNA 2C8LA 4YIKA 4CNQA 1U7OA 3B9RA 4BNDA 4DW8A 4AS3A 5AKZA 1Z4LA 2CFTA 2G09A 1Z5UA 4I9GA 5AI4A 4PNHA 3ONNA 5A3SA 3OPXA 2HDOA 2C8KA 5AVWA 1RKVA 3A3YA 4JB3A 1Z88A 2FPXA 3ED5A 3R9KA 3ZU6A 5AW3A 2WFAA 3SD7A 1QYIA 4NWIA 2G08A 2G80A 3KZXA 4YIHA 3KD3A 2YMMA 2HHLA 1RMYA 1CR6A 4MWOA 2OBBA 4Y2JA 4HGNA 2YJ3A 1L7OA 1XP5A 2JAUA 2ODAA 4UM5A 1LTQA 3OCWA 2GMWA 4Y2UA 3L5KA 1U02A 3ZVNA 4UATA 2OYCA 3SKYA 4DWOA 5IT0A 1Z4KA 4MUMA 4UW9A 1TE2A 4BNDB 1Y8AA 4EEKA 4OHFA 2G06A 3AR5A 3WGUA 2HEGA 4HGPA 1Z4NA 4QJBA 1RLMA 2R8XA 4BKMA 5A3QA 3ZUPA 3RFUA 4GXTA 5ALWA 5AW6A 2EAUA 2AUTA 3QU2A 1RPZA 1L7MA 2W4MA 2EATA 1L7PA 3FVVA 1F5SA 3QU5A 3ESRA 2NO5A 4XOUA 1RKUA 2NYVA 2P9JA 4Y2YA 5AKYA 3DNPA 4L6CA 2BDEA 5AKIA 3ZI4A 4G63A 2HF2A 3NUQA 3U13A 4Y2XA 2HCFA 2FPSA 5ALQA 3WK8A 3WK6A 1O03A 4HGRA 1SU4A 3VAYA 4B6JA 4HAIA 2G1AA 3AR7A 1VFPA 5AI5A 3WK9A 2RARA 3CZ4A 3IRUA 5ALGA 1IWOA 4BX2A 2AGVA 1RMTA 1RDFA 3N8GA 2QLTA 5AKJA 2CFSA 4AS2A 5AESA 3L0BA 5ALVA 5AVSA 1TJ5A 1J97A 5AK6A 2YJ6A 2B8JA 4IFTA 2JARA 3I1YA 5AKLA 4HGQA 1YDFA 3WKCA 3W5BA 4E88A 1Q92A 2IOHA 3NRJA 3UM9A 3IJ5A 3ZVLA 4J03A 4OD0A 3N07A 5A3RA 3W5CA 1J8DA 3L7YA 3AR9A 2WF7A 5AVQA 2GFHA 4DFDA 1QH9A 3ET5A 2BDUA 1VJRA 2WF9A 5AW5A 3OTQA 3KDPA 3D6JA 4UARA 3E58A 4JDPA 5T41A 5AW1A 5AW0A 2B0CA 3EF0A 1JUDA 1Z4MA 4GIBA 3WKEA 5AK3A 2OA0A 5ALMA 3KBBA 3R4CA 3QNMA 5FP0A 5ALKA 1K1EA 4ZEWA 3HYCA 1U7PA 3SHQA 1NNLA 4KX5A 3ZTYA 4KN8A 5AW2A 2JGAA 4EX6A 5AK4A 1CQZA 2YJ5A 2VKQA 4C4TA 4YCMA 5AVRA 2AMYA 4CF5A 3R09A 3E81A 1MH9A 5ALJA 2FPRA 4NAVA 5E0OA 1Z4JA 5AKEA 3WK5A 2I7DA 2HF7A 2HOQA 3S6JA 4ZEVA 2X4DA 3L8EA 2NO4A 2W43A 3UMCA 5ALEA 1YV9A 2IOFK 3L0YA 2FUEA 3N28A 3QUBA 2IOFA 3EF1A 3K1ZA 2W11A 2I54A 2MSNA 4NV0A 3ZTWA 2RBKA 2FI1A 1U2TA 3ZX4A 4L57A 3ZW7A 1Z4IA 1WPGA 2PKEA 1ZRNA 4XE5A 1Z4QA 5ALRA 1AQ6A 4FE3A 5AKGA 4YGYA 1ZS9A 2C9MA 2HX1A 1N9KA 1TJ3A 2G0AA 5ALIA 4EELA 4H1WA 4CF3A 4KNWA 2WHEA 1XVIA 3KOOA 2WM8A 2GO7A 4KX3A 2FUCA 2HI0A 1T5TA 3WKAA 1ZRMA 2CN1A 2ZBDA 3AR2A 4EZEA 3E84A 5AICA 1ZD3A 2B1QA 2WF5A 4NABA 3N5KA 5ALDA 2ZBFA 4XQ0A 3TLMA 3AR4A 1O08A 3ESQA 3QU9A 2GHTA 4UU1A 5ALSA 3CNHA 2JAOA 1WZCA 2C88A 3FPSA 3WKBA 4YCNA 2DQSA 3QU7A 1NRWA 3MC1A 1EK1A 1WR8A 2FPWA 2I55A 4AP9A 2I33A 4CE6A 4EENA 2ZXEA 4UMEA 3U26A 3HLTA 4BEVA 1PW5A 3SLRA 4EX7A 3FGOA 4DCCA 3SF0A 4KNVA 4UU0A 3L8HA 1Q91A 2D2VA 5ALXA 4BYGA 4XPZA 4Y3UA 3KC2A 1FEZA 4O8CA 1RC8A 3W5AA 1L8OA 1TA0A 1Z5GA 1KYTA 3NASA 3ET4A 2HO4A 4Y2SA 3WK7A 4UASA 5AW4A 1ZD5A 3AR3A 5JJBA 4FYPA 5ALHA 4BEWA 4Y2PA 1L6RA 1Z4PX 2Q4RA 4L6AA 1SWWA 3ZX5A 5AW8A 3SKXA 4Y2QA 3FM9A 1RLOA 2B30A 2QYHA 3A1DA 2R8EA 1RKQA 2YMQA 1L7NA 2IA5A 3QUCA 2O2XA 4C4RA 3L1VA 2Q4TA 3IB6A 2YFYA 3WGVA 5ALYA 2IYEA 1L8LA 3ZWKA 2I34A 1ZOLA 2B82A 4C4SA 4BX0A 3AR6A 1WVIA 5AKXA 5ALOA 3OCVA 1Z4OA 3U7FB 3GYGA 3OCXA 2R8ZA 3FPBA 5AM1A 3PDWA 5AI8A 4F71A 4IG4A 5IS2A 4HYTA 1N8NA 5ALLA 2YJ4A 1RRCA 4FFDA 3OCZA 3B9BA 1S2OA 2FDRA 4NFLA 3OCYA 2I6XA 5AK5A 5AI6A 3DV9A
chains in the Genus database with same CATH superfamily
4KFCA 5DLEA 3ZW9A 2F7SA 1WNFA 4OJMX 3OPNA 3KSAC 3BIJA 2HSWA 3MD0A 4KE8A 3VO2A 3K1TA 2GXQA 2PWBA 3G2HA 5DNAA 2RK4A 3QVXA 1PHPA 2ZDHA 3E9YA 2VT3A 1NZJA 3FWPA 3K72B 4N5LA 5KSPA 4CKBB 4HUTA 3FYUC 3MXOA 5JMPA 5FOTA 2QRUA 2I7VA 4W82A 1ZA2A 1BOOA 5JNWA 2GBFA 2A7XA 4LWPA 4R9VA 5KOIA 3BGSA 3ZV5A 4Z9FA 5KVCA 4XX0B 3NYRA 2VQFB 1ORVA 4OMFG 1GZ5A 2FR8A 3KIPA 4TXMA 3RW9A 5BXYA 4LVUA 1I36A 3RADC 1QCCA 1T34A 4DQDA 2WQ7A 2OYSA 3RS3A 5HMMA 1TX4B 3RSHA 1KMCA 3ZHXA 4G1EB 4QU5A 4QQNA 4IRXA 2NVUA 1G60A 1XD2B 3GNLA 5CM2Z 1LDGA 3BWXA 5SY6A 3U7RA 2VJAA 3H19A 3IB3A 3T4PA 2OVBA 5K3OA 1XCGB 4C0HA 3CR8A 3B7WA 4YH1A 2HDHA 2WTEA 2HV8A 5AW9A 3URKA 2Q1TA 2IU6A 4TZTA 1X2EA 2X9GA 1TW2A 4HAUA 4Z3OA 4NCJA 3GFTA 2AI1A 3S1AA 4D9EA 3C6XA 1N5RA 1VHWA 3E61A 3PCTA 4JLNA 3PDJA 2Z56A 4G37A 4YDSA 2EYUA 4U2EA 4RJTA 3EWIA 1K3TA 1UWCA 3W5DA 5CX4A 1TIBA 3WJ7A 1JEYA 2VA8A 1V1MB 4YBRA 2WUWE 1IVNA 1K4MA 3DEJA 3QUQA 2Z5GA 5I4KA 3KQNA 1W85B 1XA4A 3S0JA 5TIIA 4FR0A 3Q2OA 1J56A 1M75A 2CEAA 3OSUA 4RVSA 2CJWA 1CIJA 5EE3A 2PUCA 2SICE 5JH7A 2WYIA 1P9LA 1X74A 3ABQB 3EXFB 2JKVA 4ZT2A 1R8QA 1RXUA 4UMFA 4HWRA 4I5EA 4U7FA 2BBOA 4AIRA 5BQ5A 2HNKA 5JSQA 3GLIB 1QQ5A 2CLDX 2AE1A 2ECPA 2XQVA 2A9VA 2IYOA 1IM8A 5M2QA 2FQQA 1N7IA 2OLKA 1PUXA 2BTQB 1U2SA 3EFOB 3GVHA 3PQ4A 4MKRA 2WILA 4C7VA 1MVNA 5TR9A 4BMCA 3VSCA 1XD9A 5D7NA 5EKSA 1CZLA 3V1KA 3GPBA 3RVOA 3EUWA 1U0GA 1Z8DA 3B60A 4Q21A 4ID9A 1Z8FA 1P4RA 2B0JA 2C0CA 1CXZA 3C70A 4JUAA 3RAEC 2H4ZA 4YUXA 4D8YA 1W36C 1X6VA 2V59A 1E61A 1SQ6A 4J16A 4MQFA 4NSNA 4X1KB 4KMSA 1K66A 3D6UA 2HU2A 2GZMA 5DB4A 6ABPA 3TB4A 2ZUCA 3RKUA 3EZFA 3U9SA 1T4MA 4JJZA 4B7UA 4ARCA 1J49A 5EJIA 4QKQA 3ONVA 4X85A 4FHFA 1N6IA 2IVZA 4DGQA 4DC1A 1H4VB 4JI1B 4EHLA 4RQBA 5BXQC 4V02A 2APJA 1BXKA 1KAMA 2FV8A 4Q66C 4N9WA 1L5WA 1EWTA 1E7RA 4B74A 3DEAA 1O9BA 3HZHA 3O8RA 4EJ0A 4ZAFA 4NDAA 2J5KA 3J7TA 3RUIA 5JECA 2P69A 3U4MA 1AS0A 3T41A 2HW8A 4AW9A 2CZQA 3MMZA 2UXDB 5EKTA 4FIZA 2PT7A 3DBIA 3PPXA 4PVCA 2Y1XA 2CMGA 1KVUA 3MWKA 5KQMA 3KKMA 2P1ZA 3LOUA 2C2OA 2SBTA 2DWQA 3DKKA 3QI2A 4KAJA 4X45A 2GZ1A 3WLLA 4JI6B 1S2IA 3WWPA 4AS3A 4EJSA 3FPFA 1IPEA 4RTLA 5K09A 4XB6B 2OL4A 4GM4A 4H7EA 4BJ5A 4B2YA 1R00A 3EODA 3W5UA 2O7VA 2H2GA 4C4AA 4XJVA 3ZS8A 4OLAA 1OKKA 1EVQA 4B34A 3VRHA 4YR7A 4Q3BA 3PL5A 2I6SA 3OEHD 2IZ5A 1B93A 5HZMA 2JVKA 4AQDA 5HP4A 4RFLA 1YVDA 2XT6A 1OXSC 2OBMA 1NMEA 3KYIB 1VRVA 1W4RA 1K97A 2O0HA 1H2HA 4TKUA 2DULA 5FFMA 2CVPA 4GLLA 4ZU1X 4UULA 1BS1A 3AFMA 2BLNA 3DW3X 2ZB3A 3O8OB 1YK0A 3GCDA 4FLMA 1KIMA 2R6ZA 3O4FA 5E6RA 1P81A 2PBLA 3OIDA 3HCFA 2QK4A 4ROSA 2X22A 3RHFA 4OX9Y 4MS1B 1PNQA 4IP0A 3WYBA 2AX3A 3JAWA 1NBME 5AQEA 3EZ2A 3KYBA 3FDFA 4TL9A 4BMZA 5CGZA 4OXXA 1S5PA 1QU2A 1B7GO 2QGNA 3N53A 4GWGA 1GPYA 2H1FA 4MLDA 5FADA 4TWIA 4C5AA 2JGNA 4KQGA 2MMCA 4PY2A 2IHTA 2A9PA 4YQYA 3WYFA 2XNKA 5CT5A 1F6WA 3B9QA 1R27A 1A88A 3PSAA 2FPPA 4XB1A 4XVRA 4ZV9A 3RSSA 3ZHZA 4BBPA 1DAOA 2OT3B 2D8MA 2BYTA 4AXBA 3I12A 2BEVB 2G5GX 5A03A 2WJ4A 1E1CA 2YS6A 3DEZA 3IUJA 1X7WA 4E07A 4HGPA 4EATA 4AUEA 1XXLA 5BOVA 4WZBA 3BFPA 1FQJA 4B3BA 1DOHA 2HJHA 2C0QA 2C31A 2OV6A 2P4EA 3A4YA 3OOEA 4G5YA 4GXTA 2D2IA 2QG9A 4JBNA 1JG4A 2QRHA 4QYXA 5JSYA 3PWTA 2VUUA 1N5OX 3BJRA 5LC1A 1BCSA 3GMIA 1A9QA 3U7QB 3UYKA 4BTVA 5A0VA 1P2GA 2QZ4A 2R4QA 3KPVA 3QIAA 4MQUA 4ZQFA 2OXIA 2BH2A 4J3JA 1E3JA 4PGGA 5EINA 3FRIA 1L7PA 4YUVA 2VQDA 4ZPJA 4CG2A 1H22A 2XJ9A 4LHXA 5B1EA 1WZ2A 4W5RA 2P9JA 2PZAA 2WE8A 4MVJI 3GWZA 1AQIA 3H8WA 5AKIA 3O84A 1PEAA 3HUEA 2HCFA 3DWIA 5A4MS 3ADDA 4R40A 4B7ZA 4RVHA 1POXA 1AKTA 1OXKB 1H3FA 1PV1A 1I7PA 3OG9A 4ZT3A 3VAYA 4CM6A 4AJ4A 5CEEA 4XQ9A 4FYKA 1YBFA 4DVJA 4FK8A 4YRRA 3PTAA 3E9CA 1TM7E 3EE6A 2J0UA 1HLGA 3LCVB 4Z7NB 3GI1A 4HFRA 4C20A 2R8BA 1Z37A 3PEEA 4YQFA 3T99A 4JXXA 1QGED 5F9FA 2AGVA 2GWHA 5D6OA 2C98A 4C0SA 2P2GA 3BQNB 1P1IA 4RC9A 4DIBA 3GCXA 3L0BA 3HLKA 3R9IA 5CXUA 4QE3A 5AVSA 4AS1A 3WWYA 5ABPA 2RE8A 1Q2XA 5EEGA 2ZRLA 4V0LA 2O0MA 2ZRFA 3VR5H 4MRVA 3PXDA 4N3BA 2AUMA 3KUDA 5JTTA 1U2RA 4IFTA 1UZLA 4MDHA 1NKVA 2ETXA 4Z1MD 4PYKA 3OM8A 4DLWA 3ENZA 4BXOB 3NHPA 4L50A 2HYIC 3K05A 3O8LA 3SYTA 4E88A 2PMEA 3DT6A 2FOIA 3CF4A 1DI0A 2QVBA 3ECAA 4I5GA 4JP5A 2NUBA 5FTWA 1T5DX 1E5LA 2DFNA 1NR5A 1YGYA 1TQDA 3KOZA 1I8TA 1U2GA 3JPYA 3KQOA 4L8WB 4FEYA 5HILA 2H4WA 1N2EA 1JMVA 4BVKA 3B1VA 1YZGA 4G01B 1L3CA 5CA0F 5TMPA 1EESA 4KGXA 2VDPB 4BV3A 3DMRA 1VJRA 5IKXA 4RVUA 2QLMA 3A6GA 3AETB 2ZVPX 2X86A 1JPUA 4LYEA 3LV8A 1RTTA 2WJ6A 1O95A 1R4MA 2AG8A 2FKNA 1JAZA 2OGSA 4GI2A 2AC4A 1WW3A 4HDRB 4M55A 4F2PA 1IY1A 5LXTB 2ASEA 3STWA 2ECKA 2P6PA 5IJZA 3FOCA 1NXVA 3EIEA 4G23A 3PR3A 2DPGA 4LHZA 1FPMA 3AB8A 3K8OE 5IAAA 1OXXK 4WV3A 5J58A 1U2EA 4M2LA 1QYCA 1R9GA 1ZI6A 4EGFA 4LG1A 1J24A 4KN8A 3SF8B 5A0TA 1TD9A 1UPBA 1GUZA 3TTWA 2Q5LA 3HKDA 4GKJB 1RJFA 4TUYA 2AD1A 2QYTA 2WNIA 1VGQA 3SKVA 3S8MA 4E2WA 1XKLA 4CETA 2JAPA 4MWDA 5GM2A 5IAGA 1PR0A 2IP1A 2AS0A 2X3YA 2BHRA 3OFVA 3CRMA 4RIHA 3PTLA 3IODA 3ZE8A 4WX2B 1L2TA 3FGNA 3KQLA 3PLRA 1N57A 2HRDA 4UNQA 4ENTA 2C07A 2QN7A 3PHCA 2B8TA 3F97A 3K35A 4ZDWA 3W8DA 2A92A 1AK2A 1VIVA 1D2MA 4PQGA 5KINB 1M9NA 3KP1A 3LF2A 3OETA 2HF7A 2G1JA 2HPZA 4N40A 4UEKA 2HOQA 3I2JA 4BIMA 2DEUA 4K9PA 1D1SA 2FN8A 1ZCJA 2A0WA 3EAFA 2JLZA 3IUEA 1UBLS 4A8JC 1YA4A 4BJ1A 2XWQA 5FUBA 4C2UA 1TU4A 1QDEA 1XF9A 2O8FB 1DSSG 3UO8B 3ICPA 2YZ2A 4ZYUA 3ZYZA 3F7MA 4EB0A 2ZI6A 1UH5A 1BH6A 1K63A 2EFGA 3GEIA 3FJOA 4U9IS 5IF9A 3O0TA 3C3JA 1EA5A 1OWMA 2O3TA 2NQTA 4XWAA 1ISGA 2HY7A 2QTVB 3UCEA 4BMVA 2G17A 1G6OA 4XE5A 2OAGA 3BB3A 2B3DA 2WLSA 3TG2A 4X65B 3I61A 2W98A 4JEIA 1JYFA 4HDSB 4P86A 2RH9B 4GQAA 9LDBA 1RI5A 2FSSA 3FOBA 3U4HA 1NBEA 4W9RA 5DOVA 3I05A 3WGNA 5FBLB 4AMGA 4DEXA 1RE1A 2EX0A 1G59A 2V7TA 4J9VA 3KJNA 3QTLA 1X0VA 4LE0A 3DYBA 3M4NA 3OVMA 5K3FB 2HV9A 4JJ8A 1E1RA 1G98A 2Y66A 1AV6A 2NU6A 1E0AA 5HKKA 2WJYA 3B2NA 3V8MA 4LF4B 1CYDA 1MAAA 2JDIA 121PA 1L7DA 2V7GA 3GCWA 3OD1A 3Q72A 2DC1A 4J16C 5K6TA 1VL6A 2CN1A 4UEWA 2OO3A 2FUG6 4MO2A 4PG6A 2H1VA 5DSZA 3UXMA 7MDHA 2A3NA 4QVGA 5A9SB 3MB8A 2V74B 4D98A 4OHBA 2QMUA 3DBLA 4E31A 1MC8A 3P45A 5KJEA 4EO4A 4TKUB 5DT2A 1KEWA 5BW5A 1ZIOA 1SK9A 1KJWA 3L6DA 4JC8A 2HLDA 2QUHA 1BXRB 1C3LA 4DREA 2MOKA 2W2QA 1S2NA 1AH2A 5EJFA 5FV7A 3DVQX 4OLBA 1VPDA 3UOAB 1UF9A 2C4MA 4TZKA 3RVPA 1PTJA 4BLRA 2PD3A 1ZHFA 2UVDA 3A1WA 3FPSA 4RTNA 2HUPA 2GPWA 2YH2A 2QMHA 3EIQA 1EK1A 1DQNA 3ODGA 1Q6ZA 5B58C 5IDWA 2ZRAA 1ANKA 1HDEA 1RM5A 1MVOA 1XRSB 3UHPA 1PQYA 3MUNA 1XWFA 3GT4A 3I2GA 4GLBA 4P7FA 4UE6A 3I9V6 3U26A 4I5FA 3BC1A 1Z8HA 3JR3A 4G5OA 4PO3X 4MQBA 1C9DB 5K51A 2OHXA 3ZU4A 2UUAB 1K88A 4G0UA 2OC4A 3OT4A 3FGOA 4G09A 3FWYA 3ODPA 1HKUA 5CM8B 4D0NA 4HSGA 3V4VB 5AR1A 2EDCA 1QWSA 4QGHA 5DCLA 5C8ZA 2DKFA 2Q46A 3EDCA 5FUQA 5JSHA 3AFNA 2GUWA 1J8YF 3PJGA 2VWGA 4BVJA 1T25A 8AT1A 2Z6AA 3ZD6A 3L79A 1ZJ4A 2BIFA 3JZIA 3GLGA 1L8OA 4LRQA 3MS4A 2JJ8A 2ZS8A 1Z5GA 1PG5A 3LW7A 3O9VA 2P4UA 1L5HB 2QTCA 1OB2A 1GZ3A 4E2ZA 2I22A 2HO4A 2F8LA 5IULC 1KK3A 1NBWB 1KNXA 1FVHA 1UMKA 2Z4SA 4E3WA 1VSUA 2I3BA 3OOHA 1LI4A 2QM3A 1CIVA 1W1WA 5MN6A 4X91A 5ESXA 4XUCA 2LKCA 5EHGA 1SWWA 1M1YE 1E1KA 2QI9C 4F9TA 4F11A 3ROFA 4FFRA 3O8NA 4OXYA 4X7MA 2OZLA 1VJ0A 3W7AA 3E27A 1WSDA 4IXNA 3LA8A 2OXTA 3PNYA 1P3DA 3G2QA 3OTIA 4M1ZA 1XWIA 2JASA 1Z62A 3H16A 3QUCA 4OFBA 3GRVA 4ERNA 4RV9A 2YHIA 4UBJA 4TXHA 3ZY3A 1EUZA 2P1DA 5C5EA 4D25A 1LU9A 2I78A 1C2TA 3GVPA 3IKLA 2EJWA 3ORSA 2GDZA 4GOOD 3ORFA 1WVIA 2YWBA 4F45A 3D1JA 2ZBRA 5EUQB 1QHYA 3ETEA 4I2NA 4DY6A 3PTZA 1ACLA 5K03A 1LLQA 5FF9A 1Y82A 4MKGA 4RHUA 5A3RA 5GP1A 2GGSA 1TCBA 2ATIA 3Q3JB 3IV6A 4R8RA 4ZOCA 4DDMA 5DHQA 4RPKA 2OD7A 1JI0A 4EG8A 1G7SA 5IMBA 2F67A 4UDXX 3KFLA 4INAA 2YYYA 3TRKA 3VYRB 4C0QC 4N0MA 3HXLA 4XEHA 3C8HA 1BVYF 4CLDA 4EYQA 3VYWA 2O8CA 3T3HA 3PWSA 2KX7A 1WV0A 2QUAA 3AI3A 4N1AA 2VHEA 4OF4A 4OSOA 3Q5GA 3V6MA 3UJ9A 3OHMA 5HFAA 1CEYA 4NCBA 1DJQA 1ZH0A 1R66A 5CDUA 1QFMA 1K68A 3UMGA 3HZZA 4WK4B 4C9BA 1XZQA 4J49A 1SBHA 5LMCA 3EPJA 4ZODA 3NONA 2PKYX 3Q5EA 2ZS7A 3RQIA 4J43A 4QZVA 1GXSB 4A5OA 2EWVA 3HPRA 3A1CA 5J40A 5LP6C 1PL6A 4IAOA 1X38A 1U7UA 3EA0A 4Q4JB 1XL0A 2IP4A 1T3LA 4QPZA 4BU1A 1WNTA 4TQ9A 5LXTA 4Z4FA 5JSZB 2CFRA 3MQFA 4JAVC 1F2TB 3GLHB 2ZCVA 3PPIA 1Y9ZA 2PUFA 1ZJJA 4NONA 2J87A 4DM3A 1S96A 5B55A 2QG6A 1GN9A 2JBAA 1UZNA 2VRWA 1TL7C 3QFCA 1XYGA 3L8MA 3LE8A 3EZNA 4L5IA 4QAJA 4QBKA 4NZNA 3HSKA 1GN8A 4JVMA 3SQLA 5C7LO 3K9CA 3KKEA 3QP9A 2IDZA 4ER3A 1FOEB 2MR6A 3L5OA 4H16A 3CX7A 1SWVA 1AF4A 4RY8A 1IU9A 3KR2A 2ZSJA 3QWAA 3HMQA 2QN9A 4NYIR 2Q5QA 4F3RA 1IULA 3BMNA 4AO6A 2VPYA 3RWMB 3HKCB 5BWNA 5CFZA 3L1UA 2XCTB 1TADA 2CLOB 1YUNA 2ODQA 5T4EA 2XE7A 3ANSA 4MVJF 5BORA 3FHOA 2OFXA 3C24A 4JV5B 1HSZA 4N76A 3ROQA 1TU0A 2Q7XA 3RFXA 1HT0A 4FHCA 1YJ5A 1OFUA 3RD5A 3QWFA 1KC3A 2GHIA 5H02A 2JFVA 4RZIA 4RH3A 4EG0A 4KXNA 4WDQA 4DDVA 5EFZA 5K3DA 1L5LA 4RMHA 2BUBA 3ZWXA 1TU3A 3PU6A 4GGMX 4UPEA 1BDJA 4FKZA 3DV2A 3K8YA 4W6QA 5AW7A 1J23A 1Q3HA 3HKCA 5BV0A 4X8OA 1IHUA 4MA4A 4L3WA 4A9AA 1HX7A 2H4XA 3L1KA 4ID3A 5ALNA 3SSMA 1OMOA 1TC2A 3I76A 1E2IA 5IPFA 3T5GA 4S1TA 5IUJC 1P1FA 3WLAA 4DMHA 5ERGB 3I58A 5AFSA 5LZ9A 2PL9A 3KM0A 4E30A 1YZVA 4PG8A 4Z4CA 1KKMA 2PLRA 1BYIA 1XRMA 3FZQA 3ILXA 4L0CA 5B1DA 4B84A 4BC1A 2DT5A 2NXCA 2Q41A 3HJBA 4DNQA 5EIEA 1S8NA 4BBAA 1AGXA 4ENRA 1GQFA 4JI7B 2VYCA 3OM0A 2HQSA 3BMCA 1WKVA 3NTQA 4KQHA 3QVSA 5AQ1A 4BXOA 1WDKA 4BCCA 3NM6B 1XO1A 3A36A 3H11A 3HHPA 3NWJA 3BGWA 3IBCA 1IXYA 4XR4A 3FA2A 4QUEA 1B3RA 1R8XA 2IPAB 2BEUB 5HBRA 1SCBA 5LBUA 3VZPA 5AM0A 1LQUA 2F62A 4NZYA 5HCNA 3R20A 3OX2A 4UJ3A 3HDGA 3RVDA 4OFZA 2LP4Y 3AGQA 1OREA 1ECJA 2BMAA 3L0ZA 1JHRA 3OA0A 3X2FA 5I7WA 2DY0A 5AVTA 4HOYA 3CM0A 2O7RA 4OLHA 3FCYA 3EBPA 2PGOA 3L6RA 5ARDA 1RQNA 1ZOIA 2QMOA 2C8LA 4BRWA 3GIWA 2EP8A 3QWBA 1OB5A 3O4JA 3MEQA 3TRFA 5IEJA 1KR5A 1LX7A 4FYIA 4X8LA 2FW8A 4UUAA 3ZIUA 2VPWA 1EYZA 4EMUA 3CCFA 1OVMA 1SQFA 2G09A 4A8PA 4KPFC 4RD4A 4CN8A 2R62A 3MSCA 4Z9AA 1U0SY 3KEGA 3QEOA 4QSMA 2J9XB 2ZYRA 3P0JA 3GRAA 4F46A 5EP1A 5JBNA 4YHHB 5UKDA 3ME5A 1JDTA 4FBGA 3AG6A 4G4GA 4NE2A 3EBLA 3QV2A 5K05A 1XCJA 1MMFB 3LJKA 3OIGA 4A03A 4KOAA 2NN3C 4C3OB 3E22B 2OV4A 1JTFA 3MMNA 5HKOA 1PVOA 2D5AA 4LJ8A 1E99A 4KI0A 1F48A 1NE2A 3KZNA 1BN6A 3OKCA 4C7KA 1Y9EA 3ISVA 3Q8XB 2PUBA 3H99A 2CMKA 3IPLA 3GLKA 2ZR0A 4MS4A 1N6HA 3ZBUA 5HYVA 4RTOA 1OZFA 2XI4A 4TV9A 5KYYA 4DG8A 4G1FA 2QRVA 3PGKA 2IEZA 1U8UA 4DPLA 4QJ4A 1WUJS 2DHRA 3HU3A 2EKPA 3IEIA 5I9LA 3B1FA 4GSKA 3ZK8A 2QXUA 1J0EA 3ND9A 4Y2UA 3ZJ5A 4XWYA 1I7SB 1GSIA 2WAMA 2NPOA 3B6ZA 4AC9A 5FPKA 3I45A 5KTRA 1X15A 1Z4KA 1E3IA 3PNSA 1JJFA 4ZVTA 4AF7A 1GKKA 1TE2A 2RI1A 1UPXA 5TVGA 5JNUA 2P3OA 5GJCA 4Y9SA 3V1NA 1EKXA 4W5WA 1QHGA 3MQ2A 1XHEA 3QVMA 1BRTA 1U04A 1H2RS 1L7VC 4FNGA 1D9ZA 4BB6A 3C3KA 3IAFA 4Z9XA 4ZYWA 1T5BA 1OU4A 3VPSA 1XZHA 4BKMA 4QHSA 4EPYA 4WFJA 2FDCA 2TMYA 2ES4A 4IPTA 4BFYA 1O6FA 3BE4A 4UTNA 1SHKA 5J2UF 3IRVA 4CEJA 4XFKA 2ORWA 4HFMA 4V1CA 2A4KA 3OU7A 1RPZA 2Q9CA 1GGHA 3U4DA 4R2LA 2GHRA 3PDIB 2O48X 4QDKA 1ZN2A 2Q45A 1SKBA 2O1WA 1NXWA 3T9BA 3BRSA 5AJVB 1T6BY 5B6IA 4WNIA 4MQFB 1PT6A 2B7LA 2EZTA 5BNWA 4EECA 2EYQA 2OCLA 1KFBB 1G1AA 5TS2A 3MRXA 1EAYA 3IPAA 4O5OA 3UJ6A 4DS3A 2CNDA 3LX8A 4INPA 4ZVRA 1ATZA 1K9SA 1NJ8A 1TLLA 1DDGA 3IQIX 3KE9A 3U3OA 4JI0B 1SD5A 4G0XA 1EK0A 1IC6A 3U13A 1GGNA 2ASVA 3AJEA 4NFSA 3TDNA 3CF4G 1VJGA 1PVDA 4CM4B 3UHJA 3LKZA 4LE2A 4WUTA 2COKA 4I6EA 1VPTA 2FQ1A 5BSGA 1C1DB 1EX9A 2XZDA 2FMUA 2C3OA 3ABSB 1NQ5A 3M33A 1SVKA 2A5DA 1B41A 3L0IB 4OFXA 5CYOA 3VDQA 4C78A 4LXYA 4AYXA 3FPAA 4TV8B 2IDMA 3D3WB 4YP7A 2GO1A 1ETHA 3E15A 4P4LA 4PC3A 1I4EB 3A37A 4QGAA 1K4YA 4RLHA 4CLXA 1OGYA 2HPAA 2IEIA 1EFVB 3RASA 4EVRA 1Z75A 5DBGA 3HNPA 1K3FA 4LISA 2FB9A 2H2HA 5HCIA 4FGUA 3P9PA 2UZ1B 4HMOA 4TLDA 3A10A 4JHLA 4KODA 2H7CA 3O8QA 4FBMA 4Y6QA 4YT8A 1JQKA 1HI9A 3FTPA 3NZEA 4UCFA 1O9GA 2AR0A 3CRW1 3K2IA 1YAHA 3UM9A 2UUCB 4K6HA 3BXGA 3G2JA 3O8CA 1QGUB 3DC2A 3EUEA 1NPTO 1RI2A 4LN1A 2VJLA 4R05A 1V7PC 2VNJA 2HJWA 3L7YA 1CSEE 4GO1A 1C0PA 1ODKA 1ZXBA 3FLAA 3ON5A 3VR4A 4Q1VA 1KDZA 1NVKA 3BK2A 2HMSA 1X86B 3QNWA 1ZGGA 4P3XA 4FB5A 4PN7A 1Z8NA 3BEDA 3V1LA 4TYNA 3SZRA 3A1NA 3KDPA 4AKGA 2BHNA 1H9CA 3T1NA 5LWHA 4ALMA 1Z4MA 2ANCA 4YB8A 1AZLA 2BT4A 2Z8ZA 1J90A 4I4LA 3KBBA 4GF5A 4LXHA 3SPXA 1P6QA 3DE0X 4QLAA 2FPLA 2NUAB 5K8VA 3VTZA 4X62B 3HYCA 4ZMBA 3I62A 3PXEA 3B51X 1LPOA 3ZXXA 3DMHA 3BSYA 4QWMA 5JEDA 5EFOA 4O4JB 4YP0A 3GBPA 1ZINA 2GK7A 1ZJWA 3C3PA 5BYBA 1DWQA 4GDMA 4CR6A 2QUIA 4JQZA 4P7KA 1ZW1A 4I50B 5CK4A 2VKQA 3JVIA 4JY7A 1ZGAA 4CV0A 5HZGA 2OHOA 1FUYB 2I7CA 1D4OA 3IIJA 4GZ5A 1G291 1NXXA 3UV3A 3RUEA 4EF4A 1M67A 5ARBA 3LF1A 3KHKA 4IV0A 5HJEA 1SUWA 3VYVA 3E81A 3W3ZB 1LNQA 3ZDAA 1JVBA 1E4EA 2H1SA 4WCFA 2P30A 3JQRA 4R6XA 3ESDA 1XZKA 3DMTC 3LX6A 3BL6A 5K6RA 2WLTA 1A4XA 3S6JA 2QX7A 3CRZA 5EIBC 2AX4A 1E3WA 2W43A 5FL3A 5E8JA 4PLTA 2W93A 4F5WA 1AQLA 2PWYA 1N5DA 3L0YA 2X6QA 2XMGA 3G88A 3T34A 3NHYA 1YJQA 1NDQA 1G20A 2B4RO 2P68A 2H1HA 1FDOA 2BKLA 3HY3A 2BLLA 2QTHA 4OK5A 3MF4A 2I54A 3HCOA 2B21A 2NXNA 1BS9A 3G6WA 3BF8A 1CS4C 4C0JA 1VPWA 4ETWA 3WZLA 4I08A 3S8YA 4LBVA 1QWOA 2ZPAA 3IX7A 4YMSA 5K6AC 4Z0NA 4EY3A 4A27A 4TYWA 1D9XA 5DHSA 2YC2C 1QX4A 3PHIA 3DOUA 4TTAA 4ARVA 2PT9A 5ALRA 4AN1A 3OPQA 5AKGA 2QI9F 1Z73A 4DLTA 5JEEA 4ZQEA 2PFGA 1GNTA 2EZ4A 1D7OA 3O2NA 4HS9A 3IXLA 1XFAA 2HAEA 1IN6A 5IZCC 3U1TA 5LOVA 1KYVA 3L04A 3KEQA 4KC0A 3ORQA 2O8BA 1IFXA 3K53A 3VV3A 5BRJA 3CB4A 5C80A 3W2FA 4B3RB 4BZXA 3RSFA 1MTZA 2H1RA 2A84A 1E69A 1I1QB 4RSHA 5COQA 1AKMA 4WBXC 1HTWA 1BYUA 5H68A 1BXGB 1C7FA 3JRNA 4N47A 4NIMA 4LJ5A 1O89A 2JLAA 4ZZ3A 3W6ZA 4BO9A 3CH4B 4IUDS 1UC9A 3RYTC 4LJRA 4J07A 3CN7A 1WHSB 3ILYA 1ODFA 1M6YA 5IBPA 2A1UB 3OURA 5LLTA 4CXMA 2VYVA 1JHZA 3N5KA 4R0NA 2MSCB 5ALDA 5EKDA 4AN0A 1CUJA 1JQJC 3T1OA 4CM4A 2QM7A 3WYCA 2CCJA 2JHCA 2ZVDA 2XD9A 4KWEA 5F1PA 1LS6A 3GFSA 3HDJA 1F0KA 5KC9A 1P7CA 1GA6A 2V5AA 3EGXA 1KU0A 2JAOA 3VX4A 2DQ4A 1CLEA 4HXGA 1XDSA 4KZPA 4M0DA 4S2UA 3UEOA 5JD4A 4WXPA 2Y1KA 3KV1A 3QU7A 3AWDA 1JBEA 4YAFA 2Y1EA 3EULA 5AJTA 1T3TA 4C3UA 1JSLA 3PENA 1D6MA 1NMXA 4CE6A 3GG9A 3KLBA 4LSMA 3FMIA 1O94C 2UZIR 2WWVD 1QQTA 2WWIA 5L7TA 2DP4E 4CLOA 1N3BA 5IJ0B 4XASA 2CLCX 4LY0A 1UOOA 4J7CA 4AZ0B 3WB1A 3CLUC 3VDXA 1IJKA 1WLYA 4MW1A 1J0BA 1VP9A 4BYGA 3UWMA 1FUEA 4M0EA 5FUVA 4IFEA 1C4XA 5BOSB 1GUYA 4MTCA 4EW3A 4NYMQ 1X7WB 1FMJA 2WBLC 1RC8A 3NBMA 2NXJA 4P7JA 1OR8A 4XPIA 1XQWA 1IBKB 4LNUA 1XQYA 1HLDA 3M5DA 3HGTA 4HAZA 1B2LA 5HSGA 2Q9BA 3CUWA 2O8FA 1FTGA 1ZD5A 3QUAA 2NZJA 2VCHA 4KO3S 4LBWA 1RXIA 1UBHS 2HREA 4IKEA 2BDTA 5TDHA 4AWBA 3PL1A 4CYMA 2J30A 3CIFA 2R6GA 3PSHA 1OFVA 4RVFA 4Z3DA 4ZCIA 3RIEA 4W9MC 2HJGA 1XU7A 5E6SA 2YV4A 3TI9A 2F9MA 2FPGA 3T0GA 2B30A 3I2KA 3WICA 4AROA 3HVHA 4ZYTA 3KXIA 4FXOA 2B6HA 3A25A 1FDIA 3FPEA 4YJFB 4FTWA 5L95A 1GO2A 3HGQA 1L7NA 1J22A 4B3IA 2Z5FA 1GGFA 1ECGA 2DWPA 4HRXA 3U60B 2PRSA 2RG7A 2V97A 5A6SA 4RA6B 5KNDD 1YTLA 1IQPA 4UXJA 1AHHA 4C4SA 1JJVA 4D4MA 1DFIA 2NM0A 1YWGO 3KEMA 4B9EA 2D74A 1MV8A 5A05A 3BRWA 3BBPA 4QODA 3R9WA 5C51B 2I9KA 4LSGA 1QM5A 4XYGA 3K6KA 2PZMA 1EK5A 4FFLA 2I6XA 3HFSA 1BDMA 4L3VA 4TLMB 2J0QA 4YCSA 1H05A 4AN4A 3K0EA 1IOZA 3VR4D 2XVMA 1A95A 1BD3A 3NTRA 3ROKA 1A9SA 3UUFA 3UT0A 4HN2A 3SQXA 5JS1A 2ZSDA 1AK9A 1UBCA 1SVSA 1N2OA 1NYTA 3D3JA 3LA6A 3B5JA 1OFTA 3MIZA 4M54A 1QIIA 3DV9A 5GVSA 1IHXA 2W0SA 3V3KA 3UK1A 1U28A 4XIYA 1D07A 4RA9B 1TJ4A 2OXFA 3BWCA 4HL6A 4II7A 2OO7A 2JGDB 2CW5A 1L7XA 4YHBA 5BN4B 1KK1A 1QR2A 2IYFA 4R1TA 5EHNA 3ZNOA 2D0OB 1ZD8A 3QK7A 5AVXA 1C3OB 3DMNA 1AT1A 3EEBA 4Q02A 2WF8A 5FXMA 4ZOLA 3RBZA 4DLYA 3IEPA 3E7PA 1DAFA 4H2DA 5CB6A 2N1MA 4YCJA 4BTEA 2Y4NA 2ZJAA 4EJMA 3KQYA 2BFAA 3IDOA 5FBRB 3W9UA 1PGPA 1Y3AA 2YXLA 3MWGA 1XDZA 4TN1A 4UUOA 3SNKA 5JCJD 1DMRA 2FX5A 3Q1KA 4IIHA 4XW2A 5KNCD 3L2OB 1K8ZB 1J0XO 5K0NA 5DGTA 3QIVA 4OKIA 1QBGA 1ISRA 3E3OA 3M1IA 4DIOA 1GUFA 3AKEA 3EF3A 4NTZA 2R6DA 1OASA 1OJ7A 2HLPA 2ZAIA 3EG9B 3RHZA 3ZQUA 1GG2A 2B98A 2OM6A 1WWKA 1IPFA 4FHGA 5T4FA 3BORA 5CXXA 2H07A 2VQ6A 4L7QA 4XYMA 3MN1A 2OILA 1MW8X 4Y7DA 3LOPA 1Z0IA 1MB0A 1TAGA 4IVPA 2ZUFA 4MVJP 3WLJA 3BM5A 1RXSA 3SDZA 4KQ6A 4YMTA 1OLSB 2O05A 3U4AA 1NOIA 3UQYS 1DTEA 1JIQA 4RZXA 1QLJA 2R44A 4IZIA 3TIFA 1XLUA 2WHRA 2EKBA 2UYQA 3QBJA 3OZBA 1ZBDA 1TAUA 3CRVA 1CF2O 1J5XA 1SHZA 2G4LA 4WK6A 3WLIA 2H85A 4O4HB 4UNNA 4IBOA 4NU0A 3KETA 1S4QA 4I55F 1KO8A 1CRLA 3FYTA 2EGGA 3AY6A 3VXKA 2J9ZB 5CDFE 3H2ZA 4IINA 3FSRA 3CMCO 2GLUA 2ISQA 4RA6A 2IYPA 4FI3C 1THMA 1HRDA 2YY6A 4UTOA 3TJMA 1E6KA 5JYEA 2G25A 1G0OA 1JJAA 2C2XA 3OWHA 4OG2A 3GRZA 1KPIA 4R2XA 2V0GA 4TS1A 1PGNA 3IVXA 3GEHA 3HWX1 3NANA 3QUTA 1MB3A 3ZD8A 4W7IA 2VKTA 2CLEB 4KAAA 1JG2A 2GM9A 4K6OA 1G8PA 2C92A 1YO6A 2QTLA 1M74A 4LRYA 3ZD9A 5B4VA 4LRWA 3JQGB 2P3LA 5DM4A 3SQWA 1L3IA 2IBTA 1Z7YA 4S0XA 2PKXA 3CYFA 2R1TA 5A5GA 1KK0A 3H8JA 4D42A 5MF6A 4QFDA 1ZSYA 5EVCA 3OI7A 2VCEA 1WU8A 2FFQA 2YMPA 3A3NA 4K5QA 4OI2A 2H29A 5DNWA 1YU9A 2H7XA 3NVAA 4A0GA 4EAQA 2JGJA 1YBVA 4JSYA 3AR8A 4RHCA 2Z8YM 4EW2A 2UYOA 3OFSA 1OX4A 4L74A 2VZ0A 2W4IA 4ZD6A 1MB4A 3KQQA 1PLJA 1WDLA 4FX2A 1AM4D 2HBZA 2QL7A 2Y68A 2CV0A 1G64A 3O9ZA 4P2GA 4KR7A 3ZQ6A 1H69A 3KS9A 1YDEA 3MWLA 2Y1LA 4W1SA 1RZRA 3ETCA 4MV9A 2WYWA 1EGMB 2VPXA 2ZTSA 3L07A 1Y1PA 2YWHA 3B9RA 1GZDA 521PA 2IS6A 3WGMA 4Z7QB 4FMDB 4HATA 3DOFA 1ZFNA 3RDPA 3L1JA 3OJFA 3P5BA 1PYOA 2MYPA 3ZEAA 2ZYWX 3NBQA 3MTBA 4G6ZA 3LDGA 4LXIA 4AI6A 1OT5A 4TRNA 3EMVA 3LQKA 1FSFA 2XIQA 4TWAA 3UPDA 2IXFA 3KG2A 2VTBA 4NCXA 2J85A 3BDVA 4NDZA 4KG7A 2J4FA 4PHHA 2W70A 3UAYA 3G9UA 3I6IA 3RSZA 5K8CA 1U1DA 4QU8A 3W8EA 2NV2B 3BRCA 3R6DA 1KO4A 4WOJA 2GXSA 3PR2B 4BMXA 3P9ZA 4GBGA 2PKCA 1Q17A 2JFYA 3G49A 4YECA 4EI7A 4JB0A 3MBOA 3SSAA 1GTG1 1PFUA 1QRDA 1VZ2A 4WPGA 3E9DA 3T9EA 1EXWA 1QYIA 1I24A 4P3YA 5EIWA 1N4AA 4DNPA 3PEWA 1TO2E 2DRIA 4LXGA 2FFRA 2XYRA 3ETDA 4MVCA 1PDWA 4URFA 5FTNA 1DQYA 1E0KA 4FCTA 4HAWA 4MVJM 3EPPA 4ZAVA 1ISSA 1T36B 3HGMA 2GVZC 3Q40A 1OF1A 1GQRA 1QE5A 5LQMA 2AQKA 2AZ4A 4BY9E 1WXEA 2P9EA 4OH1A 2YJ3A 4N5HX 3NNSA 3EVZA 1GPDG 3K9QO 3OCWA 2X0DA 4IZHA 5ESWA 1N7HA 4MULA 5JJKA 3ZVNA 3WNDA 4P1ZA 3G5AA 2PJDA 3NYIA 4DWOA 4H6PA 2C2YA 4FWTA 3IAEA 3ZJYA 3SXJA 2F4NA 2P67A 4NECA 3FSEA 1SBQA 1YS6A 4CU2A 4PIMA 3LVFO 2WD9A 3EQ7A 2INGX 5A6VA 1F4PA 1U1CA 5B1IA 3WOVA 3WYNA 2JGMA 2VXOA 3GRKA 4A3SA 2N46A 3TZLA 3LW8A 4PBTA 1ODTC 1U8AA 2WWRA 3WWOA 1UC4B 2EW8A 4DYVA 2QPLA 4Q9IA 4YV1A 4CGZA 2V7QD 4TRMA 1EXVA 2WTXA 3CY6A 4OQEA 4HTFA 1UJ5A 3E0XA 4JT4A 3GLHE 4U9HS 4WZ6A 3STVA 3NXKA 3AY0A 5C32A 3KSDO 3QXSA 1EG2A 4ILEA 2EATA 1EWQA 5K0CA 3P32A 3FVVA 1N2BA 2QRJA 3FTQA 4IMPA 1CJMA 3ZJVA 1ABEA 4ND1A 1YIDA 3AU9A 4E5DA 3EQ2A 4L6CA 3HYTA 1Q0HA 4IDGA 1CTQA 3TGWA 4DT1B 4YTEA 1OTXA 5CITA 1NXOA 1NVBA 3CW2A 3PE4A 3NUQA 4FCVA 4UE3S 1KBOA 4FR2A 3W2GA 1V71A 3GJ3A 4BKRA 1QFZA 3FLBA 3H9GA 1ESZA 2IHBA 3DCYA 3FFTA 1R9JA 2IYLD 1PGQA 4JELA 4DA9A 1XB2A 1NW4A 1O5IA 2DY1A 1SU4A 4FC6A 1Y1RA 3N75A 4LPSA 4MUIA 5JROA 2BI7A 5H9WA 2XKKA 3HXPA 1M2NA 4KQ9A 3KLOA 5AOVA 2VQEB 2ZJYA 3ZOZA 3UBTA 1EP2B 2WP0A 1PR5A 2YV2A 5A0FA 2FW6A 2RARA 3NBXX 5EHZA 5C8YA 4EL0A 1AQUA 4QVIA 4ALJA 4BMSA 3OJWA 1ZKMA 4OB6A 3OTHA 3RUDA 2C9BA 4B83A 3C14C 1BHO1 1RDFA 2QLTA 2NSYA 2VPZA 1QO9A 4AS2A 1KMQA 4E32A 2JIQA 4H59A 1MF7A 3CEAA 3ADCA 5JS7A 1V7QA 3HNOA 4J4TA 1G8YA 4ZREA 1JR2A 2R47A 2HRCA 4ANFA 4X1IB 3T5TA 1DOZA 3JQGA 2ZLBA 5DI3B 1S89A 3PC7A 1T8WA 1TYEB 5A7FA 5FPTA 4AJJA 4DPKA 5KOHA 4CF6A 4I1IA 1MRSA 1PI3A 4C29A 1U8ZA 2PGJA 2BTQA 3BCSA 1I7DA 1NW3A 1IUPA 1X8XA 4BATA 1XVLA 3ZVLA 5BWOA 1DWOA 3DKIA 5JPIA 3W9SA 3WGOA 1GZUA 5A7HA 2XEDA 2XXAB 5JHGB 3BT7A 2VOEA 2AOUB 3QVLA 1VJ1A 5GIPE 4CUZA 1OAKA 3UMFA 1XCBA 4OJTA 5D2CA 4ZVMA 1NUQA 2DBQA 2QDKA 1DBRA 5FBKA 4C22A 3TECE 3E1GA 2OZKA 3EIHA 4D3FA 4V38A 3TOCA 2BDUA 1LRJA 3DEHA 1E9DA 4PR0A 4D80A 5I9IA 4GEKA 3I32A 4MCJA 2NZYA 4IYJA 4DYDA 5L51A 4PYQA 1JIJA 2Y9PB 3D8UA 4HPWA 1MAWA 1Z38A 3IAS1 4I46A 4KO4S 4WXRA 2JFQA 4QTZA 2IWRA 3RRJA 3FRJA 4EL5A 5AW1A 4L75A 1P9NA 5BSHA 2GJ8A 4YAOA 1GCAA 1Y5IA 2BFDB 3PI7A 4IS2A 1ZMTA 2J09A 2PQ2A 3C5HA 3HWRA 3L0PA 3QBTA 4TV8A 1MENA 3NT2A 5FPYA 2Q3FA 1HURA 4ZYZA 1Q83A 3LQYA 3TW8A 2XITA 2EFDB 3H1AA 1HE8B 3B48A 1YUMA 3DE5X 1Z28A 3NW9A 3CX8A 3OWOA 1F14A 2QN1A 3U48A 1TDJA 2IXGA 1HQDA 3TG8A 1KVRA 1P5HA 1G8JA 1RQ2A 2YJ5A 5CH8A 4B82A 1C30A 2VO1A 1EX6A 1DJLA 1N0UA 4IGEA 3B1WA 3MYYA 3V4ZA 4CUJA 5HBGA 1UBRS 4CM8A 3OJXA 3Q7PA 1AKVA 3AONB 1NUTA 3L0OA 4XZ3A 1DIOB 2BGRA 3QPCA 4K86A 5FD8A 2ZYUX 1CEXA 1YQ9A 3N05A 3AUTA 1KMNA 2XUKA 3OHPA 2V1XA 4M88A 4TLEA 5G0VA 1XZBA 4Q7EA 1WETA 4A23A 1U0HC 1ZN8A 1X1CA 3T8YA 1PD0A 1A5TA 2AJTA 3Q6NA 2JIZD 4N82A 1Z0UA 2VLBA 4RPJA 5FBWB 3MTJA 3NLLA 2WG0A 4QOSA 1BGWA 1G8MA 4YRPA 5U4QA 3DLAA 4HY3A 4V1CB 1F60A 1YL7A 2HIHA 2IOFK 1UK7A 4BNJA 1LTKA 1V2GA 2AN3A 4BVLA 1DJNA 4L8GA 4BV8A 5J43A 3T1HB 3R5JA 4PLPA 3C4QA 1CZUA 1G8GA 1VL2A 2J9YB 4GMGA 4YJ2B 1OTYA 3H7AA 1C0KA 3SJCA 3TRDA 4IH1A 1DT3A 5KTMA 3DJYA 2CNLA 3AW9A 3IAM6 1WPGA 3HVJA 4HYQA 1ZRNA 4XEUA 1BQ3A 2BMEA 5ICFA 3EISA 2XRFA 4CR7A 4EI2A 4F84A 3WHKA 2HO5A 3OEHA 4WNCA 5CNKA 3UICA 4A0HA 4CEHA 2FSPA 5DOZA 1Q50A 1T5HX 1XRPA 5CNMA 4F8EA 2XUHA 5IXSA 3WNBA 4ZXFA 4DSZA 3HO1A 2R751 2XYPA 2DLDA 3SR3A 4ZANA 3HBFA 1QGZA 3SS7X 1KXJA 4ALIA 3INYA 2VS1A 1VHJA 4NENB 3OBBA 5EXEA 1T0IA 2NUPB 3SM9A 2YBEA 4C2BA 5IYZA 1PJSA 1W581 1H5QA 5J5VA 2WHEA 1KH3A 4Q93A 4IRMA 1WU7A 1TECE 1QQAA 3HA3A 1V48A 1VJDA 1KP2A 1RABA 3C1OA 3A0RB 3CKYA 2PLFA 3EVAA 1E66A 4B81A 1YVPA 1FRFS 1ODJA 4EB8A 3RC8A 2CLSA 1KI7A 3MMPA 1W0CA 5JZVA 2CXNA 2WIDA 4AJHA 2SKEA 1UBEA 1X7YB 3A1SA 4HLUC 2GEUA 2AR9A 4KSBA 3VH4A 2B1QA 2XB6A 3RC9A 2BF4A 3TD2A 1F7UA 3WLRA 1FP2A 2REXB 5C7YA 1U0OC 2J46A 3P9XA 1NI4A 4J3FA 4Z0HO 1XAJA 3IILA 1UBMS 3NCHA 2AYXA 1W1UA 2X0NA 3NDPA 1ECBA 4Q82A 4LBYA 2EJBA 4LF5B 1T9BA 1JE0A 1VDMA 5IAOA 4YAJA 4DYHA 1O94D 5FBZA 3WMGA 1WR8A 5C1IA 3CMMA 1LRLA 2ATVA 1IH8A 2ZU0C 5TARA 4UMEA 3S1LA 5B4UA 3DEFA 2Q3EA 1DX9A 2Q6KA 4GRIA 3OJOA 4UHFA 3QVGB 1WCV1 3BXFA 1OX6A 2XWPA 4FS8A 4WZZA 1T1JA 5F78A 3B8HA 4BMPB 4EYOA 3S3TA 1YQUA 1B1CA 1D2AA 4I1OA 4U7WA 5E9JA 4YCDA 4CQLA 3EDOA 2CLLB 4DLBA 3ISJA 1GG5A 2DFVA 2F59A 1F9AA 3OP1A 3WNVA 1QVAA 1XYVA 1JX6A 2FQWA 5AJWA 2O2YA 1YA6A 2EWWA 4GYYA 3OT5A 4ICIA 2AT1A 4XX1A 1F17A 4V2UA 5FULA 1WIWA 3IR6A 3WA7A 3V2UA 3N2KB 1XV5A 5JTUA 1ABBA 4QOHA 3GT3A 4YGXB 5HXAA 1Z33A 3EFBA 1M7HA 5FDFA 4KJZA 4OBBA 2VZEA 1RHUA 4GLFA 2BHLA 4WT7A 4FYPA 5C1PA 4UKDA 4J91A 2HJSA 1L6RA 2QGFA 3LX4A 2AE2A 2B83A 3UGKA 5IJWA 4FHDA 4R7TA 2DHEA 2VHTA 3HQ4O 2NZUG 3ZHRA 3L41A 5A02A 3BIFA 3JATB 2QE6A 2AXQA 3NVDA 1JQ5A 2Q0XA 3DKPA 2GN2A 1N3YA 1UT6A 4HWGA 2DETA 3K5PA 1JDVA 3R75A 5DIZA 1ZZEA 1EUYA 2RJNA 1SUEA 2EJVA 2NIPA 3A1FA 3LHFA 3OE7D 1T6XA 3WJ1A 3BAFA 4WE3A 4D6YA 1HE1C 2BZSA 1L5KA 4IICA 5LBIA 1JF8A 4TRJA 2P1RA 3L1VA 3DB2A 7ADHA 4HRYA 4XGNA 1U28C 3OMWA 1B42A 2V45A 3ZCVA 4A82A 5B7NA 1Z22A 2AV6A 1V3VA 4PTYA 2VNHA 3A31A 3STHA 2HLNA 2H1LA 3A70A 1QG4A 4WA8A 3RS5A 4DNOA 2VHJA 4WQMA 3K1JA 1DAKA 3U7FB 3T5MA 1F0YA 2D2FA 3MHPA 2RCNA 3G82C 3O1IC 5A2QA 5KYXA 3KKPA 4PSUA 1LK7A 3JZMA 1YOVB 4DKXA 1FS4A 1JEOA 1NTOA 2J45A 3KTAB 1OWNA 1V8DA 2ADFA 3E8SA 3K1YA 2WA2A 3NWBA 5FR2A 5LQNA 2CF5A 2ACWA 5SZJA 1DPGA 2Y0CA 1PZGA 3N76A 4Z8XA 2FN7A 2YZNA 3QELA 3H2JA 2AFHE 3QFSA 1UJMA 2AMFA 4H6VA 4WW0A 1FK8A 1L6IA 5BNIA 3EXEB 1OILA 1OT3A 3E4DA 3GFGA 2P6UA 3LY7A 4MYSA 4U0KA 2OYRA 3H9JA 3K96A 3RC1A 2BSAA 3Q87B 5DE3A 2Q4EA 1REQA 3QX3A 3L46A 4LPKA 3VR5D 3K94A 4UD2A 2VDNB 2BKAA 9LDTA 3A6DA 4IXDA 4LJSA 2VF7A 4RQTA 3RSQA 3VNBA 3PFGA 3D64A 2H7VA 5BWCA 4U2KA 1IY9A 1KEPA 1DC5A 4K1XA 3ZE7A 2OO5A 2Y0DA 1JU3A 2CYBA 1A5BB 2GN4A 2O9JA 3KJEA 2WSSA 1HNNA 4UAVA 5I9TA 1XEWX 5HOEA 1DHRA 5IT4A 4CKEB 1T9ZA 1GPNA 1UBTS 3FMVA 5AIBA 3OZCA 4RCVA 4ZAXA 4ZEMA 1FVXA 4NK4A 4HLNA 3DMGA 4JOBA 1GRNA 2VBIA 5IXYA 4ZIRA 1AMNA 1GCGA 3ONDA 3WBKA 2OCPA 4BNIA 4EWLA 3K9HA 4IGAA 1K86A 2XKBA 3CT4A 3GAFA 1P7YA 1OSNA 4RJKA 4ZQHA 3HRKA 4GVLA 4DV3B 1U7WA 1N5KA 1NVVR 5AH0A 1CCWA 2CVFA 4Q4LA 5LM3A 5F5NA 1HFEL 1KPHA 4XGQA 5SZKB 4E4YA 1NVEA 4PLFA 3QE9Y 4OHKA 1XAHA 3AVVA 4X00A 1W85A 1JIIA 1ULSA 2AQIA 5BN5A 4JEMA 2CDRA 1DAEA 2UZ1A 1JR3D 3KZMA 3LSTA 4FZRA 4KLNA 4TGLA 3ADPA 5EXTA 3TXXA 3T38A 4IQFA 2WT9A 3UOGA 4C01A 1XN4A 2XRYA 3QMVA 2JHGA 3F1LA 1GGVA 2HPHA 1QYVA 5ENVA 4JI2B 4JXJA 3AFHA 3F1KA 3AL2A 4GM0A 1VIYA 1W76A 1Y6ZA 2XCIA 3QLVC 4WEQA 2AOUA 2BTOA 3OIUA 4EA9A 3M4ZA 3RLIA 1LZKA 2AOVA 2V6BA 1K8QA 1VYVA 2MWMA 3JWPA 4RPIA 2C1EA 1I3KA 1ZM2A 3T7SA 3G0GA 5C5CA 2Q6LA 4ZVNA 2FZ5A 3IPXA 3RBAA 1AIPA 1IZ8A 4G5QA 4J94A 1ODIA 4PYIA 1YVUA 4JYCA 4Z1MA 2BSQA 1XGKA 3AF0A 1XLTC 3T1TA 3IHWA 2QP9X 1Y81A 4HAYA 5EGNA 2P9TA 2ZRNA 3IOBA 3KKKA 3WZMA 1EFVA 5CM9C 2E4YA 4XX0A 4AKIA 4DSUA 1JE1A 3COWA 4YRIA 1E9VA 2YV1A 3ADOA 3FR8A 3JYQA 4OUKX 1IY8A 5D01A 5KYVA 3W9YA 2XBMA 1YIOA 5C8YB 1YZUA 1JKJA 2BVNA 4ACAA 2OCXA 3QM1A 4CKBA 1Z6QA 1EEHA 4HNAA 5H3LA 2XKJE 2H18A 3B6EA 1OFGA 4G5SA 1P4HA 3PHBE 3EC1A 5G0WA 1BDIA 3IA2A 3HR8A 4E11A 1CY7A 1EA7A 2FEMA 3WDLA 2Y1CA 4Q3CA 4D46A 4D4IA 2DAPA 1WCWA 1M2JA 4TS9A 5BQXA 1Q19A 4DQUA 5BYJA 4ARBA 4TTJA 3J80A 1HFJA 2AXPA 1R1DA 2F8MA 1VL8A 2GEDA 1U7OA 2QE7A 1Z26A 3GLVA 4Y9RA 3MPUA 4UOQA 3W8NA 4JUCA 5LYJA 5CBPB 4A2QA 1EJ0A 3KZOA 4D9MA 3A04A 5CVUA 1R4NA 2V3WA 2EGHA 4X9XA 5ULLA 1AUQA 1E4YA 3O94A 5DEOA 3CG4A 2PZKA 2GCIA 4IXTA 3NVKI 1E6LA 1SKUA 3TZBA 2EFYA 3TRHA 4P31A 4OIFA 3D5EA 3E3MA 3HXKA 2XVXA 4MR9B 4RD6A 1VL5A 5H80A 4TV9B 5COAA 3QPDA 2OORC 5AVWA 1NC1A 1Q21A 3MUOA 1MX1A 5CCEA 5H3CA 3JQCA 2H9AA 1GITA 1Z88A 5AVJA 1KO1A 4QGFA 4JBHA 4P80A 1DC6A 2QAGB 1EI9A 3BXZA 3KE8A 4J8PA 4IEFB 2QLFA 4LDRA 2NU7B 2YW9A 2CWDA 4LRTB 4TV9F 3EH2A 6Q21A 3CO5A 1J2TA 2Q2QA 3MRSA 3WLOA 5BUZA 4Q9DA 2NU6B 4HLUA 1UAYA 2TRSB 4NOJA 1RFLA 3AF6A 1RPTA 3K16A 1K5DA 1NT2A 2HHLA 3D7NA 3DAFA 1SZPA 1TVKB 1CR6A 3KSBC 3THOA 2AEJA 3HY4A 4FLEA 4DR2B 3ZXIA 1DNPA 3LK7A 5EE1A 4BP3A 4F2HA 3EEOA 4IHKA 5D5QA 4Z8YA 5DW3A 1A7KA 1LTQA 2H57A 3ZDYB 3EIWA 1UQTA 1G8HA 4M9CA 2VTDA 3CZAA 3L5KA 3DC7A 1K8XB 1ILEA 5JZMA 1IN4A 3PXXA 2OYCA 3CZMA 4C0LA 4O2BF 4QRDA 3JTEA 1AMUA 1Z5OA 3MWEA 3COSA 1FFDA 1IB0A 1N6NA 2Y05A 1Y8AA 1X7ZB 2Z95A 2RGDA 1EGHA 3GRYA 4QXAA 1MAUA 3VZQA 2G06A 4EEKA 3BH6A 1CETA 1T8TA 2Q4BA 5DGCA 4AJLA 1C1YA 2IWHA 3QPVA 1IIRA 1KVQA 4G4JA 2BEJA 5BSMA 5IDQA 1ADYA 2QPTA 3G1TA 4OV6B 2WK1A 1ZUNB 3DDCA 4RL4A 3REOA 3FFWA 4BO6A 3IUBA 3BFJA 4C6TA 2CXRA 2WTAA 3DOHA 3X1DA 3D8TA 2NV0A 1PR4A 1PJAA 1UFVA 2VAVA 2FCRA 3BMOA 5J5CA 2RJOA 5IFLA 1NVAA 1G5QA 4GXNA 3L1HA 4HDKA 2Y0BA 4HDCA 5IDVA 3VPHA 2RGEA 3QXJA 1YZFA 3NEYA 1E5QA 3BS4A 2HU5A 5EKUA 4ESOA 4REMA 2M6SA 4WJKB 3FCOA 3OEYA 4QJ5A 2R8PA 5DWVA 4MYCA 4L6IA 2VJDA 1JVNA 2JCXA 2LKDA 3H4VA 2WWWA 3P4YA 5AJHA 3KQWA 1A8HA 1NBMA 1U9IC 2GKGA 5CJJA 3J81k 3SYNA 4DY4A 3RB8A 1QRSA 4HZGA 3R8FA 3GFPA 3PUYA 3G0IA 2FN3A 4WBSA 4BNTA 3H9CA 2OFFA 1L7BA 3P9IA 2AOTB 4UTPA 1B8PA 3PIDA 5H16A 4YUZA 2R00A 1OI2A 4XSGA 5IDYA 4Z51A 1UBSB 3RU9A 5BV8A 4LJAA 5KOJB 2BEUA 4A0SA 2I6FA 2Q99A 2VNAA 4WEOA 2C04A 4G1CA 5GONA 3HP1A 2ZSIA 3H05A 4W8OA 4Q1AA 2WWXA 3H1FA 2GVDC 2OQRA 2R1TB 3Q88A 2HEIA 5AK6A 1R6AA 3PYMA 4FU0A 5I01A 1CR2A 2FAXA 1XEXA 2M2IA 3GRPA 1FZQA 1RJ9A 2EQAA 3NAZA 1Q2UA 4WKNA 1JB9A 4BQRA 1H3EA 3X44A 2JARA 2YY7A 3WQRA 3BXEA 3SM3A 3PR1A 5ELXA 3NHSA 3TPFA 3JQ7B 1YQQA 2IYUA 4M37A 1I2MA 3O26A 1H8HD 4LMRA 1KIAA 1M10A 1N75A 3IJ5A 4MGIR 4ZDIA 1CQWA 3RKSA 1ISPA 2JGLA 1D5CA 2DECA 2WIKA 3R3XA 1V25A 4JFAA 3T95A 4MDFA 3IDZA 3FYCA 1UWLA 4FYXA 5TQ2A 4D8UA 6NULA 5ICMA 4XTRA 1DMSA 1NN5A 1USKA 3RGGA 3V1MA 1YRYE 4LWOA 1XF1A 3W04A 1DU4A 1OLUA 4Y8VA 4FHZA 4WBNF 1VMAA 4L4RA 4OI0A 1G3MA 3OKFA 4RIFA 4BN0A 2PCLA 3QE4A 1Z08A 4EKDA 3AHGA 3MJTA 4L4SA 3FBGA 2NVWA 1PJRA 1RTKA 2I91A 2HWUA 3W5HA 5AW0A 2B0CA 1W88A 1JUDA 1LF5A 3STXA 4RL6A 3WLNA 2QP3A 3TBHA 3ZGNA 3IL2A 3WKEA 2QQFA 4IDPA 1DUIA 3DVAB 1NIPA 1Q0PA 3R4CA 5AHKA 1C9KA 5K7SA 1CUVA 5FP0A 5JWHA 1HG0A 2NT4A 1J06A 1K0UA 1UQRA 3ZU3A 1Q7BA 1R9MA 4DQKA 2J5XA 1ZXLA 5DLPA 5CLJA 1BN7A 2JLQA 1NFQA 4FOSA 4HWKA 2J0VA 2MIIA 1EHIA 1VBMA 1J0CA 1JSRA 3EG9A 7YASA 1O8CA 3WYAA 2J3LA 4QQRA 4W7HA 4G41A 1PG0A 1VLVA 1ZWKA 1KJYA 2AG1A 4TTQA 1MLDA 3M0EA 4XLZA 3AUJB 3I5MA 1AUOA 1LQTA 2NO0A 3LCCA 5E0OA 5EERA 3C6BA 5TF4A 3ER8A 1R2QA 3C1TA 1Z2EA 4Q4JA 3I4FA 2RONA 5BWLA 2Z0MA 4GR9A 4BLPA 2I2DA 2N9UA 1GXSA 2SKDA 3M4XA 3MTIA 3V7UA 2X4DA 2O4UX 4GE0A 3UMCA 1YONA 1HH4A 1HRKA 1SRRA 2DPYA 1M72A 2E3JA 1UAGA 1TQ2A 5IK2A 5TB5A 4KMMA 3KWLA 4EPTA 2NZ2A 3W4KA 2B7BA 1M5UA 1KJNA 3OP4A 2IXTA 4TMZA 2CL7X 1VKJA 4HCJA 2G8NA 4LC0A 4PGAA 3AW8A 2BZ1A 3IVCA 3QOWA 1I6WA 4RV4A 3C8UA 1SHTX 3G17A 3OLQA 4NH4A 4ZVUA 1HDXA 3EDYA 2DVMA 2UYGA 2JIDA 4UM9D 1JT2A 1USWA 2R6FA 4I4TB 1MTOA 1RQXA 3CW9A 4FE3A 1AUVA 3IMGA 2H3EA 3BD9A 3HB7A 3K9LA 4JBYA 1FFHA 3E7XA 5F3WB 4UM8B 2LE0A 4B0OA 2VHUA 1RWOA 1WCXA 5IC6A 1Q7EA 2E9SA 1WG8A 3GGPA 3VYTB 3IJRA 2JJ1A 1V41E 3IT3A 2P91A 3R77A 4FYWA 5A4FS 1UKCA 1MG0A 5C3MA 3WQBA 2H6EA 1JJ7A 4N9QA 1W47A 3CNOA 3NB0A 3Q0TA 4FGWA 4YDRA 5REQB 5MGBA 1NURA 4MS1A 1S9HA 1KAEA 1IWBB 3I0ZA 4TL8A 2YHIB 2EBHX 3LBHA 4AD8A 4HWOA 5TJHA 4QWWA 3IH5A 3TLXA 2ZU6A 1WW8A 3T7KA 2ERYA 2G5TA 4ZGWA 2PKQO 3OZ7A 1PEDA 2HK7A 2W6NA 3DHYA 3JQ9C 1NX6A 1PLLA 4M60A 2FK7A 2OZLB 4GOLD 4I1YA 3RYCA 3UTDA 3ZZ1A 1XYYA 5BV7A 3T4EA 1FFXA 1X92A 2WICA 3QVKA 4I1UA 3FNQA 4NS4A 2ZRHA 1SC3A 2SECE 1J42A 1F3OA 1M8KA 1O57A 2E7ZA 3I1FA 1M2KA 4ZKEA 1B8NA 3ZVRA 3ELYA 1XZLA 5JZSA 2IV7A 4E7PA 2QNRA 3GK3A 1G3QA 2JIRA 3EGEA 4FW9A 4F4IA 4NMLA 4Z4HA 5JH7F 1AUXA 3Q3IA 2HHAA 5G40A 3WIOA 4ZK6A 4L9RA 1I7QB 1DRKA 2HJVA 2XA2A 4DABA 5EEHA 3ZCSA 1MJFA 3OLVA 2ZI4A 4YJKA 4JNCA 1JJBA 3VSDA 4G86A 1E9FA 1TLTA 1QYRA 1YZYA 4QO7A 1F3LA 3MQ4A 3SF0A 2JCSA 5FTMA 1TTHA 1EFAA 5J2TA 1F8XA 4G07A 4JXKA 2WTBA 5EKXA 3EIFA 1II8A 3T4UA 3K30A 2GFQA 4L9SA 2MR5A 3A6FA 1J07A 2QY6A 2ICAA 4MP6A 5EE5B 2QAGC 2P6RA 2ONKA 4JVSB 1EUDA 3AEKB 3K20A 3E5RA 3RRXA 1SOAA 3A9WA 4EBBA 1IN1A 1G21E 1G7RA 2RG1A 2E89A 3WGGA 4ITRC 4F7DA 1NF9A 2R66A 3FMGA 3G0OA 5IARA 1PSWA 2VJYA 3I04M 2QD4A 2GUGA 5JADA 1UZAA 4XGIA 5BMVB 4C14A 4CKCB 3TE6A 1P0FA 5LDGA 3O91A 2X2PA 3PEYA 4JGGA 1HDGO 3GZNB 1VSTA 3W1VA 2GARA 1I6LA 3K2BA 4YRMA 2W2VA 5E2IA 1HNWB 3V4OA 4F3YA 5EPOA 4AWXA 2JJ2D 5H83A 2PZLA 4QUKA 3GNSA 2V03A 3FF1A 4PX3A 4J4HA 4Y1GA 3LXMA 2XECA 2IA5A 5B1HA 4OL0A 3S68A 2VAWA 4PYJA 4E0BA 5KIAA 4UC0A 3UCFA 3UA4A 4OBEA 2NSJA 1DKMA 3U3XA 5KWJA 2I34A 5JS2A 2NXEA 1NY6A 3UMJA 5KQPA 1H8HA 1LBQA 1XNGA 3SHVA 2AG5A 1X1AA 1RHMA 3C8ZA 3P9QA 5J9FA 3QNUA 4AY2A 5EMJA 2O06A 2OV2A 4LE1A 4HLQB 3BZBA 3CKLA 3D4IA 3FHTA 4KKXB 3SBOA 1GU1A 5EXPA 1V0JA 3GCGA 2NYUA 3FGPA 5HZHA 4XGRA 2I3AA 2R84A 3HA5A 4LXUA 1D2CA 3DR5A 3T3MB 2C5FA 3RRNA 2C95A 2FX3A 3MAJA 3WX0A 5AI6A 2C97A 1YS2X 4ZTZB 1YJCA 1R7RA 2W6ZA 2QKYA 2RHRA 4BPBA 1U8TA 2CJPA 1US8A 2FN4A 3AUYA 4RKYA 4F5DA 4ZO8A 5ECGC 4P0QB 1G20B 4Y1RA 5KAPA 3B6KA 4EB3A 2R1UA 1J5PA 4J1TC 1QORA 2JI7A 4Q3LA 2JJMA 4CCWA 1U7ZA 2GM3A 4D02A 1P75A 5KUTA 4MVWA 1AJEA 4FKBA 5TMDA 4GVPA 1M2OB 2ID7A 2QOEA 1E62A 3RU2A 4PHCA 1FTYA 1R74A 3CBQA 4U7GA 2B1RA 3SQOA 3E53A 1HDZA 2V7EA 3FB4A 4EPWA 3D8SA 3FVRA 1K4KA 4PNPA 3UMBA 4I7EA 1RRKA 4URXR 1Y5NA 4YXFA 4G5RA 1WMEA 3QKRA 4JQCA 3IVRA 3J81A 1CJTC 3N0VA 4PZCA 2LCFA 4KQWA 1CX9B 3WKDA 4WH0A 3EXIA 4QBTA 2G9NA 1ONOA 3ZDFA 2YQ4A 3QPAA 1GFSA 5BUCA 3KXDA 4XCVA 4V3CA 1JDUA 1SY7A 1WQ1R 3O21A 3DDHA 4UTZA 3VHLB 4A15A 4W5OA 2C2HA 1MRNA 4CCAA 4HDMB 2GHQA 1PGJA 3U3JA 5DX0A 2O1EA 4W9NA 2X40A 3DGFC 2CSXA 1L8QA 2EVWX 2RKBA 3TIXB 5BW8A 4U0JA 3BFXA 3G9TA 4AYWA 1AHPA 2M9MA 1O9HA 2FKAA 3KOYA 2XUPA 1GADO 4CQMA 3SN6A 3CBGA 4B46A 3KHTA 1OYOA 3ACDA 1E2JA 4GP9A 2CHEA 2P9ZA 4ITUA 4BWGA 1J2JA 2OGZA 2EWMA 4RYDA 5HFJA 1D04A 4DR3B 4C6RA 3NU1A 4JB2A 1NBMD 4ZDKA 3LBAA 3O8BA 3FTNA 2XWSA 1FMTA 4LJ6A 4Y6RA 2QMQA 5DRTA 1Q0QA 1IRXA 4BVFA 1XLTA 3AL0C 2N47A 2P40A 1MOSA 2EL7A 5G3ZA 5IC4A 1ML4A 1Z56C 1S8OA 2GEFA 3ILHA 3LT0A 4BP1A 1NRJB 5E4TA 1QO7A 3AIIA 1E5VA 4CT4B 8LDHA 2Y1FA 1OLSA 1H1TA 2ZOSA 1QPGA 4FGKA 4FX5A 2FEOA 3RPEA 2YOFA 1C7IA 1ZYUA 2VI5A 3C6YA 4DBZA 4ZVPA 3BK7A 2XB4A 2ZJBA 2H92A 4FZ3A 2W2TA 4XIGS 1K6MA 2QTWB 2XYVA 2HA2A 4J1NA 1QU3A 4FJ1A 5TMEA 3F6BX 1COWA 3G2IA 2FW7A 3LKVA 2Y92A 3F47A 5AP9A 1Z16A 2PQ0A 4AMZA 3GC6A 3ULKA 2D7CA 3ECCA 2DBRA 1T4CA 1C14A 2NYAA 2A5FA 3JTMA 2AC2A 2FMHA 3O75A 4G4SP 4ZVQA 1I3CA 5IM5A 2JBHA 1SHLA 4Y2TA 3DDUA 2N42A 2XUQA 5DBHX 2XPCA 3LP8A 1T5SA 2YICA 1Z6TA 5F4BA 3CO0S 3R7WA 3W4IA 2FMFA 3G3EA 2VSNA 4JLUA 3I09A 4RTQA 2WC1A 3G1WA 1QXSA 4UBIA 4WIAA 5AXCA 3U9TA 1XZPA 4EQZA 2G6BA 5CFQA 2LIPA 1QDLB 3D7SA 3U9LA 2D3TA 3KHSA 1BRMA 3U3RA 1DQZA 5LDHA 3ZWVA 2C54A 1NZFA 4C6TB 1DZ3A 1RIIA 3I5YA 4ZEOA 4GC5A 2PGLA 2IUUA 4P0PB 2OORA 3DG9A 1RAIA 3GRCA 4KSCA 3V3TA 1A8UA 2VL7A 3I9MA 2JZNA 5GINE 1OOEA 3DKVA 1I4OA 1U9JA 1HG1A 3IMFA 4Q4AA 3SVZA 4DCGA 1AZWA 4BLSA 2YZKA 4RTPA 1Z6GA 3KFXA 3TLGB 4UNPA 5KU1A 2G72A 4D0LB 4YAGA 3AI7A 4IH9A 3TMKA 3ER9A 1PSDA 3T3IA 1E1QD 1E9AA 3O3OB 1W9MA 3WIEA 4AJIA 4DW8A 5C8DA 1J6UA 3QA3E 2QTGA 4GP6A 2ZIVB 3L7KA 4H31A 3BYZA 4FEEA 2FPMA 4DLVA 1E32A 2PKRA 3INNA 2JFOA 5KDLA 3W5JA 5LBTA 1C3VA 3TAHA 2K2WA 2R8RA 1MOQA 1P4AA 4P92A 1NIJA 1ODLA 2VHVA 4BLOA 4LQ4A 4NZMA 1IXKA 3EXAA 3EC2A 5JI2E 4D1YA 3IUMA 2ZRJA 4OGFA 2XEXA 4PWZA 4NP6A 2VOJA 2YS7A 1SUFA 1HR0B 4KVGA 5A6SB 3LYUA 3R0QA 1PJLA 3AINA 2YQ5A 2F1RA 3CT6A 4DCJA 3D8HA 2VVTA 1F9EA 3MT9A 4G0YA 1NJ1A 4PNZA 3C3DA 3TLKA 2L2QA 3HFJA 5J2TF 4B6RA 2CNBA 5B4TA 2R6JA 3H5NA 3CLSD 4O29A 4O1MA 2JC3A 1B26A 1X8KA 3PXUA 1E8NA 2DR3A 1WEKA 1NJGA 2OUIA 4KB5A 4NWIA 3USCS 5KPJA 4KR6A 2YY5A 3GJ8A 1JHQA 1T2DA 4MYRA 4G1VA 4JUBA 5JDIC 1Y63A 1MNQA 1ZHHA 2IYRA 2NU9B 1II0A 1SCUB 4N8EA 3VU3A 4UM5A 2ACKA 1RQ7A 2ZJ1A 1YT5A 4J0IA 2F1JA 4Q6WA 1QNLA 2ZTHA 1PHRA 3PFIA 5A9TA 5KYYB 2ZRGA 4ERXA 3DCJA 2VJOA 2QYOA 1MDBA 4LOLA 3S2UA 2GA8A 1YBAA 2C9OA 5E6RB 4IHQA 1C9YA 3OM1A 4EB6A 2FLKA 2CNWA 3A26A 4G9GA 5CLGA 4OKSA 4JUFA 4F85A 1YHNA 1DJOA 2D7DA 2GF9A 3N0RA 4XDHA 1OV6A 2CJFA 1LCIA 3DLBA 2OP0A 3G8DA 3V33A 4MV1A 1NQTA 4X3CA 4DEVA 1U3VA 1DFGA 5DHUA 2XXJA 3O03A 4I4CA 1G3IA 2QN6A 1Z5PA 2FGJA 2NYRA 4HQKA 4R1UA 2TSYB 1VDZA 4YPVA 4AG5A 1L4MA 1N0VC 1MUUA 4JL6A 4D96A 4EKEA 5L9AA 5IJ9A 2ZSKA 1RKUA 2J6BA 4TMXA 1ZM9A 4E4TA 1OC4A 4FFOA 5KQSA 4JFRA 4D0GA 1A5ZA 2I2CA 3RVMA 4F06A 1OW3B 2GBPA 4X20A 4ARSA 4CMGA 1A7AA 2XSZD 4OHOA 4XXHA 4QEKA 4LYGA 4QRHA 3VVMA 1C1HA 4Q5IA 3VYSB 1PUIA 2VK2A 1R9NA 1VCHA 3OSZA 3Q4GA 2Z43A 2AKEA 1S2GA 1U1GA 3EB9A 2R2AA 2Y1WA 1LB1B 4M3NA 3AR7A 2A6PA 4Q7KA 5DNYB 2OCAA 5LA6B 5K3EA 4YBZA 2HT6A 3DCIA 1ZL0A 4NK5A 2VLIA 2L0XA 4TN5A 1PIWA 1XQXA 4D8WA 5DYIA 5JVDB 4O6VA 4F9EA 4IHAA 5AUOB 5LIRA 4ZVKA 3CFYA 5H0IA 4D97A 1SXJE 2WE7A 3Q8WA 1CY2A 1DO2A 2GYVA 4CLRB 1WRBA 3MW8A 1JQ3A 5BN5B 2JBWA 2ZYTX 3GX1A 4JJ7A 4DTCA 1T4CB 3QF7A 1K5HA 3LCMA 2ZUTA 3MBIA 3UWKA 4B2LA 1L4KA 4ESHA 4ZI7A 2GBLA 4KI7A 2C5HA 3V97A 3DZKA 5CXSA 3FIJA 1R3UA 2A9JA 2EKLA 1M2VA 2KMLA 3ER6A 3PHJA 1W5BA 3H18A 1XCOA 1Z12A 4OP2A 1X80A 2FF7A 5G1OA 2C03A 2QTBA 3SXUB 4E5MA 2FK8A 4HMPA 5T8KC 4WY5A 2GZAA 3VYUB 4NZOA 1C9JA 2OKCA 2D0DA 2M98A 1W44A 3U4CA 1NBOA 1R8SA 2Q1WA 3N59A 2I65A 4GOXA 5EWMA 1V8BA 3BWDD 2ZKIA 3IAM1 2HQ1A 4HV4A 5B36A 5CA0B 3FPGA 2WIFA 2PUJA 1ZMOA 1GAWA 3EZ7A 3DJFA 4RV5A 4HUQB 4O3MA 3WG9A 2F1OA 1X8LA 3GN2A 1A2OA 3Q3VA 4J1TA 2ZYVX 4YMIA 4ZA2A 1KNQA 3URMA 5KJ1A 3NVMB 4E5SA 1XMOB 1JAXA 2JI4A 3MCVA 1TUGA 2ZIAA 4I1SA 1RLJA 2OFOA 1E4EB 3QNMA 2BKUA 4OGGA 2OD9A 1WXIA 2ZAGA 2ZQ5A 2V0NA 3NGMA 1L4BA 5I7OA 5INTA 4N3CA 2GTPA 1BMFA 3LXUX 3DE6X 5AWFC 3F5DA 5JO0A 3V4RA 2CDBA 3ZLJA 5EQFA 2XGMA 3V00A 3RLFA 3PB3A 3Q98A 1BTOA 3TQSA 1KO7A 2IZ6A 3DULA 3QG1A 3T1QA 3E18A 4Q4HA 1RM3A 1Z0FA 4EX6A 1FBNA 3DL2A 2EXXA 4BQPA 4DLLA 3L8ZA 3HSSA 4E3ZA 3IIKA 1T2EA 2EBWA 4Z86A 4FFBA 1L5MA 4DXDA 1FFBA 3D6FA 4PLGA 4N48A 3GJ4A 3KWFA 4CF5A 4DBLE 1H5NA 1UINA 2B2XA 5EZQA 2O8NA 2QXTA 2LTAA 2IY7A 4FFMA 1XX6A 4J2OA 5EN4A 5CFNA 3ZV6A 2RHHA 2AN1A 4MS3B 1KDTA 3Q15C 1S2MA 4NV1A 1UUFA 1HY3A 3GWGA 2K6GA 2VF8A 3F49S 2OB2A 4ZEVA 3L18A 2QJRA 3HY6A 3MLBA 4EUNA 3P0EA 2NO4A 3QFTA 1KP3A 4XQGA 4PSDA 4KXQA 1OBCA 4QXQA 5JJ5A 4YALA 1LLDA 4O2AA 1OLOA 3OA2A 4BE4A 4UCWA 4IO1A 3MTQA 4NJMB 5EXDA 2IOFA 4F60A 4Z53A 2ATCA 3LZDA 4MW9A 5CHEA 3W5IA 4YJ3F 1PZFA 1ZISA 1FMFA 1RCUA 2IIQA 3GA5A 3ZX4A 1F5NA 2QMEA 1EQAA 5K0JA 1CUEA 1QIFA 4K3UA 1DC4A 1LV8A 1NW5A 3EY9A 1DX6A 4HFJA 3SOPA 5B57C 2NO6A 4MHOA 2E4UA 4UU8A 1W5SA 3DMFA 4MEAA 1CIPA 5CTAA 2PL1A 5CT8A 2K4MA 5LZ4A 2X19A 3OO1A 3SYRA 3ETGA 1X1RA 1T0BA 1P39A 1TJ3A 3AL3A 4D3SA 3NIDB 4HZUB 3SX4A 1HETA 1OV4A 1EXMA 4H15A 5A5VA 4JJ4A 5TPWA 1W96A 1IBMB 1NPDA 4RUK