2G1DA

Solution structure of ribosomal protein s24e from thermoplasma acidophilum
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
MDLIIKEKRDNPILKRKEIKYVLKFDSSRTPSREEIKELIAKHEGVDKELVIVDNNKQLTGKHEIEGYTKIYADKPSAMLYEPDYELIRNGLKQKEAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of TA1092, a ribosomal protein S24e from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Ribosome
molecule keywords 30S ribosomal protein S24e
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g1dA00
4C7QA 1X5TA 1RKJA 2LECA 1NJIT 3CCSS 1VC0A 5IQQA 1WF2A 1M5PC 2LA6A 2X1AA 2AYBA 3THPA 2RRAA 3G9CA 2DH9A 5LJ5Y 1N52B 5GADU 3G4SS 3VAIA 4CH1A 2CQPA 3MURP 1M90T 3CULA 2LA4A 2LQ5A 3SDEB 2KHCA 3U1LA 4J5OA 2DNGA 3VAFA 3CC4S 2DHSA 1Q7YT 5D78A 3Q2SC 2I2YA 2HVZA 1KD1T 2DIUA 2CQ1A 2OTLS 2XS2A 4Y00A 3K0JA 1ZZFA 1X4EA 2DB1A 3VAKA 2MZ1A 3I55S 1JJ2R 4WF9Q 3VF0B 2XNRA 3NNAA 2DHAA 2AD9A 1WG1A 1WI8A 2KT5A 4WFNQ 1WELA 3BEGB 1U1NA 1S72S 1UFWA 3BO3A 2E5IA 4W90B 1VQ8S 2V94A 2YKAA 2ZJQQ 4Z2XA 5CYJA 2MSSA 4TLQA 2ZJPQ 2OTJS 3CC7S 2ADBA 2LCWA 1QVGR 3CTRA 1YIJS 1HA1A 2MQLA 2CQ2A 3R27A 1X4AA 2MB0B 3TO8A 1NU4A 2Q79A 2YH0A 1FNXH 5DDQC 2QA4S 4PR6A 2KYXA 2OSRA 1WEZA 1YI2S 3CCJS 1H2UX 2WBRA 3LPYA 1VBZA 2BOPA 2M0GB 1WF1A 3V4MA 2MZRA 3P5TL 4IOAQ 2PEHA 2MQNA 3FEYB 2CPFA 5H1SV 1WHVA 2DK2A 1WG4A 2L9WA 1VBYA 4P6QA 2FHOB 2M4MA 2YTCA 5LSLA 2DNOA 3NS6A 1X4HA 2MZTA 2EK1A 2MKCA 2FC9A 1BY9A 5GAHU 4V19X 1VQKS 1DHMA 2J8AA 3P6YC 2KXFA 3MOJB 1QVFR 1SJFA 1FHTA 2DNYA 3CF5Q 2XB2D 2DNHA 3EGZA 3CCMS 5HO4A 2MGZB 1WF0A 2DHGA 4IO9Q 3HHNB 1FXLA 3US5A 3R1LA 5MLCV 2X1FA 5DDOC 3P3DA 1K8AT 4F25A 3LQVA 3SDEA 2KG0A 2BZ2A 2CQ0A 1FT8A 3UD4P 4QPTA 2LYVA 2E5GA 1SJQA 4QQBA 4LMZA 3BS9A 4TU8A 2E5HA 1DBDA 1VC6A 1YHQS 2CJKA 1PGZA 2DNQA 4A8XA 2CPIA 3DXBA 2RU3A 1UW4A 2EK6A 1VQMS 2KI2A 2QFJA 1VQ7S 1YJ9S 2DO0A 2RNEA 1Q81T 2M2BA 1N54B 5GMKa 4TU7A 3NMRA 1P27B 2K8GA 2DNZA 2KRBA 2KRRA 2J0SD 3NNCA 4CH0S 2CPEA 2MQPA 1VQNS 4ED5A 1YWXA 3CD6S 3CCES 1YJWS 2DHXA 3FEXB 2AYEA 3SXLA 5JVGQ 2NZ4A 2JVRA 2RVJA 2MXYA 4YOEA 1A7GE 5CA5A 1U1PA 5LSOA 2CPDA 1U1RA 1M5KC 2DGSA 3N9UC 1SXLA 1L3KA 4UQTA 1M5OC 2MMYA 3UCGA 2DITA 2YH1A 2DH8A 1G2EA 2CQDA 3G6ES 2DGWA 2LXIA 1O0PA 1FJ7A 1URNA 1VQOS 3MUTP 4YB1P 2M52A 2OSQA 3VALA 2DNRA 3IWNC 2MY8A 1WTBA 1VQLS 3CUNA 3ULHA 4WIIA 1JMTA 1IQTA 1K73T 2RQ4A 1X4CA 4YUDA 1X5PA 1UAWA 4WFBQ 2VOOA 2KM8B 4WKRA 2MJNA 5ITHA 2FY1A 3CCLS 4LIRA 3B4MA 3VAJA 3NS5A 1NO8A 3H2VE 4C0OC 2KXNB 2SXLA 2XS5A 1WHWA 2RQCA 1X4DA 4TU9A 1W2BR 5D77A 1WHXA 2MY7A 3BO4A 1Q82T 5JVHQ 2D9OA 1U6FA 2N3OA 3ZZZA 4OZ0A 2HGLA 3S8SA 2MZJA 2M88A 2U2FA 1YTYA 1D8ZA 3TYTA 2J0QD 2MZQA 2LEAA 2F9DA 5EN1A 2FPHX 3OW2R 3UCZP 2NLWA 3CPWR 2E5JA 2RRBA 2D3OR 1WEYA 3B4DA 1U1LA 5HL7Q 2DIVA 2MYFA 1VQ9S 3Q2TC 3UWTA 2MPUA 2F3JA 1ZH5A 1JJ4A 4IUFA 2G0CA 3MD3A 4IOCQ 2DNNA 3VAMA 1OIAA 2DGVA 3SMZA 4EGLA 1H2TZ 1U6BA 3MI7X 2KG1A 2DGOA 2GHPA 2KM8C 3CCVS 2JWNA 1S79A 4OZ1A 3UCUP 2X1BA 2OJ3A 2MGZA 2MKIA 5DDRC 2KFYA 2E44A 3UD3P 2CPYA 3G71S 3CCRS 3CMAS 2N3LA 1XN9A 2CPXA 3L3CA 3MUMP 5CXTA 1OO0B 3S01A 1X4BA 2DGQA 3J7YU 2HGNA 5DM7Q 2DGTA 2DGXA 3MD1A 2M7SA 1DRZA 2ERRA 3U1MA 2KU7A 4F02A 3CCUS 3EGNA 1VQ5S 2RS2A 4U67Q 1UP1A 2UP1A 1YITS 2PE8A 1WHYA 1KOHA 1X0FA 5LXRA 2XSFA 2XS7A 2J76E 4CIOA 5DDPC 2MKHA 2MKSA 2ZJRQ 2HZCA 2QEXS 4FXVA 2CPZA 2L41A 2EVZA 2X1GA 2G4BA 2D9PA 3S6EA 4Y0FA 3S7RA 3BO2A 1VC5A 1H2VZ 1X4FA 3VAGA 2CPJA 1U1KA 2U1AA 3J7ZT 3RW6A 2L08A 1WWHA 2DH7A 1H6KX 3PIOQ 2AYGA 2N82B 3D2WA 1Q86T 5GAGU 1DZ5A 5IM0B 2CQHA 1SJ3P 2CQ4A 2O3DA 1KOOA 1HD1A 3HI9A 1A9NB 3IRWP 2RT3A 4ERDA 2DNMA 3CC2S 2N7CA 3G8TA 1KC8T 1ZZNA 2CQ3A 2M8HA 3CCQS 4WFAQ 1M1KT 1P1TA 1X5SA 2RS8A 2M8DB 4PKDB 3ZZYA 2MKKA 1N8RT 5BJRA 1FO1A 2RUGA 2DISA 2DNPA 2DNLA 1JJHA 2KXHA 2CQGA 3DLLQ 3I56S 2VONA 1VQ4S 1SJRA 2LKZA 2CQIA 1VQ6S 5GAEU 2CQBA 1CVJA 2MZSA 4QU6A 2MJUA 3R1HA 1WEXA 2LEBA 1VQPS 3MDFA 2OIHA 3NNHA 2DGUA 1X4GA 1FJEB 2KH9A 4W92B 2VOPA 2JX2A 4FXWA 2JRSA 2DO4A 3P49B 3G8SA 1X5OA 2HYIB 2A3JA 2M9KA 2AYMA 2KVIA 2M70A 2YWKA 1RK8A 3MXHP 2CQCA 1D9AA 3JB9k 1F9FA 2ADCA 1U1QA 4BS2A 4F26A 3G96A 1OPIA 3VAHA 3CMES 1HL6A 1OWXA 2I38A 2HGMA 4C4WA 1QM9A 2G1DA 5DM6Q 5LJ3Y 5GVQA 4QU7A 2K3KA 2MQMA 2F9JA 2XNQA 1U1MA 4UY8T 3MUVP 2JVOA 1KQSR 2LMIA 2CPHA 1PO6A 4LJMA 3CXCR 5IM0A 3H2UB 4CQ1A 4RU2A 1U1OA 2KN4A 1FJCA 1WI6A 5FJ4A 3EX7B 2MQOA 1WG5A 5DETA 5LXYA 2MHNA 1R8PA 1VBXA 3THTA 3TP2A 1K9MT 1N88A 4M5DB 1AUDA 3PIPQ 1M5VC 4WCEQ 4PRFA 2DNKA 5IFMA 2FC8A 1B7FA 1HD0A 2LXUA 3RW7A 4ZKAA 1YJNS 2GO9A 2VODA 1U2FA 1SJ4P 1R8HA 2MQQA 3UE2A 2MSTA 2B0GA 2MKJA
chains in the Genus database with same CATH superfamily
2X3GA 2ZH2A 1NNDA 3BM7A 1XERA 4C7QA 3OTOJ 1QVGR 1X5TA 2V63A 3BQ1A 3GIRA 2Q3PA 1G7CB 1T9TA 2L9DA 3E51A 5KFCA 4TQRA 2VFRA 3T41A 1H38A 1D0EA 1WF2A 2M3DA 2HW3A 5JJBA 4GRSA 5LJ5Y 1HNXF 1HR0J 3V5RA 3ILLA 4FPRA 4KAIA 2E66A 5HLFA 1HBOB 1A6LA 1RQ0A 3KUHA 3M6UA 4B17A 3DKDA 1N4LA 3HXMA 1M90T 4USTA 5LT5A 3CULA 3HDSA 2IMOA 4A8KA 2LA4A 5DJBA 3UDVA 5CHCB 3HD1A 4DL3A 2XO6A 1C2PA 2KHCA 4NLUA 4J5OA 2YNFA 3CJ4A 3R3TA 4K0KF 4DV5F 2WCXA 1B4SA 3X1LB 4DR3F 1W25A 1BD6A 1EAYC 1RTJA 5AXKA 3W61A 3H42A 3NAIA 1KD1T 4PPDA 1SC6A 2XM3A 2BV3A 3MPUB 4NMXA 2OTLS 2C2RA 4Y00A 2J9DA 3K0JA 4KJIA 3TEHB 3UPFA 4C11A 1X4EA 2DB1A 4IG0A 1Y11A 3W60A 3HVAA 1RAAB 1RBLA 2MZ1A 1RTHA 2JJ4D 3I55S 3VAKA 2BX6A 3VF0B 4UOFA 4U6PA 2XNRA 4AT1B 2AGQA 1HHTP 4OFZA 3OFHA 6FD1A 1S6QB 3I4PA 3SCIE 5EWGA 4JI0J 2IHR1 2ZKTA 2AHOB 4CLTA 4DBQA 2PD1A 2OMLA 3C6TB 3EZ5A 3H20A 1WG1A 4MK8A 3NCRA 4LQ3A 3V4IB 4ED8A 4K2JA 4DN0A 3G82B 2OPPA 5EDWA 3BO3A 3LALA 1NK0A 4W90B 1VQ8S 2V94A 3H4BA 1PSDA 3U1NA 3F73A 3C6UA 2Q6CA 3QSYB 2ZHBA 4DX5A 4LFCF 1O51A 4Y3CA 4DR4F 2ZJPQ 3VWSA 1N36J 2X3DA 3BYRA 1D1UA 4MKAA 4URQU 4O3NA 4RX6A 1D9DA 4GMKA 1EB0A 1WC5A 1FESA 4RW6B 4C11B 2ILYA 4XAKA 5KG3A 3Q8YA 2F4FA 4NXMJ 5HQ8A 3B6BA 4PEOA 1GMUA 2QA4S 3KJQB 1IVZA 3KK3A 2OSRA 2YWGA 4ED0A 1WEZA 1U25A 4QWCA 2ZUAA 4PXCA 3TOQA 1PIEA 1H2UX 2QLXA 2YKMB 2WBRA 3LPYA 4LF5J 4OV1A 3T5LA 4ZPDA 1ROFA 3LAKA 4HT7A 4ECVA 4QWEA 2MZRA 3P5TL 5KFIA 3ZTRA 4ZMMA 2YBVA 2PEHA 4NWBA 1Q8LA 4J9NA 1KWMA 4TNOA 4N7TA 4WFYA 5FLXY 3RB0A 2KT3A 2QL7B 4CWBA 5H1SV 3PR4A 1JK9B 1WHVA 3PXGa 3GSDA 2DK2A 1RT4B 2R4FA 4ECTA 4YP3A 2UXBJ 4I2PA 4ZVTB 5J2MA 4DF8A 2FHOB 4MIAA 3KWMA 3ZTOA 1VJQA 3HSGA 3O5TB 3DLGA 3OBIA 1NXIA 1VK3A 1RWOB 4KO0B 5L1JA 3T3FA 2ILZA 1NK8A 2FC9A 4UQGA 3UR3C 4DSFA 4HDGA 4OHZA 1VHIA 5B7WA 2N4DA 3CDUA 3W64A 4B9SA 4LFAF 1MMDA 4NCGA 1JLQB 1RT7A 5B09A 3CJ5A 4A8FA 1S49A 2HFZA 1SJFA 3TI0A 1ZETA 2E1CA 1KLMA 3CF5Q 2XB2D 2HFOA 4IRKA 3MEEB 3VVTA 3AXMA 3OUYB 4IR9A 2XMWA 4FF2A 1VJWA 3GYXB 5FLXU 3EGZA 1WF0A 2GNKA 2B3TB 1W2IA 2W4DA 2OKQA 1N0UA 5KT7A 1FWLA 1WACA 3D6FB 3RB4A 1HNXJ 3K2YA 3R1LA 1JKHA 1GXUA 1FXLA 2FB0A 5KFFA 5DDOC 2X1FA 1K1SA 2YNFB 4ZPTR 4N5SA 2AX1A 1PYOB 3DLKA 4C8MA 4EZ6A 2KG0A 3BJYA 1DTQA 2CQ0A 1FT8A 3UD4P 3QZ8A 3M30A 2LYVA 3MR6A 4PUOA 3BZQA 1PJ7A 2C2EA 2DR5A 2CIMA 1Y9OA 3M4XA 4ZIWA 3CDEA 2B9EA 3ET6A 1TU0B 1CS4B 4JP8A 3DYAA 4A8QA 3W2VB 4J9UE 2E9TA 1W7WA 2HAIA 2DNQA 4IH5A 3I6PA 4CLWA 1Z4UA 4CNYA 3O8WA 3CJKA 2H9ZA 4LRCA 2NXCA 2XSJB 4NRUA 2DEJA 4KE5A 4U7UD 1NDKA 2ZHOA 3EICA 4B3SJ 4YDDB 4MMOA 3KLEA 1HW8A 4DR7J 4JI5F 1YJVA 1UW4A 3QIDA 2PMZD 3RUBL 2FLPA 1T02A 5DS7A 2QFJA 3FDSA 1URRA 1VGYA 4KR0B 3SV3A 1VQ7S 2YKNA 3CIMA 4HHJA 5GAHI 3Q23A 3A8KA 2ZVIA 4P2MA 4TU7A 4DV6F 4DR1J 5DLFA 2JLGA 1Y3JA 3AFGA 4CH0S 2QSWA 1X60A 5F8IA 2UXBF 1S6UA 4ETZA 2LXFA 3LP0A 2QSFA 1R0CB 1FDDA 2CXEA 3CCES 4RW8B 1P1LA 3K5MA 4YEAA 5KFRA 3ZZRA 4USHA 4QYRA 4X4RA 1WDTA 1N6QB 1S4EA 3RU0A 2CDRB 5KT3A 4LF6F 1R6YA 1A7GE 3M30B 4DL2A 2VV5A 2CPDA 9ATCB 3TARA 2HG4A 3CGIA 3M1VB 3D0GE 4WYLA 1M5KC 2B4OA 4OX8A 2DGSA 4ZHRA 3N9UC 5KFAA 3PKYA 2DITA 2YH1A 1FD8A 2CQDA 2HQGA 4MTPA 5L9XA 4F04B 3IGVA 4X2BA 2W4CA 2LXIA 4HDHA 4CTAA 1FJ7A 4O3QA 3AQOA 2HS4A 3V4IA 1HI8A 4MK9A 3FQKA 1ZM2A 2V4JA 4CLKA 3JS9A 2QT7A 2Y0BB 2Z8QA 2DNRA 4OZNA 1SKRA 3F56A 1EKSA 1HBMB 2CWKA 2AGPA 1S0VA 2H4YB 3MMBA 3PNIA 2I8EA 3D3BJ 5CD4A 2A6OA 4WFBQ 1NK9A 4WKRA 3PRDA 5A6PA 3TQ1A 1HI0P 1FDAA 2MJNA 2W7PA 4JI1J 2PMHA 3N6MA 3VAJA 3NS5A 4OYZA 3QIPB 3HHDA 4JI8F 1RHQB 4LR8A 4C0OC 2WONA 2DR8A 3RYLA 3KNGA 4RWWA 4AYBD 2R8IA 1M1GA 2XS5A 1WHWA 4Q7AA 4DV4F 4O4RA 2BA9A 1VK8A 1X4DA 2UV8G 2HHVA 4ZN1A 1UL3A 2CG8A 3W63A 4DQPA 3ZZUA 4GKKJ 2OEKA 2Y3YA 1UKUA 4F67A 2CUYA 5HVHA 2VZ9A 2B6AA 1MWZA 3G87A 4QBUA 4OZ0A 1T05A 1S1TA 3ISNC 2MZJA 3RAXA 1O8BA 2EWHA 5SUHA 3TYTA 4CLZA 5B08A 5D15A 3RRKA 1JIHA 4WJBA 3R7SB 1CJTA 1CULB 5E3RA 3ZTQA 5KOXA 5M2UA 2C1EB 2FYXA 1GMWD 5GMDA 2VBWA 1UVJA 1RHJB 3O44A 5F0WA 1NUEA 2DR7A 2KKHA 2YKPA 3MM9A 1KVKA 2RRBA 3I0SB 5IWAF 2KTQA 4NL5A 1SJ1A 2IAJA 3C19A 4OZ5A 4ZDNA 2UXCF 1TKTA 1WEYA 1NDCA 4QWDA 1Q8BA 5DGAA 1UWBA 2V68A 4IYQA 1NEEA 3BGUA 3B4DA 4NYOA 2VBXA 1OMSA 2ZH7A 3MM8A 5HL7Q 1U1LA 2DBBA 3DC2A 5DQHA 3KK1A 3Q2TC 2KZZA 2WW4A 2F3JA 2EXUA 1ZH5A 2V34A 3R6LB 2G0CA 2KJVA 3KLIB 3BSCA 4G1QB 4IUFA 2RB7A 4IOCQ 1YQHA 2RSQA 5C24A 4KQZA 3VAMA 3I5AA 2DTJA 4MKBA 1PJ5A 1OIAA 4WIQA 3SMZA 4PQUB 4EGLA 1H2TZ 2VPYB 1U6BA 4WU2A 2QN6B 1J5OB 2FLNA 5HROA 3H25A 4IFYA 1T03A 1ZTWA 4GVLA 2ZEJA 2AJFE 1SCJB 2JWNA 5HP1A 7FD1A 1Q1KA 4PQAA 1EHWA 4EUVA 1YRUA 3LO3A 4CYUB 5DDRC 1SH3A 2Z56B 2KFYA 1SUQA 2HKEA 4C8OA 4F0MA 3KXDA 4NASA 4IH7A 1XNQF 4QYZJ 2HHPA 1TR0A 3M8WA 3BBFA 5GAGI 2O01C 5I4MA 1RJJA 3MUMP 3L3CA 1P6TA 2HHQA 1OO0B 3S01A 4DG1B 1X4BA 3QYYA 1N33J 1NDLA 2DGXA 2RKIA 1H3DA 1GTHA 3QATA 4DUYF 5J2QB 5K14A 4NX9A 1DRZA 1LW2A 2QA2A 1IBMF 3U1MA 4WK3A 5KT5A 5I3UA 1WC6A 3R97A 4V19J 1C4CA 5A8KA 3CCUS 1U09A 2BE7D 3KG4A 2RS2A 4HVZA 4U67Q 2GVDB 2Z2YB 4I2PB 4OMFG 3V6KA 4B3MF 4P10A 4ES2A 3DOMB 3HD2A 1YITS 3CJRA 1RU2A 3BR8A 1KOHA 3DDKA 3HFZB 3QO9A 4P7TA 5HBMA 3SCLE 5CABA 2XS7A 2V2ZA 1MSWD 2D74B 1XMQF 2F8MA 1U2CA 3GPAA 2EI5A 1G3OA 2MKHA 5DQIA 4OIXA 3TQEA 4P74A 4FYVB 2QEXS 1RWUA 3OTOF 2HS3A 3D4JA 3DRPB 2CPZA 2FVCA 1F5CA 4M5MA 4RW4B 4BCAA 5HP1B 2IBOA 5I3UB 4K7QA 4DPUA 1Q7LB 3V6DA 1F9EB 4X4TA 2HVIA 3IM8A 2GZOA 5A2QY 2DRBA 4O4GA 3S7RA 2IYGA 3CJTA 4XDDA 3QAEA 3SSSA 2K06A 1IBLF 2R7TA 1KN6A 2GIQA 1RT6A 2RIJA 4USKA 1GNKA 3FZ2A 1SC4B 1UCNA 3O1LA 5L9NA 1U1KA 1JLAA 5EX0A 4JI7J 2QIFA 3D1OA 2AYGA 2GA7A 2N82B 5E2QA 3D2WA 3ZNJ1 1DZ5A 1TAUA 1HNIA 1NRKA 1RWMB 2HIQA 3DRRA 5KFHA 3KNAA 2F40A 4JI4F 3C66A 1LOUA 1U0HA 2O3DA 3I32A 1KOOA 3O6QA 3HJVA 1HPZA 3SFGA 4YFUA 5D3GB 1N5YA 1A9NB 1HQUA 2ZBQA 2DNMA 3PJXA 4JI3F 2V50A 2E7WA 2HEKA 3MOZA 4DCOB 4C98A 4M94A 1SC1B 1CJTB 1S1UB 1Y00A 3KLIA 3R5CA 4O3PA 5C25A 4R5PA 3QBCA 1VYAA 1RYSA 5IS2A 4RUAA 2VU5A 4Q43A 2EBGA 4CO1A 4EO8A 4URSA 3OSNA 4DUZF 3Q8PB 1XNQJ 2K3IA 1P1TA 4TYBA 1FJGJ 5CCMA 3DXSX 5KFOA 3BGLA 1HNVB 3NP5A 2WB4A 2MKKA 3PW4A 4A8WA 1FO1A 1IKVB 1YK9A 2AJ0A 2Z2MA 5EWFA 2FJWA 2R7VA 4ZCLA 2PN6A 1WJ9A 5HBMB 2IJNA 2H1YA 3DLLQ 2VONA 1K44A 1VQ4S 2JC0A 1F6TA 1RTIB 2OP5A 2QL9B 2KVQE 1SV5B 1CVJA 4LFCJ 4DR4J 3ZZPA 3H7HB 5CZXA 2ZH5A 3TA2A 1CJKA 1FK9A 2C28A 2UXDF 1IM4A 3IG1A 5JXSA 2OIHA 1Y0HA 1R8AA 1S59A 3LP2A 4AUKA 1X4GA 1LWEB 2EFOA 3JSMB 3OSPA 3TZWA 1MLAA 1U0SA 3CWJA 3ILIA 4WFXA 2D3O1 1D9FA 5E0OA 2JX2A 2AJ1A 2GV1A 1TK0A 1TK5A 3MFIA 5A8WA 4URGA 1V9OA 1SIZA 5I3PA 2DR6A 2BQ3A 1X5OA 2HQIA 2HYIB 4NEZA 1J2VA 3P96A 4C8NA 4DDFA 2AWZA 4ECSA 1EARA 4USVA 5H9FK 4LQ9A 2EFGA 1RK8A 2XEXA 4K4VA 1ZAXA 3ILOA 1D9AA 3E01B 3IR6B 2VIHA 1MMNA 3NRBA 4N76A 1HBMA 1F5AA 3R7BB 4KO0A 4NLOA 2HIYA 1CJKB 1FK9B 3MHYA 4A47A 1NK4A 4DXLA 2GO8A 1S10A 1J5OA 3PG9A 4Q0BB 1HL6A 3AA9A 3Q8QB 3ONQA 4DU7A 3M9NB 1T3NA 4NXNF 2KYZA 3IBWA 1RLCL 5D4PA 3IXQA 2BEFA 1QM9A 1WSVA 1WUUA 2WAQD 5L38A 2B8QA 5DM6Q 1VMBA 2H5IB 4X65F 3R5JB 4M5DA 2VC1A 4JI6J 4HKQA 2HBYB 2JEGA 3DCAA 2ZH9A 4UY8T 3MM6B 3MUVP 4KFBA 4B3RJ 4NXMF 1R27B 4OX9F 4ZVUB 1NPKA 1ZA2B 2CPHA 3PX4A 4QCLA 3CCTA 4J90A 2VBZA 5E3PA 2VG5B 4ITSA 4WP9A 5IM0A 2UVWA 3H2UB 4CQ1A 2WVCA 4XO0A 4F4KA 3T1HJ 4G6VB 2BR0A 5FJ4A 1P9QC 1WG5A 5DETA 5LXYA 4LBIA 1R8PA 3RTVA 1CPZA 1VLYA 3TP2A 2QMWA 4K4XA 1YGYA 4IFVB 3BBBA 3M8ZA 4EO6A 3NNHA 4M5DB 4ID8A 1RT6B 2HFUA 4IG3A 5C25B 3CCWA 1FVQA 1LWCA 5U47A 5HQLA 1IQZA 2AEJA 3CJKB 1UVIA 3PR5B 2K1RA 2R7UA 4PRFA 2ZBPA 2DNKA 4UUWA 5IFMA 3MR2A 4LRFA 3AD8C 3RW7A 3ITHB 4ZKAA 4C3KA 4K4WA 4GKJF 2YX4A 2ROGA 4OYMA 1IWAA 4L3KA 1U2FA 2VODA 1Y4ZB 4ANCA 1RAOA 2AV5A 5D8HB 2ZOFA 1IWGA 2VG7A 3D6HB 4WE1A 3UE2A 4DR3J 4RUBA 2W9AA 4WXOA 2B0GA 3K8VA 4OX9J 2JNJA 2CA9A 4K4TA 3DLBA 2C2ZB 2F4VJ 3PW0A 3IM9A 1RKJA 2RD5C 4M5KA 4F3MA 3BKFA 1NJIT 4H4KA 1QDUB 4ZLJA 4NRTA 1VC0A 5IQQA 1FXDA 3T6JA 4Z37A 2BBEA 2WVDA 1ZM9A 1JLBA 3N6NA 1M5PC 4Z7YA 2CNKB 3KYLA 4B9UA 4JI7F 1OQ3A 4KB7A 2AYBA 4D3GA 1PC5A 1FFWB 3JYTA 1FKOB 1Q5YA 3EE3A 3GONA 4NLSA 5B0GA 1YG0A 3VAIA 2ALZA 4LT6A 3BDPA 3DRSB 2B56A 3NMAA 1SL2A 3I82A 4LF7F 1FNOA 4FBUA 1LWFB 4RLEA 4JB8B 3WZ0A 3SDEB 4JI4J 4LF1A 4YB7A 3D66A 3CJ8A 2DNGA 2W2OP 1ZTTA 3CC4S 2DHSA 5J2QA 2W01A 3PYFA 1QAYA 6FDRA 3GV5B 4EBCA 2RQKA 2HVZA 3M8PB 1MMLA 1AB8A 3OFEA 3PCOB 1TL3A 1JLQA 1RT7B 4DZ6A 4LF5F 1FRLA 1IKVA 2E7XA 2XZTB 1YZ7A 4PG4A 3TR5A 4ZHRB 4ZIVA 3EXCX 2H65B 3JQJA 2AMCB 2DHAA 4YR0A 5ETVA 2JEIA 3PEJA 5ETKA 2V4RA 4Q8EA 2CVEA 3D1QA 2KT5A 1WI8A 3FCVA 4J37A 1HMVA 1REVA 3JQKA 2RF2A 4NLRA 3VGUA 3BEGB 3FRYA 1U1NA 2QO3A 1NHKL 2XYGB 4BBYA 2OPSB 3JSRA 1H98A 1TV6A 3OTDA 2W24A 2BKNA 4HACA 1JLFB 4QR2A 2MLXA 4ATNA 4Z2XA 4EYIB 4KY3A 5BYQA 1Q53A 2ACYA 2IC3A 1XMQJ 2OTJS 1RHUB 2ADBA 2AJQA 4K2XA 3CTRA 2GC8A 1HA1A 5E3AA 2VFTA 1UEKA 4CLYA 4MH8A 2G13A 2MB0B 1BWEA 5D0GA 2HNDA 4P2XA 1FCAA 4FF1A 4QWBA 5DDQC 3J80Y 3EGWB 3MM7A 2XLIA 3MMJA 2V2QA 3C6TA 1YI2S 4ZCKA 3H5XA 2XWXA 2BOPA 1PBAA 3D1HA 5SZTA 3V4MA 3EVMA 4J9PA 1FXRA 4ZP6A 4DR6F 3M8PA 4OI2A 1N33F 1B7YB 1HARA 2MQNA 1H7WA 3NAHA 4PWWA 2CJYB 1OJ4A 2CPFA 3HVTA 2A6MA 3PACA 2B9YA 2B5JB 2RMLA 3OL8A 3GU0A 3GIJA 1WG4A 1NK5A 4I1TA 3A12A 4OYXA 3W5YA 1S1TB 2XHWA 1XMBA 5EUHA 1WSRA 5LSLA 1SH0A 2XGQA 1VRUB 3CIZA 4AL6A 3AH6A 5KFKA 1X4HA 4ZVRB 2VOPA 3W9IA 4FVCA 1H7XA 1X8DA 2IDLA 4RU9A 3W8GA 1EP4A 3RJMB 3M6VA 5AJ3J 2XY5A 2ZDPA 4PABA 5D4LA 2EFVA 5H9FJ 1B0VA 1VQKS 4JI8J 1E6VA 3OL6A 1JQGA 2KXFA 2NS1B 5ETQA 1TFWA 3MOJB 1SIWB 3Q8UA 1KSPA 4WE1B 2YQ0A 4KGZB 1NB2A 2QX0A 3NGKA 4H54A 5C2CA 2AU0A 4ES3A 2VA2A 3QPIA 2DNHA 3CCMS 3KLFB 2O66A 2MGZB 3MF5A 2H48B 3BF4A 5AE2A 1UVNA 1OSCA 4JBCA 1XC9A 4LR7A 3N01A 3VZHA 2HNZB 4X4SA 3W65A 4F25A 3Q24A 4ZCMA 3CJ0A 2HHUA 4ID5B 2VJUA 3RB3A 4LVNP 1TL7A 1TUWA 2IRYA 3G8QA 4C8YA 4QPTA 5D4NA 4CI0B 1N32F 2CADA 2E5GA 2JLEA 2GIRA 3CDWA 4KTQA 4KHMA 3EGVA 1UW9A 3OXLA 2E5HA 1YLXA 1O5JA 4DV4J 1UPMB 1U24A 1R43A 2MHEA 3AD7C 3DOLA 4DV7J 2YQ1A 4K0KJ 1YSJA 3QNWB 4NLXA 1GFWB 1U2RA 3SEOA 1PGZA 3RZAA 3HZEA 3NGUA 1CJUA 4I6AA 4KKOB 4A4JA 4A8XA 4M95A 2A2DA 4DR5J 3R9LA 1Y5IB 1H72C 1YBTA 4OYWA 4YR2A 2PA8D 1RAIB 5IT9Y 2YXLA 3DXBA 1AA1B 3QGHA 5F3ZA 2GGPB 4PCQA 2W9BA 4DQSA 2KI2A 1MNEA 1XTZA 5AXMA 1TL3B 1XR5A 1YJ9S 2UU9F 3OLAA 4LSLB 2RNEA 4H4MA 5J2NA 1XMOF 4B9TA 1YBUA 4RW6A 5GMKa 3C16B 4OL8A 2AZ1A 1YVFA 1S1XB 1N5QA 1P27B 2DNZA 2UUWA 2VDIA 3N0VA 4FKYA 2J9DE 2OD4A 1TUGB 2CPEA 5F41A 1NJWA 1S6QA 2ZC3A 2WHOA 2MQPA 3QRPA 5LMNJ 3SCKE 2EBEA 2GIFA 2XSJA 4O44A 1OYDA 3CD7A 3NXZA 3VHQA 1HI1A 1TMMA 4NYPA 4OYBA 3HJFA 4ICLB 2FLOA 1C0TB 3BGOP 2XC9A 2NZ4A 5JVGQ 3BB5A 2R2RA 4FBTA 2JVRA 1TK8A 2MXYA 4IFYB 3ENVA 4B9LA 3ICLA 4B3RF 1IJEB 2VPWB 3MM9B 4YOEA 1WC1A 1U1RA 3S1TA 1BQMB 2B43A 3FCWA 4F36A 4QOTA 1GEHA 3DRPA 1SXLA 4IQMA 4IG0B 4UQTA 3Q8RB 5L1IA 1S5ZA 2ZD1B 1RHMB 3BGRA 2FHJD 3GR1A 3JQMA 5L8RC 3UCGA 2IFXA 4CO5A 2VQEF 1L3TA 3M2RB 1FNMA 3V6DB 3P4UB 4KKOA 2CYYA 3LWMA 1REVB 3N6LA 2ROPA 3AXKA 4PXBA 3MUTP 4ZPAA 1ZAWA 4YB1P 2ZH3A 2AX0A 1TTHB 2OSQA 2P2CB 3QFWA 3VALA 4P7VA 2AQ4A 3IWNC 2MY8A 3UDCA 2GQ2A 3CUNA 3FRZA 3MM5B 1JMTA 1TL4A 1IQTA 2HWIA 1FFSB 2EKNA 1FI4A 1TFYA 3B54A 3C14A 1X5PA 3MEDA 3E3XA 1FRIA 1U7LA 2C2DA 4N8OA 4DV7F 3ZZTA 1AT1B 4ZJOA 2FY1A 3OUYA 1SUQB 4LIRA 4Q8FA 4OYPA 3CDBA 3L7PA 4OI0A 3FBCA 4DX7A 4Z7CA 4XPCA 1LNQA 3Q89A 2P5VA 1B0PA 2SXLA 5ETTA 5A8RB 2HK2A 2L9NA 3ENQA 3MAHA 4R25A 5G4DA 2H51B 3ZNUA 5CCLA 3NGDA 5K14B 3TUJC 2XO7A 4NE9C 1IKWA 2J9CA 1WHXA 5D77A 5KFVA 3GCWP 4B3MJ 4F2SA 2CWXA 4J9VA 1EX8A 1N5SA 1YBAA 3H59A 5JVHQ 4FKXA 4GC7A 2D9OA 3GMGA 8ATCB 5K8NA 2HFNA 2RUSA 3PYEA 4Q2LA 1UJ5A 4F4AA 3K17A 3M7VA 4DQQA 3RW6A 1RT2B 5FDLB 1BUXA 1TAQA 2R2UA 4DFMA 3OVBA 1RWWB 5K20B 5BR8F 3G86A 3FSIA 2XY7A 2M88A 1T03B 4ZVHA 1D8ZA 4CTAB 5BYSA 3GYGA 3K58A 1LK7A 2BKOA 2N4CA 4JI2F 2LEAA 1LEOA 2FPHX 3QGPA 1GMVA 4I0WA 5B0AA 2WTFA 3OW2R 2NLWA 3CPWR 3UCZP 4BC9A 2E5JA 2GS8A 3OVAA 2DVIA 4KHPF 2LDIA 5BYRA 4ILLA 4J9QA 3VTIA 3IR5B 3C15B 1V3ZA 3KJVB 1CQMA 3SQGB 4DSIA 2HVEA 1IBMJ 1S1XA 2ABYA 2HFSA 2DIVA 9RUBA 4AQYF 2IJFA 3UWTA 3T1HF 5G0RA 4AXIA 4UZBA 4BS2A 4PYAA 4CLPA 4DUTA 2OPRB 4CM2A 3W8PA 1Z2ZA 2QYGA 4F3OA 4EEYA 3KLEB 2LU1A 5B0DA 1NHUA 2NYHA 1NK6A 3KMQA 3QT7A 1S99A 4LF4J 2VPXB 2DGVA 1S9FA 4ED7A 3DU6A 1WNEA 2DGOA 1HBUA 3Q86A 4TYAA 4USUA 1LWXA 2GHPA 1DQ8A 3GFYA 4UOGA 4X4QA 4F4YA 4Q0BA 5T7LA 1N34F 3ET6B 2MGZA 1U0HB 3AT1B 2E44A 3DLEB 3FEZA 5LMUJ 1FWKA 4J91A 3G71S 3CCVS 5B0CA 3E8OA 4OJ3A 3CMAS 3T1YF 1FRJA 3EXYA 1TP7A 2XBPA 2WW8A 5IXUA 1SQGA 3TAQA 2KB2A 3A3NB 3ELHA 3PYGA 2CAJA 2NXUA 2FTRA 5HVGA 1XBWA 4CH7A 2QL5B 4UTGA 5J2PB 2AF6A 3IP0A 1BHNA 4MT1A 3B8HA 5KFZA 2GJ2A 3DRXA 2R8KA 1C4AA 4MIWA 1JNRB 1GXLA 2LDYA 3SCJE 3W9JA 2IIHA 4ZCIA 4ZITA 1KDNA 1NK7A 4B9MA 3MMBB 5ETNA 1S76D 3BQ2A 3TRGA 1UP1A 1C0UB 4KC5A 4ZVSB 4L6V3 4ZLLA 4X4VA 2DY9A 4ZVGA 5GADI 2V4JB 3ZTSA 3KFWX 1N0VC 1MWQA 1RTIA 1B0TA 2ZZTA 3N5BA 3V2UC 2HBRB 3J81Y 4PWDA 5DDPC 3DLHA 1FKAF 4HLBA 5D0EA 2GFFA 3T9ZA 1VBKA 2EEYA 1KRPA 2HRYA 2VQEJ 1QD1A 1TKZA 1N5TA 3HKWA 4QR1A 3ITHA 2H3EB 3KHRA 1OY9A 2W2NP 1U48A 3BSAA 5LSRA 4DMZA 1S7IA 2G4BA 2D9PA 3Q22A 2GJIA 2GJFA 3WDOA 3FFIB 3DLEA 3I5CA 4RBTA 4ZVFA 3QRQA 1K0TA 4RW7A 1S6OA 7FDRA 2CNOB 2FHMA 3F44A 6AT1B 3EPIA 5GMEA 1XR7A 1C0TA 1HQ2A 1UA1A 1H2VZ 1HR0F 3VAGA 1KFDA 4NXNJ 1HYSA 4M8LA 2CPJA 1UWAA 1RWNB 1DAXA 4DG1A 1CULA 2L08A 1FEEA 1S4FA 2DH7A 2ZVSA 3HSDA 3M05A 4WP3A 4C97A 1EJ7L 4HHHA 1CSJA 2H54B 3WX4A 2ZHAA 4IRCA 4KPYA 3ISZA 5HAOA 5IT9U 1RGVA 5KG5A 3GYNA 4LSNB 3GZ7A 3AB2B 3BH6B 3R5AA 2YKNB 3QFHA 1HNIB 4HYKA 2YWFA 4NLPA 1KC8T 1RAFB 1HD1A 3QQCD 2L48A 1PC4A 3QJLA 3MPYA 1ELOA 4L74A 3W2VA 5IZHA 3OL7A 2VFVA 4UF4A 2GMHA 3LP1B 2QGFB 1D09B 2V8DA 4QIEA 4DPTA 2N7CA 2UXCJ 1ZZNA 2UUAF 4USWA 3GILA 4C2MA 3CCQS 5AXLA 4DSKA 4X4NA 2P6TA 5C24B 1Q78A 1DTQB 4DFKA 2AP6A 3J81j 2QYCA 3AAWB 3L4BC 4M63A 4K5RA 3TJAA 3KLHB 4ZPVR 1TKZB 2ZOGA 5KAKA 1X5SA 4IQXA 1YJTA 2RS8A 2V8HA 4KH0B 1NKEA 2C3MA 1NKBA 3HHLC 1L3UA 3OT9A 2AZ3A 3L7OA 4FF3A 2DISA 3HVWA 2DNPA 2X7IA 2DNLA 1S9EA 2IM1A 3UVJA 1JJHA 2Y9HA 1Q16B 3EDQB 5DLGA 4M5HA 1S6PB 1SJRA 2BACA 4NI2B 1LFWA 2CQIA 4NLWA 2H5JB 4L3NA 4LIWA 2H4WB 1R6VA 2IM3A 2CJBA 2ZBCA 3W66A 4HH1A 5THWA 4ECRA 4JI0F 1QTMA 4QU6A 2NXJA 1CJVA 1NDPA 1ZAVA 4MIBA 3R1HA 4LF7J 1WEXA 3POTB 2RRNA 1O6XA 3MDFA 3EMTA 2DGUA 4Y2KA 2FZKB 2KH9A 1FJEB 2K7KA 1F0XA 2POKA 3R8YA 4UUXA 5M2RA 2RE1A 1WKLA 3TZYA 3Q83A 1RT3B 2GMJA 1QLNA 2JRSA 4ZP7A 4PWUA 3D3CJ 3HVTB 5K8MA 2HHXA 1V5VA 2KL8A 3AD9C 3G8SA 3P49B 4DR7F 2DJWA 4ZPCA 1DJ0A 1OY8A 1LK5A 2JL9A 4BWJA 2I5JA 1IR2A 4NI2A 4DUYJ 3IBCB 1LV5A 3QO9B 2Y1JA 3MXHP 4Y65A 4XDCA 4K5SA 4D3HA 4S0MA 3JB9k 2FD2A 1F9FA 1IXKA 2EFNA 4FS1A 2ADCA 3MPDA 2OFGX 1HBNB 2DXFA 4G3IA 3TUIC 2ACMA 1YKWA 3VAHA 4X66J 3ZXWA 4RNMA 3KK2B 1PAEX 1OWXA 3UN2A 5DZ7A 1JXLA 1TVRB 1XR6A 4FZVA 1S1WA 4DR6J 5LMNF 4C4WA 4ECWA 2G1DA 4LUBA 4DL4A 2YWHA 3EZUA 4C0BA 5LJ3Y 3LPEA 3DM2A 4ILRA 1KHWA 4QU7A 3OHAA 2CDQA 2DPJA 2F9JA 3C8YA 2CJXB 4MKYA 1RUSA 4U7CA 1SQEA 1RU1A 3D0HE 3QT5A 1SVDA 3T9NA 2E1MC 1R8BA 3QT8A 5KFEA 3MTKA 4NCBA 4I69A 4LJMA 1S1VA 2CFXA 2FVRA 1PKUA 4LR9A 2PO4A 4X64J 2OEMA 1FF2A 2VUGA 1XIQA 4HT5A 3EX7B 4OX7A 4UOCA 3DDNA 4QYZK 2BE2B 3TUZC 1GTEA 4CLSA 4QZVB 1K9MT 2F63A 1CLFA 2A10A 4O4GB 3PIPQ 4CT9A 1U45A 1ACMB 1NSKL 4G1QA 3I87A 1M5VC 2OPSA 4DHVA 3JTOA 3C6UB 3KUEA 5KFJA 5T14A 2W9CB 1B7FA 1HD0A 1OY6A 4EWTA 3T5JA 2DPIA 4ELVA 2IRUA 3W1YC 2CG4A 1APSA 1JJCB 4J9OA 1X9SA 3VVUA 2GO9A 2RHQB 2YNIA 2ZOMA 3DGVA 5ETMA 1SJ4P 1R8HA 3IWLA 3RAQA 2MQQA 1HNWF 3M8SA 4QW9A 3RR8A 2EFQA 3CW2C 1T9YA 3N4WA 3T1AA 4B3TF 2RU9A 3KG1A 1NJYA 3HLUA 4QIVA 5F9NA 2B4PA 4RPFA 2Q6BA 3KHHA 3UNGC 3KOAA 4PWDB 2MKJA 4C0HA 3NBPB 1DQAA 2C3PA 2VH7A 1QSSA 1VRTA 3EYZA 2HHWA 1MW7A 3DMJB 3GFZA 4OZ2A 2IA0A 5LM7E 3LH2S 4IO1A 1DTTA 2OUGA 4B02A 3HKZD 4ZVEA 4EK2A 4UY85 5KG7A 2I6WA 4NCGB 5DZ6A 1LW2B 5JMNA 1KQKA 3CCZA 3M6WA 4R0EA 5D0RA 3THPA 2GHVC 5C7PA 3G9CA 4K8RA 2DH9A 3FMWA 1RAGB 1ZYQA 1I6JA 1KQFB 4DPWA 2W25A 2WVEA 4NZ0A 4DU8A 3G4SS 2RHSB 1WKKA 2CQPA 3DLGB 4OJGA 3MURP 1AUSL 2Y1IA 2FJXA 2QLFB 4C3LA 5DGBA 2B8PA 3A4TA 4NLYA 1J27A 2Z30B 3SV4A 2UXDJ 3M2RA 2KHDA 3OFGA 1FTRA 4JV0A 4E0DA 3SQOP 1B99A 2VASA 2E5LF 2BM0A 3VAFA 2YKOA 1NAQA 3PEHA 2BJ9A 4FYYB 4JI6F 5CYQB 2XMJA 3Q2SC 1QUVA 3BV8A 4FPIA 4KGXB 4NA2A 1JLBB 3THVA 2I2YA 2ZBIA 2VA3A 3D6TB 3C46A 1X9MA 1CG2A 3W2WA 4ED2A 3D67A 2EC0A 2DY1A 3MAQA 4Y2MA 3BPDA 3AOBA 2B4UA 2VG7B 5KFTA 1U47A 4LFBF 2ZE2A 2E9RX 4WF9Q 1HQUB 3NWRA 3NNAA 1SC3B 1S6PA 1G1XA 2AD9A 1FRHA 1IUJA 3MAAB 2ZUGA 3QLHA 4FDFA 1R89A 3ZO7A 4ZLNA 2JH3A 2I9SA 4ZPBA 3M8QB 3MR7A 5LOQA 1YJ7A 4J9LA 1WELA 5BR8J 5H9EJ 1S72S 1UFWA 2XMTA 4N77A 2E5IA 3T5KA 2KO1A 2FQQB 5KFWA 3I0SA 4WYWA 5CYJA 1IKXB 2J7WA 2MSSA 2WZ1A 3AOAA 3DI6A 2NPFA 3CC7S 2IVFB 3R7NB 3TX0A 4O23A 1DFDA 2ZNZA 1YIJS 1JB0C 4DR5F 1X4AA 2GQCA 3QWUA 4WWSA 3TO8A 3G6XA 4TKTA 3H5UA 2W8KA 4OI1A 1PCAA 3KDOA 1NU4A 2C42A 1BMQB 3MAAA 2C3UA 2GVZA 3FKBA 4PR6A 2KYXA 1BXNA 2VBYA 1YDLA 2FVPA 2J5AA 3PHEA 1V3RA 2K1RB 3CCJS 4DL6A 4RBVA 1VBZA 2VFSA 1WF1A 2LQJA 1IKWB 3GWCA 4IOAQ 2VG5A 4DCJB 1TVRA 3NS7B 4DX8H 1YRXA 4GC6A 2QG9B 1DY3A 3KK2A 4OI6A 4X4OA 1I3OB 1QAXA 2VHGA 2W1BA 1U4BA 1VBYA 4P6QA 4DLEA 3DRYA 2J7UA 4K4SA 4O3RA 2YTCA 3OXGA 2DNOA 2OGUA 2WSCC 2ASDA 1VI7A 2OFHX 4GVBA 5HK4A 1ZS6A 2UUTA 3M2UA 2QLWA 2EK1A 3MCSA 3WBZA 1HBNA 2V8GA 3NKYA 2BYCA 1S9GB 5GAHU 4YDXA 5CYMB 3LA0A 2ZH8A 1DHMA 5L1KA 2UUAJ 4CZCA 2ZZNA 2J8AA 2J0XA 3L7UA 3M8YA 5F8JA 3P6YC 4B08A 3M32B 1IM6A 1QVFR 2J6TA 4CP5A 3CMQA 2GW8A 1NJZA 5IQ6A 2P9EA 3UR0A 5HI7A 1CEZA 1U8SA 3A8EA 5HO4A 2OPQA 3ADAC 4DSEA 2XY6A 2DHGA 4KT0C 3PIOQ 2E1RA 3CO0P 1VLOA 4IO9Q 1R0AB 3HHNB 1FTCA 1KR4A 8AT1B 5MLCV 4DV6J 1DTTB 1U26A 2IJRA 3A13A 3P3DA 5F3TA 1K8AT 3LQVA 3POTA 2R8HA 1IBLJ 5KTQA 4DS5A 1RHRB 2AIRB 2MLZA 2YWEA 1RBOB 2FGCA 4M5GA 2YNIB 4FYXB 1SJQA 1RACB 5J2PA 4MJKA 2ROEA 4LMZA 2BE2A 5J1PA 1ZM4A 3HFVA 4HEA9 5JUMA 3R2DJ 5HMWA 4DV2J 1VC6A 3HO1A 4P2SA 1YHQS 2QC3A 1RE1B 5A0YB 3CJQA 3J7YU 1OPZA 2XMAA 3A3PB 2NXNA 3SI8A 2BW7A 4ZJLA 1T9UA 1UJ4A 4GVBB 2V2KA 4B9VA 3BGFA 1RI7A 3GP9A 1RISA 2RU3A 3GFHA 2XG8A 1VQMS 1TL5A 3OR2A 2EC2A 2WOMB 5CQGA 5KG0A 1TZ0A 4HACB 3D68A 2DO0A 2WRMA 2G2YA 3GFXA 2KJWA 4OHXA 2M2BA 1N5YB 1N54B 3GB0A 2I1RA 2F65A 4CRJA 5KFBA 1TKXA 3KK1B 2FHJA 4DSJA 2K8GA 4KV8B 3UO0A 2J0SD 2Y8WA 4CNZA 5IT0A 4WP8A 1RHKB 2R8JA 2HURA 3W62A 1VQNS 2C3OA 3M8QA 3MM6A 4M5IA 1QSYA 1T95A 1LWCB 4P9SA 3LW5C 3TANA 2PMWA 4CO4A 1QAJA 3CD6S 1X7VA 1TQLA 5ETLA 2DHXA 4X64F 3FSYA 2JEJA 2OELA 3FEXB 1FX2A 3IRXA 2AYEA 2GGPA 2RVJA 5FIIA 1IJFB 5CA5A 3OR2B 5LSOA 2XZWA 2P6SA 1U1PA 5B0EA 1RADB 1RAJA 3T6BA 4ENOA 1L3KA 5D3GA 4QIWD 4CO2A 3DU5A 2DH8A 2BANA 1G2EA 2VPZB 3H5YA 1Z2LA 2BQRA 1B64A 1RT5B 3PW7A 4V1Ak 4AFFA 1S12A 3MMAA 1FKPA 4DCPB 4ES1A 3BSNA 4LF9J 1YX2A 1URNA 1VQOS 4KFBB 2ZH4A 3PW5A 3BSOA 4MFBB 3RRGA 2G0IA 4ILMA 3OD2A 5K8OA 1IBKJ 2CZ4A 2M52A 2YPZA 4DR1F 2NYIA 1VQLS 5F8NA 4OI4A 5C42B 3ULHA 3KKFA 2XZDB 4MYUA 4PYDA 4WIIA 5KFSA 5AE1A 2PI5A 1QTNB 1X4CA 3IGNA 2RDIA 3MM5A 1C1CA 1R0BG 2HPUA 2V2VA 2WB1D 5GAEI 1UVKA 4WXWA 4YUDA 1E6VB 1T3OA 5KT2A 2VOOA 2XYHB 4W98A 2R42A 4Y2AA 4USMA 3JYTB 2J6UA 2DT9A 3MWBA 4RNOA 2UUCJ 1NM2A 3CCLS 2GAHC 2PDAA 3B4MA 1NO8A 3AOCA 4USJC 2JSXA 2YWWA 1XQIA 3H40A 2MDAA 3Q8SB 5KT6A 3P45B 5CZVA 1P8GA 2XMVA 3EDRB 1RDRA 4F0KA 2RQCA 2HSEB 4TU9A 3MPVA 5HVFA 2XI2A 3H4DA 4FP9A 1Q79A 4LF8F 2QZ8A 2RH3A 3ENAA 4U7UK 3R2CJ 1RAEB 2E1AA 4RR5A 5B0FA 2IM2A 4LF9F 3KLHA 4DL0C 3ISND 5KOWA 2N3OA 3M2VB 3BR9A 1OS5A 3CVKA 3IS9B 3K5PA 4OHWA 2UV8A 1JLEA 3D5MA 3ZZZA 3PJ9A 4KV8A 3S8SA 4TY9A 2V9WA 3HCXA 3LWLA 3RB6A 2HNYB 5FD1A 3WC0A 1SL1A 4EYHB 1LKZA 1IR0A 2E5LJ 3L9ZA 4EU0A 2NUUG 2XS2A 3MM7B 5ETRA 1HWKA 4UOHA 2FUG9 5D6GA 5I42B 4YY3J 5KFMA 5HJXA 2BOAA 4ZVQB 3TA1A 3ZFVA 2COLA 1YJRA 3FMBA 2HBQB 2PT0A 1NBEB 4XTTA 2APOA 4DWIA 2MLYA 3J7A1 4B3OA 2C3YA 1PJ6A 2A0FB 3CDAA 1SB6A 3A8IA 2IC3B 1NLKL 3M6XA 3P8BB 5ETSA 4DV5J 4M5NA 4NZ7A 2D3OR 3D54A 2BRKA 1YZ6A 3FBFA 1TKTB 3GTYX 3NWGA 5IWAJ 1RT5A 2QFIA 1S0NA 2HNDB 1OSDA 3DYAB 4EI2A 3OJSA 2MYFA 2WK4A 3SQGA 4AL7A 3K59A 1VQ9S 4FXDA 4CLLA 1JJ4A 2E1PA 4CT8A 4CCHA 1B70B 2DNNA 2QLBB 4L76A 1RWVB 2QLJB 3HSZA 3LGNA 4P73A 2R8GA 3DOKA 1EKRA 4GO5X 1JXEA 2E9ZA 3MR3A 1DLOA 3UQSA 2KG1A 3AHPA 3H8YA 3GV7B 1FD2A 1T9XA 2V67A 3RBDA 2C22A 3TA0A 1CC7A 1VHFA 2V5HG 3I4HX 3W5ZA 2KM8C 1S79A 4OZ1A 4USIA 2BJ7A 3JAMU 2X1BA 4DL5A 3SSRA 3UCUP 1I5OB 2OPQB 4E8UA 2MKIA 2XGPA 2YQ3A 3AJDA 2OJ3A 4ZVPB 4JI2J 3UD3P 2CPYA 2QA4G 1TL1B 3I0RA 3NGRA 3EVOA 3GSIA 1BC6A 1CJUB 2N3LA 4JUZA 4DV3J 2B9XA 2AW0A 4I2QA 4P75A 4DSLA 2CPXA 5ETPA 4NLQA 4YR3A 3MMCB 1VS3A 3G2XA 1YJUA 3I31A 3JXOA 4ANEA 3MFHA 3K5LA 5DM7Q 3F41A 3TVKA 4C9DA 3MD1A 3TEGA 4F8RA 3SIPB 2ASYA 3JSMA 2R2TA 4I4BA 1RTJB 2RDDA 2YPYA 3HHEA 2LQ8A 4KGMA 2KU7A 5A8KB 4DS4A 3EM1A 3UN3A 4F02A 2HS0A 2FLLA 2CRLA 4HR2A 1K0VA 3BDEA 5T7LB 4YMEA 1F3FA 4JV5J 1KFSA 4MKVA 2B6AB 2HQCA 3MEEA 2R9LA 1KBRA 1VDHA 1Y5LB 2ZITA 1RA7A 1ZOTA 3CE8A 3CB4A 3PTWA 1H74A 3TJ8A 2UP1A 3QRRA 2VQFF 1X0FA 1HWUA 1LWFA 4LF4F 1HWLA 1OQ6A 2ZDOA 2ZH1A 3OHBA 4X65J 1VIXA 4RKUC 2G2ZA 4CIOA 2MKSA 2V0NA 5E7OB 3RAMA 4ZP8A 5F8HA 2ZJRQ 1ITPA 1BQNA 3D0IE 4Q44A 1KVJA 2YKMA 3LUYA 4J7CA 3NOCA 5E33A 1RT3A 2NXEA 4OYOA 3WX8A 1RCXB 4A48A 2L41A 1MROA 2HLTA 1HIYA 1U8WA 1ZPVA 1LXNA 3GJRB 2EVZA 3NL0A 3FSXA 3VV2B 3BPSP 4UW2A 2C2NA 3H5SA 3PX6A 1WOPA 1GXTA 2R7QA 3Q8VA 4OV6A 3MMAB 3BO2A 1W26A 3FNNA 4PAAA 1TMJA 1U02A 2EW9A 4KYZA 4PG8A 2YKQA 2DKOB 5HATA 3IRXB 3VGVA 2HHHF 3TAMA 2U1AA 2IVYA 3DOKB 1NH7A 1H6KX 2W9BB 4ER8A 3DRRB 5GAGU 4HTJA 5A76A 3DDIA 2V8PA 1ZBTA 1QY7A 2W8LA 1MN7A 5J2NB 4UT4A 4YY3F 4LRAA 4MYTA 5HROB 4RZRA 3P5BP 4WKYA 3HI9A 4JOUA 3IRWP 2RT3A 5HSPA 4WTYA 4TN2A 1R7IA 3OQ2A 1RBAA 4CO0A 3K8WA 4I6WA 3CT9A 4NLDA 1WOOA 2DCUB 4PG5A 4Y2IA 2A1BA 2CQ3A 2M8HA 2PEBA 3OTCA 1NH8A 3TAMB 1GH8A 3GIMA 3VGTA 5KFPA 3N79A 4WFAQ 2HZAA 4FS2A 2HVHA 1KTQA 1D3WA 4FYWB 1M1KT 1WC0A 3U7JA 1GX6A 3M2VA 4PKDB 5RUBA 3WIUA 2IDEA 4O0NA 1BQXA 4LBHA 5BJRA 1N8RT 2C2KB 2RUGA 3LOUA 5FDLA 3TNVA 4G65A 5EGYA 2HNYA 3KJVA 1GAOA 4FNHA 3GR0A 4RL1A 3SYZA 1EQ0A 5HLFB 2KXHA 2ZE2B 2CQGA 1WD6A 2HWHA 3I56S 3LF0A 3PVXA 2VICA 3PJWA 5J1NA 4X66F 5DG7A 1HNWJ 1VCTA 1LW0B 3NEKA 4P2FA 3SSQA 3J7YI 1KTVA 2XMMA 4J9KA 5L46A 2CQBA 1QAIA 2MZSA 2UUCF 1KP6A 4IH6A 2DRAA 1XWLA 4A8OA 5IT4A 1S57A 4ZLPA 2J8SA 2XYPB 4PG7A 2WSFC 3OFFA 4AD6A 3I5BA 3ZTPA 5K8PA 1VQPS 2B7BB 2GCFA 3AB4B 4PXDA 4CO3A 3FK4A 4ZP9A 4DLGA 1PYSB 1RSCA 1HBUB 3U02A 1SKUB 4KGVB 5IOLA 4FXWA 1AW0A 4QR0A 2B4VA 3RBEA 1FERA 1RT2A 2K2PA 2W2MP 4OZLA 2DO4A 5KFGA 1N5VA 5EWEA 4A8MP 5L39A 4DV1J 1N36F 4K4UA 2HRTA 2YVSA 2M9KA 4LFBJ 3HHKA 3DOMA 2YWKA 3RBXA 4AQYJ 4DFPA 4E98A 4NLVA 4OHYA 2YY3A 2V69A 3VQSA 1VFJA 2CJQA 2NZCA 2R7OA 4Q2MA 3PYDA 3CSKA 3GE9A 4F26A 4H4OA 4N56A 3D7SB 3PDNA 1DLOB 1HQEB 2PC6A 2YX1A 3AODA 1JLCA 4ZS6A 5LMUF 3HSJA 1K1QA 2JFDA 3TVZA 4OLOA 2XI3A 2GQQA 2I38A 2B7CB 2FVQA 4I64A 2HGMA 1FRXA 3HM9A 4I2QB 1HPZB 4DI6A 2H5EA 3DN9A 2K3KA 5CAAA 2MQMA 3VZIA 1T8EA 2ALYB 3SFUA 1U1MA 2KFZA 5HMXA 1FE4A 2OPPB 4NZ6A 4RWXA 4ED1A 4I56A 2JVOA 1KQSR 1X0PA 1QE1A 4IDKA 3M2UB 4BLGA 3K5NA 3HFKA 3L09A 2JC1A 1JWWA 2HLUA 1WORA 3QJJA 3QWPA 4WTOB 1RLDA 2W7OA 2FIUA 2HQFA 5IV4A 2KN4A 1MG7A 1FJCA 4AE5A 3M1VA 2MQOA 4B3SF 4RNFA 1RT4A 4L72B 2MHNA 1HYSB 1KS2A 3LAMA 2ZH6A 2YNGA 3W7BA 3GG0A 1N88A 1GQEA 3G6VA 4ECZA 4KHRA 2RF2B 3UN5A 2JZ5A 3X3UA 4TY8A 3RRHA 2OPRA 3RGIA 2UU9J 2DHHA 2UUBJ 3HMJG 1JLFA 1HWJA 1ICEB 3BN7A 3K89A 4CM0A 2JFKA 1V5IB 3JTPA 1BQNB 2LXUA 2QE5A 5K5MA 4B3OB 2IYIA 3WHIA 2F7VA 3UD5A 4NEYA 2FY8A 2FJDB 5CH7B 3W9HA 2FJEB 3R6GB 1P9YA 3C16A 2IMWP 3KHLA 2JEFA 2AJ2A 2KDOA 2MSTA 1A0OB 4KRWA 4RJVA 4CDIA 1VISA 3JAMY 2QRRA 2ZWPA 1SL0A 4F50A 1D8YA 4QWAA 1JKHB 5DQGA 3KUGA 4K4YA 3PFEA 4U8YA 3A1YG 2LECA 3KLGB 3G82A 3CCSS 2Z57B 2AEFA 1NPPA 3DMJA 5E3QA 1IKYB 1KQGB 4Q45A 1WKJA 2RKIB 1F2HA 1RWPB 3HT0A 4DJBA 1PBUA 1UFLA 3UFCX 4DR2J 1BQMA 1RKIA 2LA6A 5F8MA 2X1AA 3BYPA 3PFOA 4RW4A 2RRAA 4B9NA 1M1HA 3DOLB 1Y5NB 4L75A 1Q0NA 4O3SA 1N52B 3UVJB 1TL1A 3I0RB 5GADU 3GIKA 4CH1A 3VQTA 3OJUA 1FKOA 3G6YA 4YS2A 1SPBP 2JDJA 2LQ5A 3MMCA 4WFZA 5A8RA 3LTOA 2W7AA 3QSIA 1LXJA 2XMUA 3U1LA 3PW2A 1UA0A 1UETA 2BRLA 3T1YJ 3ENWA 1BLUA 1Q7YT 1LQ9A 4QW8A 1UZHA 4X62F 5D78A 1GK8A 4N8NA 5F0UA 3BBCA 4QPXA 3IG1B 1EZZB 3GIIA 2DIUA 2CQ1A 3IMQJ 1XEZA 2CZVC 3NLCA 4LSLA 2XCPA 2D41A 1ZZFA 4KBIA 2IM0A 3BKTA 1Z1ZA 2LFVA 4ED3A 4U95A 1JJ2R 2EFPA 1KVIA 4LVOP 2RQMA 3VCDA 1FA0A 1S9EB 3WIVA 5M2PA 4DV0F 4C48A 1HFEL 3ZC4A 4A46A 4O0IA 3PO4A 1Q8KA 4L73A 2DYAA 4H4KC 2J7KA 4OLPA 4DZDA 4ZN3A 3KK3B 4JV5F 1AFJA 3KJFB 3W3SA 4RW8A 4WFNQ 2Q66A 2AT1B 2HQ3A 2PSZA 1HMVB 3NCPA 3FC9A 5EHHA 4IR1A 1AROP 2YKAA 1SBRA 3A3OB 3O2IA 2QTWA 4RUHA 4ZK7M 3GV8B 3GQCA 2ZJQQ 2EG1A 4WPAA 3M9MB 4PXEA 5E5NA 1QSLA 4TLQA 4TQSA 3MECA 1CC8A 1NZ8A 1WC4A 1VOMA 3DGPB 1Y3KA 1IKXA 2LCWA 1S1WB 2Z0GA 2MQLA 2VB6A 5KFLA 1S0OA 2CQ2A 2QJ3A 3R27A 2OMOA 4EFAC 1VQYA 3QT6A 1BE4A 3NOGA 5IC4B 3PO5A 3HZGA 4OYIA 4C6AA 3LP0B 2W2PP 1JLEB 1DARA 1CBKA 2Q79A 2YH0A 3CJ3A 5KG6A 5H9EK 1FNXH 2DXDA 1L3SA 3TZZA 2GVZB 4J9RA 2DXEA 1FFGB 4QIGA 1NPRA 2IBKA 1RAHB 2CNLB 3UNYA 2M0GB 4JYAJ 1MU2B 4OZJA 3BREA 1C1BB 3FEYB 5CD4H 3H98A 3WC2A 1UEUA 3W2WB 2O67A 4EZ9A 2G2OA 1H0HB 1Y10A 1AZSB 2BVZA 3DI6B 4IKAA 2HBZB 5KG2A 4TVAB 2ZZMA 4QIFA 4RW7B 4N47A 2B9WA 2L9WA 1NB7A 1SQFA 2M4MA 2WSEC 3DM2B 4KIAA 1HNZJ 1T94A 2OAUA 2ZM6J 3NS6A 2Z58B 4ZA1A 5HQMA 3HK2A 2MZTA 1VRUA 4DUZJ 1PG5B 4DPOA 4LFAJ 5LL6d 2MKCA 2BJEA 3QMQA 1BY9A 4H4OB 2NSBA 3HP6A 1SKSA 1S0MA 2XMKA 2VG6A 4V19X 1F5BA 2W4PA 5AT1B 4PUOB 3OVSA 2IPOB 1F60B 1VQSA 1YRTA 2JLFA 3K57A 2N7YA 1KLMB 2JHEA 3DFEA 4JV1A 4RBUA 1XNRJ 4G1IA 2D1CA 2IY5B 1FHTA 2DNYA 3M32A 4F4ZA 2G0JA 3QIPA 2DR9A 3AA8A 3IC1A 4BWMA 5A8WB 4JI5J 1KNZA 2BANB 4MK7A 1RZMA 4X4PA 4ELTA 5HN0A 5AXNA 1QJHA 2F5GA 2IRXA 2MEWA 1LW0A 2Z2ZA 2VC0A 1T9VA 3NG8A 4PG6A 5T41A 3US5A 2LLZA 5KFNA 3QZ7A 3DLJA 3OPKA 3GJQB 3SDEA 2ASLA 1ZM3A 1IBCB 2BZ2A 3MCOA 3F0NA 3KHGA 2V8VA 5C42A 1N6QA 2LQ9A 4P52A 2VFUA 4QQBA 3DGPA 1HNZF 2BE9B 3TX8A 2FJBB 3BS9A 1C1CB 3IFEA 3Q0AA 3PX0A 2JOQA 3AY0A 4PPZA 4F3QA 4TU8A 3FVYA 4CYUA 2Y8YA 1DBDA 3MZIA 1N32J 3MEGB 1NHVA 2DD8S 4TY8B 2CJKA 1OYEA 5KFXA 1X9WA 3TUPA 1I94J 1REGX 3GCXP 2OI2A 3SZ2A 4X62J 1VRTB 1X31C 3IWXA 3RG6A 2CPIA 3CNQP 3KLGA 2B51A 3KMSA 1PILA 4P72A 1XJWB 1FX4A 2O1PA 2W9CA 2CNNB 2EK6A 5KG1A 3D9BA 1ZA1B 4DPXA 5I3QA 5E41A 5D4OA 1IBKF 3O3LA 1Q81T 1VQ6S 1UWBB 3K7RA 3NMRA 2UUBF 2CJ9A 1PYTA 1NSQA 2KRBA 3SBMA 2KRRA 5KFDA 1TKXB 3NNCA 1G4CA 3QLHB 2PFDA 1RTZA 2MKYA 3VR1A 3TAPA 4ED5A 4KHPJ 2D7SA 4DPYA 1YWXA 1WOSA 4NA3A 2BJ8A 2ATLA 1T9WA 2FZCB 3T5HA 1YJWS 2BMBA 2I0XA 2X51A 1T05B 4F2RA 3FCHA 1I51B 1GMWA 2XHCA 4I68A 3SXLA 2UVUA 1JLCB 3HPOA 1JX4A 3WQPA 2HQDA 1T0TV 3MR5A 4ECXA 3TZXA 3QJPA 2BKPA 1RTHB 1L5UA 4K4ZA 4RUCA 1U6ZA 3PY8A 1M5OC 2MMYA 2LVWA 3MPWA 5HJYA 3I9V9 3UDEA 3OV7A 1IR1A 4DFJA 3G6ES 4DQIA 2GVDA 2DGWA 2HHHJ 1KHVA 3RR7A 2WONB 1O0PA 2FDNA 5F9LA 4XIUA 2V9KA 4HHUA 2CZ9A 1UPPA 3KJNB 2HFVA 4IDKB 4OI3A 3PRBA 1SV5A 2BXJA 1J5EF 1G6BA 3QGIA 1WTBA 5DO2A 1RA6A 1S9GA 4QJVA 1K73T 2K7JA 2GX8A 4F0HA 2RQ4A 3LP2B 2ZKUA 4ID5A 1XK8A 4OJ1A 1UAWA 2GAGC 2D3UA 4RNNA 3AJ1A 3OLBA 2KM8B 4GKJJ 4RW9B 5ITHA 3PKMA 5F8LA 4RO0A 3FZBA 4XPEA 2E29A 3H2VE 3UDLA 4YB6A 2KXNB 1RWXB 4X84A 3KLFA 3LGHA 3N5FA 2I5JB 2Y1RI 4NMLA 4DV2F 1R0AA 4C8LA 1BGXT 2YNHA 3E01A 3OTBA 3BKUA 4YN3B 1W2BR 1N56A 2MY7A 5CYMA 4PQUA 1MN9A 3NCQA 4NOHA 2XLJA 1C1BA 4O3OA 3BO4A 5HMYA 2OH2A 1Q8IA 1Q82T 3ETOA 2NR0A 5F8GA 1FRMA 2W2QP 4F4WA 2R7SA 4W4MA 1NZAA 1U6FA 3H2LA 2NPIA 4ELUA 5A6WA 1RTDA 2J0WA 2HGLA 1FE0A 2M5YA 2DCLA 3MM8B 3B78A 5DRKA 2AGOA 1NJXA 3C2PA 2NQPA 4TLRA 2U2FA 3HHLD 4LSZB 4OQJA 1FKPB 1YTYA 3M8RA 2OHDA 4ETXA 2Q43A 4KPCA 2J0QD 1JLAB 1UEVA 2MZQA 2F9DA 3EJMA 1F1BB 2BW2A 5EN1A 3ZZOA 4OJHA 1HW9A 1L3VA 4OX6A 5I42A 2P9CA 3I9ZA 3AJ2A 4DN9A 4Y28C 2GHWA 2FJAB 2HZVA 2CKWA 1FDNA 3ILJA 4DV1F 3PV8A 3JSYA 3NGTA 1HQEA 1AXQA 2R7WA 3C15A 2BM1A 1KKHA 1LFPA 2RDJA 3IR7B 1RB0A 2UVRA 5E3CA 3IAS9 2ZD1A 2V4QA 2MPUA 2O5DA 2NSCA 2J6SA 2D69A 4G1PA 3RBZA 3DHXA 5ETOA 3MD3A 2ATCB 1Y7PA 4F4XA 1H73A 1M5HA 2C2OB 2Z2LA 2YNHB 3B82A 4R5PB 2UVVA 1SKWA 5CYQA 3UW1A 4YB5A 4F7VA 3V81B 3MI7X 4MAKA 4RNHA 2P8IA 2OD6A 4N41A 2WBMA 1AFIA 1E6YB 4HTIA 2PIIA 2FHKA 2QV6A 5J1EB 1AYEA 1N48A 3PM9A 4YHHJ 3FGVA 2KZMA 1RTDB 2XWYA 1PAUB 1RWKB 4ECYA 4EMDA 3MEDB 4IRDA 5D0HA 1HBOA 3E2EA 4K59A 3CCRS 4A8SA 4GO7X 4P71A 1XN9A 4LF6J 4ED6A 4ANDA 1B3TA 3DNCA 5CXTA 3GJSB 5KFQA 4EBDA 4FNIA 2DGQA 4UZCA 1Q95G 1WC3A 2HGNA 2DGTA 4CLFA 4U96A 2M7SA 3V81A 3OL9A 1R3NA 1R31A 4NLTA 4OYAA 5KG4A 5C2GA 4CLUA 2MTLA 4LRBA 4M5LA 4OZ3A 2ERRA 2VF3A 2VL1A 4ZPWR 2KFNA 2R2SA 4KSEB 2E7VA 2QMUB 3QAUA 4NPOA 3V6HA 4NA1A 4LF8J 4A8YA 1FVSA 3HHLB 3EGNA 1NCLA 4R8UA 1VQ5S 1HWIA 2EPIA 4BDPA 1TELA 2AEMA 3CEDA 1RXOB 1S48A 3EVWA 4C8KA 2ZFHA 4WK1A 2PE8A 4DL7A 1J5EJ 4I67A 1CQNA 1I1GA 1JLGB 1WHYA 1S97A 3HX9A 2C2MB 1VIOA 2XSFA 1S1UA 4MFBA 4TXSA 1CJVB 3TWZA 5LXRA 2L3MA 4DV0J 4JI1F 2J76E 4YHHF 4J9MA 3MTJA 1MU2A 4DF4A 1S7HA 1N34J 4JI3J 1HHSA 2HZCA 2ZNYA 3MEKA 2ZM6F 2HMIB 1EETB 1Q5VA 2ZBRA 2QA1A 3HULA 2XCAA 2HAFA 3TJ9A 1NSAA 1U49A 1WTFA 4FXVA 2F4VF 1HNVA 3CD5A 2R7XA 2WVFA 2HRUA 1SH2A 3CJ2A 2A2CA 4I6YA 4RW9A 2X1GA 3EUNA 4ZVOB 7AT1B 2PFFB 1FWPA 2G1HA 3BN4A 4WU3A 2IAJB 3S6EA 3EWGA 4LF2A 3IBFB 4Y0FA 2J9EA 2Q1LA 2ZWOA 3W5XA 3JSBA 1FJGF 3OR1B 1M5SA 4I7FB 1VC5A 4IFVA 2LQBA 3EPGA 1QUPA 2HK3A 2NUHA 5J2MB 4JYAF 3FQLA 1X4FA 3D28A 2IA6A 1HLWA 2BUNA 2ZC4A 5G0RB 1KONA 3J7ZT 1KEKA 4U8VA 1WWHA 4Y6IA 4Y34A 1HHQA 2NREA 4ZJQA 4ECUA 2HHSA 2F8HA 3NY0A 3PHTA 1EP4B 4LSNA 1Q86T 3J81U 2Y1LB 3R5DA 5IM0B 2VQFJ 2BDPA 2CQHA 3FBEA 1SJ3P 3J7AN 4M5JA 5J1EA 1IN0A 1T11A 3IN5A 2CQ4A 2DRDA 5KT4A 2PGCA 3C3LA 1KLNA 4FF4A 5A0YA 4ERDA 3FBBA 4DX6A 3KTQA 4ED4A 3CC2S 2FJVA 4IG3B 5HANA 3DHWC 4NCAA 1JNZB 1SI9A 2AKWB 3KDNA 3OR1A 5KFYA 5B0BA 1DURA 2BJ1A 3LP1A 3G8TA 4ECQA 1NKCA 2VD3A 1S77D 4XK8C 2F8EX 2QMXA 1UZDA 1RP5A 2AJ4A 1I94F 4NYZA 2FZGB 1TV6B 1BWVA 4JV2A 2CVIA 3DLKB 2VKZG 1V6HA 1ZPWX 4R0JA 4BC7A 1UVMA 3MGJA 3HT3A 4DV3F 2HWTA 3JTNA 4FVMA 2M8DB 3ZZYA 1MROB 1RT1B 3PZPA 3MEGA 4AXJA 3IS9A 2PA3A 3CJSA 5HMZA 1UMJA 4WZMA 1CS4A 1XMOJ 4FYDA 1JLGA 5BXIA 1HKAA 4I7FA 1F9HA 3HF5A 4BHQA 1FDBA 1C0UA 2LKZA 2F1FA 3M9OB 2XTJP 2R7RA 1JXVA 1GT8A 5GAEU 2BABA 2PI4A 1MWYA 2HNZA 2MJUA 3R5GA 5AE3A 2LEPA 3K5OA 2CJAA 4DQRA 4FN5A 2HHTA 1LWEA 2LEBA 2YX7A 3AQPA 3OXFA 1RABB 1TL7B 5KFUA 2IVMA 3J7Z5 4HH0A 2VJVA 1T7PA 4EBEA 4W92B 3C14B 2NCKL 2GMLA 3GG1A 3MCNA 4LRDA 4Y2CA 3HHLA 4R8UB 4K50A 2MQ8A 5IV3A 4C3MA 5AJ3F 3DRSA 1UTAA 2DEIA 4NLGA 3NBPA 1F3VA 3CO9A 1R8CA 4KH1B 2FGOA 3A8JA 2A3JA 4X4UA 3MCMA 2AYMA 2KVIA 2A18A 2M70A 4E2FB 1ULRA 2V6AA 4C8ZA 3IA0A 2CQCA 2BJDA 1EQMA 1V3SA 1VR6A 2D3ZA 2G9OA 2BJ3A 3IO1A 2XQCA 1U1QA 1IKYA 1FEHA 5IC6B 1E6YA 3T19A 4IOBA 4PZVA 3G96A 2EG2A 3IAM9 1EIYB 1OPIA 2OLWA 3U27A 2VG6B 5ADZA 5A2QU 3KG0A 3CMES 3ETMA 3OTEA 2RAQA 1FRKA 2B5JA 3UI3A 3KLVA 2XLKA 1AZSA 2P9GA 3NGSA 4ALZA 5GVQA 3BGRB 5MAOA 4WBFA 1DQ9A 2ASJA 1K47A 1NMEB 3FJ2A 2XNQA 2R3VA 4YQWA 1NSPA 4DEZA 2KT2A 3CD0A 2XULA 5DG9A 3GLJA 3PRVA 1RYRA 4LREA 2LMIA 4B3TJ 1PO6A 1TKDA 2EKYA 3VGSA 3R5BA 4ICLA 1VRQC 1QE1B 3ZZ0A 3N28A 3CXCR 2WOMA 3TVYA 4RU2A 1GX5A 1RCOB 1S1VB 2VDHA 1RT1A 4DOZA 1U1OA 2Y0SD 1WI6A 1M0SA 2FVSA 4LBPA 3BH7B 3LGMA 2OEJA 2RJZA 3D6MB 4GKKF 4AL5A 2LP4A 4U9RA 2OO4A 3L95X 5C5JA 3LANA 2Z4PA 3THTA 4Q5VA 3FFIA 5L1LA 1VBXA 4DR2F 3GJTB 5DG8A 1XNRF 1AUDA 4J9SA 1F2GA 1TUVA 3H0PA 4O44B 2RILA 4WCEQ 2VKRA 1Q4RA 2WVBA 3FUYA 3HVRA 1EETA 2FC8A 4HI2A 4HI1A 3J80U 3MECB 2HMIA 5EX3A 4M1KA 1YJNS 4KGKA 3H90A 3QGGA 4OHVA 3TW0A 2BQUA 1UVLA 4H4MB 3BQ0A 3V6JA 1UJ6A 5K9FA 2UZAA 3EZOA 4ZOSA 1UFKA 2YNGB 3I96A 2HVDA 4HL9A 8RUCA 2LU2A 4WZQA 1WDDA
chains in the Genus database with same CATH topology
2X3GA 2ZH2A 1NNDA 3BM7A 1XERA 4C7QA 1QVGR 1X5TA 3BQ1A 2Q3PA 1G7CB 2L9DA 5KFCA 3E51A 4TQRA 2VFRA 1H38A 1D0EA 1WF2A 2M3DA 2HW3A 5JJBA 5LJ5Y 1HNXF 3V5RA 4FPRA 4KAIA 2E66A 5HLFA 1HBOB 1A6LA 1RQ0A 3M6UA 4B17A 1N4LA 3HXMA 1M90T 5LT5A 3CULA 3HDSA 2IMOA 4A8KA 2LA4A 5DJBA 5CHCB 4DL3A 1C2PA 2KHCA 4NLUA 4J5OA 2YNFA 3CJ4A 3R3TA 4DV5F 2WCXA 3X1LB 4DR3F 1W25A 1BD6A 1RTJA 5AXKA 1KD1T 3NAIA 4PPDA 1SC6A 2OTLS 2BV3A 2XS2A 2C2RA 4Y00A 2J9DA 3K0JA 4KJIA 3UPFA 4C11A 1X4EA 2DB1A 4IG0A 1S0NA 3HVAA 2MZ1A 3I55S 3VAKA 1RTHA 2JJ4D 3VF0B 4U6PA 2XNRA 2AGQA 1HHTP 4OFZA 3OFHA 6FD1A 1S6QB 3I4PA 3SCIE 5EWGA 2IHR1 2ZKTA 4DBQA 3EZ5A 2PD1A 2OMLA 3C6TB 3H20A 1WG1A 4MK8A 3NCRA 4LQ3A 3V4IB 4ED8A 4DN0A 2OPPA 5EDWA 3BO3A 3LALA 1NK0A 4W90B 1VQ8S 2V94A 3H4BA 1PSDA 3U1NA 3F73A 3C6UA 2Q6CA 2ZHBA 4LFCF 1O51A 4Y3CA 4DR4F 2ZJPQ 3VWSA 1D1UA 4MKAA 4URQU 4O3NA 4RX6A 1D9DA 4GMKA 4RW6B 1FESA 4C11B 2ILYA 4XAKA 5KG3A 5HQ8A 2QA4S 3KK3A 2OSRA 2YWGA 4ED0A 1WEZA 1U25A 4QWCA 4PXCA 3TOQA 1H2UX 2QLXA 2YKMB 2WBRA 3LPYA 4OV1A 3T5LA 4ZPDA 1ROFA 3LAKA 4HT7A 4ECVA 4QWEA 2MZRA 3P5TL 5KFIA 4ZMMA 2PEHA 4NWBA 1Q8LA 4J9NA 4TNOA 4WFYA 5FLXY 3RB0A 4DWIA 2KT3A 3PR4A 5H1SV 1JK9B 1WHVA 3PXGa 3GSDA 2DK2A 1RT4B 2R4FA 4ECTA 4YP3A 4I2PA 5J2MA 4DF8A 2FHOB 4MIAA 3KWMA 3O5TB 3DLGA 3OBIA 4KO0B 1VK3A 5L1JA 3T3FA 2ILZA 1NK8A 2FC9A 4UQGA 3UR3C 4DSFA 4HDGA 4OHZA 5B7WA 2N4DA 3CDUA 4LFAF 1MMDA 4NCGA 1JLQB 1RT7A 5B09A 3CJ5A 4A8FA 1S49A 2HFZA 1SJFA 3TI0A 1ZETA 2E1CA 1KLMA 3CF5Q 2XB2D 2HFOA 4IRKA 3MEEB 3OUYB 4IR9A 3EGZA 2XMWA 4FF2A 1VJWA 3GYXB 1WF0A 2GNKA 2B3TB 1W2IA 2W4DA 2OKQA 1N0UA 5KT7A 1WACA 1FXLA 3RB4A 3K2YA 3R1LA 1JKHA 1GXUA 2FB0A 5KFFA 5DDOC 2X1FA 1K1SA 2YNFB 4ZPTR 4N5SA 2AX1A 3DLKA 4C8MA 2KG0A 3BJYA 1DTQA 2CQ0A 1FT8A 3UD4P 3QZ8A 3M30A 2LYVA 3MR6A 4PUOA 3BZQA 2C2EA 2DR5A 2CIMA 1Y9OA 3M4XA 3CDEA 3DYAA 4A8QA 3W2VB 2E9TA 2HAIA 4CNYA 2DNQA 4IH5A 3I6PA 4YFUA 1Z4UA 3O8WA 3CJKA 2H9ZA 2XSJB 4NRUA 4KE5A 2ZHOA 4YDDB 4MMOA 3KLEA 1HW8A 4JI5F 1YJVA 1UW4A 3QIDA 2PMZD 2FLPA 1T02A 5DS7A 2QFJA 3FDSA 1URRA 1VGYA 4KR0B 3SV3A 1VQ7S 2YKNA 3CIMA 4HHJA 5GAHI 3Q23A 4DV6F 4TU7A 5DLFA 2JLGA 1Y3JA 4CH0S 2QSWA 5F8IA 2UXBF 1S6UA 4ETZA 2LXFA 3LP0A 2QSFA 1FDDA 3CCES 4RW8B 1P1LA 3K5MA 4YEAA 5KFRA 3ZZRA 4USHA 4QYRA 4X4RA 1N6QB 3RU0A 5KT3A 4LF6F 1R6YA 1A7GE 3M30B 4DL2A 2VV5A 2CPDA 3TARA 2HG4A 3CGIA 3M1VB 3D0GE 4WYLA 1M5KC 2B4OA 4OX8A 2DGSA 4ZHRA 3N9UC 5KFAA 3PKYA 2DITA 2YH1A 1FD8A 2CQDA 4MTPA 5L9XA 4X2BA 3IGVA 2W4CA 2LXIA 4HDHA 4CTAA 1FJ7A 4O3QA 3AQOA 2HS4A 3V4IA 1HI8A 4MK9A 3FQKA 1ZM2A 2V4JA 2QT7A 2Z8QA 2DNRA 4OZNA 1SKRA 3F56A 1HBMB 2AGPA 1S0VA 3MMBA 3PNIA 2I8EA 4WFBQ 1NK9A 4WKRA 3PRDA 5A6PA 3TQ1A 1HI0P 1FDAA 2MJNA 2W7PA 2PMHA 3N6MA 3VAJA 3NS5A 3QIPB 3HHDA 4JI8F 4C0OC 2WONA 2DR8A 3RYLA 3KNGA 4RWWA 4AYBD 2R8IA 2XS5A 1WHWA 4Q7AA 4DV4F 4O4RA 2BA9A 1VK8A 1X4DA 2UV8G 2HHVA 1UL3A 4DQPA 3ZZUA 1UKUA 4F67A 2VZ9A 2B6AA 1MWZA 4QBUA 4OZ0A 1S1TA 3ISNC 2MZJA 3RAXA 1O8BA 2EWHA 5SUHA 3TYTA 5B08A 3RRKA 1JIHA 4WJBA 5M2UA 5E3RA 5KOXA 2VBWA 1UVJA 3O44A 5F0WA 2DR7A 2KKHA 2YKPA 3MM9A 2RRBA 3I0SB 5IWAF 2KTQA 4NL5A 1SJ1A 2IAJA 4OZ5A 4ZDNA 2UXCF 1TKTA 1WEYA 4QWDA 1Q8BA 5DGAA 1UWBA 4IYQA 1NEEA 3BGUA 3B4DA 4NYOA 2VBXA 2ZH7A 3MM8A 5HL7Q 1U1LA 2DBBA 3DC2A 5DQHA 3KK1A 3Q2TC 2KZZA 2F3JA 1ZH5A 4G1QB 2G0CA 2KJVA 3KLIB 3BSCA 4IUFA 2RB7A 4IOCQ 1YQHA 2RSQA 5C24A 4KQZA 3VAMA 3I5AA 2DTJA 4MKBA 4PQUB 1OIAA 3SMZA 4EGLA 1H2TZ 2VPYB 1U6BA 4WU2A 1J5OB 2FLNA 5HROA 3H25A 4IFYA 1T03A 1ZTWA 5HP1A 2AJFE 2JWNA 7FD1A 1Q1KA 4PQAA 4EUVA 1YRUA 3LO3A 5DDRC 1SH3A 2KFYA 4C8OA 1SUQA 4IH7A 1XNQF 4QYZJ 2HHPA 1TR0A 5GAGI 2O01C 5I4MA 1RJJA 3MUMP 3L3CA 1P6TA 1OO0B 3S01A 4DG1B 1X4BA 3QYYA 2DGXA 2RKIA 1H3DA 1GTHA 4DUYF 5J2QB 1DRZA 5K14A 4NX9A 1IBMF 1LW2A 2QA2A 3U1MA 4WK3A 5KT5A 5I3UA 4V19J 1C4CA 5A8KA 3CCUS 1U09A 3KG4A 4B3MF 2RS2A 4HVZA 4U67Q 4I2PB 4OMFG 3V6KA 4ES2A 1YITS 3BR8A 5HBMA 1KOHA 3DDKA 3QO9A 4P7TA 3SCLE 1MSWD 2XS7A 2D74B 1XMQF 2F8MA 2EI5A 1G3OA 2MKHA 5DQIA 4OIXA 2QEXS 1RWUA 3OTOF 2HS3A 3DRPB 4RW4B 2CPZA 2FVCA 1F5CA 4BCAA 5HP1B 2IBOA 5I3UB 1Q7LB 3V6DA 4X4TA 2HVIA 5A2QY 2DRBA 4O4GA 3S7RA 2IYGA 4XDDA 3QAEA 3SSSA 1IBLF 2R7TA 1KN6A 1RT6A 2GIQA 2RIJA 1GNKA 3FZ2A 5L9NA 1U1KA 3O1LA 1JLAA 5EX0A 2QIFA 3D1OA 2AYGA 2GA7A 2N82B 5E2QA 3D2WA 1DZ5A 1TAUA 1HNIA 1NRKA 2HIQA 3DRRA 5KFHA 3KNAA 2F40A 4JI4F 3C66A 1LOUA 3I32A 2O3DA 1KOOA 3O6QA 3SFGA 1HPZA 5D3GB 1N5YA 1A9NB 1HQUA 2DNMA 3PJXA 4JI3F 2E7WA 3MOZA 4C98A 4M94A 1S1UB 1Y00A 3KLIA 3R5CA 4O3PA 5C25A 4R5PA 1RYSA 5IS2A 4RUAA 4Q43A 2EBGA 4CO1A 4EO8A 4URSA 3OSNA 4DUZF 3Q8PB 2K3IA 1P1TA 4TYBA 5CCMA 3DXSX 5KFOA 3BGLA 1HNVB 3NP5A 2WB4A 2MKKA 3PW4A 4A8WA 1FO1A 1IKVB 2AJ0A 2Z2MA 5EWFA 2FJWA 2R7VA 4ZCLA 2PN6A 5HBMB 2IJNA