2G1KA

Crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate at 1.75 angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
168
structure length
168
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Mycobacterium tuberculosis Shikimate Kinase in Complex with Shikimic Acid and an ATP Analogue.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Shikimate kinase
total genus 62
structure length 168
sequence length 168
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2g1kA00
1Q1QA 2N42A 3W6NA 1FL9A 4LBZA 3OEHA 1C4OA 4V03A 2D62A 1E94E 1YJ5A 4B73A 4UNNA 2FSFA 1Z63A 4TT3D 1ZM9A 4OBEA 4LPSA 2BIFA 1CJKC 3SFZA 4OK5A 4JJKA 1E79A 1OFUX 1E2PA 5FPTA 1DS6A 1P9RA 1AN0A 4BASA 1N5KA 1VCNA 1UM8A 1XMIA 2BV3A 2HT6A 5L3SB 2OHFA 4FIDA 2IBMA 3A1UA 2BOVA 2AL7A 1XEXA 2FMXA 4M1YA 1NL3A 5IT5A 2R44A 1DAMA 1RRCA 3GPLA 2OEPA 4TL9A 2GZHA 4EAQA 5DLQC 4XSGA 1OV4A 4Z1MA 4LHXA 4DHEA 2F1IA 1R10A 1II8B 2W6JA 3EIEA 1S3GA 1ONBA 3HR7A 5B64A 2QT1A 3OFNA 1KDPA 3B1YA 3M6AA 4PR0A 3W5JA 1XJQA 2AFIE 2PX3A 2ZRKA 4TMTA 1R2QA 3I32A 1T3LA 4EPYA 3NXSA 1U94A 3O47A 4I1VA 2O8EA 4AK9A 1XEFA 1ZIPA 4PHHA 1OHHD 2FDCA 4IXMA 5BYJA 1WE2A 4BRUA 1UKEA 2OSBA 1NP6A 3FE2A 5L3VA 2NO9A 4AURA 3LW8A 2IYUA 1N0UA 2FGJA 3A8TA 4LJAA 2R62A 2ZI5A 1ZINA 3A1TA 5FH9A 2ZRHA 1XTQA 2IA5A 1TTTA 2RGNA 3LDAA 1LB1B 1G64A 2IHYA 3QIAA 2OFXA 2ATVA 1NVWQ 1VIAA 3EW9A 4UXIA 4Z1MD 2IYVA 3F0TA 3MWJA 4URVR 4B32A 2QP4A 1JQJC 1YRAA 1U0JA 2NO7A 1NMXA 4NP6A 1H8HA 2WOJA 3KTAB 2CL6X 3SN6A 3I72A 3MJHA 4JSYA 5FOSA 4CF7A 3DM5A 1GP2A 2Q6TA 2R9VA 3TE6A 1E2QA 2HEIA 721PA 4TLDA 4A0HA 1CXZA 3MD0A 3HU2A 5JWOA 2VO1A 4FCWA 1IN6A 1Z29A 3QJYA 4NMMA 4A8JC 3PEWA 1Z2CA 2FV8A 1G7CA 3C41J 1M2OB 4NU0A 5HCIA 5JCZA 3T06B 3RS0A 2CLCX 4HB0A 5CB8A 4PZZA 1ZYUA 4HAXA 4TMWA 4OK3A 4E22A 2GA8A 3QPVA 2UVQA 2GRJA 2GCNA 2OM2A 5A0FA 2IUUA 4BEJA 4BECA 3GLGE 2ONKA 1E2GA 1E0KA 1XDBA 4BZXA 4HAVA 1RW4A 3HJNA 4TLEA 4YXWD 1I4LD 4PAQA 1OLOA 2BBOA 2FH5B 1KY3A 1E2FA 4OI4A 4L9WA 4B47A 1QDEA 2CDNA 2JLZA 1RE0A 3QPUA 2JGNA 1ZUNB 4HLDA 4KHZA 4LJ8A 5KDOA 3SDZA 5LBIA 4BEBA 1S3SA 4KFTA 5CYPA 4BE7B 2ZI9A 1R0WA 3U3RA 1J8MF 4QBIA 3U60B 3EA0A 4K81B 2N46A 1P3JA 2JLSA 3RRZA 4B75A 2AWOA 2HLDD 3OAAA 3P27A 1XJ0A 4BFTA 2PT5A 3SE0A 4A6PA 2F3TA 5EE1A 1WQ1R 2J7PA 1L8QA 5TB5A 3K0AB 1QG2A 2UZ3A 3QOFA 4HB4A 2ZYTX 2FA9A 3ASZA 2ZSDA 2GXAA 1KO5A 2XTZA 2ZS8A 3H1TA 4QM7A 2OAQ1 1HY3A 1KI6B 1Q1ZA 1XB2A 1D9ZA 4IDPA 1QRAA 4KU4A 1DARA 4XTCS 821PA 2P0EA 1A7JA 1IN8A 1Z47A 1JI0A 5DYGA 4DLRA 3GJ7A 5GADl 4B71A 4RZ3A 1E9BA 1YKSA 3BWDD 3IQWA 4JLBA 3H4MA 4V0NA 4B44A 1W4CA 3D6TB 4FMBB 1FX0A 5DI9A 5DH9A 5DIFA 1W5SA 5CYOA 3GFOA 5FFMA 1KSGA 4Z54A 4ESVA 1YZLA 1OHHA 1GG2A 1Q3HA 1W0KA 2ZJYA 3Q5DA 1DBSA 5JHHB 4FD2A 3ZS8A 4BWYA 2YWGA 4YDSA 3THYB 1AGRA 2HLDA 2OXCA 1G3UA 3GLHA 1XNJA 3QE0A 4HZUB 4F4IA 2GCPA 1J2JA 1W47A 2AXPA 4TLCA 3R8CA 4ACBA 4CEJB 1VHTA 1UBGA 2MSEB 4AC9A 2BCGY 4DSNA 3CNNA 2PEYA 3T1OA 3GJ6A 2H18A 2QMHA 1S4QA 4MH0R 3H86A 5J4HA 2CLSA 2FZ4A 4Q4LA 3KX2A 1QHNA 4A8JA 3D8BA 2QP3A 3RWMB 4PHGA 4XTRA 1B0UA 1SVIA 3AVUA 3QG5A 1M34E 5EXSA 3CONA 4UXHA 4ZIRA 4OJQA 2IL1A 3T1QA 3Q8XB 2HXSA 1SXJA 3CPJB 4KSCA 2AHOA 2RB4A 1FZQA 4KCGA 5EUMA 4Y0AA 2GBLC 2V7QA 3RWOA 1OT3A 1HEIA 3GD7A 3K53A 4TSFD 1M74A 3DO6A 2RKOA 3UMFA 2ZIAA 2NPIA 3HYRA 2ZRBA 1XF9A 2DFKB 2DYKA 4NKRA 4WAUA 2MSCB 4F4JA 2DFTA 3LVQE 1IXRC 3IQXA 2IEZA 1PLJA 3KQLA 1IN7A 4LBWA 3TLXA 1MKYA 4GPTA 4GNKA 4EKDA 3HYTA 2QI9C 2JIZA 1A4RA 5GJWC 2XB4A 2OUKA 1T91A 3RSOA 4RCYA 3B9QA 4PO9A 5IDVA 3NHBA 3EASA 4DCUA 4YXWA 4M1TA 4HUQB 4HUQA 2WKRA 2VIIA 2A9KA 4A2PA 4GOXA 5BXQC 3P1JA 3AVPA 1GILA 2O8CA 1Z6XA 3AP1A 4LHWA 1QHSA 3KUDA 1YHNA 2C8VA 2IXGA 3K70C 3TUZC 2ZE8A 5BW8A 1MABB 4TL8A 1CIPA 3ZH9B 2VF7A 3TUIC 3BC1A 3E70C 1ZNZA 1FFHA 1W36D 1X8LA 3Q7QA 3ZS9A 4QJ4A 4XVUA 1XCMA 2X2FA 2BKUA 2GETA 3ND8A 2WWHA 3IBYA 3NHAA 1OH8A 1Q1BA 4PPNA 4PAOA 2GJSA 4AG5A 2IK8A 5CIWA 3FKQA 1NLFA 2K5UA 5AR1A 3L0SA 3O8BA 2NMVA 2FOLA 4PSVA 1SZPA 4N0DA 4AD8A 4US0R 3DPUA 3EIQA 5BN4A 1RIFA 4DLXA 1AM4D 3CLVA 2WWWA 4Q7JB 5EJEA 5J4LA 1J70A 1OYWA 3R7WB 2FGKA 2NZ8A 2EW1A 3ZVMA 3LLUA 4HDOB 4KVGA 2ZRPA 3NBFA 1K5DA 4JIMA 5TMPA 4EJSC 2V54A 3KTAA 1NBMA 3BAFA 3QI2A 1Q57A 4HAWA 4M9ZA 3UKDA 4G5QA 1DPFA 3QXCA 3VX3A 2CXXA 1KI3A 3L43A 3WBKA 5C2JB 1E98A 1Z0JA 4DVGA 1IXZA 3FVQA 2OG2A 3AVXA 1KHTA 3J81k 4R71A 2G0NA 5SZJA 3RS2A 1NG9A 3W6PA 4IOLA 1FTSA 1E2MA 3TBKA 3G5UA 4NCKA 4UNSA 2PCJA 1QHXA 3BS4A 1JR3E 1QVAA 3JZMA 2PMDA 4B3FX 1F6BA 1N3BA 1ZM2A 2ZI4A 3CNLA 4AKEA 4D80A 1FW6A 4DIEA 1KDOA 4YQFA 3EZ2A 5EUQB 1G6HA 1VG8A 2VP6A 4AG6A 2CE7A 3IKJA 5E7JA 5JJLA 1EWQA 1DTSA 1ZP6A 2ZRNA 3M0EA 1G20E 4Z8XA 3U7FB 2Z0MA 5FOTA 4DC9A 4IRUB 4JJZA 2YINC 5FBVB 4HB2A 2OESA 4YMSA 1JEDA 3TVDA 3ZVNA 1IY0A 2ZYWX 2ODEA 3QNUA 3X1DA 1BYIA 3MMPA 2W6JD 3P26A 3R8FA 3KKMA 3NKVA 1A2BA 1IQPA 1GRQA 4ZDKA 1L2TA 2E1RA 3CH5A 4A82A 3TSZA 1ZRHA 2IS4A 3DKVA 3AVTA 1AZSC 1KI7A 1XCPA 2GF0A 2LWIA 3VU9B 4V0OA 3GLIE 2EQBA 1XFAA 4TMVA 3TJZA 2BKEA 5FBQB 5TXGA 4U00A 1W0JD 2HCJB 2DB3A 4LPKA 1YZKA 3BH0A 2OBLA 5EXTA 3U4QB 1P62B 3VR1A 3KB2A 3CWQA 5JRZA 4URWR 1AQUA 1ZBDA 4D25A 1QHHB 4ARZA 1W48A 4PC7A 1GOTA 2PCLA 4KO8A 3T1TA 3U4QA 1Z28A 3LQRA 4DDVA 2XSZA 1E9AA 2J7PD 1YR8A 1IN5A 1HE8B 1ZM3A 4LV8B 2GDJA 4QGAA 3U6KA 4HDCA 3WP0A 1OJLA 2W2XA 1E2EA 3SHWA 1RRFA 2WVJA 5P21A 3K0EA 1GWNA 5FTLA 1HURA 3ECCA 1Z6TA 2QY9A 2BEJA 1XTKA 3CZPA 2R6CA 4Z8YA 1Z0DA 1NN3A 2L0XA 5HTKA 2NQ2C 4DSTA 2W2TA 3AF2A 3K9HA 3CF6R 1UF9A 3KL4A 1KI4A 4M21A 5AJWA 5BYKA 3RHFA 4URZR 2OLJA 3EA5A 4RD4A 1AKYA 3B13B 5AWFC 1PJRA 1Z06A 3HU1A 4IDHA 1CJTC 2XSZD 4MUBA 5B57C 1Z3IX 3HR8A 2WIAA 4D4KA 1BMFA 3U3MA 2XB2A 2ORWA 2WJGA 621PA 4QJ5A 5CITA 4LJ7A 2GTPA 5HZHA 5JJIA 3MGCA 4IDNA 3FMIA 3PUZA 2V3CC 4KLNA 1N0VC 1JQLB 2ZJOA 1KZ7B 5FOXA 1GRRA 1O3YA 3UXMA 3KFXA 1L4YA 4CYMA 1K8RA 5JSZA 1XU4A 3FGNA 4HB3A 1XWIA 4Q4AA 3CRMA 2ORVA 2RGDA 4BFVA 1CR1A 2J0UB 2B7BA 1JECA 4HLUC 4DDTA 3EPKA 4NCHA 1G7RA 2FFBA 1MR3F 4PX9A 4AY2A 2QNRA 421PA 1XXHE 1NI3A 1XZQA 4GI7A 4C0SA 2O8DA 3AF0A 3DVLA 2EFGA 3KJGA 3GLFE 1GNQA 2VHQA 3T34A 1G41A 2ZJBA 3MFYA 4KSBA 2PT7A 1U8AA 3CRVA 5SZHB 3AKYA 1KI9A 1R0YA 1E2IA 2ZR0A 4M0LA 3I92A 1W36B 2IYSA 4B3XA 5JRJA 2ZETA 3U61B 1BH2A 2Z43A 3EG5A 1KSHA 2QAGB 1T3SA 2IUTA 3LAWA 1F2TA 3K0FB 1IJEA 4URYR 5CLQA 3T12A 1XEXB 3OE7A 3RSLA 1XD2A 4WBSA 3CM0A 2AX4A 2J46A 4MRNA 2WPDA 2I1QA 2FPKA 1MH1A 2W6ID 3NIBA 4Q21A 2QRNA 3KKOA 4OI1A 3FDIA 2FFQA 4QKQA 5LD2B 4ITRC 1YU9A 2FFHA 1TF2A 4YC7A 5JSZB 2AN9A 1LS6A 1GNPA 4TL6A 1IHUA 2CVHA 4MGZR 4A0GA 2QGZA 4TYYA 1MOZA 4GL2A 4I1UA 5CK4A 2IYZA 3D7MA 3FFAA 3CRQA 3SBDA 4IXNA 3Q5EA 4PXAA 5JEDA 2G1KA 2B8WA 5E95A 5JJKA 5EZ6B 3RS3A 5CLLA 3SYKA 4TQ9A 1CR0A 1OB5A 2I1VB 2UKDA 2OE2A 3W9YA 4R9UC 4II7A 4E07A 2H8KA 4HLQB 4DCNA 4BFSA 3BFVA 4P33A 2B6HA 4IKEA 5AJZA 1KNXA 2JATA 4MKGA 1QF9A 1U99A 1D2EA 2Q21A 2NPFA 3SZRA 2H57A 2OCBA 4NCJA 4JLVA 3V4RA 4B34A 2WJIA 2GEVA 5C4MA 4BPBA 1TEXA 1U90A 1F2TB 1II0A 3K0FA 4Q18A 3THXA 4OKSA 3OZXA 2NO0A 2QN6A 2BMDA 1SXJD 4Q03A 1KZGB 2NGRA 1Z83A 4JBWA 4LJ6A 4BLPA 3EWAA 1W4BA 3MWYW 1AK2A 4X8LA 2GEUA 4QNRA 3K70D 2EWWA 1FMJA 3ZQ6A 1DOAA 4MKHA 3L0OA 3QKRB 4OQMA 3CRW1 5AUOB 2D3WA 2ZUCA 1VTKA 2VL7A 3GLHE 3K70B 2XITA 4UKDA 3QF7A 1AIPA 5HCNA 3IDQA 4ZDWA 3IIKA 3PEUA 2ZSEA 3IHWA 4ILEA 5HR5A 3UWKA 1SKQA 3C5HA 3B1XA 3K0CA 1TX4B 5AJYA 3U7GA 5AUQA 2IEYA 4C0HA 3LH5A 2WWIA 1UFQA 4EUNA 1ZCBA 1OH7A 1YZNA 1JXOA 4Q4HB 3BB1A 221PA 2J45A 4D4LA 4U02A 1QZXA 1R5BA 3B1VA 1G16A 4NBSA 1CJUC 2D4HA 4C0QC 3AB3A 1ZU4A 2WSSD 3OIWA 1VDZA 1OKKD 5CJPA 3AVWA 2DFLA 3WYAA 4BGDA 1DO2A 2AD1A 5IRCD 3AF4A 4LHZA 4IW3B 3ADDA 1E0AA 4MUAA 2IWRA 5EZ5A 4PC1A 4Q7LA 5KSPA 4MDEA 4LUCA 4B2IA 4QHSA 2GF9A 3GJ3A 1VCIA 5TY0A 2UZIR 3WXMA 5BN5A 2JAQA 3WBJA 2BBWA 3FMOB 1CR2A 1YR7A 2GEDA 2J3EA 3HU3A 3PR1A 5KNBA 5KTYA 4BUJA 4FCTA 1ESNA 5DHFA 2BJVA 4QG7A 2P65A 1BOFA 3BRWD 5DHAA 5EXXA 1YZGA 5L3SA 3W8NA 1EFCA 2ATXA 3UG7A 4CDGA 5BWMA 1E9SA 1E6CA 4D4JA 1AS3A 4LJYA 3V00A 2DBYA 2NO1A 1OXTA 1I2MA 2BBSA 2VP0A 2WSSA 3L0IB 2A3RA 3ZVLA 1OW3B 2XZPA 2FWRA 3ADBA 4OI2A 4TMXA 4DLUA 1R5OA 4B3DA 4D0GA 1HT2E 2IYWA 1KOFA 4S2EA 2F9MA 3EXAA 2BWJA 5H68A 3SHFA 3QENA 3KUCA 4FXPA 4GFDA 2EFCB 4JLOA 1KMHA 1VKJA 4RFSA 2C2HA 5LPNA 1D2MA 2IYQA 4ZCMA 4Q00A 1Y63A 2G83A 3DMNA 2CL7X 3WHKA 2JJ1D 4EPXA 3NH9A 3JZAA 4DJTA 5LB2A 1OB2A 4RD3A 4DCVA 4Q4AB 2KJQA 4PZYA 4AKIA 3CWZA 2OZEA 3GQBA 2J0UA 3SS8A 4TTPA 3UPUA 4P4SA 1OXUA 4RD2A 1US8A 4X8HA 2YWHA 3VKGA 2IXFA 3TR0A 3LA6A 4EPRA 1SKYB 1Z0KA 2EYUA 1J8YF 4M4SA 1FX0B 4GT1A 4A2QA 4DSOA 5GVSA 4EQ6B 2ZANA 3C4JA 1OFIA 1FNNA 2FE4A 4O2RA 3GJ5A 2ERYA 2E9SA 4BFYA 4M9SA 4ZPXA 2XNSA 1E1QA 5HE9A 1NKSA 2H92A 4NYIR 5CDFE 4B3BA 3A6PC 1GNRA 5CM8B 5L3QA 1AQYA 3TNFA 1P9WA 4DLZA 2WAYA 4MGKR 1TUIA 3CR7A 1W46A 3LY5A 1NY6A 2RCNA 4MA4A 4E03A 3AKDA 1XRJA 4V02A 1NNEA 4JYBA 2O8FA 1F2UB 3X1ZA 1UBFA 4U5XA 5C18A 4GZLA 1CBUA 3KJIA 1NN5A 3PQCA 2C04A 4Q19A 3PVSA 1BS1A 5IK2A 2JASA 4DRZA 4G5RA 4NYJR 3DM9B 1JR3A 1SVMA 3TRFA 1WCV1 5J4YA 1VPLA 1XPRA 4QFMA 1UAAA 4CEIA 5K8UA 1J7KA 4MRRA 4PPFA 3U6BA 4MRSA 2G9NA 3NC1C 4WIAA 3ADCA 3SI7A 2BMFA 5K8IA 4Q1BA 3NBYC 3SR0A 4LV5B 1RPZA 1NBME 3THYA 2V9PA 4ZV4A 3EPJA 2A7QA 4Q7MB 4KYIB 1G6OA 4ZO4A 5B30A 1N6NA 4KFSA 2IF0A 5DYIA 2V7QD 4MRVA 2J0SA 2HDNB 3B2EA 2J87A 2P2LA 4XIGS 3GLFB 5G3YA 2IC5A 5JI2E 2YOHA 3DOFA 3N2IA 2QQ0A 4UNQA 1WBDA 1QVRA 2OCAA 1NVVQ 5KNDA 3THXB 2CEAA 1TMKA 4LJ4A 2GJ8A 2IF2A 2QSYA 2CCGA 4JBXA 1S96A 4GP7A 1G3IA 2O5VA 5AK0A 4TYQA 1NMYA 2V1UA 2QTFA 2WJYA 3REFA 4EQ6A 3SYLA 1K6MA 1KDRA 2XXAA 3RS5A 1P75A 2X8AA 3TR5A 3DZDA 3QKRA 1QHGA 2HUPA 2PLRA 5EP1A 3BB4A 3AVQA 4JMPA 3FHTA 2O8DB 2QG6A 1VCOA 2KSQA 4CEIB 4PQRA 3VKHA 2VHJA 1T8TA 2BVNA 3FOZA 1YR9A 3AM1A 3P4YA 1GL6A 4RJLA 5B58C 1IONA 2QAGC 1ZD8A 4R2IA 5FPSA 2JLYA 2ODNA 2V6JA 5EXPA 4Q1EA 3CB4A 4A8JB 1S9DA 5JFGA 4C0BA 5KSYA 4HZUA 4R7ZA 2ZRJA 4JLDA 3BERA 3I3SR 1E0JA 2OV2A 2X1VA 2OCYC 3KFVA 3KQNA 3QVVA 2PJZA 1UKYA 4MKIA 3TKLA 4MDFA 3LVRE 3LQQA 1KI6A 1CRQA 2VA8A 3SOPA 1MRSA 3AF3A 1DAEA 2BBTA 3SJBA 3ZIAA 1TEVA 3AF1A 3QXHA 1KK2A 1KSJA 4DLVA 4DT1A 2F6RA 4E5UA 5JHGB 1GSIA 4Q4JB 2A30A 4H1UA 3AKCA 3N5CA 5IHPA 1YVDA 4XSHA 1KKLA 2QAJA 1W4AA 2JLRA 5DISB 3A4MA 5CB6A 4D26A 4DLSA 2QBYA 1E0SA 4Q4HA 2ANCA 3L0PA 2REBA 3I1FA 1S1CA 3LWNA 1SXJC 4O0MA 1G291 5BQ5A 2ZRMA 3TW4A 3GLFA 4MQBA 3Q7PA 1JAIA 4OHWA 4ERNA 4PZLA 1X8KA 2W2VA 4QOSA 1XMJA 4F38A 3FHCB 2GJ9A 4LSGA 4E09A 4KI0A 1LVGA 2FSHA 1PV4A 1MT0A 4Y0VA 4QC2A 1M7HA 4ZKEA 1ZW6A 5J5CA 2XNDA 5TV2A 2RGBA 4DCSA 5KDLA 2WKPA 2IXEA 1NG1A 3C5CA 3ZZTA 4QM6A 4RD0A 1OSNA 1P73A 1EFUA 1F3OA 1T9HA 4NYMQ 4TYNA 1KDTA 1E69A 2XZOA 2D7CA 2BM1A 2HF8A 4P32A 1XJCA 4WA7A 3VR4A 4NCIA 2W00A 4V0KA 1R7RA 2WMOB 1EFTA 2VSFA 2ZE6A 2YNMA 2JDID 1GZSA 1COWA 3LBIA 4C0JA 4ASUA 2B21A 2CHQA 4JVNA 1W0JA 4KITB 3W3AA 3TSOA 4QGGA 4I1SA 5FPHA 2WSMA 1E2KA 4DB2A 2WJJA 3DL0A 2O8BB 1RJ9A 1RJ9B 3NVAA 4H1VA 1P2TA 4YMVA 3KXKA 3IPXA 2PEZA 2D06A 1EFHA 2C9YA 4W5JA 5KDDA 4A36A 1OE0A 3AEZA 3K0SA 4KJZA 1WXQA 2DR3A 4HAZA 4YMUA 4LWZA 2F9LA 4EPWA 1XTSA 4C2TA 1XX6A 3ZLJA 1GKYA 4WXPA 5G41A 3VTKA 2WTUA 1Z07A 4I99A 1ZNYA 1DAHA 2MSDB 1N6KA 2W83A 3Q72A 2ZRDA 1NSFA 2Z6VA 3AUYA 1JAHA 4L8GA 1C1YA 2X19A 3EWSA 2EFDB 1Z0IA 4Q1CA 4JLMA 5FPKA 4O3MA 4DZZA 5EP2A 5KUTA 3OEEA 2QMEA 1NIJA 2R8RA 4X8OA 4AYWA 2FEOA 2GXUA 4G3XA 4JT4A 1ELOA 1XP8A 5JS7A 4CGZA 3T61A 1U0LA 3K9LA 4QXAA 1XBTA 4ZIRB 1OIVA 1TU4A 2W0MA 4OHVA 5GVRA 1TU3A 4DXAA 4TZ6A 1NVVR 4UNRA 3CIOA 3MG9A 2YZ2A 2O0JA 5BN3A 2IYXA 3T1VA 1NLYA 1R6BX 2GVZC 5FUWA 2JLXA 2YOGA 2GZDA 1TQ4A 1G21E 4NHOA 4R98A 2OLKA 4JLKA 4BLSA 1RC8A 2QQEA 1EWRA 3WRXC 3R9WA 2NOAA 5D3MB 1QHHA 2I4IA 3RNLA 4FMCB 1G19A 2XAUA 4RZXA 4OYHA 5L8VA 4NDZA 3CNOA 3QPWA 1ZIOA 3K0AA 3PUWA 3SJCA 1KJYA 2GILA 2ZRCA 3U3OA 3ZQJA 3L8ZA 3DHWC 1SVSA 4NE2A 1AZTA 2FSGA 5JWRA 4UNPA 3RS4A 3UWOA 1E32A 2FEMA 2CCJA 3TW8B 1UEJA 1QHYA 2VSOA 4CT5A 1CKEA 2PZEA 3ZIAD 2P5SA 3HP1A 5AUPB 3IEVA 3BFKA 2O8CB 2JJ8A 3U7HB 4HLCA 4D0LB 3TSWA 4AWXA 2Q3MA 4GZMA 3BIFA 1E2LA 1TADA 2F3RA 3GJXC 1XEWY 4FWIB 4PO8A 1G3MA 2Q9AA 4X8MA 2YC2C 2A5YB 1NKTA 1OKKA 1LTQA 2WAXA 1UDXA 1DAKA 3DOEA 3WMEA 3U2QA 3KQKA 3EC1A 4ON9A 3GLHB 4TYPA 3T15A 2LKDA 2J41A 2GESA 2R6GA 1XTRA 1GFIA 1W2HA 4MKFA 1A2KC 2R65A 4K46A 1DE0A 4BLQA 4WZAE 4AI6A 4EFNA 3GJ4A 2G0TA 3NH6A 1DELA 2WICA 2KI5A 3GEEA 2C5LA 3K0CC 2RAPA 3SQWA 2HT1A 5FR1A 2P6UA 1N6HA 1E2DA 4FMDF 4LHYA 3ZZUA 4KODA 4PQYA 4Q48A 4WOPA 1HH4A 5JLJA 5KNCA 4IDOA 1XXHA 4KBGA 4EPVA 2WWGA 2X2EA 3W90A 3CF0A 1F48A 2PX0A 4R2HA 4NTZA 1NSTA 4RVCA 1NF3A 3A37A 1W7AA 5IK2D 1XD2B 1G8HA 1HTWA 2YJTD 2DWPA 4B3CA 1QBKC 4QBHA 3SYNA 4Q7KA 3EIHA 2Q9CA 3PFIA 4PHFA 4ZDJA 4OQLA 1XPOA 1GM5A 4EFMA 4WXRA 3RLFA 1KO4A 1GL7A 4JL5A 1NN1A 2WBLC 1LF5A 2P67A 2CJWA 1OIWA 3B1ZA 4TMKA 3VKWA 3U44A 1SVOA 1N6RA 4NZYA 4HAUA 1VMAA 5EP4A 1II9A 1BYUA 5JBQA 4Q9KA 1V43A 3B82A 3UIEA 2WOOA 3UK6A 3RANA 4CEHA 5GJCA 2C96A 1QHIA 5EP3A 5KPDA 1SHKA 3UATA 3W34A 3V4FA 1N5LA 1KNQA 1Z5ZA 3RC3A 2Q0HA 1KI1A 4TLAA 3R20A 3EZFA 1ZNXA 2FJUA 1DAIA 3EAQA 3THWB 3THWA 4ZI2A 1KY2A 2VH5R 1YE8A 1IY2A 2ZSAA 4IJMA 1K5GA 4BFZA 1VYTA 1DG3A 4B2LA 4EDHA 2WIBA 1TF7A 5CDFA 2EWVA 1Z0FA 3FKSA 3B60A 4M8NE 2QROA 1GDDA 1BKDR 3WMFA 3BD9A 1QG4A 4NH0A 3QF4A 1PLLA 3RDPA 1ZM4A 3FB4A 5HKKD 3BJIC 3AV0B 1N2CE 3I8SA 3LX5A 4NONA 5IF9A 1G8GA 3QG1A 2CHGA 4U7DA 2DY1A 2VHUA 3LW7A 3NTUA 5JMTA 2ZXUA 1WP9A 4FW9A 1YZQA 3K8YA 2VSXA 4M1OA 2CHVA 3R9IA 4JT2A 2J5XA 4RD1A 4P4UA 2ZQ5A 3B85A 2H17A 4Q9LA 5A5GA 2VLIA 3GLGA 3ASYA 3RVBA 4DIDA 4YMTA 4LZZA 1VG1A 1NMZA 3OAAD 2D74A 3ADKA 2ZS7A 4OL0A 1JNYA 1RRPA 3GLIA 2QTHA 3WMGA 4I81A 4JVMA 3GEHA 1G4UR 2IYRA 2REXB 3IIJA 3VR2A 2V55B 4F7WA 1ZCAA 2AWNA 3PUYA 4A0RA 4JKIA 3VU9A 3V9PA 5FTMA 4EJSB 3B78A 3SJAA 1CS4C 1TAGA 2R2AA 1NJGA 1G9XA 4AYTA 3N2EA 4PFSA 1NJFA 2H5EA 2YWFA 4L4UA 1IAQA 3F3YA 1GITA 4B2PA 3Q3JB 3IILA 1GTVA 1WA5A 1FTNA 2C9CA 2WM9B 1G17A 2FNAA 3OEHD 5D3QA 3VR5A 3MUFA 3QF4B 1X8JA 2A78A 4MGIR 2CK3A 2PH1A 4P4TA 5C4GB 3SEAA 3NEJA 2Z4SA 3X1XA 2PJRA 4DWJA 3MSXA 4B35A 1W0KD 1YQTA 1Z6GA 1ZU5A 2KBEA 3QKTA 2BEKA 4HYYA 2W6IA 2IYLD 2GNOA 2Z4RA 2CNWA 1W36C 2V6IA 1KI2A 2ZE5A 2R6DA 2QMUA 3ONWA 1D9XA 4Q1DA 4YLGA 1IXSB 4LV6A 1MO4A 2LCFA 1F2UA 3PENA 4O2LA 3X1WA 2J1LA 3LLMA 2Q3HA 3FWYA 5CIQA 5CM9C 2IS2A 1A82A 3BOSA 2C9OA 2QEQA 2BM0A 4L9SA 4MITA 5M04A 1Q12A 2PBRA 1S9HA 5J4VA 1E1QD 3B1WA 3MCAA 2O0KA 3H84A 1IY1A 2QRZA 3OFND 4ZKDA 2JLUA 4O25A 2YHSA 1VIYA 5L3RA 4JVLA 2REOA 1MO5A 1P6XA 1R8QA 3KB1A 2F55A 4XOIA 1TUEA 1X86B 4EIWA 1N0WA 2GZAA 2A5FA 1AKEA 1GUAA 3F8TA 4QBFA 1XMSA 5B2ZA 2ZAOA 2ZROA 4M2LA 2WZQA 3MRSA 4G01B 3VHLB 1U9IC 1S8FA 1AGPA 2Q3FA 2BDTA 3I73A 1FNMA 2CCKA 2P6RA 3BK7A 2H7VA 4JVSB 4BLTA 3REGA 1Q44A 3I5YA 2IWHA 5JEEA 1FPMA 4F91B 4LHVA 1G3RA 4EPTA 3AP2A 4IEEA 1TNDA 4JLNA 2GHIA 3KXLA 1ZAKA 4DEYA 1IN4A 4URXR 3CO5A 2AXNA 2FF7A 1UEIA 3K09A 1M1YE 1R0XA 4PHTA 4BFXA 3NDPA 4EFLA 3W5IA 4Q5IA 2O0HA 1XEWX 2JLVA 3SC3A 4LYAA 1FQKA 2GXSA 1CTQA 1IBRA 2IHBA 1KIMA 1TQ2A 2N1BA 4LYJA 2EU8A 1I4TD 4W5WA 2QPAA 1NY5A 1ZUIA 2PZGA 4AKGA 3FKSD 4D4MA 3NG1A 4DLYA 2ZVPX 4OQNA 2VP9A 3P32A 4Q1AA 3U3JA 2GJAA 2DWQA 1KK3A 4LGMA 5DN6A 3UG6A 1G18A 3DKPA 2V8OA 3JVVA 2DHRA 4A9AA 4C4PA 4DLWA 2GKSA 3RABA 3RRNA 3IGFA 4QGHA 4XVRA 2BMJA 2ZYVX 1E9RA 2CMKA 3K9NA 4C0KA 4GP6A 3BFXA 3WYGA 4Q9JA 2MMGA 1TPZA 1X3SA 1PUJA 1T5LA 3WY9A 2VP2A 5FL7A 2BCJQ 2YWEA 5JCPA 4POAA 3FTQA 4N3NA 4BFWA 2VPPA 3T5DA 3QBVA 4C30A 3MLEA 3NEYA 2GWHA 1YZUA 3W3ZB 2IW3A 4PC3A 4RSGA 1U0HC 2GJKA 3OF5A 2BC9A 1UKZA 1S0UA 3QBTA 4CT4B 3LXRA 2CBZA 4FINA 4KAXA 4KFUA 2ZI7A 3AKEA 3IPYA 1G8FA 3CW2A 1IOZA 4HEJA 1KAOA 4MYUA 1SULA 2ERXA 5L3QB 3KQUA 1PLKA 2CNWD 2FSIA 4US2R 4RFVA 3TUJC 4J0QA 2QP9X 3IEUA 2ZU6A 3AGPA 1W2GA 4Z51A 2RGNC 5KPJA 2JCSA 1RFLA 3LRPA 1CEEA 1BO6A 4H9GA 2F43A 2F43B 3NC0C 1F5NA 2Z83A 4M9QA 5E4FA 1FOEB 1NVUQ 5FBWB 1EX7A 1EK0A 2J59A 5EE9A 4TLBA 2Y8EA 3RRYA 2IUSA 2O8FB 2J0VA 1D8TA 3PEYA 4KYUA 1G5PA 1NN0A 2OFWA 1E3MA 4D0NA 1TL7C 3B5JA 3C16C 2ASEA 2C99A 3T35A 1D5CA 1R4AA 4JYCA 2ZUBA 2ANBA 3A36A 5FUVA 4M1MA 1T8UA 4PAMA 4IFBA 5UKDA 1KJWA 3QXSA 2OO7A 1T4GA 4LRWA 3ZD7A 4DEXA 2ZPTX 1PUIA 2A5DA 1FP7A 1E4VA 2HF9A 1ZVQA 2QAGA 5FL3A 4JKYA 2QZ4A 2G1JA 4FWTA 4BFUA 2ORIA 5K8LA 3RYTC 2ZREA 3EC2A 3UANA 5JECA 5HPYB 1GKIA 1Q21A 3O8DA 4F92B 4WW0A 4ZCLA 1HYQA 4KLZA 3TAUA 2YV5A 3AH8A 2H16A 5TDHA 1ETUA 1HQYE 3HPRA 2G88A 2FG5A 4XH9B 4JL6A 1TQDA 3S1AA 2OXRA 1M7GA 3Q85A 3C7KA 2PL3A 2A5GA 2JLQA 4BLRA 1E1RA 5A4JA 2J9RA 4M53A 1U8ZA 4TWZA 1J99A 3A58B 6Q21A 5JS8A 4A92A 1EGAA 3PITA 1SXJE 2DCUA 1WMSA 4N0EA 2GXQA 4RFSB 3B9PA 2E87A 2QA5A 3U5ZB 4G5OA 1UJ2A 3U44B 3VHXA 2XNDD 3B8HA 3GJ0A 1GAJA 2WKQA 2GVDC 5F98A 2HXYA 1P7CA 2CVFA 2QM8A 4LCBA 2OILA 1W1WA 3SBEA 3AVYA 1OFTA 4IFEA 4N1AA 3WYFA 4CEJA 2YOFA 3RS7A 5E7MA 4DKXA 4Q9HA 1I4DD 1Z6AA 3TQFA 3QUSA 3SNHA 2FZLA 2QE7D 3Q9LA 1FP6A 4KFRA 2JIZD 1D6JA 1JXMA 4IOJA 1JR3D 1HUQA 1CU1A 2AFHE 2FPLA 2JDIA 2KBFA 2X77A 2ZRGA 1NIPA 4QNMA 1W5TA 3HPQA 1HQCA 3AUXA 2IYYA 4RZUA 4MYCA 2YC4C 3L82B 2ZM5A 1M6NA 2I3BA 4F93B 4LC0A 4JS0A 4OHYA 3P20A 1LFDB 5H1YA 2WJVA 3I8XA 2VHCA 2HJGA 2ZRFA 1PZNA 5CJ2A 4BRWA 1W4RA 1TQ6A 4DDUA 4B74A 4Q47A 3VX4A 1RRGA 4LBYA 4K8OA 3WHLA 4PO1A 5HE8A 2OFOA 1XD9A 1VYVA 1WRBA 3BH6A 3VR6A 3ICQB 4LK2A 4ESHA 4L5BA 2TMKA 3SQXA 3GEIA 1WDTA 4Q1FA 1LS1A 2IT1A 1B23P 4YONB 1KSFX 4AYXA 4W9MC 5H70A 1EESA 4URUR 4OI0A 4V0ME 2EYQA 1Z2AA 2YKGA 3A1WA 4GOJA 5SZKB 5EE0A 3PIRA 1Z08A 3ZD6A 4P4SB 1J90A 2OCPA 4A6XA 3UMSA 1DEKA 1UADA 4MYHA 4B3GA 2QPTA 4MRPA 1CF4A 1T5IA 2IS6A 1ZC3A 2XOKA 5AJXA 3A1VA 1FUUA 3BE4A 1LNZA 1VG0B 2RGXA 1ZD9A 4IVPA 2V1XA 3FFBA 3K1JA 3ZDQA 2ECKA 4BZQA 2RGGA 2WPDD 1E9CA 3GMTA 2CL0X 4DSUA 2VTKA 1H8ED 1R5NA 2W0SA 3QVUA 4IEIA 3NBZC 1SGWA 3ZZ0A 1DAGA 4GMDA 2XZLA 4Q4JA 1UKVY 3C15C 1LV7A 1H8HD 4CRWB 2GCOA 3BH7A 5G53C 3SJZA 2GBLA 5EQTA 4YMWA 2QSZA 1S1MA 1S2MA 2BMEA 5FOWA 1NVXQ 4HZIA 3VAAA 1X1SA 2P3SA 2VP5A 2ZYUX 2WWXA 3LNCA 2NTYC 4HDQB 3IBGA 4G0NA 2ZVQX 3U3KA 4IDQA 4NPHA 4FI3C 4KVAA 3E1SA 1VCMA 1RVDA 2CK3D 2BJWA 2GAAA 5ELXA 3KKNA 1ANKA 3RC8A 1E4YA 3CH4B 4QHTA 1E1RD 4JSTA 1EXMA 3A1SA 2G3YA 1KO7A 2HJVA 3ZGXA 1SVWA 2EFHB 1KGDA 3TGPA 4HUTA 5CK5A 4BQSA 3IHLA 1P60A 4OQFA 4QGFA 1ESMA 3ND9A 3TIFA 5KHOC 5C46F 1R0ZA 1Y3AA 3QKSB 1UBEA 2NIPA 3BORA 3MWKA 4ARZB 4C3ZA 4OHZA 4IOKA 2MMCA 3OE7D 5DSZA 2JJ1A 4LBVA 4LY6A 1DG1G 4NYMR 3CUEF 1YRBA 5E7IA 4C0LA 2QPOA 4V0MA 1DADA 1XXHB 4B43A 2ZI3A 2QUZA 5FOVA 1IM2A 4Q01A 4P31A 4D82A 5JZVA 3QEOA 1SXJB 4ABYA 3GJ8A 3QY0A 2NG1A 3BBPA 4LJ5A 1P2VA 2ZR7A 2RGEA 5GJVC 5C1BA 4HSEA 2FN4A 3M4YA 1KJZA 2C78A 3CBQA 5JWHA 3WNBA 1M7BA 4A0FA 4ZCIA 2JEOA 5HZKA 1JJVA 3C8UA 5F3WB 4PANA 4HATA 1Q1EA 4P0TA 2ZJ8A 4B6FA 3LXXA 1LF0A 1CULC 2CJWB 4RZ2A 3PXGA 2O52A 2QMOA 4DUGA 3FMFA 5D3MA 3JVUA 2QT0A 2RH5A 4WZ6A 3PV0A 4GDFA 2HCBA 1Q3TA 1ZNWA 3QKUA 5DI3A 4FMDB 5DI3B 5FTNA 4XD7A 4NCNA 4P3YA 1DAFA 3I5XA 3FPAA 3HDTA 4RCZA 2D7DA 3F5FA 3LFUA 1FMLA 1MO3A 2JA1A 4NL4H 3QXJA 2GCOB 4TSFA 1Q20A 2ZTSA 1X6VA 2KWIA 5J4KA 3NBXX 5DE3A 2G6BA 4B6EA 2VEDA 1KTVA 4CVNA 1ZM7A 3OHMA 2EFEB 4G5GA 2DFNA 4HAYA 3QSYA 2ZI6A 2XEXA 1SVKA 4PSAA 3UMRA 4M9XA 3I61A 4QHYA 1Q22A 1MRNA 1T0JB 4CW7A 4PPQA 2QGNA 3CKLA 3OIVA 3G0HA 4RY2A 2J0QA 4JL8A 5G3ZA 3CX8A 1Z0AA 2OBNA 4I1OA 2QTVB 1AS0A 3IO5A 2ZSBA 3MAAC 1XCGB 3PCRB 4BZPA 4TZ0A 5FBLB 4DT1B 4C2UA 4B48A 1KKMA 1OXXK 1SKYE 3B6EA 3ZYCA 4CZ2A 2ZU0C 4M22A 3NDBB 2ODBA 1ZD1A 3GP8A 4XD7D 2VYFA 3KKPA 4Q02A 4KBFA 2ZJAA 4PPGA 2WV9A 1KI8A 2ZJ2A 3QQ5A 1IJFA 1JEEA 2IYTA 3FMPB 4PTLA 1M8PA 3THOA 2WJHA 4BLOA 1WBBA 1XPUA 3ZVRA 2ZITA 3L8YA 5H8WA 5DO9A 1MO6A 4KXFB 5FUXA 4HI0E 1KMQA 2KE5A 3DEFA 2ZJZA 4IVRA 3H2YA 4W7SA 3HWSA 2YVUA 1EFRA 1V5WA 3EZ9A 1P2UA 5DGXA 1H65A 1G8YA 3SFVA 3CF2A 1CLUA 1CR4A 2VQSA 2XGJA 4JBYA 1VYUA 2B8TA 4OJKA 4XWAA 1MABA 1X1RA 1FUKA 4MYTA 2RHDA 4OQXA 1NLZA 4UJ5A 3TH5A 4MGYR 1OIXA 1OF1A 1Z8FA 1OFHA 1OXSC 2FU5C 2HYDA 3GFTA 1XD8A 4RKEA 4TMZA 1N6IA 4QBGB 3G82C 5G40A 4ASUD 1R8SA 3AGQA 3OESA 1JJ7A 1KK0A 1HV8A 2XTNA 2JLWA 1A5TA 2VBCA 4GOKA 3M1IA 1HE1C 3VQTA 5KOYA 2CE2X 3EZ7A 3ETLA 3TVTA 3R7WA 3IUYA 2VRWA 2XTMA 5AJVB 1N5JA 4TQAA 1UPTA 3VFDA 2OAP1 1BMFD 4RKFA 3PG5A 3EZ6A 1E2JA 2OT3B 4GMXA 5FUYA 4CEHB 2ZS9A 3AVVA 4IOMA 5K8TA 3PUVA 5JI3E 4XJXA 4QRHA 2C77A 3KDSE 4PSKA 1E9FA 2WMNB 4JLJA 5F9FA 1O87A 3KZ1E 2B92A 5FR2A 3W8RA 1E9DA 1AA9A 4WZBE 3WRYC 8OHMA 3GCGA 5FL7D 3SU8A 4OHXA 1ZJ6A 2XX3A 3O8RA 1DVRA 1GKUB 1NBMD 4A4DA 4S35A 1RYFA 2H1LA 1AS2A 4L16A 2QORA 4ZI3A 2O8BA 3P4XA 4DB4A 1JBKA 4OK6A 3CX7A 4IVQA 3LBNA 3WNDA 4C0AC 2QBYB 2B7CA 1T3HA 2QENA 4F4CA 4TN1A 1W44A 4A1FA 3DDCA 1C9KA 3A4NA 2FX3A 1XMVA 4XWKA 5F2EA 2F1HA 3AVOA 1II8A 4FCVA 4QJ3A 1I2DA 4W5HA 3DZ8A 3PEVA 1VECA 2F1RA 3ZJYA 4A2WA 3GLGB 2A2ZA 3CPHA 3KXIA 3TK1A 2PMKA 1GIAA 4DDWA 1WF3A 2NZJA 5LD2C 2F1JA 3RAPR 3VNVA 5FI0B 4I4LA 1COWD 2GAOA 2AR7A 3LD9A 3QKSA 4TL7A 2ZRLA 1YR6A 3N70A 3O8CA 121PA 3PUXA 4G1UC 3RRMA 3DMDA 1L4UA 2QE7A 4HLUA 1MV5A 3R9XA 5AUNB 2RGAA 2JJ2A 2IX3A 1TF5A 5KSOA 3I62A 4AKHA 4ZDIA 1T0HB 1PVOA 2LKCA 1N6PA 1SVLA 2NO6A 4AIIA 2P6NA 3GFPA 1N6OA 2XJ9A 2D2FA 3BXZA 1HT1E 4C9BA 1P2SA 2C95A 5KSZA 3EX7C 5FTKA 1DO0A 1KO8A 2SHKA 1G4AE 2CLDX 1EFRD 4XWOA 4A15A 5DN6D 3AQ4A 1E2NA 3LX8A 1E79D 2C03A 2C98A 5J47A 2WWYA 1G5TA 2RHMA 1BIFA 1U8YA 5EE5B 3B7GA 1Q0UA 2BHRA 1JALA 4M1SA 4DUGD 3AP3A 4LJ9A 2XJ4A 2QL6A 3D3QA 4G5SA 3PJRA 2VF8A 1G3QA 5DNYB 2ZRIA 2AKAB 2ZAMA 2DPXA 1E99A 5ANRB 1U81A 1US8B 1HA3A 1NRJB 2ONJA 2J7KA 4B76A 1ZC4A 3TQCA 3KJEA 2Q9BA 5E3HA 4TT3A 4LI0A 1H8EA 2IS1A 1YZTA 4V0LA 3E2IA 5KU1A 1RYHA 1KK1A 4UQOA 5LB4A 2HYIC 4FMCF 5TARA 5TVKA 1SQ5A 5FBRB 1E96A 3C14C 1F60A 1ODFA 1P61B 2XOKD 3FYHA 1OXVA 3CR8A 3WP1B 5KO2A 4PC6A 1E2HA 1LW7A 4TTQA 4FN5A 2D2EA 4PC2A 1W49A 4YDHB 1G7SA 2GK6A 3TMKA 3CZQA 4GSYA 4NYJQ 5FOUA 4US1R 1A1VA 1CJMA 5F9HA 4UJ3A 1N25A 2W58A 5GJBA 2VHTA 3VMFA 1SHZA 1WB9A 1CRPA 1OH5A 1U98A 1L7VC 2P5TB 1JR6A 2AKYA 1CP2A 3IO3A 2WWFA 1RZ3A 2KB0A 3FHOA 2PLFA 3EARA 3LBHA 4KV9A 4B33A 1OH6A 1D2NA 2RGCA 4LDJA 2XXAB 2QM7A 3IIMA 4GBMA 4LX0A 1P5ZB 4JLAA 1GVNB 1VHLA 2ZJ5A 2AK2A 2DWOA 1GRNA 2HV8A 3T5GA 1VG9B 2R6FA 1FQJA 1KYIA 2VP4A 3VR3A 2QU8A 4PQFA 4Q9IA 4XVQA 5J40A 4M1WA 3QEJA 1JB1A 3K9GA 1Z6YA 521PA 4DCTA 1G1MA 1KAGA 1LY1A 1EG7A 1AJEA 1RKBA 2FFAA 3QXXA 1XZPA 4WVFA 2WHXA 1ZUHA 3CX6A 1Z22A 1JPJA 3EPHA 3BGWA 4UXJA 4TYWA 2OBMA 4TTRA 2ZR9A 2R6AA 4LYHA 4LC1A 4M1KA 4RD6A 1P4SA 2ZEJA 3A4LA 4L15A 3X2SA 4D6PA 2EVWX 1UBCA 2YYZA 3NWJA 4D2IA 1KMHB 2Z5FA 3S1AB 1P9NA 5LDDC 2GK7A 3KKQA 5HKKA 4ACAA 2PZFA 2ZE7A 2AK3A 3ICEA 2FPMA 1XTJA 1U9IA 3KQHA 4IHQA 3D31A 4C7OA 4C7OB 3W6OA 2ZRAA 5KYKA 2ODWA 3OEED 3KJHA 1GL9B 1G7TA 2RMKA 3CPEA 3LO5A 3X1YA 1N5IA 4JZKA 3MWLA 1N6LA 1ZMXA 3VNUA 1UDWA 1XTIA 1CJVC 4LOAA 3L2OB 2V4ZA 4DBLC 1T6NA 2ZSFA 2AD5A 3E5HA 2A5JA 1OPXA 5FI1B 1KO1A 3OIYA 1G8PA 5SZIA 4DLTA 3WNCA 1EX6A 4JLPA 3K09C 1P72A 4D81A 4EJSA 3TAHA 3U7EB 2ZUDA 3EPLA 1JPNA 4NYIQ 4QL3A 5FPYA 5FTJA 1G5RA 4CIDA 1OYYA 5EE3A 1U2RA 1E9EA 4GRAA 3BB3A 3H0KA 3GLIB 3CRRA 3OIUA 4LYFA 3MJRA 2F7SA 2G77B 2O8EB 2JJ2D 3I4LA 3LV8A 4Q66C 4TQUS
chains in the Genus database with same CATH superfamily
2N42A 1MEOA 5JFTA 4LBZA 4V03A 2D62A 1E94E 2JJYA 3TR6A 4CFSA 1YJ5A 4HX5A 4GEGA 5JH7B 4UNNA 2N9UA 4QDTA 4Y1RB 4Y2GA 2P68A 4MS3A 1FXUA 3JVIA 3NJ8A 4OBEA 4TT3D 1FVXA 4FYIA 4LPSA 5AHWA 4B4UA 2Z1MA 5CU7A 1WD7A 4JJKA 4M0MA 2OZVA 3HO6A 1E2PA 4KQXA 3MCUA 4D9FA 1AN0A 3WLJA 3Q40A 3H2HA 4CMJA 4BASA 1M9NA 3I23A 3K4QA 5AOVA 3I2HA 4V1CA 3O38A 4G4SP 1AV6A 1DFIA 2BSAA 4AFNA 2G4VA 3OZBA 2HU7A 1XMIA 5FLYA 2OHFA 2A35A 3OQVA 4PY2A 3JD4A 5FOQA 4KQ6A 3RTGA 1ID8A 3QELB 1B8OA 5DDIP 3NTVA 4TL9A 3FTCA 4QJBA 4EAQA 4AQYB 2R87A 1RHUA 4L3OA 5FUBA 2BRUA 5LJLA 2W6JA 5A3SA 4OLBA 1MT3A 1S3GA 1X7GA 3W5JA 2WEKA 3HCNA 3COVA 2NT4A 4JOSA 2WVHA 1ZICA 1G8KA 1JPVA 2ZYIA 3JASB 4JYMA 4DQUA 1J06A 1WXXA 3EDRA 3A28A 4G86A 5CRIA 5KTNA 4M1EA 1Y37A 4WMLA 1L8AA 1O8CA 2OBFA 3NXSA 4KLAA 3RU2A 3O47A 1ORDA 1V3UA 3O4HA 3B9RA 5AK5A 1KP2A 4AK9A 2Q62A 3DAGA 1ZIPA 1PFQA 4PHHA 3G9TA 1J8DA 1E7RA 3Q0EA 4BRUA 5BVHB 4O2BB 3Q8KA 4PGMA 2NO9A 5L3VA 1JFSA 1N0UA 1XZFA 1P4RA 5CLGA 3ESAA 2DCMA 2VNAA 4DYDA 5K4AA 4C29A 2RGNA 1I2BA 4D6YA 3D0OA 3JXEA 1Q2XA 2IHYA 3K0KA 4YJKA 3QIAA 1LGYA 3SKXA 5P8WA 1IHPA 3TQQA 4GX2A 2TMDA 2R97A 3EW9A 4H7PA 1KAMA 5TGZA 3GJTA 1HORA 4WLEA 3IIIA 5TS3A 3DYBA 4DMHA 1LRKA 5EERA 4Z1MD 1RM5A 5LXTA 4B32A 4UDOA 1N2HA 1JQJC 4KWEA 1MRZA 2G70A 3H9GA 1YHYA 5EA2A 3SN6A 3WGZA 2CL6X 4UPEA 3I72A 5I9IA 3H8VA 2FVXA 2Q6TA 3VI4B 4BO3A 4YRRA 5DTRA 4TLDA 3OH8A 1CXZA 1J2RA 3RUFA 2R8EA 2XT0A 1P5FA 3UGQA 4ZGWA 4R0VA 5JWOA 4FPXA 4ZYZA 2FRXA 1HGXA 4NMMA 4M0EA 4HAOA 4NU8X 4A8JC 2FV8A 2G0AA 3PEWA 2JHCA 1PGOA 4RHXA 3RS0A 4JQZA 1WUIS 3FR7A 2AJ8A 2QLBA 5EMNA 1M2EA 3OZ7A 1I30A 2HDWA 3QX7A 4I5GA 4UU8A 1Z0UA 5E1DA 3JY6A 3FD8A 4XDYA 2GA8A 1MXFA 5A0FA 2IUUA 3B48A 1SC4A 2ONKA 3GZJA 4TX1A 3C8DA 1NYLA 4YPFA 3UY4A 2DC1A 3R3WA 3DBLA 1REQA 3QI7A 3QV2A 2VHWA 3HJNA 2Q4TA 4N82A 4QUHA 2VRCA 1DKRA 2IVFA 2Q1SA 3VOAA 2E18A 1U8TA 2ID9A 1YS4A 5MF6A 3W8EA 1Q7BA 3F98A 1HYEA 5JBNA 5H9VA 1RMYA 2W8BB 2XDYA 3S7TA 2OC4A 5BV2P 2BI4A 1QH1A 3KZNA 1QDEA 1ZISA 2CDNA 1SZDA 1H6CA 2O0LA 1ZIXA 2OENG 2JAHA 1MMFB 2FQ1A 3H5TA 1WXHA 4WE3A 3U37A 4KHZA 1V8PA 1JLHA 2JFXA 4LJ8A 3VPSA 5J1SB 3DE5X 1E6WA 2R4TA 4FOPA 3OZWA 3OPQA 2JD2A 5D5PA 1SOMA 2ZI9A 1R0WA 1TC1A 1J8MF 3FNQA 2YJGA 3EA0A 1TRHA 4QRIA 4NARA 5E9JA 4E6EA 3JPWA 2N46A 3JW8A 1RQXA 3VU9B 1WUTA 3ZWQA 3P27A 4BMOB 1T36A 4H08A 3PEEA 3WBFA 1N8KA 2PT5A 3NTRA 4J1TA 4KNVA 3SE0A 4BU1A 3AI7A 3JD0A 4TKUB 1WQ1R 3DLCA 5TB5A 3K0AB 3PS9A 2WPNA 5CCXA 2IYFA 5IC6A 2FA9A 3ABOB 1VJDA 1W5EA 3I37X 1KO5A 3N05A 4BQFA 4YV2A 1KYTA 1Z26A 4GEKA 1EBBA 4RETA 2OAQ1 2Y1EA 1Q1ZA 2REQB 3UA3A 1D9ZA 4IDPA 3FJOA 5EMKA 3WLTA 4CLHA 3EOZA 5JVDF 1A7JA 1RAIA 1U7OA 2EJBA 4R16A 5GY7A 1Z47A 3C1TA 1D6NA 4L72A 4HQNA 1XQYA 5DYGA 1HO3A 1YNSA 4MDYA 4J29A 4WCFB 1HSOA 1H5NA 1AN9A 3IQWA 1YKSA 2CVQA 2OAEA 4JLBA 1B7GO 3AUFA 4JITA 3RVPA 3ZQUA 2GZ1A 3D6TB 1ZR4A 1QTQA 5REQA 1W5SA 3DZIA 4NFYA 4RLQA 4YJ2B 4IIFA 3KT8A 4IZIA 1W0KA 3L8GA 2X41A 4NFSA 3WK9A 2H52A 2CXTA 3OLZA 3ZS8A 2UV8A 1AGRA 4HZUB 2NACA 3QE0A 4F4IA 1EM8B 1WLYA 5KEIA 4B0PA 4L0DA 3NANA 2QMZA 4C5CA 3ZTYA 4ECAA 4QPPA 3T9FA 2BCGY 2N75A 2Y6UA 3ZQ4A 3DDNA 4DSNA 3CNNA 2ZYAA 3K7EA 4NSNA 3ER9A 3GB9A 4W8HA 2QMHA 4GWKA 3W8DA 1DEXA 3STWA 4J16C 5J4HA 3L0YA 4L8FA 2FZ4A 3A1DA 4DV6B 2A33A 4RZQA 4Q4LA 3ZPXA 1TA0A 1QHNA 3RKSA 5A6SB 3D3WB 3IIEA 3ZBUA 1Y7TA 5AW5A 9ATCA 3N2GB 1B0UA 1JSRA 2X0KA 4FT2A 3BBLA 3AVUA 2AGVA 1M34E 2CNOA 3QG5A 4XLLA 4XOUA 3O95A 5EWMB 4CL0A 1OROA 4OJQA 1MOPA 3Q8XB 3MTDA 3NC4A 3W1VA 2LUOA 1SXJA 2R1VB 2R7KA 4FEAA 4IGIA 1I7DA 1KR2A 3VO1A 2BEUA 5JAPA 4Y0AA 3GXBA 2H3EA 2V7QA 4JP2A 4LXIA 5JO9A 3RWOA 1NE7A 1NV8A 1HEIA 1Z4NA 2W11A 2P41A 3GD7A 4YBRA 2JGIA 4KI7A 3WZMA 2BEWB 2RKOA 4BVJA 5IN5A 2DP4E 2VYCA 1NJ2A 4IXTA 1K8YB 1V4VA 2DFKB 2KLBA 1YCHA 4NKRA 4QFBA 4WAUA 4MWTA 4F4FA 2I91A 2DFTA 1MV8A 2W2MA 1TW2A 1NASA 3KQLA 3OM9A 2C92A 3BL5A 5FTWA 3TLXA 1MKYA 4GNKA 2JIQA 2NUPB 3HYTA 2JIZA 2HOQA 1W4LA 3A4IA 3IP5A 5E0OA 1GPKA 4YCJA 4YRDA 2XB4A 4KWCA 2K2QB 4MV8A 3HACA 1JHOA 1A2QA 2DWUA 3QUCA 3PNBA 1ZIYA 4GO1A 3UO8B 1XMPA 5JQGA 1GAWA 3LXUX 5AHXA 1A9TA 1EJ2A 2AKEA 1TTPB 4HUQB 1NW9B 3DF9A 3B7WA 3JTMA 5IARA 4A2PA 1GILA 2O8CA 1E92A 2DSNA 2PKWA 1ZGCA 4QO8A 3RREA 2C8VA 4YK7A 1Z5WA 4NBKA 2H2FA 3PFCA 1CIPA 1KPHA 4TL8A 3ZH9B 1T8PA 1O1YA 2VF7A 2XOXA 1DXQA 1JMVA 2A9OA 3FUUA 2CDCA 4HNAA 1ZNZA 3A4YA 1QFSA 1IHDA 2WUEA 1Z62A 4K0RA 5JLAA 1WWKA 3HXMA 2BKUA 3BRWA 4FDAA 5LQNA 1OH8A 2WWHA 3IBYA 4OB6A 1GGKA 4PPNA 2IK8A 3R74A 4HMPA 2PAAA 4RIFA 3VC1A 1NLFA 2F1KA 4XRGA 4YMHA 5JY1A 1XDDA 1NYTA 4PSVA 3CH7A 1E9VA 4YPOA 4N7RA 3EIQA 5B1HA 3PCXA 4DLKA 5LOVF 3DT8A 1AM4D 1W5BA 2H51A 2I4LA 4Q7JB 4U7HA 4XZ3A 4XUCA 3CZ4A 5KWVA 2FGKA 2NZ8A 2AN5A 3PI6A 1VJRA 1NP7A 2GH1A 3EZYA 4CM4B 5ARDA 3LLUA 4CM4A 4D43A 4E12A 3IXMA 4FHDA 4JIMA 1GNSA 3N8IA 2UXCB 2HPAA 1WX1A 3KTAA 4BV8A 3PK0A 4I9NA 1Q57A 2YS7A 2OQIA 4G5QA 1LDNA 4HTAA 4MS1A 4PCUA 3HCBA 2Y2UA 5C2JB 5KWSA 1QU2A 3HTXA 4DVGA 2DUNA 1IXZA 5HZGA 4KFCA 3FVQA 2FR8A 2MOKA 2VJBA 3HCDA 1M5UA 5DSTA 4MOWA 1XL1A 4ZI7A 3C3PA 3G5UA 2D0IA 1ATIA 3WLKX 1WVGA 2B3DA 4Q7QA 1J6UA 2ISCA 3G9ZA 1JR3E 4XLTA 4I66A 1N3BA 3TLKA 2ZI4A 3UJ6A 3JAWA 1R3DA 4HTFA 3H19A 3LRTA 3UJHA 4ZAVA 3H5RA 3R9KA 1PT7A 1G6HA 3BRSA 3MN1A 4LF4B 2CE7A 1EWQA 4LXYA 1ZP6A 3L7KA 1KJNA 2XCQA 3B38A 3U7FB 1UDBA 2OHIA 1QQ7A 2Z0MA 3HSKA 4DC9A 5LWHA 3DOJA 1QK3A 3A04A 1KJJA 2DPYA 4ZEOA 4YRIA 2YINC 4EYSA 3FCEA 1PJQA 4JBGA 5IT9A 4QVIA 4IIYA 1QE5A 1JKJB 5A5VA 2RBGA 3C6ZA 1BROA 2GM3A 4FDVA 1JSZA 2ZYWX 1KBQA 3QYFA 4O1HA 3TVDA 3X1DA 4CU5A 3U1BA 3P26A 3R8FA 1EBUA 3SXJA 4PAGA 1JFTA 1IQPA 1W76A 1RPJA 3AIMA 3IAXA 2IP1A 5MN4A 3N8DA 1SUAA 2Q50A 4JEUA 1L8LA 1BXGA 5LFAA 4C07A 1QIHA 5FHRA 4UASA 3UMJA 4KREA 1XKTA 2JB9A 3DKVA 2AW5A 5B7PA 2GF0A 2X3UA 2W90A 3DL4A 4HD8A 3K0BA 4Y2YA 3TTTA 1XFAA 3TJZA 2ZB3A 3AEKA 5TXGA 3VSEA 3DH0A 2A4MA 2BGLA 2J4CA 3PB3A 4LPKA 4DAOA 5BV7A 2V7EA 3BH0A 2XF8A 4EGSA 4MJ3A 3Q7EA 1YMQA 2Q8PA 3Q2OA 4HEHA 4DBZA 2VF2A 1IZYA 1QCDA 1E1KA 2GHRA 2ZATA 3RIXA 3KE8A 5C8YB 4ARZA 3T1TA 1GOTA 2PCLA 3PGKA 4C4ZA 1ISFA 1ZMBA 1SUEA 3SM3A 4LRSB 5CCDA 3OLQA 1E9AA 4DDVA 1YR8A 5ALOA 1MJNA 2NVUA 5BW5A 1IDN1 1VPWA 4MO2A 4D42A 3S40A 4Y7DA 3KZMA 1BDMA 1BOOA 4GE3A 4FGZA 4HDCA 4D96A 2EJUA 4BV3A 3DQZA 1E3EA 3BGOS 1V26A 1Y9DA 1E2EA 2UYQA 1JR4A 2WVJA 3ONVA 2WR8A 1G98A 4LZAA 1D6MA 3F49S 3H5OA 5TMBA 4X66B 3WO1A 1QB8A 1FVFA 3ECCA 4YIHA 3WL6A 4HNUA 3L4BC 4FYHA 1WZUA 5FLXA 3DTNA 4I5EA 5HTKA 1DP4A 4RFLA 5K03A 3LUDA 4DSTA 1I5RA 1Q92A 2W2TA 2QB5A 3K9HA 1PJLA 1Y5IA 4MWSA 1UF9A 1VE1A 3FYUA 3KL4A 3LBAA 2RFLA 4HGRA 2OLJA 5F23A 2UZ0A 1UT8A 1WB6A 1K8XB 4R40A 3HVHA 4W5TA 5AWFC 4Z4CA 4AUMA 3HU1A 1C3OB 1KPIA 2XSZD 1P4AA 2Q1TA 4FCCA 3C97A 4IDHA 4LMBA 5F51A 5HDBB 2D2XA 3TAXA 1E5VA 1ZN7A 3HR8A 4YRBA 1GTG1 3K9FC 5DNUA 1JHZA 1K9SA 2XB2A 2CY0A 3I6YA 2WJGA 4I50B 5EMJA 5FD8A 5HZHA 2SCUA 3PUZA 1BQ4A 2C5FA 1ZGGA 2HJRA 2R5NA 4YO8A 4Y2UA 3IUJA 5H9WA 2Y1FA 5JAOA 5ALFA 3VDNB 1DKQA 4CT0A 4P22A 1ECCA 2AR0A 1RAFA 2IW1A 3IAS1 4NBNA 4A5OA 3HGTA 3D2BA 4TTVA 1FB5A 4UCWA 3UOAB 3UXMA 1K8RA 3OQHA 4CYMA 5JSZA 1KC1A 3EXFB 2F3UA 2W4QA 4KJXA 3BGVA 4IS3A 2X0FA 3O4RA 2XWQA 3R7AA 2OFFA 1QV7A 4KQ1A 1HTTA 3BZUA 4IVNA 1FU8A 3T3GA 5FRDA 4WY5A 5EZYF 3VNAA 3ST7A 1ZD5A 1GZVA 4UDNA 1N9GA 4PRYA 4V0RA 3AF0A 5JXWA 3U4QA 2V7VA 1GNQA 1WQ4A 1G41A 3MFYA 4BGVA 5DCWA 2PT7A 1U8AA 1QQAA 2ZBPA 4FQ5A 3ZXIA 3JD1A 3TWOA 4M0LA 1N2SA 3UGKA 4CF4A 2IYSA 1L1FA 3U3DA 4B3XA 1SC3A 1HK7A 3EG5A 2YNMD 3AJEA 3DL2A 4YAFA 4MEBA 3THSA 2QAGB 3GNTA 2IUTA 1E3WA 3EYAA 1L4KA 1W8DA 1PT6A 2CYBA 3K0FB 3L7AA 1AMNA 3H4VA 1E63A 1U4OA 4QQRA 1XEXB 4HDSA 4FS3A 1ST2A 3D8HA 4EABA 3NZEA 3CSSA 2J46A 3EQ6A 2J4FA 4FKZA 2DM6A 2V7BA 4I5FA 2FXIA 3QW4B 4Q6BA 4PAWA 4YWHA 5GPBA 5HW0A 2Z6UA 4EG5A 1YQDA 3KT3A 4IG4A 4N5NA 2JCBA 4WESA 3FDIA 1CQIB 4HX9A 4QKQA 2M2IA 3P0FA 4NCAA 4YC7A 1YR2A 1W19A 3RGGA 3IXQA 3MJDA 1LS6A 1GNPA 1R0BA 2EW8A 4IP0A 5BNTA 5K09A 3J81A 2AI1A 3MTEA 2PUEA 2W48A 5HS4A 3OLVA 4I1UA 5CK4A 5IBCA 1Y6QA 3FFAA 3CRQA 4NOKA 1MEEA 2E3JA 3E4DA 5JEDA 1FP1D 5TPWB 2G1KA 2AS0A 1A9SA 3ZHCA 4B81A 5AVZA 2HIMA 3I9JA 3RS3A 5CLLA 4ZV9A 1SU4A 2O2HA 1THMA 2RB5A 1NNI1 3FUVA 3LKDA 4BRZA 4ER6A 2QG9A 2F2TA 2AIRA 4G23A 3VRHA 5C8VA 2WWRA 3VSDA 1OFUA 3DULA 4WECA 2ZSHA 3RVQA 4DCNA 2NZ2A 3CCBA 4KNYA 1Y1RA 1JG3A 4JOCA 1BHO1 2B6HA 3S55A 2HNKA 3A1CA 4KMRA 1GG8A 3NUGA 2JFNA 2OV4A 1RYDA 1ISGA 1T3TA 4GF5A 4HFNA 3COJA 4RJKA 1SD1A 1QF9A 1GZHB 1D2EA 5KTSA 3EGVA 3VH3A 4C4SA 2ISQA 5AVTA 4ECEA 2OCBA 2HBYA 4KWTA 3MS7A 3B7PA 4Z7OB 2WJIA 4DCOA 4BO0A 4BPBA 1TEXA 1Z5NA 2NYVA 4HRXA 4F9TA 3IRVA 2B61A 2Y76A 2OXFA 3EHDA 3GJSA 4FZ3A 1RXWA 2BMDA 3UHJA 4HDNA 2J09A 1XQ6A 4RTNA 5HBRA 2Z8YA 3EGCA 2MCFA 2VDQB 2FZCA 2DRIA 3HUTA 1FLDA 3OIGA 1DTWA 1YR1A 4PX5A 1K7XB 1AK2A 3RS8A 3L0DA 1V16B 2K4MA 4QAQA 2X13A 4DGQA 2XBUA 3VR2D 4HDRA 1KQ3A 1WO8A 1CZLA 3EGWA 4CMGA 1QQ5A 2JFYA 3AL3A 1UL1X 3EZNA 4MKHA 4ID9A 4OQMA 2BJHA 4URFA 3RD5A 3V8EA 4AWBA 3OO0A 1Q1GA 2ZTLA 4NC9A 3FDJA 4D56A 3DE0X 4CR8A 2PTGA 2XITA 4UKDA 2FMKA 4K03A 3SX2A 4ZDWA 1DAOA 2CLHB 2R11A 3IDQA 1T5TA 1F06A 4CL8A 4V1CB 3U56A 2OUIA 3IIKA 3PEUA 3MSCA 3K1ZA 1PR3A 3E9CA 1ZN9A 3AM5A 3MXTA 1G9TA 3ZZNA 4KIFA 2H1HA 3SVLA 3C5HA 2MR6A 3K0CA 4ZMRA 3QHPA 3LH5A 4Z99A 1D8AA 2AF3C 1TZ2A 1Z16A 1U3WA 2OKCA 2W37A 1LSSA 4L8LA 1C1XA 4ZQIA 1OH7A 4KR3A 3DUFB 4Z0PA 2VCHA 4EMUA 4P2BA 1O96A 5ALJA 4XCVA 3Q0TA 5CHEA 221PA 2B6NA 2XMGA 3MJSA 4YBZA 4EJFA 4U02A 2VF4X 4IDEA 3G2NA 4NY1A 4M0UA 4K9RA 3B1VA 2FTKE 2E4UA 3V1LA 4LFAB 1CJUC 2D4HA 2HFKA 4YRCA 5AICA 1ZU4A 3VMMA 4AZ0A 3Q87B 5KOHA 3IUNA 3L0CA 3ZU2A 2EEPA 3PVCA 1JDNA 1DO2A 2AD1A 2PU5A 3EGXA 3QOXA 3JVDA 4KOEC 4BP3A 3ZWNA 4C76A 4H1WA 2EP8A 3AI2A 1LI7A 1UBRS 2MR5A 3NWBA 3ZNQA 4R7TA 5BMVB 3MT8A 1BJRE 1GAXA 1UC4B 1X9GA 2A86A 5ENDA 4MDEA 2Y71A 4B2IA 2ZXFA 3E7FA 5DMXA 3F9RA 4KLRA 3VHQA 2ZKLA 3HN2A 5TY0A 4CQLB 3V3TA 4E5SA 2RJNA 3FF1A 4LK3A 3WBJA 2NSLA 3FMOB 3IBSA 4E32A 4OGGA 3FNIA 5AT1A 3HU3A 3MINB 1UK8A 1V25A 1NULA 2O5RA 2A84A 1YIAA 2ORYA 1C3EA 1ESNA 3BL8A 4FCTA 3VKVA 4IWYA 2XWJI 4ZJPA 2P65A 3NHZA 2JC3A 3OPYA 3QMWA 5DHAA 5E3JA 3P9RA 5EGSA 2BUBA 2GB4A 5BORA 1P1JA 5NULA 2G5CA 5L3SA 3WLIA 2ATXA 4CDGA 2V96A 1YBAA 2Z2KA 1X7XB 1G42A 1W96A 1DI0A 1KDZA 3NVDA 2AR9A 2NO1A 1MAVA 2I2FA 5DRTA 3CHYA 5CG2A 1OXTA 1VA5A 2BBSA 2WSSA 1NXOA 3CT6A 3GN2A 4W9NA 3CW9A 1I2AA 1JIJA 4EF4A 5E9QA 2XZPA 3M1AA 1UWLA 1PJSA 2B34A 3ADBA 4LTDA 4TMXA 1PHPA 4EKYA 4JSRA 5GIOE 3GF4A 3LTEA 5E2IA 5CBPA 4P82A 4D0GA 3EN0A 3S8EA 1CY1A 5JNUA 2PS0A 3MWDA 1DCKA 1UBSB 1EJ6A 1VSQA 4IMRA 1I94B 3WQHA 3VJRA 2BWJA 3F3KA 5H68A 3SHFA 1ZONA 5EJ9A 3DZBA 1N2XA 4RFSA 1KMHA 5LPNA 4QXRA 3VOSA 5J2TF 2XB6A 5IUKC 1TLFA 3H9CA 4TWBA 4DJTA 5LB2A 5KC9A 3DG9A 5EHGA 2HLHA 3AQIA 4DCVA 2BFCA 1SCBA 3CWZA 1AVTA 4GRDA 4PZYA 4KB5A 2Y93A 5B12A 1GG5A 3UPUA 1RRVA 1US8A 4X8HA 4JT9A 1ZJWA 2AZ4A 4KO2S 3X3HA 1QIGA 2P11A 3KPVA 4H7IA 4UREA 5LA6A 1Z0KA 1CC1S 2EYUA 4QDXA 1E62A 4EELA 2BKAA 4UNIA 2IV7A 5LJIA 4DSOA 5CM2Z 5EIBC 4EQ6B 3NHRA 1FNNA 1YZYA 4XSVA 2VDMB 3RYFA 2WNIA 4RZIA 4RGBA 2ERYA 1UBLS 4H7EA 2D0OB 3GCDA 1FQWA 4M9SA 1WPXA 2SECE 4OHPA 3K8ZA 1NKSA 2H92A 3WOHA 2CB0A 3GRCA 2CNKA 4U2DA 4BVBA 3T3OA 1H9CA 3A6PC 2VK1A 3ZE9A 4GYJA 1T0UA 2WJ3A 3GVIA 1RWMA 1YAJA 5BQOA 2YMPA 3TNFA 3RQSA 5FPPA 1Y6RA 3IA7A 4DYHA 5JNVA 1GYPA 1IHYA 2YZNA 1J7JA 4UMFA 3ZXSA 3CZCA 1YO6A 3C3YA 1TM7E 1IUPA 1QKIA 4O3FA 4X92A 3V3KA 2RCNA 2NTJA 4TKUA 3OT1A 1EDOA 2HRBA 2Q3CA 3H1AA 1HQDA 1XRJA 1DGQA 1C7IA 1QMGA 2FMUA 2QU7A 3PPWA 4I8IA 4RH3A 2EEZA 3PIIA 5H5JA 1I3KA 1VSUA 2JZNA 2XAAA 4RK7A 3UZUA 2ZJ6A 3LPAA 4B5LA 4EYEA 5MDHA 3PNVA 3T5TA 5B6IA 3CE9A 2JASA 3BIOA 1JIKA 2R7LA 1ZSYA 5DJ5A 3NT2A 3ILYA 3RT9A 5IDXA 2PBZA 3M33A 3TRFA 1UUFA 1WCV1 1NLMA 1XPRA 1E8MA 3QKIA 4QFMA 1UAAA 1A88A 1J39A 1D2HA 1EIZA 4RTRA 5K8UA 1J7KA 4E31A 1KBZA 1QFZA 4B80A 5LUAA 1TJPB 1DXHA 1PFGA 3IUBA 3NC1C 4H2DA 2GDZA 3PWKA 4IXDA 1UQRA 3A0RB 3SI7A 1XMQB 1VJ1A 2BSXA 4Q1BA 2HCFA 1RHMA 1QAOA 4G67A 4LV5B 1RPZA 3LRXA 2TECE 2WVAA 3KNZA 1NGSA 1ZXBA 3PXBA 3EPJA 1DX4A 2BF4A 2XQGA 3ORSA 4GWLA 4Q7MB 4ZO4A 3ZOZA 4KFSA 5B30A 5D87A 5F1YA 1ABBA 1A50B 3R0JA 1PZMA 2V7QD 4EA9A 3W2IA 2HDNB 3UKOA 3AHHA 2J87A 2V5UA 7YASA 4WBNB 5JI2E 2YOHA 3ACDA 3DOFA 3N2IA 1YS6A 2FR8C 1X9IA 3JTEA 3O2NA 4KXMA 4N6GA 2BPOA 3RV3A 5JSYA 4DPLA 5FAKA 2PUGA 3QA9A 1P0PA 3S44A 5EHXA 1BCRB 2MJLA 2G9RA 2IF2A 4O4IA 3AJAA 4NOLA 3TQSA 1GFSA 2VYVA 3G5MA 3F4LA 2O5VA 2W6CX 5I7WA 2EGUA 4IUCS 4KTVE 1X80A 5LQRA 4W1RA 2VUHB 1FNCA 1PL6A 1JHYA 2GYVA 2VTEA 3U4HA 1NXQA 1WVMA 3PFWO 3RYHA 2WJYA 2P4EA 4NS1A 1NM5A 5AW1A 1EPUA 1SIWA 4ZVOA 4GU5A 4GBGA 3BD7A 3G49A 2QN2A 2X8AA 3WL8A 5A2GA 1KEKA 5K4GA 2BR5A 2F8MA 3E58A 5EP1A 1VC2A 2I7TA 3ESCA 2ZIXA 2HI0A 3LF1A 1PTJA 1APBA 4M83A 4F3KA 1USVA 4JMPA 3FHTA 2MDTA 4WK6A 4ZI5A 4YQEA 2PX5A 3WIEA 2IXDA 4L5CA 2D8AA 1U0FA 3PNQA 1RRKA 1L5KA 1UZAA 4IAOA 1NF2A 5EKUA 2QAGC 3LUFA 2X15A 5FPSA 4BO2A 3VZSA 5FPQA 4PLPA 3ROXA 3HCCA 4RW0A 3GPDG 2O2DA 3D3WA 4Q1EA 4ZZ3A 3WJAA 3G02A 4R7ZA 1JEOA 4P7GA 3BERA 4PG4A 4OUDA 4XWGA 3ZJVA 2E37A 3RF6A 3AG6A 1ENPA 1U1FA 3ZHYA 3DFZA 1SPXA 4GYWA 4MKIA 4PWZA 4MDFA 3SOPA 1KI6A 4DUZB 1EP3B 3KM0A 1MRSA 3AF3A 1X7ZA 3DPSA 1GQ2A 1QYCA 3KLMX 2BBTA 2H0QA 2WUVA 1ENOA 4H0CA 1TEVA 3SJBA 2RK3A 4BKQA 4FFMA 3DHYA 1RLTA 5EVJA 5NLLA 3EQ8A 4DLVA 1GV1A 3IEXA 3U4CA 7REQA 3AERB 2PZAA 4AZ3B 1N0IA 2UYOA 5HILA 2FSPA 4AJKA 4F46A 5IHPA 1UXGA 2ZGVA 3Q10A 4MV1A 3RASA 4ETMA 1KKLA 1UXHA 2IX9A 1JHUA 3K0HA 1G8AA 3A4MA 3GI1A 3QVKA 2GBCA 3WLMA 3FYDA 3OURA 4LE1A 4QECA 2DBVO 1TFRA 2OD2A 4I7EA 3IDZA 4KAFA 1TTQB 4HYQA 4Q4HA 4ZCPA 4BZZA 1GQFA 1ORVA 1QH8B 3L0PA 3ZHQA 2I67A 1YMUA 1S1CA 1NOKA 1SXJC 4BQIA 4O0MA 1Y4SA 3ZU4A 3MRXA 1F7UA 1C41A 5AJUA 3TW4A 5J2TA 1W30A 1S8OA 3SMVA 1VXOA 4G6ZA 2EX4A 1U3VA 4NG5A 4OHWA 4ERNA 1VSTA 2KYRA 2QRJA 2ETXA 1XMJA 3CB2A 1EMDA 2J9GA 3G0DA 3QTLA 4QPCA 3KOUA 3PDJA 3EF0A 2FSHA 2OGZA 2QTWB 3MLAA 1RQ2A 4N9WA 2X0DA 5KOJA 3AR5A 3P8ZA 1I6MA 5J5CA 3DBHB 3DBHA 3RBVA 5ENVA 4OGLA 3SMQA 1GPH1 3ZZTA 3E35A 4QM6A 5AKKA 1PQYA 1PZFA 2NUBA 3HXLA 4BEWA 1F3OA 3RK0A 3SXPA 2H0RA 4EHNA 1GSOA 3IALA 2Q7XA 4WNCA 2FKNA 4NNJA 4DV3B 1XC7A 2C4MA 1R7RA 1Y7PA 2BLLA 1EFTA 2QYTA 2RH9B 3IQGX 3M5CA 4N4AA 4O4JA 5AH0A 5C51B 1GZSA 5JSQA 4EKNB 1BC5A 4ASUA 3TW8A 2B21A 3HXTA 4KITB 4YP5A 1EUQA 1L3IA 4BS9A 1PX2A 1Y5LA 3H7IA 2WSMA 2Q07A 3ID6C 1R0CA 2WJJA 2XCUA 1F9AA 1S8NA 3FYUC 3MTGA 4HCJA 2IU0A 4AECA 4FE7A 1SD2A 3G9QA 1DRWA 2I78A 4H1VA 5F5NA 4RV5A 3VBEA 3T4PA 3S2UA 3FOWA 1JL3A 5K3EA 3IODA 3IPXA 2I55A 1TVKA 2QLJA 1ZXXA 4NX2A 2PTHA 3KR2A 4JT8A 4HAZA 2B83A 4EPWA 4I4CA 4Z4GA 1K5PA 2B4TO 2IGBA 4GBJA 4IDBA 4OY3A 1ISHA 1XRNA 4RM2A 5GAJA 1DIOB 2JI8A 4UFNA 3OC6A 4CLEA 4YY3B 1EXDA 3JYQA 3X43A 1KEVA 2A4KA 2IEDA 3AWDA 3NAQA 3H13A 1R6VA 5G41A 1XZBA 3HB4X 5SYNA 3U9TA 3VTKA 4MYSA 3IE1A 2QN9A 2PUDA 1ZNYA 3NEPX 1DAHA 3A6GA 1T9GR 2E48A 3CT4A 1GUFA 3V7NA 2PQ0A 2VHXA 3MGKA 4IBOA 3Q72A 4RK6A 5JAMA 1NSFA 2IUEA 1BHQ1 1VCHA 2Z6VA 1YQQA 1C50A 1CS0A 1Z0IA 1TUGA 1ONSA 3MFQA 4KX3A 4PPYA 4QTYA 5IWCA 4KXXA 4OB7A 3QX8A 1GKLA 1H9BA 4UHHA 1RLOA 4Y6PA 3S8YA 4KYTA 5KUTA 2XVAA 4FFRA 1U8FO 5IF3A 4CMCA 3C85A 5JO0A 5HUQA 1NIJA 2R8RA 2YZMA 5LZ8A 1XTZA 2GOYA 2PR7A 4RK4A 1KH1A 1XWWA 3ICWA 5LXTB 1A9XB 1AK9A 3ILSA 4OFXA 3E0QA 4G1VA 3BG5A 1J8VA 2W0MA 3CURA 4G1BA 2Q1XA 3FH0A 4CF3A 4UNRA 1DB3A 4X1KA 4WL0A 3UK1A 1EVEA 4YCNA 5BN3A 1IMJA 3NLLA 3H3XA 1R4NB 4S1WA 1O6GA 3HUDA 5GGXA 1MVLA 1LSUA 1JLLA 3ZHOA 1G21E 1OILA 4R98A 3ENNA 2JRLA 2OLKA 3Q1KA 3V33A 5ALVA 3R75A 4R3WA 3KV1A 5EFZA 2XMQA 3IL2A 1LQTA 1JN0A 4JI2B 1EWRA 3PF9A 4KGVA 2VH1A 1DBWA 1RPTA 5D3MB 5ALEA 1R64A 1L5WA 1B42A 4FMCB 5E4YA 3IOCA 1X15A 3RNLA 5I4KA 4TTJA 2CXOA 5CNMA 1AX9A 3F90A 2QTZA 4BE9A 5D51S 3GP5A 3N07A 3QPWA 3TSAA 5I7RA 5KNDH 2ZRCA 3L8ZA 3DHWC 2CFRA 3QEKA 4RENA 3L1JA 4UNPA 1NUHA 1TJ3A 2EF1A 1LXCA 2CCJA 1UZNA 1PDVA 4K5QA 2DHCA 3U7QB 2O8CB 3HP1A 3IEVA 1NJSA 2WM2A 1HG0A 1CE8B 1X74A 2XXBA 3LBYA 4UU7A 1ATZA 3WAJA 1R4MA 2ES4A 1QIIA 3CVOA 3NS7A 4PX2A 4Y6QA 1IWBB 3NHSA 1P2BA 5CNIA 5JSKA 5EZYB 2XRMA 1SEPA 3BIFA 1TADA 4OQPA 3FDFA 4BAGA 4KO3S 4MVJD 5ED4A 3FOEC 1G3MA 1QMPA 4X8MA 2YC2C 3ENKA 1NKTA 1M5RA 1PD0A 1LTQA 4ALMA 2AMFA 2PRSA 2VDWA 3AFOA 1Q0QA 4EY4A 3GLHB 4TYPA 3I34X 4QTXA 2Q3DA 3T7TA 4G9BA 1EA7A 1O0SA 2HDOA 2J41A 2LKDA 2R68A 5GONA 1XTRA 1DC4A 4R9SA 1GFIA 1W2HA 3LLSA 4OBBA 4LRQA 3GUZA 1WETA 4K46A 1IEWA 1NR7A 2HMTA 1R15A 4BLQA 5JV5A 2IPMA 4CTJA 5A3VA 5IVHA 3MB8A 3NH6A 1DELA 4GRIA 5FKJA 4AROA 2WICA 4DJAA 2C5LA 5JPIA 2D5CA 1XU9A 1N6HA 1E2DA 2I0FA 4FMDF 2I2AA 3PX3A 4TV8F 4F6CA 3MAJA 3CISA 3EULA 4BGEA 4WOPA 3PLRA 1HH4A 4UM7A 1KQOA 4RE6A 4RYLA 3RIGA 4IDOA 4KBGA 2YZGA 3NP7A 4RA6A 3OM8A 1CLEA 1L4LA 4C20A 4ZJYA 1X42A 2ZTMA 3TW0A 4DY4A 3DBRA 3JYHA 4D74A 1F48A 5JYBA 4R2HA 1S7CA 2IDKA 1C9EA 2XVZA 4W7IA 5U1PA 3SK0A 1G8HA 1HTWA 2YJTD 4ALKA 4KOAA 4G09A 3SYNA 1RI3A 1VMIA 4Q7KA 4YMLA 5K6TA 2WQZA 1YVPA 2Q9CA 4WJKB 4Y1EA 1YOBA 2FPIB 4D9JA 4WXRA 1SRRA 5KYVA 3RLFA 3O8NA 2D5IA 1GL7A 4HBGA 4M0CA 1NN1A 2WBLC 3H1EA 4WY8A 4ZRDA 5M5BA 4GMKA 2ODPA 2CJWA 4MWBA 4O63O 1GQYA 3TQOA 4NBRA 3U44A 3MJTA 3B1KA 3OQPA 2BGNA 1J9ZA 2HHJA 4K05A 1C1HA 1VMAA 4PONA 1BYUA 4J16A 1QHEA 4EEKA 2IYPA 4Q9KA 5KTKA 1V43A 3UIEA 3BE5A 5BV8A 1CNFA 2WOOA 2R85A 3BWVA 4MI3A 5FXMA 1KFJB 3VU0A 4CEHA 3UEOA 4E2FA 3W5BA 1ULHA 3FPHA 3C1UA 2JHAA 4UD6A 3AMVA 3W34A 2BH9A 4PIPA 3K96A 1Z5ZA 3RVOA 3RAEC 4ZYWA 5U4QA 3EVEA 4Q0MA 1OWPA 4EO4A 2X9GA 4K9SA 2AN4A 4FSHA 1DAIA 4QFCA 1J23A 2XEDA 5H83A 5KNDD 5EHIA 3UB4A 1RTKA 1UK9A 2ZSAA 3AI3A 4WOBA 1QWOA 2BTQB 2ZUWA 3AR6A 4IJMA 3TMYA 1FXWA 4BFZA 3ESRA 2ZB4A 3W1EA 5IBQA 1C9MA 4X7RA 2WIBA 1C9JA 3KOMA 4C7XA 1HDYA 2ZWMA 3W9SA 4BO4A 3UXEA 3ISTA 2W2PA 1GQRA 3AUKA 5ESXA 3LUCA 1U4SA 2GLTA 2XRYA 1XZHA 4D3XA 3B60A 4M8NE 1GDDA 1KEWA 3E5RA 4KMMA 3EUEA 3RDPA 5KQMA 1PLLA 2FN9A 5CR9A 1NBIA 4GUDA 3JALA 4WK0B 4R83A 5ITSA 3TSYA 5JZMA 3BJIC 1B74A 4ZQGA 3I8SA 4ME6A 3KSUA 4OHKA 8ATCA 4R1MA 3HBJA 5DTQA 1G8GA 4LRXA 2CHGA 5AOBA 3UN1A