2G1DA

Solution structure of ribosomal protein s24e from thermoplasma acidophilum
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
b'MDLIIKEKRDNPILKRKEIKYVLKFDSSRTPSREEIKELIAKHEGVDKELVIVDNNKQLTGKHEIEGYTKIYADKPSAMLYEPDYELIRNGLKQKEAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S24e
publication title Solution structure of TA1092, a ribosomal protein S24e from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Ribosome
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g1dA00
4PR6A 1OPIA 1U1KA 1QVGR 2DGTA 3LPYA 2MGZB 4WFAQ 2CQBA 2RQ4A 5BJRA 2RQCA 1PO6A 3B4DA 2MKHA 3CUNA 1VQ7S 2KXNB 1WI6A 1SJQA 3NS5A 3MUMP 2F9DA 1BY9A 2DNRA 2KT5A 3UE2A 2BZ2A 2XS2A 1A7GE 2JWNA 3U1MA 1X4CA 4WKRA 4A8XA 2CQCA 3V4MA 3P6YC 3IRWP 2MQPA 3Q2SC 4CQ1A 1WHYA 4PKDB 1P1TA 1YJNS 1VBZA 4WF9Q 1WEYA 1U1LA 4RU2A 1IQTA 3NS6A 3VALA 4IUFA 2MSSA 4LJMA 1HD0A 2M7SA 2SXLA 2CPFA 2KH9A 3BO3A 1YHQS 1K9MT 3US5A 1YWXA 3CF5Q 2YH1A 2KRRA 1U6BA 3VAJA 2HGLA 2MZRA 2E44A 2HZCA 4P6QA 4CIOA 3BO2A 1WEXA 3P5TL 2MZQA 3UCUP 2KXHA 1SJFA 2CPZA 2LCWA 2RRAA 2J0SD 2GHPA 3NNHA 1VBYA 2YTCA 1N88A 2X1BA 3SDEA 2KG0A 1SJ3P 1R8HA 1PGZA 5MLCV 1VC0A 2DHXA 3OW2R 2LA4A 2OTLS 5LJ3Y 2BOPA 3CC7S 3UD3P 2DH7A 3TO8A 1X0FA 2MMYA 3TYTA 2CPHA 2RVJA 1WG5A 3CC2S 1KD1T 1WEZA 3CMAS 2N7CA 5DETA 3CCES 2CQHA 3G96A 2AYMA 5JVHQ 3EX7B 4LIRA 3UCZP 2F3JA 4Y0FA 1KOOA 3S7RA 2RNEA 1YJWS 5DDQC 3CC4S 1K8AT 2CQ2A 5IQQA 2KXFA 2G1DA 3CMES 1M1KT 2MGZA 3L3CA 2XS7A 2VOOA 2KG1A 4FXVA 2DNMA 3MUTP 2KN4A 3BO4A 1Q7YT 3MD1A 1P27B 5CA5A 4QQBA 3CCQS 1AUDA 2DNHA 2U1AA 3CCRS 1JMTA 1U1NA 1O0PA 4F02A 1VQ6S 1NO8A 3SMZA 3R1HA 2M8DB 2MKKA 1U1PA 1Q86T 4OZ1A 2KI2A 2N82B 3DXBA 3BEGB 4QU7A 2CPEA 2FY1A 1ZZNA 2LKZA 4ZKAA 1S72S 2FHOB 1JJHA 2DNYA 3HI9A 2LEBA 2MZTA 2LMIA 1FXLA 2F9JA 3SXLA 2KFYA 3VAKA 2X1AA 1WF2A 1WHXA 1X4FA 2DHAA 3NMRA 5LXRA 4IOAQ 1U1OA 3VAFA 4W92B 3VF0B 4YB1P 2DK2A 3MI7X 2EK6A 5DDRC 5CXTA 1WELA 3G71S 3CPWR 5GAGU 2N3LA 1X4AA 2HYIB 2AYGA 2ZJPQ 2CQ0A 1VQ5S 4Y00A 2RRBA 1M5PC 2LA6A 2DGVA 1F9FA 2MHNA 2VOPA 2DH9A 2XSFA 4Z2XA 2HGMA 3CCLS 2J8AA 2DNGA 3G8TA 2YKAA 3MURP 4TU9A 2VODA 2DGOA 4V19X 5GVQA 1FNXH 2QA4S 2JX2A 2YH0A 1FT8A 2DITA 2G0CA 1U1MA 3CCSS 3B4MA 1DHMA 2DISA 2CJKA 3NNAA 1YTYA 4UY8T 3LQVA 2MSTA 2DGXA 5D77A 2MY8A 1VQ9S 3CTRA 1VQ8S 2LXUA 3I56S 2V94A 2NLWA 2B0GA 2DNKA 4WFNQ 1N54B 2M0GB 1VQMS 2MKIA 3K0JA 1WTBA 3UWTA 1G2EA 3Q2TC 2LECA 3BS9A 2CQ3A 1VC6A 1KQSR 1A9NB 1D9AA 4UQTA 1FJ7A 2DGWA 4TLQA 2L41A 3D2WA 4U67Q 3HHNB 2U2FA 3J7ZT 4C4WA 2G4BA 2CPDA 2X1FA 2JVOA 2KU7A 4OZ0A 2DIVA 1HD1A 2KHCA 2N3OA 4TU8A 3G8SA 1KOHA 2J76E 5LSLA 1DRZA 2MY7A 2DNZA 3RW7A 3S6EA 4LMZA 2DO0A 2OJ3A 1WF1A 2WBRA 1WG4A 2M9KA 5EN1A 2EK1A 2MQQA 1M90T 3R27A 1X5PA 1X5OA 1H2UX 2LXIA 3UD4P 1WHWA 4PRFA 1VQNS 1FJCA 5GADU 2ERRA 2MQOA 2DGSA 1H2VZ 1R8PA 4F26A 2DO4A 3R1LA 2DGUA 2ZJQQ 2CQPA 2RU3A 1FJEB 3MUVP 1CVJA 5LSOA 3S01A 3CCVS 1WHVA 1WF0A 1NU4A 3TP2A 1X4DA 2CPXA 1KC8T 1M5OC 2RS8A 1X4GA 1UP1A 4J5OA 3ZZZA 5GAEU 2UP1A 3P3DA 4F25A 1QM9A 2DNPA 3CCMS 2M4MA 2E5GA 1YJ9S 4C0OC 2PE8A 2D3OR 3H2VE 1SJRA 1X4EA 1UAWA 4WCEQ 2J0QD 3P49B 1OO0B 2CQIA 2KM8B 3G9CA 5DDOC 1RKJA 1Q81T 1VC5A 2CPJA 5D78A 2CQ4A 1N52B 3VAHA 3EGZA 3MOJB 4CH1A 1JJ4A 2NZ4A 2AD9A 1WI8A 2I38A 5GAHU 3H2UB 2MKJA 2D9OA 2GO9A 2XNRA 1FHTA 1VQLS 4IOCQ 1HA1A 5DM6Q 2MQMA 2PEHA 2DNQA 4WIIA 3FEYB 4TU7A 3G6ES 1RK8A 1YIJS 2MB0B 3VAMA 3N9UC 1X4BA 1ZH5A 2Q79A 2KVIA 5IFMA 2DGQA 3G4SS 2OSQA 2AYBA 1UFWA 2EVZA 1H2TZ 2LEAA 2QFJA 2D9PA 1M5VC 1U6FA 5HO4A 3DLLQ 3NNCA 4ERDA 2L08A 3MD3A 3CCJS 5IM0B 3PIPQ 1SXLA 2M8HA 2FPHX 2ZJRQ 1N8RT 1SJ4P 2VONA 4QPTA 2MZ1A 2LYVA 2X1GA 4EGLA 2K3KA 2E5IA 3S8SA 1YI2S 3IWNC 3ULHA 1JJ2R 3CD6S 4QU6A 2FC9A 2K8GA 5H1SV 3CXCR 3I55S 1DBDA 2O3DA 4ED5A 2DH8A 2JVRA 4FXWA 2MZSA 1OWXA 2M52A 2DHSA 3PIOQ 2MXYA 4IO9Q 2MYFA 5DM7Q 1WWHA 1L3KA 2CPYA 1NJIT 2MKCA 1D8ZA 2MZJA 1ZZFA 2KRBA 3CULA 2XS5A 5LJ5Y 3MDFA 2CQGA 1XN9A 1X5SA 1M5KC 1VBXA 1X5TA 1VQ4S 2OTJS 2E5HA 3FEXB 2HGNA 1S79A 1U1QA 3THTA 3CCUS 1WG1A 2E5JA 1QVFR 2DIUA 5ITHA 3J7YU 2AYEA 1K73T 2OSRA 2DNOA 1VQOS 1W2BR 3MXHP 2MJUA 2MKSA 1H6KX 2MQNA 1OIAA 2XB2D 4CH0S 2HVZA 1X4HA 4C7QA 2MPUA 5LXYA 2M2BA 1Q82T 1DZ5A 2LQ5A 5DDPC 2FC8A 2YWKA 3RW6A 1UW4A 2ADCA 2DHGA 4M5DB 2M88A 5FJ4A 4WFBQ 1YITS 5JVGQ 3VAIA 4W90B 2M70A 3ZZYA 2L9WA 2DB1A 3UCGA 2QEXS 2I2YA 1U2FA 2MQLA 2CPIA 4YOEA 2KM8C 5GMKa 1VQPS 3SDEB 2XNQA 1FO1A 1VQKS 3U1LA 2OIHA 2CQDA 3JB9k 2A3JA 5IM0A 1B7FA 2ADBA 2KYXA 2JRSA 1U1RA 2DNNA 3EGNA 5CYJA 2RT3A 3THPA 2RUGA 5HL7Q 2MJNA 2DNLA 1HL6A 2RS2A 4YUDA 1URNA 3VAGA 2CQ1A 4BS2A
chains in the Genus database with same CATH superfamily
3LPYA 3VV2B 4WFAQ 1FDBA 3VHQA 3GJQB 2BW2A 3W2VA 2RQCA 3CUNA 2X7IA 1BQNA 3Q24A 1A7GE 3QIPA 2GZOA 2NUUG 4ILRA 3SQGA 2H65B 3BKTA 1HBUB 1RTDB 4WF9Q 2ZE2B 3OUYB 4IUFA 4IFYA 2CKWA 2EXUA 4OHWA 4JI6J 1Y11A 2BJDA 5HQLA 1IQZA 4R25A 2OEMA 3MM8B 5ETSA 1VS3A 3QRQA 1N88A 2X1BA 2DJWA 3L7UA 4HHJA 2BOPA 1KFDA 4M5JA 3TYTA 4DV2J 1S4FA 4XTTA 4QJVA 1NK5A 3OSPA 1DQ8A 3MAAB 1KS2A 4J9RA 3O5TB 2VG5B 2QMWA 5GAGI 5HMYA 1XWLA 2FJDB 2K06A 3J80U 6AT1B 4HTIA 1SV5A 2X51A 5K5MA 4GKJJ 2G0IA 4C8ZA 4UF4A 4YY3J 2FY1A 3I4PA 4WU2A 5D3GB 2P9CA 5E0OA 2F9JA 4B3OB 2X3GA 1S12A 3HHDA 5J1NA 3TAQA 4YB1P 2EK6A 4RBTA 1S9GB 2F63A 4C8MA 3HULA 2HHHF 2VDHA 1R0CB 3R6GB 3A8EA 4A8WA 1NK0A 4B9LA 3CCLS 1JJCB 4DJBA 2N4CA 2KVQE 4JI2F 5K14B 3KLFB 5FDLB 3CCSS 2DISA 1BC6A 1YTYA 1FJGJ 4M5HA 2MSTA 3CT9A 3K17A 5F8GA 3QO9A 4F04B 1DTQA 5L9XA 4WFNQ 1G2EA 2JNJA 1S59A 1A9NB 4ECSA 1D9AA 3VZIA 4URSA 4OZ0A 3RBXA 1NCLA 3S1TA 3SSQA 2D1CA 5F9LA 4NASA 1NJZA 4DX5A 4ZMMA 2H54B 4QPXA 3PW4A 1C0UA 2XO6A 4WTYA 3UD4P 1VRUB 4DUZF 1HNIA 3BB5A 4I68A 4G65A 5L38A 2GAHC 5GADU 2HFVA 2W7OA 4FVMA 4P7VA 2Z2LA 3TAMA 4XIUA 3FMWA 4RJVA 4FDFA 5DGAA 1MN9A 1V3ZA 5EGYA 3TP2A 1GNKA 1KC8T 3FCVA 2UP1A 1QM9A 5I3UA 4PG8A 1OO0B 3SV4A 2MDAA 5DGBA 3L7OA 1N52B 2WSCC 2PFDA 3UPFA 4CH1A 4WKYA 4K8RA 5HSPA 2EKYA 2J5AA 1UFWA 1QLNA 5LMNJ 4AL6A 4RWXA 2IYIA 2ZJRQ 2VKRA 1OSDA 2V2KA 4EGLA 1XR7A 4RW9A 4X2BA 3ZTSA 1EQMA 1NMEB 2ASLA 1TL5A 2FC9A 1O51A 1RE1B 1UPPA 1KDNA 2J6TA 1AA1B 4JYAF 4ED5A 2JVRA 2KJVA 4ELTA 1KLMB 1OPZA 2E9RX 1IBLJ 4B9SA 5LJ5Y 4C8NA 1S9EB 2QE5A 2BKPA 4J9LA 1FX2A 4ZVGA 3Q22A 4X65F 1QE1B 2DIUA 3W2WB 5GMEA 3OHBA 3DHXA 1SKUB 5LXYA 1Q78A 3E3XA 3AA9A 1JNRB 4JI4F 1IUJA 5KFUA 1NHKL 4ECTA 1HNXF 3DFEA 4H4KC 1XEZA 4NYPA 4FPRA 4TY9A 4LSZB 1MN7A 2P8IA 3SDEB 3IWXA 5AE2A 1UZDA 3FFIB 4WWSA 4DV5F 4LRFA 4NLPA 3PV8A 4F4KA 4Y28C 1RT5A 2J6SA 3T5KA 3EWGA 4X4QA 4PXDA 2CVEA 2C2DA 3BH6B 3JYTA 3GSDA 5A6PA 4BS2A 3F44A 4OZNA 1GT8A 1N48A 4I2QB 4H4OB 1XNQF 3A4TA 4IG0B 2ZM6J 2BJ7A 3RB0A 3GPAA 3ISND 4BLGA 3T3FA 3SFGA 4ZITA 1P1TA 5HLFA 1PG5B 2H3EB 3OR1B 1U1LA 2IJFA 2CJAA 1R0AA 1YHQS 1W7WA 3US5A 4KRWA 4CLUA 1HWUA 1YWXA 3QRPA 4R0EA 3ETMA 2JSXA 3RZAA 3NNHA 1R8BA 1N36J 4KIAA 5MLCV 4LF6J 2XMMA 4M95A 4RW7B 3DGPA 2H5EA 3GWCA 2ABYA 2W01A 2RVJA 3CC2S 1L3VA 3BR8A 4C0BA 2ZHOA 2Z57B 2CQHA 3WC0A 3VGUA 4DX7A 2QTWA 3AH6A 1XC9A 3BO4A 2QL5B 4ZLLA 4RNMA 4KGZB 1RHMB 3CDAA 3DYAA 3DLJA 2ZH1A 2DNYA 3MEDA 4HT7A 3D3BJ 1XMOJ 3Q8SB 2X1AA 4P9SA 2VDIA 3KJVB 2CADA 4B9VA 4ICLA 3IS9B 3IRXA 4ANCA 2HS3A 2N3LA 5IC6B 1UMJA 3FMBA 1M5PC 4DSFA 2VA3A 2ZH9A 2P2CB 1X0PA 3BGLA 4M63A 3G8TA 4DN0A 2R7TA 4PXCA 4A8FA 2NXJA 4F4ZA 1K1QA 2LQ8A 1JWWA 1HARA 2W1BA 5IV4A 2LXUA 2VPWB 1RTIA 3OXFA 2ATCB 2PO4A 3CO9A 1S4EA 3K0JA 1TK5A 2QMXA 1OYDA 4WP3A 3AQPA 2G13A 5KFFA 4J7CA 4UQTA 4DPOA 5F3ZA 4C48A 1RCXB 1HKAA 4NLTA 5E3PA 3M8PA 4USUA 3AODA 4QWEA 3R6LB 1U0SA 3NL0A 3UDCA 1FWKA 1X5OA 2PEBA 4J90A 5C25A 1K0TA 3TQEA 1VIXA 3PFEA 2HK3A 4ZCKA 1DLOB 3UN5A 5KG5A 3D6HB 3M8QB 2F7VA 2R8IA 2XULA 1BGXT 1KP6A 1QJHA 4CLSA 4ZPBA 1M5OC 4WTOB 2DNPA 2J9DE 1PYTA 1TV6B 4LVOP 5JMNA 1HBMA 2HVIA 3TWZA 2R8JA 3I6PA 1U2RA 5CYMB 2WHOA 1WI8A 5GAHU 4PEOA 3NP5A 2QLWA 4WK1A 2YX1A 3FEYB 1PCAA 2FD2A 4OX8A 1Y4ZB 2OELA 4DS4A 2ZBRA 1PC4A 2UXDF 4F4WA 2WBMA 1B0VA 4JI3J 1U6FA 5HO4A 2FPHX 2V0NA 1SJ4P 1EAYC 5DLFA 2LYVA 2DKOB 1CSJA 4P73A 1XR5A 4LRBA 4FN5A 3H7HB 1QUVA 1YI2S 1ELOA 4JI1F 2XGQA 2YX7A 2XWXA 2HWIA 4CNZA 1HBOB 5THWA 2O3DA 3KMSA 3H0PA 4IRDA 2GCFA 1ZM3A 4IKAA 5C42B 3M32B 1Q4RA 2MKCA 5HI7A 4Y2CA 4NXMJ 1SL2A 1JLAB 3SI8A 1NJXA 2ZBIA 2BACA 4ZCMA 2HGNA 4K4YA 4Y34A 1S9FA 2E5JA 1QVFR 5KFWA 4C8LA 2RDDA 3ILIA 3HLUA 4ED6A 4YB6A 1D09B 3P8BB 5DJBA 3KTQA 3CDWA 2MPUA 2BUNA 2W7PA 4OYPA 4GMKA 3BH7B 5I42A 1UW4A 3MF5A 2Z58B 1RLCL 1UFKA 4ELUA 2V8PA 1Q7LB 4TLRA 4DXLA 3P45B 1PJ5A 1WTFA 1HW8A 1SC3B 2V9WA 4I64A 2HRYA 4FKXA 3P4UB 1T11A 3X3UA 5KFEA 3HHLB 1OPIA 2XG8A 2RQ4A 4MK9A 4DG1B 4Z7YA 2KXNB 1E6VA 4ZP8A 3MMAB 3R7SB 3UE2A 1S99A 2H4YB 1FTRA 2AGOA 3TVZA 1T03B 2MQPA 3Q2SC 2ZD1A 3M9NB 3EE3A 3QQCD 2F40A 3MPWA 1HQUA 3WBZA 1N5VA 2R8HA 1RWPB 2IIHA 4OJGA 4YQWA 3M2UB 5HJXA 1ZETA 4NCAA 4JB8B 3NAHA 2C3MA 5B0BA 3V4IB 2BRLA 2VPZB 1FE0A 3EGVA 2KXHA 4DR7F 3T5JA 4HACB 2B56A 2KG0A 1UW9A 1BE4A 3C6UA 1UVIA 2RQKA 3HSDA 1LW2A 3CC7S 4LF5F 2W2OP 4NA1A 4A4JA 3HX9A 4MMOA 2OD4A 3IM9A 3T19A 2FJXA 1FKPA 1KOOA 5DDQC 3CC4S 4X62F 1N4LA 1Q7YT 1AUDA 3G87A 4DFKA 4E0DA 1IKYB 1JK9B 2M8DB 2HBZB 3CCWA 1NM2A 5I3QA 3VQTA 5LT5A 2LMIA 2VFTA 4CCHA 3C6TA 3C14B 5LXRA 1IKWB 2E5LJ 2DK2A 2WSEC 3JAMU 4X84A 2OLWA 2CQ0A 1BLUA 3QGIA 1CQNA 1SI9A 4TYBA 2W25A 4OHVA 4JV5J 2LFVA 1XMBA 3D28A 5C2CA 5KTQA 5KOWA 2CWKA 3MM7A 3R3TA 1GMWD 2VG6B 1S48A 2C2OB 2OD6A 1HQEA 3N0VA 2GJIA 2V94A 2HS0A 2NLWA 3BKFA 3PEJA 2WW8A 3E51A 1VC6A 5A6WA 4G1QB 4QCLA 1FX4A 6FDRA 4DR1J 3DOKA 3HO1A 3K57A 1FVQA 4L74A 1F0XA 3HHKA 4J9VA 3UVJB 5HK4A 3IXQA 4RL1A 3K5MA 2HSEB 2LXIA 2DVIA 3WIUA 3UQSA 2GIQA 1V6HA 2J7WA 4BBYA 3I4HX 1EKSA 3MEEA 2YNGA 1FNOA 1WF0A 1TL4A 2R8GA 4I0WA 1KQGB 2GJ2A 1XTZA 3BM7A 4DV0J 2M4MA 2C3OA 1EKRA 3D7SB 3MTJA 2OPRB 3NOGA 2YQ0A 2PFFB 4FF2A 2I0XA 3NOCA 1SUQA 2BDPA 4HKQA 2ZWPA 3BGRB 3M2RB 3PO5A 1R89A 2OO4A 2F8EX 4PUOA 1E6YB 4DV2F 3TJ9A 3ISZA 4ZLPA 4DUYJ 1ZH5A 2QRRA 1ACMB 4J9UE 4QW9A 4OI0A 2B4UA 1LWCA 2LQ9A 1MU2B 3DLLQ 2DXDA 5CCLA 3CCJS 2IBKA 5GADI 5ETKA 2W2NP 4GKJF 4CYUB 3LP1B 2C3PA 3OTEA 3JS9A 3HM9A 3CD6S 4YY3F 3PX0A 5K8MA 4PAAA 4JUZA 1YBAA 4HHUA 2IHR1 4CLZA 2GNKA 1OWXA 2ROPA 1CC7A 3OSNA 4NZ7A 3LPEA 4DQSA 3W2VB 3CULA 3D5MA 3KJNB 1BQNB 3GFXA 4ZA1A 1S1WA 4Z7CA 3QIPB 1WD6A 1Q5YA 3SQGB 5E3AA 2HW3A 2DNOA 4EU0A 1WORA 3LANA 4U7UD 4IFYB 2XB2D 4P2XA 4ED2A 2C2NA 3DDIA 4FVCA 4RX6A 3GLJA 1FJGF 2EI5A 3FQKA 5DLGA 4W90B 3NY0A 2IC3A 1MMDA 3TA0A 3PRBA 1QAJA 1CLFA 3FUYA 1C4CA 2RUSA 1FKOA 2FB0A 2MLZA 2A3JA 1RT4A 3KK2A 4LF1A 2DR5A 2EC2A 1CEZA 3HFZB 4HVZA 5KFMA 3G2XA 2UUBJ 3THPA 2MJNA 1X31C 1FWPA 2AEMA 4ANEA 3RRGA 4LUBA 1M1GA 4MKVA 2CQ1A 4JBCA 4B9TA 3JSBA 1TELA 2WRMA 3BN4A 1GTEA 1JXLA 2F9DA 3K5LA 4A8MP 3PJXA 2KT5A 4C0HA 3QT5A 1TMMA 5K8PA 3P6YC 4RWWA 3V2UC 1YJNS 2AJFE 2VFVA 3ELHA 5ETMA 4I69A 3RR8A 4DF4A 5KFBA 3BO3A 3SSSA 1HNZF 3A3NB 3FCHA 3EUNA 3RB3A 1NPKA 2NXEA 2GHVC 1Z4UA 4LF9J 2HZCA 3BQ0A 5ADZA 3DLKA 4B9UA 3KNGA 1V3RA 4QYZJ 2LCWA 2BXJA 2AGPA 3TW0A 3N4WA 1R8HA 4F4XA 3UD3P 1PYOB 1R0BG 1HWJA 1H72C 3QO9B 1C0TB 2QC3A 1DTQB 1MW7A 2VOOA 3GIIA 5KOXA 3CCQS 3CIMA 3O3LA 4DCPB 4NLSA 3SMZA 2IJNA 2ZH3A 2UV8A 1RU1A 4PWDA 2CPEA 1IBLF 1NSKL 1S72S 1UKUA 5HVFA 1SQFA 2LEBA 2KFYA 1X9WA 4EEYA 3L95X 1HNIB 2NYIA 2M3DA 1RT3A 3VF0B 1WC6A 3TAMB 1VQ5S 5E3QA 2RKIA 2Z30B 1BWVA 4CH7A 4Z2XA 5I3UB 1YJTA 4MJKA 3POTA 4ZVUB 4Q7AA 2Q6BA 1RT7A 2J7UA 1TUWA 3CTRA 5D0HA 3KNAA 3G6XA 4TY8A 5F8LA 2RIJA 4MKBA 1TKTA 2BMBA 3LWLA 5CHCB 1U0HA 2ZZNA 2AF6A 4KGXB 2BKNA 2V9KA 2VQFF 2HIQA 2GMHA 2PDAA 4PXBA 1PSDA 4JI5J 2DT9A 5AJ3J 2CIMA 3I0RA 2ZM6F 3NGRA 4RW9B 4G1PA 1H2UX 2B4PA 3RAXA 3OL9A 4DI6A 3DDNA 3G82A 3V6JA 3CJTA 2ASYA 1JXVA 2ZDOA 3V81A 3MUVP 2A6OA 2CZ4A 1X4DA 2HFZA 1HI0P 3PACA 4F25A 4QIVA 2LQBA 2IDLA 3FBEA 2BVZA 3PEHA 4UUWA 3U7JA 3OLAA 5FIIA 5M2PA 4RW4A 1N36F 2BJ3A 5B0CA 4LF6F 4CP5A 2EPIA 3GIMA 1FNMA 2I38A 3H2UB 3DOMB 1J5OA 4DEZA 5J2MB 2DPJA 2PA8D 3OLBA 2Y8YA 2EFGA 1W26A 3GP9A 4LBPA 2YKPA 2QSWA 4Q2MA 2YNHA 1NK8A 3HHEA 1RYRA 2B43A 3GR1A 4ZPTR 1VRTA 3R7BB 3SV3A 2M8HA 1N8RT 2NSBA 2WVFA 2BA9A 4MYTA 4PYAA 1RT5B 3GJRB 5HP1A 5H1SV 4NX9A 3JYTB 1EB0A 5DS7A 2HQGA 3M4XA 2B3TB 1F3FA 1WWHA 3G6YA 2H4WB 1T9UA 4YR0A 3KLGA 4B3SJ 2QL9B 5T7LA 1S79A 5GAHI 5HLFB 1NPPA 2W4PA 2XQCA 1WSVA 3Q89A 1X7VA 1O6XA 4NA2A 1R0AB 1DZ5A 4GC6A 5KFKA 2W7AA 2HHVA 3C2PA 4J9KA 1W2IA 2P6TA 3ZNUA 2XHWA 4LSLA 1SIZA 3OJSA 1HIYA 5LMUJ 4YN3B 3UCGA 3P5BP 5CZVA 4BDPA 3FEZA 2QA4G 3BBCA 2BQUA 2OMLA 3DGPB 2E9TA 3D6TB 1ZTWA 3QIDA 2CG4A 2GAGC 2QFIA 2XBPA 2DGTA 4DPUA 1NJYA 1PO6A 4FF3A 4YHHF 4WYWA 4DUTA 2AKWB 2HLUA 5D4LA 3M8YA 1R7IA 4OI6A 4A8XA 1S6UA 2OFHX 3DYAB 3RJMB 4I6YA 2R7OA 4K50A 1IQTA 1PKUA 3MEDB 2YKNA 1DURA 2V4JA 2Q66A 2PMZD 1VCTA 3MAAA 3SQOP 3CB4A 4ICLB 3IRXB 3KDNA 3NLCA 1RAFB 3CCZA 3UCUP 2Y9HA 2YTCA 3V6HA 1SJ3P 1VISA 2RJZA 2V4QA 3OW2R 1HW9A 2C2KB 4NLUA 3OQ2A 2HRUA 4ZDNA 4JI3F 3G96A 3GV8B 3I9V9 4LIRA 4NRUA 4GC7A 5IWAF 1U25A 3OD2A 1RTIB 1F2GA 2KG1A 1NPRA 3GQCA 2KT2A 1UVJA 1U1NA 1S9GA 1AT1B 1VQ6S 3C19A 4NE9C 3M8PB 3QLHA 3KK1B 2XO7A 3CO0P 4NXMF 3TI0A 1JJHA 1A0OB 3R5DA 2KZZA 2YXLA 1Y5NB 1FXLA 4WP8A 1WHXA 2J9EA 4N56A 5C25B 4K4ZA 2WVDA 5I4MA 3MR3A 2ZUGA 4ZPWR 3N28A 3D0IE 1NEEA 3TUJC 4ECWA 2ZZMA 3H25A 3CPWR 1M1HA 1X4AA 1TUGB 4FBTA 4KJIA 2H5IB 1HBNA 1F9FA 3TNVA 2D7SA 1HBMB 1OQ3A 2DNGA 2FHMA 1P1LA 3M8WA 3MAHA 1ZPWX 4DCOB 2J9CA 3QGGA 1UTAA 1UWAA 2DITA 1RAEB 2CJKA 3QFHA 3LQVA 4ENOA 3R2DJ 3I56S 2C1EB 1SC6A 5KG7A 4ECRA 2VPXB 2DGWA 4ECXA 4TLQA 4YR2A 2U2FA 4TU8A 2XYHB 3ENAA 3S6EA 1J27A 2KTQA 1F9HA 5EN1A 2HVEA 1M90T 4GO7X 2B7CB 2H9ZA 1WHWA 1UL3A 2OMOA 4TKTA 3NBPA 2UZAA 3MTKA 1FD8A 3R1LA 2E1PA 1RHUB 2OI2A 2YKOA 5A8WA 1X4GA 4RNFA 2Q43A 4EO8A 2BANA 2QLFB 4NWBA 1SJRA 4X4TA 4X4SA 1V5IB 5F8IA 3H5YA 3P49B 2CQIA 4MFBA 2OPPA 3NGTA 2CPJA 2MHEA 4K0KJ 3MOJB 3NG8A 2AD9A 4BHQA 3FRYA 1TUVA 2Z0GA 5BYRA 5I42B 4LT6A 1A6LA 3NGSA 1NK6A 3UDLA 3T1HJ 3VAMA 2ILZA 5KFZA 2DD8S 1IBMJ 2DGQA 1S76D 4F7VA 2EVZA 4N76A 1JIHA 2X1GA 4ZPVR 4DUZJ 3J7AN 5D8HB 3LOUA 4U8YA 2BV3A 2OFGX 2NXNA 3I55S 4JV1A 2D74B 4K59A 4QZVB 2IVMA 3JSRA 2XMWA 1E6VB 3T1AA 4H4KA 2E5LF 1XN9A 4JI7J 2FGCA 1M5KC 3N6LA 3MR6A 4C11A 2CRLA 2ZD1B 2QX0A 1YBUA 3PHTA 2MKYA 3BGFA 4ILLA 3MXHP 2MQNA 1NNDA 5D15A 2O01C 2LQ5A 5DDPC 3PR5B 3PY8A 3AT1B 3DRRA 3PFOA 1WKLA 4KH1B 3ZTQA 3OVAA 2DB1A 3NGDA 4HR2A 4ES1A 2ZWOA 2VJVA 4I2QA 2QV6A 2Z56B 3C6UB 2N7YA 3JB9k 1GEHA 3QWUA 3VGVA 1LW2B 4DR1F 3I5BA 1TTHB 2C2ZB 1Q0NA 4FXDA 4QR0A 1NJWA 1T8EA 2V2ZA 1FKPB 2V34A 2V8GA 4CT8A 1HWIA 2AQ4A 5U47A 3GV5B 4IG3B 1BQXA 2AMCB 2DEJA 2JFKA 1WI6A 2XY7A 2DNRA 1T9VA 2PD1A 2XS2A 4MH8A 3DU5A 4DZ6A 2BR0A 3VGSA 4G1IA 1JXEA 1ZA1B 2GFFA 4CQ1A 4JV0A 1ICEB 3MWBA 2GS8A 5E5NA 2FZCB 5HMXA 4DWIA 3MPYA 2B4OA 2NXCA 4I7FA 2YWHA 1K0VA 4ZVRB 2MZQA 4N8NA 1Y0HA 4QBUA 4WIQA 2XZWA 3LAKA 4DUYF 1Y5IB 2C2MB 4CT9A 3MMCA 2QO3A 5I3PA 3MM7B 3GE9A 2GIFA 3OT9A 1HQEB 2F3JA 4X4RA 1Y3JA 3CDBA 1JQGA 3AB4B 2G1DA 2CZ9A 5BYSA 1KVKA 3H5XA 2LDIA 2IVFB 4CM2A 3PTWA 3CMQA 3D54A 5IOLA 5CCMA 5ETTA 4O0NA 3RR7A 3DOKB 1R8AA 2HQCA 2ZVSA 3RTVA 3KHGA 1DARA 2ZH8A 4DDFA 3RBZA 4OLOA 4DL7A 2R7WA 4OYZA 4NA3A 1RADB 2AWZA 3IFEA 3MEGA 5B0EA 2F65A 3SCIE 3MEEB 4GKKJ 2YNGB 1AZSA 4ZP9A 4Y00A 2F8MA 4M5LA 3RRKA 2HGMA 1NSPA 2HNYA 2YKAA 1OJ4A 3B54A 4DV1J 2FLNA 2RDJA 1SUQB 1KQKA 2EEYA 2RU9A 1REVA 1HYSA 5L9NA 4Y2MA 5KFYA 1UA0A 3QYYA 4PUOB 1Y5LB 3N5FA 2A10A 2UUBF 1U8SA 2E1RA 3EPIA 2B9EA 3HP6A 4ZVPB 3FC9A 4ZPCA 3DMJA 3EPGA 1RU2A 4O0IA 3J7ZT 2X1FA 1HD1A 2N3OA 1LWCB 3EVOA 4OI4A 5LSLA 1IJFB 2DNZA 1TV6A 1WF1A 1WG4A 4A8QA 5SUHA 2WZ1A 3TZYA 3QJJA 3D1HA 4NLOA 4LFBF 2D3UA 3BPDA 1SC4B 2MQOA 3B6BA 1H2VZ 2G0JA 2DO4A 4KV8A 4FYWB 2VBZA 3KLIB 4RUHA 2CPXA 2PMWA 4LF9F 1Y3KA 4IDKA 2BKOA 1S1WB 2DXFA 1NXIA 1XNRF 4C0OC 2D3OR 3SIPB 1EETA 3J81Y 3M2VA 2L48A 3IGNA 1RKJA 3LP0A 5LL6d 5D78A 1RUSA 4HH0A 3TA1A 2IDEA 1JJ4A 2YWGA 4YB5A 5DM6Q 3R7NB 1RT2A 1HHSA 4LF8J 3PO4A 1HBOA 1QAYA 1X4BA 3DDKA 5IFMA 2IC3B 1QTNB 5IT9U 3DC2A 4FYDA 1FKOB 4ERDA 2IJRA 1RT4B 4ZK7M 3KK2B 4QPTA 1T02A 2FVRA 4DS5A 4KR0B 3Q8UA 1BUXA 1R6VA 5A2QU 1YLXA 2HLTA 1WDTA 4FXWA 2VC1A 4ZLNA 2MYFA 3ZZRA 4TQRA 4XO0A 1NJIT 2X3DA 1D8ZA 2FJVA 1G4CA 1KN6A 3MM9A 2OPSA 3HSZA 2LXFA 1FXDA 3VWSA 3A12A 2R2RA 4Y6IA 2GGPA 1Q8BA 3ISNC 4MTPA 1W2BR 2HFNA 1F6TA 1KVJA 3O1LA 4CH0S 4C7QA 4ZVEA 4X64J 1F60B 3SBMA 2M88A 3NCPA 4IRCA 1MWYA 4JI0J 3DLKB 2UXDJ 3R9LA 2BE2A 1J5EJ 1J2VA 2RMLA 2AJ0A 2XMUA 4ED8A 2V69A 2KFNA 4ZVTB 1T03A 2KYXA 4JI1J 1F1BB 2EFVA 2RT3A 3QBCA 1RKIA 4JI5F 3V6DA 5AJ3F 1RB0A 1C4AA 4QWAA 1YRTA 2DTJA 2QYCA 4AE5A 4USWA 2XY6A 1JNZB 3MUMP 2W8LA 1S0OA 3NGUA 1IR1A 2BZ2A 2HIYA 2DR8A 1NAQA 2V4RA 4PWDB 1VK3A 2UXBJ 3UD5A 4IQMA 1RP5A 3OFFA 4LJMA 4DV4F 1K9MT 2JEFA 2UU9J 4AYBD 2G1HA 3RB6A 4WFZA 1RT3B 3CF5Q 3K58A 2E44A 5L1IA 5J1PA 1U09A 1GX5A 4U8VA 3IBFB 4NYZA 1LFWA 1RT6A 4HI1A 4OMFG 2RKIB 2FDNA 4F0MA 4K4TA 1NHUA 1UZHA 2E29A 4KQZA 2BE9B 4NCGA 3LA0A 1N33J 1V5VA 5F9NA 2CPHA 4FYVB 1KNZA 4KGVB 1RT7B 3S7RA 3GCWP 1YJWS 4TY8B 1SKSA 4V1Ak 2MGZA 4RNHA 1TKTB 3OTDA 4IH5A 3LGHA 2V50A 2H5JB 4DV6J 3TARA 2HHUA 1U0HB 3OVSA 1YJVA 3E8OA 3GMGA 2RQMA 4J9SA 2N82B 3W8PA 4UOFA 3Q8YA 4O23A 4J37A 3PVXA 3WQPA 1NZ8A 4B3SF 2R7RA 1LKZA 2XSJA 1YZ7A 3KJFB 2LLZA 3ZZ0A 2R2TA 2NPIA 1X4FA 4JOUA 5ETOA 3J81j 4USIA 4NMXA 3V81B 1DJ0A 4MKAA 2PGCA 2HYIB 3DU6A 2ZJPQ 1KONA 1JLQA 2W8KA 3RUBL 5IT0A 1CG2A 2ZHAA 4J9MA 2LVWA 4QIFA 1UPMB 4DSEA 4LR7A 3OR2A 2I6WA 2YNFA 1VDHA 1SL0A 4RW4B 1VHIA 1K1SA 3L4BC 4OZJA 1IKXA 3QMQA 4WP9A 5C5JA 2IRYA 4QOTA 3G8QA 4F8RA 1VQ8S 3GYXB 1J5OB 5LSRA 2EBGA 1VQMS 2EWHA 4NCBA 3LP2A 1H7WA 1HNWJ 2YNHB 2R2SA 4U67Q 1Z2LA 1VRTB 1DRZA 4Y3CA 4ED0A 2M9KA 1UVMA 5H9FJ 2ZHBA 3HHLD 3MCMA 2H1YA 5HP1B 4P2SA 4RBVA 4L73A 1FCAA 3PDNA 1JX4A 2DGSA 4M1KA 2ZJQQ 2XHCA 5H9EK 3C8YA 2YPYA 3ZZZA 3KLGB 3UNGC 2I9SA 3ENWA 2PE8A 5T7LB 5A8KB 4DZDA 2J0QD 7AT1B 1U45A 1WC1A 4F3QA 2GQCA 2HPUA 3Q8PB 2FHJA 2Q1LA 2R7VA 1RWVB 5KFXA 3DOLA 3MCOA 4KT0C 4LRDA 2VBWA 1SJ1A 1PBUA 3T5HA 5F0WA 2KHDA 3OL6A 3GONA 1TK8A 3GYGA 1VHFA 1RK8A 4LSLB 2R8KA 3LAMA 1NRKA 3Q0AA 2ZBQA 4F2RA 1JKHA 1MROA 2AV5A 1S10A 1QTMA 5EHHA 3MEKA 3IWLA 2IBOA 1T05B 4E8UA 2APOA 2CXEA 3CXCR 2YNIA 2WONA 5HBMA 3I0SA 2RHSB 3AXKA 2NQPA 3R5CA 3GCXP 4FYYB 1GK8A 1BHNA 2MZJA 2ZBPA 1TU0B 1SKWA 4OYIA 3TAPA 1G3OA 3NWRA 1N34J 2VG7A 4USHA 1PJ6A 4FNHA 1X5TA 1ITPA 4DN9A 2HAFA 3CJRA 4DR3F 5ITHA 2XCPA 1SQGA 1K73T 1LWFA 1VIOA 4ECZA 1WC4A 3H40A 5KFDA 2YKNB 2V4JB 4WJBA 2HVZA 2C2EA 1OMSA 1RHKB 3R5JB 3RW6A 2JEGA 2R42A 4B3TJ 4IYQA 3T9ZA 1N0UA 1PILA 5EX3A 4DL4A 1NDLA 2CPIA 4BC7A 2KM8C 3VQSA 3DLEB 4D3HA 4DSKA 1RAAB 3N5BA 2GV1A 2VQEF 3HFVA 4UTGA 2Q6CA 2NXUA 3EICA 2DNNA 4MKYA 5C2GA 2W9BA 1S6QA 2QZ8A 5HJYA 2RS2A 5J2QA 3OJUA 2W2QP 3ADAC 4ZIVA 1P8GA 1JB0C 1LEOA 4X4PA 2ZITA 2VBXA 5BJRA 1CS4A 3M6UA 5ETVA 3QLHB 3FGVA 1KR4A 3DGVA 1MWQA 2IM0A 2Y8WA 3L09A 2VL1A 4NI2A 3BDPA 1U6BA 4K0KF 3JQKA 2AX0A 2ZFHA 4I1TA 1C0TA 4YDXA 4P52A 3U27A 3BDEA 4K5RA 1MWZA 3BYRA 1HBNB 2VC0A 3EVMA 3T1HF 1KKHA 1V3SA 4QW8A 4MK7A 1IBMF 1LQ9A 1WEZA 2O1PA 2N7CA 4WU3A 3UO0A 3J7Z5 1HHTP 1CJKA 2KL8A 2ZOMA 4FXVA 2MLYA 3MD1A 4IFVA 1TL1A 1CJVB 1NO8A 1H98A 2GMJA 2HFOA 2E66A 4YFUA 2HVDA 1R6YA 2W9AA 2YY3A 3AD7C 4JI7F 4X66J 3FK4A 2MZTA 3WC2A 1HNZJ 3SXLA 1LK7A 4MT1A 3VAKA 4CO5A 5E2QA 1RISA 4ZN3A 1ZS6A 4TYAA 4AXIA 1GAOA 3NBPB 1LNQA 4I56A 2IYGA 4UZBA 2HHSA 4OJ1A 1TL3A 3HF5A 5GAGU 4B02A 2AYGA 5IQ6A 5A8WB 4O4GA 2F5GA 1RAOA 2BANB 1I5OB 5B08A 4AUKA 4O3NA 2YQ3A 4LBIA 4MFBB 4H54A 4USMA 3DRYA 2OPPB 3O2IA 2DGOA 3P96A 1FNXH 2IAJA 4OYAA 2G0CA 2CFXA 1U1MA 3WZ0A 3X1LB 3OXGA 4UY8T 1FEEA 2V2VA 3EZOA 2LECA 3BS9A 5FLXU 2WVBA 2W9CA 2K3IA 5L1KA 5EX0A 3QPIA 4RUBA 1KQFB 4YMEA 2JLEA 3PW2A 2VA2A 2MQQA 4AL7A 1DQAA 5KT3A 1ZAVA 3IA0A 4DU8A 3PJ9A 1HFEL 3DOMA 2HAIA 2Z2YB 5J2MA 2V68A 1VGYA 3CCVS 2W4CA 3I32A 2HRTA 4J5OA 1WDDA 4O3OA 4C11B 1UAWA 3QGHA 3JTNA 3G9CA 3DRXA 1Z2ZA 4USJC 2B4VA 3IP0A 3D6FB 2JL9A 1IM6A 4ZLJA 1T0TV 2IVYA 3N79A 3DRRB 4K4SA 4WIIA 3QRRA 1GXTA 2VQFJ 1KVIA 2A6MA 4TXSA 1RHJB 4DOZA 1VRQC 3VR1A 2VONA 2R7UA 1SBRA 7FDRA 2K3KA 1UFLA 1XR6A 3U02A 2HVHA 1EJ7L 5KAKA 4NRTA 4OI2A 1FRJA 2DHSA 4ID5A 2C2RA 3RG6A 4R5PA 2CPYA 1KTQA 4ZHRA 1SB6A 1F5BA 1U49A 3OHAA 3FEXB 3FBCA 2B8QA 4GKKF 4QYRA 4LQ9A 3W9IA 7FD1A 4C3KA 2HHPA 2HBYB 2P6SA 2IA0A 3FRZA 1N6QA 2IA6A 3KDOA 4DV1F 1MMLA 4P10A 2OGUA 2YWKA 4I7FB 4RW8B 4FKYA 5HVGA 2QSFA 2CJBA 2HKEA 3AAWB 3KUHA 1D3WA 4LFAF 2QEXS 4DQPA 1U2FA 3F0NA 2O66A 1VQPS 2AGQA 1H38A 1CJUA 5KG3A 2BX6A 2IPOB 2DHHA 2JH3A 3MMCB 2HS4A 1AB8A 2ILYA 1R27B 3CJSA 1U1RA 3TZWA 3EXCX 2VV5A 2J0XA 3TA2A 2DNLA 3K8WA 2CNKB 4HT5A 4ED4A 1U1KA 2VF3A 4X4UA 2VFUA 1F2HA 2JOQA 2JWNA 1X4CA 1FRMA 2UV8G 1BWEA 2EFNA 1VBZA 3UW1A 4ZVHA 4RU2A 3NAIA 2AHOB 2CNNB 4ILMA 3CE8A 3K7RA 4Q45A 4WXOA 1ZM4A 3KFWX 4H4MA 2LDYA 3CJ2A 2DY1A 1N56A 2KRRA 3MEGB 4CIOA 3BO2A 4EYIB 1AZSB 4CM0A 2J0SD 2HZVA 4LF8F 5AE1A 2NYHA 1VC0A 1KTVA 4KKOA 2HNYB 3UNYA 1K47A 1RAGB 3BGUA 3KK1A 1KD1T 2QN6B 1REVB 2O67A 1U7LA 3FSYA 5EUHA 3KK3A 1HYSB 4F3MA 3UN2A 5J2NA 3R97A 4NEZA 5F0UA 3CJ5A 1K8AT 3QAEA 4AXJA 3O6QA 2CUYA 1M1KT 4YHHJ 4HH1A 3QFWA 2C22A 2OH2A 3UN3A 3DMJB 3GR0A 3ZXWA 1ULRA 2GHWA 5HMWA 1KEKA 3QSYB 1U1PA 4OZ1A 5KFHA 2FHOB 4A47A 5ETQA 1XMQF 3MCNA 4ZP6A 2XYPB 5G0RA 3LGNA 4MIBA 2ZKTA 2PN6A 1RHQB 5B0GA 4NLRA 2FIUA 1HWKA 1Y00A 3MM5A 4KFBA 4K4VA 4KV8B 1IKVA 3H59A 4IO1A 4X64F 3TEHB 1S0MA 1TQLA 4IDKB 2DH9A 4JI0F 4KGMA 4OHZA 3J80Y 1P9QC 3CD0A 4RBUA 3MURP 1EETB 3M2VB 2VODA 1J5EF 1W25A 3LP0B 4UOHA 3O44A 3MECA 5IWAJ 2KDOA 3OTBA 1VQ9S 4BC9A 1RT2B 3AJ2A 1HI1A 3FQLA 2HURA 1N54B 1WC0A 2H51B 2M0GB 3UWTA 2GVDA 2Z8QA 4DFMA 1AW0A 3LO3A 3PXGa 3KG0A 3EVWA 2AX1A 3EDQB 4G6VB 2K7KA 2MY7A 2PA3A 3RW7A 3HSGA 4Q5VA 1S1VA 1Y9OA 4KBIA 4RKUC 3M6VA 3BPSP 5KT4A 1X5PA 1DAXA 1TL7A 2UXBF 2ZH4A 2E7VA 4GVBA 3DLGA 4NYOA 1IR2A 4KHMA 1FJEB 2RU3A 4OYBA 2BW7A 2JEIA 3GIRA 5D0EA 1NU4A 2UU9F 2BE7D 4XPCA 3MM9B 3TJAA 2OPSB 3P3DA 2WVEA 6FD1A 1M0SA 1PC5A 3MHYA 1NK4A 2YKMA 2GGPB 1IWGA 4BWMA 1S7IA 4JP8A 5KFOA 2RSQA 2UUCF 1T9XA 5IC4B 2NZ4A 2GVZA 3HMJG 1N33F 4P75A 2GO9A 4TNOA 4ID8A 3CIZA 4IOCQ 1HA1A 1HPZB 1BQMA 1D1UA 3H20A 3G6ES 3KXDA 4HHHA 2VZ9A 2KVIA 2BE2B 3LF0A 1RTJA 3K8VA 4LF2A 1RAJA 2LEAA 3QSIA 4DV6F 3NNCA 1LV5A 2AIRB 4DV3J 2Z4PA 3SEOA 1FESA 2VBYA 2VPYB 3FJ2A 3ULHA 2G2ZA 3QATA 3V6DB 2XI3A 1DBDA 4B3MJ 1S97A 2MXYA 4RUCA 4IO9Q 1HHQA 3MOZA 3KHRA 1DQ9A 1X5SA 3NEKA 3EZUA 4LFCF 1WACA 1WG1A 2OEJA 3PRDA 3IR7B 3QWPA 2E1AA 4LF7F 2XY5A 1WNEA 4AT1B 3NCQA 3W7BA 2DPIA 1YITS 1FXRA 3VAIA 4IG3A 2XGPA 1RT6B 4GO5X 1YKWA 4NCGB 1HNWF 4E98A 2VFRA 3PKYA 5IM0A 1BXNA 3I87A 3GYNA 4ELVA 4B17A 5DQHA 3AQOA 3TUIC 1Y7PA 5JUMA 5BR8J 1H3DA 1QVGR 1MG7A 2MGZB 5DQIA 4WZQA 2HFUA 3BR9A 5A0YA 4F4YA 3NS5A 1OQ6A 2PIIA 3GFYA 1GMVA 1DTTA 4AL5A 1TFWA 4KE5A 1WHYA 5B7WA 5HVHA 2XSJB 4PG4A 3M7VA 3W5YA 1VQSA 1AXQA 2M7SA 1UJ5A 3KJQB 3IG1A 1DY3A 5A76A 1JLCA 5ETPA 1LXNA 2B9XA 4USTA 4PG6A 3P5TL 4C9DA 1JLQB 9RUBA 2IM1A 1S1XA 2CPZA 4UY85 2GHPA 4LSNA 4N5SA 1RQ0A 3SFUA 3HKZD 3FZBA 3OR2B 2YNFB 3M6WA 1WG5A 3OVBA 1IKXB 1VJWA 4OIXA 2B7BB 4RR5A 2R7QA 1ZOTA 4Y0FA 1FK9A 3AA8A 4C98A 1B64A 2CQ2A 1EP4A 1WC3A 3LP2B 3HVAA 1FDNA 3KHHA 5BXIA 1I6JA 1O0PA 5ETRA 1NH8A 2QMUB 1WUUA 2KI2A 5DZ6A 2A18A 2W4DA 3TOQA 1N34F 3QAUA 4NXNJ 2XM3A 1H7XA 3MFHA 1NKBA 3OFGA 1U02A 1WF2A 1C2PA 1U4BA 1RCOB 3FBFA 2FZKB 1N0VC 5HROA 2LP4A 3MI7X 3CJQA 2HFSA 3MPDA 3G6VA 2P9GA 4EK2A 4WE1A 1EIYB 2RRBA 2Y1IA 2LA6A 4B3TF 3AFGA 1FD2A 2HWTA 2XSFA 2HQFA 2GMLA 5IXUA 1UEVA 3DOLB 3L7PA 4P74A 4ZOSA 2CJQA 1ZAWA 3SCKE 1EQ0A 3KLIA 3PX4A 2CNLB 4CLLA 2CPDA 2FLLA 1JKHB 1TK0A 5KFQA 1MROB 1RYSA 4D3GA 4OHXA 2R2UA 3H5UA 2E7WA 1TVRA 4DQRA 2YNIB 2WONB 5HBMB 5IS2A 2ZOFA 3I0SB 4RLEA 4F26A 4KB7A 4NLDA 2DGUA 4KHPJ 2WB4A 2ZDPA 2VG7B 3JXOA 3CCMS 4IRKA 2WCXA 4KTQA 1YGYA 3VVTA 5DDOC 4NMLA 1LWFB 1XJWB 2UXCJ 4PYDA 1U2CA 3BGOP 4OQJA 2KT3A 2FVQA 3QJLA 3T6BA 2MB0B 2K7JA 2VFSA 1B70B 3D67A 5K8NA 5AT1B 2AYBA 2XLIA 3NWGA 4E2FB 1I1GA 3H8YA 3D0GE 3TR5A 2L08A 4TVAB 3GFHA 1AUSL 3QT8A 1U24A 2W9BB 4LFBJ 1JJ2R 4QU6A 1S6QB 3JSYA 4TN2A 5J2QB 4X66F 4OYWA 2B9WA 1L3KA 2EW9A 1CS4B 1ZZFA 4O44A 1XNRJ 1LW0A 2G2OA 1VBXA 1H73A 1UVKA 1VQ4S 2OTJS 2DBBA 3JSMA 4DSJA 1N5YA 3THTA 1R43A 2KO1A 2J9DA 3MFIA 3OL7A 3DRPA 5T41A 3MAQA 4FS2A 4DL5A 3WDOA 1H0HB 3H4BA 1PIEA 4EWTA 1Q82T 4DPWA 3K5NA 2OPQB 4NI2B 1FEHA 2FC8A 3H90A 1CULA 4CO3A 4K4WA 1TR0A 4NPOA 4OYXA 1HNVA 2J0WA 2CAJA 2DRBA 1NB2A 1FRKA 2I2YA 2OIHA 3CSKA 3IAM9 3T1YJ 4CLPA 3OXLA 1FTCA 2HHQA 2KKHA 1N5SA 5F8MA 8ATCB 5CYJA 1QAIA 4NL5A 2RUGA 1SCJB 4EUVA 4YUDA 5HQMA 3EM1A 3RBDA 2P5VA 4N47A 1CJKB 1EARA 4F0HA 4A8OA 2V8VA 4USVA 2EC0A 3B4DA 4IFVB 1TL1B 3M8RA 1XK8A 3SYZA 1B99A 5E41A 2DRAA 1AROP 1C1CA 3OV7A 4LVNP 3CD7A 2GA7A 1RAIB 1OS5A 4ZPDA 3NS6A 1EZZB 3VALA 2HZAA 1HD0A 2HHWA 3D66A 4F3OA 2BJ8A 2UVUA 1FFGB 5RUBA 4M5DA 2CA9A 4ED3A 4LQ3A 1TL3B 3PR4A 1XERA 2W24A 3PJWA 4O4GB 1UWBB 4DMZA 4CO0A 4HLBA 4C6AA 1RJJA 1NK7A 3BV8A 4NLVA 4OJ3A 4PQUB 2E1CA 1Q8KA 2IAJB 4OV1A 5DETA 5LOQA 5F3TA 3ITHA 5JVHQ 3DRSA 4MAKA 4Q0BA 1O5JA 2BEFA 4PG7A 1IN0A 4OJHA 1LWEA 1SPBP 1JLGA 5KG6A 1P27B 2W9CB 2DNHA 2Y1JA 2YVSA 4A8SA 1Q86T 3DXBA 4FNIA 1RWUA 3BEGB 2CJXB 5IZHA 4N77A 2WTFA 2J6UA 3C3LA 4DV4J 1Q53A 1S0NA 1SVDA 4R8UA 5K9FA 4OX9J 1NDCA 3AB2B 2CNOB 3MMJA 2BQRA 1N32J 1TMJA 4CLYA 3AOCA 4ZCLA 2DCLA 1C1BA 1FRXA 2VOPA 4KY3A 5CAAA 3FBBA 3KUGA 4UQGA 2YH0A 3KOAA 5KT5A 1VOMA 1LWXA 5HN0A 5KFLA 2VKZG 1O8BA 1D0EA 2JDJA 2DNKA 3SCJE 2D69A 3AXMA 1Q8IA 5KG1A 2HNZA 3M8SA 3Q2TC 3M9MB 4QYZK 4ATNA 5F8HA 2E1MC 1VQYA 5AE3A 1RTHB 2F8HA 3JAMY 4DR6F 2FHKA 3H4DA 1XIQA 3DHWC 4X4OA 3ZZOA 2DO0A 5A8KA 2EK1A 3M30A 4DBQA 1KWMA 8AT1B 3EXYA 4KHRA 1IWAA 1XBWA 2VB6A 2ROGA 1S1UA 4KPCA 4ID5B 3I5CA 4R5PB 1OY8A 1WHVA 4ZHRB 4MYUA 1MSWD 1GQEA 2PT0A 1S1TA 3W63A 5HATA 2V8HA 4RU9A 3KLEB 1HWLA 4WCEQ 3ENQA 1GXLA 1NSQA 2BOAA 4YEAA 2BRKA 4NZ0A 4DFJA 3EDRB 1N6QB 3C16A 3CJ3A 2MKJA 1T05A 5KT2A 4PXEA 2PEHA 4CTAA 1QAXA 1YIJS 2IM3A 3G4SS 3CW2C 1CJUB 2NPFA 4GRSA 2W2MP 2I8EA 2MZ1A 1SIWB 4KO0A 3A13A 2B5JA 2DYAA 4Z37A 2K8GA 2ZNZA 1FVSA 4C3MA 2QL7B 2F4VJ 3PIOQ 4WK3A 5DM7Q 4O3RA 3VGTA 1IM4A 2XTJP 4DL3A 3FKBA 2Y3YA 3NMAA 2UVVA 3GJTB 2AYEA 2H48B 3DLEA 4OV6A 4CLWA 3FVYA 3K2YA 3THVA 3MCSA 4H4MB 4EBEA 4CNYA 2VU5A 4UOCA 4M5IA 5J1EA 3I9ZA 1VYAA 1MLAA 2LEPA 4PPDA 2FTRA 1ZPVA 1FO1A 3Q8VA 3VTIA 4KKOB 3RRHA 3AJDA 4Y2AA 1YSJA 4M5MA 5KFSA 1APSA 3KK3B 5J2NB 2E9ZA 1RA7A 2FJAB 5EWEA 4L72B 3KYLA 3GV7B 1RA6A 4ZVOB 1UVNA 1RI7A 1JLEA 3B8HA 4I2PA 4DR3J 3Q83A 1VBKA 4L75A 5DG9A 1TAUA 3MMBA 3HCXA 3WX4A 5KFNA 2FLPA 1G6BA 3TUPA 3PW7A 4RW6A 3CDUA 2PC6A 4Y2IA 2Y0BB 1YX2A 2KH9A 5G0RB 4C3LA 2AP6A 5KG2A 1S0VA 1RGVA 1GMWA 2MZRA 2C28A 2GC8A 3MM5B 4KFBB 3HVWA 2YWFA 1IKVB 1WEXA 3FSXA 3TVYA 4W4MA 5C24A 1SJFA 2RRAA 4M5KA 4ETZA 2DHXA 3OFEA 1CJVA 2VQEJ 3KUEA 1UETA 2MMYA 2GJFA 2OHDA 2B6AB 4IR1A 3ZFVA 3GIKA 2UUAJ 5E3RA 3MECB 4I6WA 2FJWA 2DXEA 4DV3F 3R5AA 1TKXA 1S6PA 2IMOA 3L3CA 3VVUA 2GVDB 5CA5A 2XLKA 3CCRS 1M5SA 4B3MF 2MKKA 4PG5A 1NH7A 4IH6A 2AJ1A 2LKZA 1ZZNA 4KGKA 1S1VB 4QWDA 1BMQB 3KMQA 3HHLC 3PKMA 1TL7B 5B0AA 2JZ5A 5DRKA 4IOAQ 3TQ1A 4GVBB 4KC5A 1YQHA 2CDQA 4P71A 5CXTA 3BSAA 3DLGB 4A8YA 1R3NA 3BKUA 2XZDB 4P72A 1KRPA 5E33A 2DGVA 1F9EB 2RILA 2CVIA 1S57A 2YKMB 4RUAA 3MPUB 2HHXA 4DR4F 5GVQA 2QA4S 1T94A 1GH8A 4L6V3 2GVZB 2ZNYA 2D3ZA 1SH0A 2MY8A 4NEYA 3ILLA 2FGOA 3CEDA 1BQMB 1NLKL 1ZBTA 4ZCIA 1CJTA 5C7PA 4B08A 1PAUB 5L8RC 2RB7A 5BR8F 4LR8A 2G4BA 2KU7A 1Q16B 1RTJB 2KHCA 1KOHA 3AOBA 2R7SA 4V19J 4OZLA 4WYLA 4DX8H 1N5TA 1T9TA 1L3TA 3ILJA 1QSYA 2R4FA 1VQNS 2RRNA 4MK8A 2K2PA 2RS8A 4ES3A 5KFIA 4O3PA 4EO6A 2VUGA 5D6GA 2BYCA 4EBDA 3B82A 3PYDA 1X4EA 2ALZA 2QYGA 4I6AA 3CJKA 1UEKA 4NLQA 2CWXA 3EGZA 2A2CA 3K5OA 3SZ2A 1RSCA 4WPAA 4XK8C 4HI2A 1S5ZA 4N7TA 5A8RA 2ZVIA 3ZTOA 4ALZA 4FYXB 5BYQA 3A3PB 3BBFA 3DKDA 1IBKJ 2OSQA 3RBEA 3A8KA 1H2TZ 5M2RA 3D6MB 3PYGA 5IM0B 5KFJA 3GJSB 3C46A 5CYQA 4K2JA 2AJQA 1T7PA 3RU0A 4Q8EA 2FVPA 3QZ7A 4NXNF 2QJ3A 3BSCA 4M5NA 4DR2J 5J2PA 4ZJQA 1N5QA 1NBEB 1FRIA 2ZC4A 4RW8A 2ZBCA 3BN7A 5A0YB 1RWKB 4OZ5A 3MDFA 3E2EA 1RBAA 3K59A 1DTTB 3CCUS 1YJRA 4F4AA 2OSRA 1VFJA 1LOUA 2ZOGA 1RHRB 5HMZA 3W62A 1FFSB 1Q79A 3IG1B 3ENVA 2WOMA 4UOGA 5M2UA 4B9MA 5KT6A 1YDLA 5EWFA 5ETLA 4B3RJ 2DY9A 4JI6F 1RT1A 3DLHA 3FSIA 3IC1A 1JLCB 4JV2A 3TANA 3MPVA 4U6PA 1TKDA 1YVFA 2M70A 2L9WA 1S1XB 4YB7A 4LSNB 1IXKA 4YP3A 4DLGA 1B0TA 1HMVA 4DU7A 2EFQA 1L3UA 3D9BA 5L1LA 1RABB 3M1VA 1VR6A 5E7OB 2LQJA 2VD3A 3EGNA 5CQGA 5HL7Q 1RBOB 4ZJOA 2OAUA 1FK9B 3GTYX 4PR6A 4ECUA 3PW0A 2B9YA 1EP4B 1D9DA 3R5BA 1LFPA 1JLFA 4GVLA 4KHPF 3U1MA 4EZ9A 2CQCA 3HFKA 4PABA 2RHQB 3GILA 4DQIA 3I82A 5CZXA 1WEYA 3KLHA 4DR5J 4F50A 3HKWA 2MSSA 3R5GA 2Z2MA 2GQ2A 3CNQP 4DSLA 3NGKA 3OTOJ 2YH1A 5HROB 3VAJA 2HBQB 4CO4A 2KFZA 4P6QA 2EFOA 1JLBA 2UXCF 3DN9A 1RWXB 4LFAJ 3DCAA 3V5RA 4WE1B 4HL9A 3CDEA 1TKZA 3PHEA 3A3OB 2OTLS 5CABA 3TO8A 3JTOA 2VJUA 3IBCB 4FS1A 1KBRA 2XMVA 3TUZC 4XDDA 4ZJLA 3CCES 2CDRB 4ED1A 4Q43A 3R8YA 2AYMA 4FF1A 2CJ9A 1S77D 2ASDA 4F2SA 2RNEA 2I5JA 1REGX 2JEJA 2XS7A 2D41A 5KFPA 4F36A 1T3NA 1ZYQA 2UVWA 1M5HA 2RD5C 1X9SA 4RPFA 1RWOB 2AJ4A 3HI9A 4O3QA 3TJ8A 2L9NA 3LH2S 2C42A 2HMIA 4AQYJ 1TVRB 3Q86A 3W1YC 1U47A 5DDRC 1SV5B 4QIWD 2HNDA 2RE1A 4DPXA 2FY8A 2XZTB 1FI4A 2GW8A 1OSCA 2MHNA 3TX0A 2ZZTA 4TU9A 1L5UA 1IR0A 4U7CA 4UT4A 5KT7A 3B4MA 2QG9B 9ATCB 3T1YF 4QWBA 5KFVA 2RAQA 3E01A 3F56A 3LWMA 4LF4J 5FD1A 2Z2ZA 4P2FA 5B0DA 4UZCA 1LXJA 2WVCA 3MM6A 2CQ3A 4F0KA 1SH3A 3HT0A 2AEJA 4ZS6A 1PBAA 3HPOA 2KYZA 4RNNA 2DIVA 3M05A 2FZGB 3LTOA 1D8YA 2AZ3A 2QA2A 1XMQJ 2OJ3A 5LMNF 4ED7A 2O5DA 3I96A 3HT3A 1UJ6A 2JC0A 2F1FA 1FJCA 3HJVA 4M8LA 3F41A 3WX8A 1HPZA 4ETXA 5LSOA 2VIHA 3AY0A 1GXUA 3PX6A 5AXLA 5KG0A 3MR5A 3QJPA 2RF2A 4HYKA 4O44B 5KFCA 5GAEU 1KHVA 2XI2A 1LW0B 2BJ1A 4J9PA 4P2MA 1D9FA 3KG1A 3JSMB 4MIAA 1N5YB 1LK5A 1C0UB 4DV7J 1VC5A 3OTCA 1DFDA 2BM0A 3VAHA 3DRPB 3HVTA 1F3VA 2LU2A 2AEFA 3HVRA 4WXWA 1CULB 1RDRA 2MQMA 2K1RA 4KSEB 2AU0A 3IR5B 3IGVA 1HNVB 4PQAA 4CLKA 4DF8A 1CQMA 3TVKA 3RAMA 2QFJA 1M5VC 1FFWB 3ET6A 3MD3A 1SXLA 8RUCA 2HG4A 5D4OA 3PCOB 4CWBA 3M8ZA 3HZEA 1TZ0A 4EFAC 1TP7A 2VH7A 3ETOA 4L3NA 3ZC4A 3RB4A 2M52A 2XMJA 4OX9F 1S6OA 3RYLA 2PSZA 4K2XA 1N32F 4C8OA 2MTLA 4FPIA 3FDSA 2F4FA 1C1CB 2AW0A 4URQU 3J7YU 2UUCJ 1VQOS 2GX8A 2GO8A 3MR2A 4OX7A 4ER8A 3WHIA 4M94A 4ANDA 4W98A 3L9ZA 2B51A 3CVKA 2QA1A 3PYEA 4DQQA 2DHGA 1RAHB 4M5DB 5G4DA 4Q2LA 3GU0A 2IFXA 2WSFC 3BQ2A 2QLJB 1QSLA 4FZVA 4ES2A 4ITSA 4YOEA 2ACMA 1ZM2A 1OYEA 2UVRA 2XNQA 1WJ9A 3CD5A 3T9NA 4HDHA 3DNCA 4NZ6A 2KZMA 3OFHA 1B7FA 4ECYA 1U6ZA 1KSPA 3OPKA 3BREA 2R3VA 5K20B 4DSIA 4YS2A 2EBEA 3IN5A 1SL1A 3ITHB 4RZRA 3DRSB 4WFXA 1RBLA 3TZZA 3F73A 4NOHA 3DM2A 2XCAA 5KFGA 2V67A 4Q0BB 1LWEB 1JLGB 2VHGA 2HQIA 4WZMA 4LFCJ 2HQ3A 3U1NA 3KKFA 4Q44A 3V4MA 4Y65A 3I31A 2A0FB 3I5AA 3NCRA 2WAQD 3W9JA 4LF7J 4LRAA 2WK4A 3CJ4A 2YKQA 4R8UB 2SXLA 4PCQA 2CPFA 4AD6A 2VASA 2Q3PA 2N4DA 2XMTA 1XMOF 2QLXA 2V2QA 1KLNA 4A48A 1HLWA 5IT4A 1NB7A 2ZEJA 5B0FA 3LALA 1VBYA 1C1BB 3C15A 2DH7A 2AT1B 1YK9A 3TRGA 3DI6A 1S7HA 1ZM9A 3EX7B 3IO1A 2EFPA 3W3SA 2IMWP 3W9HA 1T3OA 2BQ3A 1WOPA 2G2YA 2HNZB 2DNMA 3MUTP 2KN4A 1QSSA 1FERA 4K4XA 1Q8LA 2F4VF 1SH2A 1I94J 1HR0J 4RNOA 2ZH6A 3R1HA 2PMHA 4PPZA 4ZKAA 1HBUA 1RTDA 4DHVA 2ZE2A 3OUYA 4KH0B 3M30B 4HEA9 2NSCA 2JHEA 1U1OA 1S1UB 3VAFA 2POKA 3LW5C 1L3SA 1T9YA 1WELA 2DEIA 3VZHA 3MM8A 4BWJA 4USKA 3HD2A 1Q95G 4CO2A 1S1TB 2J8AA 1F5CA 1KHWA 5CH7B 3OL8A 4V19X 1MNEA 2HQDA 1IVZA 3NNAA 2D3O1 3C16B 3TX8A 4EZ6A 5D77A 2VG5A 3IBWA 1NSAA 3H98A 4NLWA 3PYFA 4CTAB 3PNIA 3J81U 1GMUA 1KQSR 3J7A1 4WBFA 1FJ7A 4JI8J 4AFFA 4CLTA 3HHNB 4NLGA 1IJEB 4CZCA 3UR3C 1HQ2A 4R0JA 4O4RA 3PG9A 4QR2A 2OKQA 5D3GA 4FP9A 3HD1A 4KO0B 4N8OA 3R27A 5DO2A 2B5JB 4B3OA 4K7QA 2WB1D 4EBCA 1OY6A 3TZXA 2UUTA 4J91A 1UP1A 2ACYA 4WFYA 2R7XA 3CJ0A 3H2VE 3WIVA 2KM8B 1Q81T 5K14A 2YX4A 3ZZUA 3KLFA 5FDLA 4CI0B 1RACB 2D9OA 1FHTA 4U7UK 5HAOA 2MEWA 3NKYA 4J9QA 2UUAF 4EYHB 3ILOA 4MIWA 5KG4A 4TU7A 1X9MA 4NLXA 4XDCA 3N9UC 5J1EB 2QGFB 2QT7A 5AXNA 4ZIWA 3EJMA 4U9RA 4NLYA 2J8SA 1RWNB 1GX6A 2V5HG 1FRLA 3FNNA 2E5IA 1RXOB 1ZTTA 3IAS9 3IWNC 3HSJA 1VRUA 3GFZA 3W61A 2MZSA 2OPQA 2KB2A 2DR6A 3SCLE 4LIWA 5D0RA 1NK9A 1PAEX 2QLBB 1JLEB 1UA1A 1I3OB 1CC8A 4I2PB 3ZZTA 1U1QA 1VJQA 2LU1A 3MMBB 1B7YB 4I4BA 2MKSA 5H9FK 1R8CA 1P6TA 1RZMA 5HANA 2YBVA 4C8KA 4RW6B 5IT9Y 1QD1A 3LGMA 2HHHJ 4U95A 2ADCA 3JQMA 1F5AA 2RDIA 4KPYA 5FJ4A 5JVGQ 2ATLA 5A2QY 3ZZYA 4JI2J 5C24B 3R2CJ 2CYYA 3MGJA 2MQLA 3T41A 5GMKa 4ZVFA 2FHJD 3TEGA 1VQKS 3U1LA 2ADBA 2J7KA 1SKRA 3GSIA 3OBIA 3BF4A 3H5SA 3D4JA 1I51B 4LBHA 4A8KA 1NKEA 1UJ4A 1TKXB 1S6PB 3AOAA 2PI5A 1TFYA 2CQBA 1KLMA 1VQ7S 2MKHA 1SJQA 5GMDA 1S9EA 2JFDA 2P9EA 3EZ5A 4KAIA 3IRWP 1UWBA 4ZN1A 1QE1A 4PKDB 3PRVA 3W2WA 1EX8A 3T6JA 2C3UA 2DR7A 4PQUA 3A1YG 3Q8QB 1RTZA 3N6NA 1UEUA 2A1BA 5LM7E 2ALYB 2HGLA 5B09A 5F41A 5JXSA 2HEKA 2OP5A 2EG2A 4OLPA 2KJWA 3KHLA 2GIRA 4J9NA 3SDEA 1HQUB 1PGZA 5IV3A 3PZPA 3FFIA 2COLA 5LJ3Y 1X8DA 3N6MA 1X0FA 4IH7A 1FE4A 1IBKF 4JV5F 1FWLA 2B8PA 3HXMA 3UDEA 3GZ7A 1WOSA 5DQGA 3UCZP 3MR7A 1QY7A 1GFWB 2BM1A 1NZAA 2JC1A 1WKKA 5EDWA 1YZ6A 1CJTB 2U1AA 4DR2F 4CDIA 4H4OA 1VMBA 4IG0A 4QU7A 5AXKA 3D68A 4JYAJ 1NHVA 3OR1A 2AJ2A 3SSRA 2DHAA 1VLYA 4URGA 4RO0A 4W92B 4PZVA 4K4UA 4S0MA 2C3YA 5SZTA 2ZH7A 4A46A 4X65J 4B3RF 4RW7A 1RTHA 4DV0F 3CJKB 3W65A 4OI3A 3HZGA 2JX2A 3AD8C 3A8JA 4O3SA 3C6TB 1FDDA 4JI4J 4K5SA 1HNXJ 2DGXA 3HJFA 4IQXA 4DL2A 3QZ8A 4PWUA 3IM8A 2NCKL 3G86A 5A8RB 2MKIA 3ZO7A 4LRCA 3BBBA 2EG1A 3W5ZA 5EWGA 1IBCB 3QT7A 5CD4H 1EHWA 4DV5J 2OEKA 1FRHA 2IM2A 4C4WA 2IRUA 2JVOA 3ICLA 4PWWA 3G8SA 4C8YA 3QNWB 3KLEA 4LMZA 2WBRA 5CYQB 1PYSB 1YJUA 2ZKUA 5KFRA 4U96A 4ZP7A 3ZZPA 1VLOA 3KJVA 1V9OA 2ERRA 4DR5F 5J2PB 3BSOA 1R8PA 3IS9A 1YRUA 1NDKA 1XNQJ 2CQPA 4F67A 2ASJA 3S01A 1RWMB 4B9NA 3OTOF 4N41A 3EMTA 3H2LA 3ONQA 2E5GA 1YJ9S 3FZ2A 2NR0A 1U48A 2DRDA 3VCDA 4UW2A 3QGPA 5DG7A 2HBRB 4YDDB 3IMQJ 2CJYB 3A8IA 2XNRA 1R31A 4OFZA 1H74A 2WOMB 1FKAF 2HHTA 3D1QA 2XMAA 3D3CJ 2XYGB 4DFPA 1RT1B 2DNQA 2RH3A 1PJ7A 3Q8RB 2Q79A 1XQIA 4OL8A 1Z1ZA 4DR6J 3MZIA 3M9OB 1HMVB 3BZQA 3AHPA 3W60A 1MMNA 2XC9A 3K89A 3M1VB 4G3IA 3AJ1A 3Q23A 4CLFA 2NREA 4UUXA 4DPTA 5GAEI 2DH8A 1X60A 1DLOA 2V63A 3BJYA 3UR0A 3M8QA 4DX6A 4IOBA 3AD9C 5ETNA 2R9LA 2KRBA 2W2PP 4AQYF 2XS5A 1YG0A 1JLFB 2CQGA 4QWCA 1B3TA 2E5HA 1UCNA 1QDUB 4YR3A 3V6KA 2FYXA 1H6KX 3KLHB 3NRBA 5CYMA 5HQ8A 2VICA 1YBTA 2YPZA 3W5XA 1Q1KA 2HK2A 4FBUA 1AFIA 1P9YA 1ZA2B 1QUPA 1JLBB 4QIGA 4OZ2A 2FVCA 4CRJA 4C97A 1Q5VA 4LF4F 4EMDA 2YWWA 5L46A 4CO1A 2FQQB 3D0HE 1TKZB 2ROEA 5L1JA 3ZTRA 5KFTA 4DCJB 2JRSA 1NDPA 4X4VA 2HWHA 1SC1B 2DR9A 3FCWA 1HL6A 4BCAA 2MQ8A 3JQJA 1URNA 3PW5A 2I5JB 3EGWB 5C42A 3M32A 3BQ1A 1BD6A 1Y10A 5MAOA 3J7YI 2YWEA 3H42A 5F8JA 2BABA 1BY9A 1JLAA 2XLJA 3PM9A 3C66A 4WKRA 2MLXA 3UFCX 3T5LA 4OYOA 1S49A 2YQ1A 2FLOA 2FJEB 5D4PA 2WW4A 1G1XA 5K8OA 4DLEA 2B6AA 4DV7F 1WKJA 2HMIB 1KFSA 3W64A 1WOOA 5DZ7A 1FF2A 2HNDB 3RGIA 4OX6A 2Y1LB 4LR9A 1RWWB 2FUG9 2M5YA 2G9OA 4DPYA 2QIFA 1VK8A 2LA4A 3ZTPA 3CJ8A 3CMAS 2ZH5A 3B78A 3DXSX 4HDGA 4OZ3A 2XEXA 3E01B 3HHLA 5IQQA 2KXFA 4OYMA 3CMES 5L39A 3MM6B 4DG1A 2A2DA 4QQBA 1JMTA 3MMAA 5H9EJ 4F02A 2IY5B 2E7XA 1VI7A 2JLGA 2DCUB 1U26A 1CPZA 3D1OA 3M2UA 3NMRA 1NKCA 4XPEA 3JTPA 3K5PA 1YRXA 4M5GA 3V4IA 3CGIA 3G71S 1T95A 4QR1A 3KWMA 3EYZA 3GB0A 2RF2B 5DG8A 2UUWA 4HACA 1K44A 4ECVA 2ZUAA 2NUHA 3GG0A 1FT8A 1DHMA 3HVTB 2CG8A 3NS7B 1FA0A 5F8NA 3M6XA 4Y2KA 2B0GA 1U8WA 1WTBA 2K1RB 3RAQA 3D2WA 2L41A 1IKYA 3POTB 2Y1RI 5D4NA 2J76E 5KFAA 3ET6B 1G7CB 1UVLA 2FVSA 4FF4A 3C14A 2BJEA 4PRFA 2JLFA 1IKWA 4KYZA 1CVJA 5T14A 1B4SA 3HK2A 2NS1B 1NUEA 4OHYA 4DL0C 5JJBA 2EKNA 3ZNJ1 4ZVQB 4LREA 3O8WA 4DR4J 2JJ4D 3N01A 1WC5A 3I0RB 4OI1A 5CD4A 5FLXY 2CQ4A 3UDVA 3KLVA 3GIJA 2VG6A 3G82B 1OY9A 4P7TA 4ZVSB 3GG1A 1VQLS 4DR7J 3HDSA 2BBEA 4DL6A 1WSRA 1HI8A 5E3CA 4G1QA 1RLDA 4LF5J 2ZC3A 4L3KA 5LMUF 2IRXA 1TAQA 3NXZA 2D9PA 3CWJA 3PIPQ 3UVJA 1SQEA 1I94F 1HR0F 2XWYA 4X62J 1ZAXA 2Y0SD 3S8SA 2L3MA 1AFJA 4QIEA 2PI4A 2CZVC 3DM2B 2NZCA 2AZ1A 3IR6B 3DLBA 4HTJA 1ROFA 1B0PA 1FDAA 2OUGA 2ZH2A 4L76A 1URRA 2GQQA 4ZPAA 2OPRA 4EI2A 5D0GA 4X4NA 1AYEA 2XMKA 4TQSA 2MJUA 1OIAA 3BGRA 3M2RA 1T9WA 3LUYA 1X4HA 2L9DA 4IR9A 2FJBB 2M2BA 1E6YA 4J9OA 3W66A 4WFBQ 1YJ7A 3CCTA 4I67A 4ECQA 4Q8FA 2V8DA 3BYPA 3UI3A 3W8GA 1MU2A 2CQDA 1CBKA 3KG4A 3C15B 1GTHA 4JI8F 4CYUA 2BJ9A 3LP1A 4C2MA 3DI6B 4XAKA 2V6AA 5AXMA 3BSNA 3QT6A 3VAGA 2I1RA
chains in the Genus database with same CATH topology
4PR6A 1U1KA 4ECUA 2XBPA 3PW0A 4X4UA 2DGTA 3LPYA 2B9YA 1EP4B 4WFAQ 1D9DA 1FDBA 3R5BA 2BW2A 3W2VA 2VFUA 2RQCA 1NJYA 1PO6A 4FF3A 3CUNA 4YHHF 4WYWA 1LFPA 2HLUA 5D4LA 1JLFA 1BQNA 2JOQA 3Q24A 1A7GE 2JWNA 1R7IA 3QIPA 4KHPF 3U1MA 1X4CA 4EZ9A 4OI6A 4A8XA 2CQCA 1S6UA 2OFHX 2NUUG 4ILRA 3SQGA 3HFKA 3DYAB 3GILA 4DQIA 3I82A 5CZXA 1FRMA 4I6YA 2UV8G 1HBUB 2EFNA 2R7OA 1RTDB 1BWEA 1VBZA 4K50A 1WEYA 3UW1A 4WF9Q 4ZVHA 3KLHA 4RU2A 2ZE2B 3OUYB 4F50A 4IUFA 1IQTA 3HKWA 4IFYA 2MSSA 3NAIA 3MEDB 2YKNA 1DURA 2V4JA 2Z2MA 3CE8A 4ILMA 2CKWA 2GQ2A 3K7RA 4Q45A 4WXOA 4DSLA 2Q66A 4OHWA 2PMZD 1ZM4A 3KFWX 4H4MA 3NGKA 2BJDA 2LDYA 3CB4A 3CJ2A 4ICLB 1N56A 2YH1A 2KRRA 5HROB 1IQZA 4CO4A 3VAJA 2KFZA 3MEGB 4P6QA 3IRXB 2EFOA 4R25A 4CIOA 1JLBA 2UXCF 3NLCA 3DN9A 3BO2A 3DCAA 3V5RA 4WE1B 3MM8B 4HL9A 4EYIB 3CCZA 3UCUP 1VS3A 2J0SD 3CDEA 4LF8F 5AE1A 2YTCA 1N88A 3V6HA 2X1BA 2DJWA 1SJ3P 1TKZA 2RJZA 1VC0A 3PHEA 2V4QA 3OW2R 1HW9A 4HHJA 1KTVA 4KKOA 2OTLS 2BOPA 2HNYB 1KFDA 4NLUA 3TO8A 3JTOA 4FS1A 3TYTA 3BGUA 3KK1A 3OQ2A 2HRUA 1S4FA 2XMVA 4ZDNA 3TUZC 4XDDA 1KD1T 4JI3F 4QJVA 1NK5A 1REVB 3OSPA 1DQ8A 1KS2A 1U7LA 2O67A 3FSYA 5EUHA 3KK3A 3CCES 1HYSB 4J9RA 4F3MA 4ED1A 4Q43A 5J2NA 3G96A 2AYMA 4FF1A 3O5TB 2CJ9A 2VG5B 3GV8B 2QMWA 3I9V9 5GAGI 5F0UA 3CJ5A 4LIRA 4NRUA 5HMYA 4GC7A 2ASDA 5IWAF 4F2SA 2RNEA 1XWLA 1U25A 2FJDB 1RTIB 2I5JA 1K8AT 1F2GA 3QAEA 4AXJA 3O6QA 2JEJA 1M1KT 2XS7A 2D41A 4HH1A 2KG1A 5KFPA 4HTIA 1SV5A 3GQCA 2X51A 2KT2A 1UVJA 1U1NA 1S9GA 2C22A 1T3NA 2OH2A 3DMJB 3GR0A 5K5MA 1VQ6S 1ZYQA 1ULRA 2UVWA 2GHWA 5HMWA 1KEKA 1M5HA 2RD5C 3M8PB 1U1PA 3QLHA 1X9SA 4OZ1A 4C8ZA 5KFHA 3KK1B 2XO7A 2FY1A 2AJ4A 3I4PA 4NXMF 2FHOB 3TI0A 1JJHA 4WU2A 3R5DA 4A47A 5D3GB 2KZZA 2P9CA 3HI9A 1XMQF 5E0OA 1Y5NB 4O3QA 1FXLA 2F9JA 4B3OB 2L9NA 4ZP6A 3LH2S 2C42A 1WHXA 5G0RA 2X3GA 2J9EA 3LGNA 5C25B 4N56A 4K4ZA 4MIBA 2HMIA 5I4MA 1TVRB 3MR3A 2ZKTA 2PN6A 2ZUGA 3HHDA 4ZPWR 5B0GA 3N28A 5J1NA 3D0IE 1NEEA 4NLRA 4YB1P 3TAQA 3TUJC 4ECWA 2FIUA 1U47A 2ZZMA 1HWKA 2EK6A 5DDRC 1SV5B 4RBTA 3H25A 3CPWR 1Y00A 3MM5A 4KFBA 1S9GB 4KV8B 4QIWD 4K4VA 2HNDA 1IKVA 3H59A 1X4AA 4IO1A 4C8MA 2HHHF 4X64F 2RE1A 4FBTA 4KJIA 1S0MA 1TQLA 1HBNA 2GW8A 3A8EA 4A8WA 4IDKB 1NK0A 1OSCA 1F9FA 2MHNA 3TNVA 2DH9A 2D7SA 4B9LA 3CCLS 4JI0F 1HBMB 1OQ3A 2DNGA 2FHMA 4KGMA 4OHZA 4DJBA 1P9QC 3J80Y 1P1LA 2N4CA 3CD0A 4RBUA 3MURP 4JI2F 1EETB 3M2VB 3MAHA 4TU9A 1ZPWX 2VODA 1L5UA 2J9CA 3QGGA 5K14B 1J5EF 1W25A 3LP0B 1IR0A 2DITA 4U7CA 5KT7A 3KLFB 5FDLB 3B4MA 2DISA 3O44A 3CCSS 2CJKA 1BC6A 1YTYA 3MECA 3LQVA 2MSTA 3T1YF 4QWBA 3CT9A 2KDOA 5KFVA 3OTBA 5F8GA 1VQ9S 4BC9A 3QO9A 3E01A 3F56A 3I56S 3LWMA 5FD1A 1RT2B 1DTQA 1SC6A 3AJ2A 1HI1A 3FQLA 5KG7A 5L9XA 4WFNQ 1N54B 2M0GB 5B0DA 4ECRA 1LXJA 3UWTA 1G2EA 3MM6A 2VPXB 2CQ3A 2Z8QA 4ECSA 1D9AA 1A9NB 1SH3A 3VZIA 4ZS6A 4DFMA 1AW0A 3LO3A 2DGWA 3PXGa 4URSA 4ECXA 4TLQA 4YR2A 3HPOA 3KG0A 2KYZA 2U2FA 2AX1A 4RNNA 4OZ0A 2DIVA 3M05A 4G6VB 3S1TA 3SSQA 4TU8A 2D1CA 1D8YA 5F9LA 2K7KA 2MY7A 2QA2A 2PA3A 1NJZA 3RW7A 3S6EA 4ZMMA 4Q5VA 1S1VA 5LMNF 2OJ3A 4ED7A 1Y9OA 2KTQA 4KBIA 4RKUC 4QPXA 5EN1A 2O5DA 3I96A 3M6VA 3PW4A 5KT4A 3HT3A 1C0UA 1M90T 1X5PA 1UJ6A 4GO7X 2JC0A 1DAXA 4WTYA 3UD4P 2B7CB 2H9ZA 1VRUB 2ZH4A 1WHWA 2F1FA 1HNIA 3BB5A 4DUZF 4I68A 5L38A 1UL3A 1FJCA 2OMOA 4TKTA 4M8LA 3F41A 3NBPA 5GADU 2W7OA 4FVMA 2UZAA 3MTKA 1FD8A 3DLGA 4NYOA 3R1LA 4P7VA 1HPZA 4KHMA 2Z2LA 1FJEB 2RU3A 4ETXA 3TAMA 5LSOA 4XIUA 2JEIA 3FMWA 3AY0A 5DGAA 1GXUA 1NU4A 1V3ZA 2UU9F 3PX6A 5AXLA 5KG0A 3TP2A 2YKOA 5EGYA 3MR5A 3QJPA 1GNKA 5A8WA 1KC8T 2RF2A 4HYKA 1X4GA 4O44B 4RNFA 5KFCA 1KHVA 3MM9B 5GAEU 4XPCA 2OPSB 2XI2A 2UP1A 3P3DA 6FD1A 1LW0B 1QM9A 4J9PA 2Q43A 1M0SA 1PC5A 3MHYA 4EO8A 1NK4A 2BANA 5I3UA 4NWBA 3KG1A 3JSMB 1SJRA 4PG8A 4X4TA 4MIAA 4X4SA 2YKMA 1N5YB 5F8IA 3H5YA 2GGPB 1LK5A 3P49B 1OO0B 2CQIA 4MFBA 3SV4A 2MDAA 2OPPA 5DGBA 4BWMA 1C0UB 1VC5A 3OTCA 2CPJA 3L7OA 1DFDA 1N52B 2WSCC 2MHEA 2BM0A 3VAHA 3UPFA 5KFOA 2RSQA 3DRPB 2UUCF 3MOJB 4CH1A 3NG8A 3HVTA 2NZ4A 2AD9A 3HMJG 1N33F 2GO9A 2LU2A 4TNOA 4ID8A 3CIZA 4BHQA 3FRYA 3HVRA 1TUVA 4IOCQ 1HA1A 4WXWA 1HPZB 4WKYA 2Z0GA 5BYRA 5I42B 1BQMA 1RDRA 1D1UA 4LT6A 3H20A 1A6LA 2MQMA 1NK6A 3UDLA 2K1RA 4KSEB 3G6ES 2AU0A 3VAMA 3IR5B 3IGVA 1HNVB 2ILZA 2VZ9A 4PQAA 5KFZA 2DD8S 2KVIA 2EKYA 2DGQA 4DF8A 1S76D 2BE2B 2J5AA 1CQMA 1UFWA 1QLNA 3LF0A 2EVZA 1RTJA 3K8VA 3TVKA 1RAJA 2LEAA 3RAMA 2QFJA 1M5VC 4N76A 4DV6F 3NNCA 4AL6A 4RWXA 1LV5A 2IYIA 3MD3A 1SXLA 2ZJRQ 2HG4A 2Z4PA 3SEOA 2VKRA 5D4OA 1FESA 1OSDA 1JIHA 2VBYA 2V2KA 2X1GA 4EGLA 1XR7A 2VPYB 4RW9A 4ZPVR 4X2BA 3FJ2A 2ASLA 1TL5A 3ULHA 3HZEA 1TZ0A 2FC9A 5D8HB 4EFAC 1TP7A 1O51A 2VH7A 3ETOA 3LOUA 3V6DB 2BV3A 4L3NA 3ZC4A 2OFGX 3RB4A 2J6TA 2XI3A 4JYAF 3I55S 4JV1A 1DBDA 4ED5A 2D74<