2G1TA

A src-like inactive conformation in the abl tyrosine kinase domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
271
structure length
271
Chain Sequence
YDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title A SRC-like inactive conformation in the abl tyrosine kinase domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 271
sequence length 271
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2g1tA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2g1tA01
1ZYLA 4FV0A 4RC2A 1GZ8A 2V22A 2LAVA 2VNYA 3CKXA 3KRWA 4RFZA 5L2IA 4G6NA 4ANOA 4O84A 4G6LA 1ZMWA 4OTFA 2WTCA 2BIKB 5HE0A 3ORPA 3WYXA 3PXYA 3QHRA 2PVMA 2A19B 3GU6A 3ZSGA 3G6HA 1LPUA 3Q32A 4FIIA 4QMSA 4QMLA 1ZMUA 4UWCA 2GQRA 4FI1A 3I5NA 5J95A 2F2UA 4J98A 3O71A 5CQUA 3IGGA 3V51A 3P1AA 3VBXA 2C6EA 1YHVA 2C6LA 4JX3A 4EJ7A 1PKDA 4I5HA 4FUYA 3ZRLA 3HAVA 3FKOA 3SG8A 4CZUA 2UZBA 2Y0AA 3EQGA 3OEZA 3P7AA 3RKBA 3R1NA 1E1XA 4D5KA 5IQEA 3FZPA 2XM8A 1KOAA 4X2FA 4BL1A 1JKLA 2IVVA 5CAQA 2C47A 3EFKA 2W9FB 3HMIA 4E93A 1IAJA 3BWFA 4TTHB 2XZSA 3LXNA 2VGOA 3I7BA 2XK9A 3PVUA 3DAJA 4Y5HA 3EN6A 2B52A 3MVJA 5LXMA 4IAKA 4WNKA 1H27A 3QUPA 1OPKA 2YLEA 4O38A 5E92A 3VUDA 3MIAA 4K1BA 4TYHA 3NW7A 2DQ7X 4RVMA 3EN7A 4XOZA 3E62A 5E1SA 2J50A 4PWNA 3HMOA 4RA5A 4X2GA 4C35A 3GGFA 4FODA 4FV1A 1XKKA 4AT5A 4BDIA 3E93A 3R8LA 2VTSA 1K3AA 4QD6A 3Q5IA 4FNXA 4DGOA 4BBFA 4U41A 4DEIA 4USFA 5EQPA 1MP8A 5IA5A 5IZFA 2WD1A 1YI4A 4I4FA 4JBPA 4ENYA 2PL0A 4BCNA 1B39A 5IKWA 2W17A 2W1ZA 4C36A 1K2PA 3QCQA 3ENMA 3RMFA 5LWNA 3LXPA 4ITHA 5EKNA 5E1EA 4FEWA 2W4JA 5JGDA 3RPOA 1LR4A 3KGAA 4IE9A 4J96A 4C4FA 4DG2E 3R9NA 3ZTXA 2DWBA 2VTPA 2PVNA 3NPCA 4R7HA 4F0FA 3SW7A 4WRGA 3R63A 4EH4A 4JIAA 4ZSEA 4MD9E 4FA2A 5BPYA 2JKQA 2YAKA 4I6FA 4QMVA 5FUTA 2GS7A 4QMTA 3VHKA 3WOWA 4X21A 5E8TA 4ZTSA 5HIDA 4CMUA 5LWMA 4MH7A 3RAWA 4CV9A 2FSOX 4TYIA 2VD5A 1Y57A 3UDBA 3BIZA 3V8TA 4DEBA 3GB2A 3NUAA 4G31A 2BROA 2XKCA 1H00A 2PZPA 3P4KA 3OMVA 4R3RA 1OBDA 3M2WA 3DY7A 4PQNA 5AR4A 5L2SA 2WMWA 4S2ZA 2F57A 3IONA 4BWXA 3E3BX 5CQWA 4I5CA 2B9FA 3R1QA 4O7VA 2P3GX 3D5UA 4RJ8A 3FI2A 4X3FC 4Y85A 5FEQA 4CRLA 5BQ0A 3DK7A 3RALA 3QD3A 5ETCA 2CN8A 2WTKC 4FEUA 5DGZA 3C0HA 4JQ8A 4XP0A 5CSHA 5D7VA 3VBWA 2X2KA 3AC2A 4D4SA 2WHBA 5H3QA 2XF0A 3EOCA 5KMLA 4GL9A 2XVDA 3DB8A 4H39A 3W32A 3UPZA 1Q3DA 2VX1A 1H07A 1T45A 4AWIA 2JD5A 5KMIA 3MPTA 4O91A 4CSVA 2E2BA 4UALA 4JOAA 4C61A 3C5IA 4JAIA 4HVHA 3IDBA 5EYCA 2A0CX 4B8MA 3KXMA 4I6BA 3V5TA 4EQMA 1CDKA 3KXNA 4MWHA 4FKUA 4FEVA 4J1RA 1OL6A 4YJUA 5JEBA 2GNJA 5LARA 1KOBA 2YM3A 4MF1A 5B0XA 3W2SA 4HYUA 3TTIA 2OZOA 3QGYA 3AT2A 4J99A 4B99A 4BGHA 4FG9A 2XJ0A 3LM0A 4G9RA 3TWJA 3QZHA 4AN9A 3R04A 4FV5A 4W4VA 5CNNA 3U6IA 4F1MA 2GTNA 2V7AA 4QPAA 3WZJA 5J5SA 1ZXEA 2A2AA 2C5OA 2XNEA 2CLXA 2JDVA 3HMMA 3OBJA 4Y73A 1HOWA 2BAQA 4FTOA 4GG5A 5GZ8A 3I6UA 1ZOGA 3E64A 2JIIA 3C4ZA 5K4JA 2CLQA 2WTVA 3S95A 1LEZA 3FMKA 3SV0A 3JY0A 1OVEA 4JG8A 3ZC5A 4P5ZA 4XNEA 1FMKA 3OWJA 4FKGA 5HBEA 4LV8A 1OECA 4AF3A 3R01A 4EOLA 3RCJA 4USEA 4MK0A 4WKQA 3TZ7A 2YCQA 3HZTA 3F5PA 4J8NA 3RWQA 4D1ZA 2CMWA 2QODA 3GXLA 4O22A 2W1HA 5LMKC 4GFMA 3ZFXA 4F6WA 4WO5A 5J9YA 3F61A 1JQHA 3IW6A 4LRJA 3WZDA 1U59A 2QOBA 2EXEA 1OL5A 5KZIA 3DBQA 3ZBXA 4D1SA 1J1BA 4XBRA 3LFDA 3CCNA 5M55A 2VTRA 1Q8WA 3QRUA 1UWJA 2UW6A 4FZFB 4A06A 4HYHA 1DM2A 4BRXA 4RVLA 5J5TA 3H0ZA 3CP9A 3OTVA 4K9YA 4CZTA 2GTMA 2P2HA 2JITA 5CI6A 4U44A 5E7RA 4AOTA 4D1XA 4BKYA 2GS6A 3R71A 4F7SA 5JK3A 2JLDA 2DS1A 2ZM1A 3OUKA 4PPAA 3KF4A 2XJ1A 2VZ6A 3GQLA 3NYVA 4NKAA 2P0CA 3NS9A 4PDPA 4W8EA 5HOAA 3FJQE 2OW3A 4EC8A 3LFNA 3UQCA 2B9JA 3LQ5A 3QTQA 1OKWA 4BYJA 1J3HA 3PXKA 4FL1A 4EWHA 4FSMA 3QALE 4X2JA 4XYFA 4MQ1A 4LI5A 4G3FA 2WTIA 4M67A 1OM1A 5EM6A 3PA3A 2R3IA 5A14A 5K5XA 2PZRA 3R7VA 4DTKA 2DUVA 4ZTRA 3B8RA 3C4XA 4EC9A 5HQ0A 3O8UA 3Q2JA 1WVXA 3QRTA 4R3PA 4YZCA 5CNOA 3F7WA 4RSSA 1IAHA 3S2PA 5D9HA 2C5XA 5E8SA 4WNMA 3ZFYA 2CHLA 5F9EA 4FKQA 1CMKE 3HECA 4FT9A 1ZRZA 4AZVA 4E5AX 3ORTA 3W2QA 5HE1A 5IQIA 4L53A 4FZDB 4O0VA 1G5SA 4ANLA 4WUNA 5A46A 2WU6A 5IQDA 3ALOA 4WUAA 3KC3A 2J51A 2UW0A 1YOLA 3H9FA 2B9IA 2Y6MA 3IDPA 1H1RA 2OICA 4FT5A 4EOQA 5KUPA 4K11A 3EQRA 2BIYA 1CKJA 3PIYA 4V05A 3R8MA 3R8ZA 4UMPA 5KKRC 3P9JA 4W4XA 2OH0E 4O0UA 1Q62A 1PJKA 3CJGA 4BDHA 5CEKA 1AGWA 3EL8A 5AP2A 3HAMA 4V0GB 2W1DA 4B6LA 4YZ9A 5LCJA 1WFCA 1UVRA 1R3CA 2QQ7A 4X3FA 5AV4A 1BLXA 2R7IA 4RZWA 4X3FB 1W82A 4YC8A 4F6UA 3UC4A 3UTOA 2X2MA 3IW8A 4GFOA 4YU2A 1FMOE 1H01A 2WTKB 3MVMA 4F1TA 2BMCA 1Q8TA 3HDMA 5IF1A 5IA1A 4DTAA 4EK5A 3VW6A 4XG6A 3OP5A 3HGKA 4JI9A 3PJ8A 3F69A 3L9MA 5IA2A 4LM5A 3MFRA 1LEWA 5J87A 3TNHA 2V0DA 4NIFA 2I40A 3BHTA 5LVOA 4HZSA 3IW7A 1W83A 1Z57A 4ANBA 2C6MA 2J0KA 3VS1A 4W4YA 1WBTA 3UJGA 3U9CA 4A9YA 3AMBA 3JVSA 3T9IA 3UZPA 2VTLA 2QG7A 3ZBFA 4CTBA 1KV2A 5CU2A 2VWXA 4M68A 5GJFA 1KE9A 3UIBA 4O7TA 5CZIA 2CNQA 2UZDA 2VO7A 1IASA 3U4UA 3VS4A 4AA4A 1B38A 5TO8A 3V8WA 3TM0A 5BVWA 5HNIX 3R7UA 2UZUE 4FTJA 4O2PA 5IQAA 4EK3A 1QL6A 1I44A 4BCPA 2ITWA 4DLJA 3OXIA 4DINA 3F3TA 4CD0A 5B2LA 1IR3A 2B0QA 4QMZA 4FT7A 4E6DA 3SHEA 4YURA 1JSTA 4DFYA 2C0TA 2WEIA 4I3ZA 3DKGA 3E63A 3QUDA 4IACA 3V01A 3TKHA 3V5JA 5HTBA 2REIA 4YLJA 3WI6A 4O7ZA 3CKWA 4HVGA 5CEIA 3WF8A 3DT1A 3MY0A 5HVYA 5L8KA 5BYLA 4AZFA 4RLKA 2BKKA 4GJ2A 4QO9A 4HGSA 4N70A 4ACDA 3NCGA 3ELJA 3BYSA 2YAAA 5LMKA 5KNJA 4X7QA 3ZDIA 1JKSA 1FVTA 3FV8A 3BLHA 5F1ZA 3WE8A 2F7XE 3DU8A 2UZVA 2OJJA 2W1FA 3MI9A 1ZYCA 2W96B 5JT2A 1DS5A 2CJMA 4UWBA 4F9BA 4YSJA 3GCPA 1Q8UA 1F3MC 5E9EA 2X7FA 2XCHA 3PVGA 4JR3A 4M69A 3FI8A 4IHPA 4E4NA 4M69B 5CS6A 3VS7A 5J8IA 5DYJA 3C4CA 1BL7A 5DEWA 5HO6A 2CDZA 3PXRA 5IDNA 5IUGA 4W4WA 2ZJWA 4IZAA 3EQDA 2OXDA 2ZAZA 3CTHA 5J1WA 2W1IA 1WBNA 2VAGA 5M44A 5ETFA 2BRBA 3QYWA 4QMUA 3NEWA 2KULA 1PW2A 1WCCA 1MRUA 2UZWE 3OCSA 4FSQA 2FYSA 3O7LD 4HNFA 4TPTA 4UYNA 5KBQA 2QOFA 3GI3A 3ZO4A 4DBXA 2R3FA 1GIIA 3R00A 4RGJA 4MD8E 2R3LA 4E7WA 1UA2A 3RHKA 4YTCA 4IADA 3TI1A 1OMWA 4YHFA 1W98A 3V04A 2XRUA 2W5HA 1SNUA 3EFLA 4HGEA 2GNIA 4W9WA 4X6RA 2YA9A 2PVJA 4GU9A 4EI4A 2WOUA 3POZA 2ERZE 2UW4A 2ACXA 1H26A 4XG4A 5EHLA 4ZAUA 2HY0A 5HG5A 3F7ZA 2X8IA 3IW4A 3JVRA 1R0PA 4GT3A 4AW0A 3COKA 2JC6A 4JDHA 3ZLWA 4YGAA 5HIEA 3VJNA 2FSLX 2HZ0A 3KVWA 1W8CA 2LGCA 3QAME 4R78A 3EQFA 5DFPA 5CTPA 1BI7A 2UW7A 2YM8A 3PY1A 5CT0A 3AG9A 4DEGA 4ZJIA 5IISA 2JDSA 4U81A 3S00A 3N4VA 3MH2A 4I0RA 4I94A 2H96A 3PRFA 3OT8A 3QTUA 4IC8A 3LJ0A 5EDPA 5L2QA 3DJ7A 3UO6A 1PRYA 4O86A 4BCIA 4ZS4A 2GHMA 4ZSAA 1S9IA 3LW0A 4BCHA 4FG7A 4UBAA 3QLFA 3KU2A 5EI2A 3TKUA 4R77A 5KKRB 5AP1A 3PPKA 5DH3A 5CXHA 5B2MA 4AW2A 3QWKA 2F4JA 2OBJA 3NW5A 4EZ7A 3QKLA 4YZDA 3RZBA 4CKRA 1OIUA 1XBCA 2ZV8A 1WVYA 3AC1A 3K3JA 3LOKA 3AGLA 4FV4A 4IJ9A 4BYIA 3MYGA 5CXZA 2O64A 4E26A 4RQKA 5CSPA 4O7LA 3D7ZA 5C8MA 5HESA 3I7CA 4U3ZA 3CQWA 4U43A 4FUXA 5LOHA 3TNWA 5BUEA 4BWKA 2QLQA 5AA8A 4KNBA 3NAXA 1OIQA 2IW9A 3VS5A 2JDRA 2UZTA 3FPMA 3TZ9A 2RFSA 3QD4A 2ONLC 4IIRA 3GEQA 5G1XA 1FGKA 1OITA 5IUIA 5IMEA 3ALNA 3E8EA 1OI9A 1B6CB 1J1CA 3MB7A 3ORNA 1TQIA 2W9ZB 1VYZA 3P23A 3W8LA 2B7AA 3ACKA 5HEZA 4ZJJA 2XRWA 2VX3A 3FMNA 4TWPA 3FMLA 4ZLZA 4RX5A 2QVSE 2ITYA 4G5JA 4WT6A 2HWOA 5A4LA 4BBMA 5CASA 3ODYX 2ITVA 5AMNA 3ORXA 3TNPC 5AAEA 5HX8A 2X6DA 3BHVA 5M4CA 1G3NA 2G2HA 3R30A 3C0GA 3TIZA 1XH9A 3TDWA 4U45A 4Y95A 3UOHA 2UZOA 3F3UA 2OH4A 3DK6A 2BRMA 3CS9A 1XH5A 3AT4A 4YTHA 1HCLA 2Y7JA 2W1GA 5D7AA 4AU8A 1XH4A 3A8XA 3BE2A 5LMAA 2F2CB 2GFCA 3TUDA 3FLYA 3EHAA 5I9WA 2PUPA 3RPYA 2ERKA 2OZAB 4PMTA 4Z7HA 3VUIA 4C2VA 3IKAA 2Y4IC 4XV2A 4JIKA 4BCKA 3LKMA 5AP7A 4TXCA 4LRKA 1DI9A 1O6KA 3KF7A 5ETAA 3T9TA 4G3EA 3BU5A 3ORKA 3H9RA 3ZFMA 2AC5A 3ZEWA 3K5VA 4CLJA 1VYWA 5HO8A 5AUZA 1K9AA 4E5BA 3U6HA 4PL4A 2Y9QA 5BYYA 4FIJA 2BAJA 3F5UA 4PP9A 4EOIA 4IB3A 1QPCA 3QL8A 2FB8A 3PSCA 3PZEA 4OTWA 4QP8A 4V01A 3NLBA 3F66A 4CTCA 1SM2A 4R6VA 4FV7A 4AFEA 4FC0A 5FBOA 3VBQA 5JKGA 4HCUA 1LUFA 2FGIA 3RM6A 2C3JA 3E5AA 4U42A 5AM7A 4ZLYA 3NMUF 1R1WA 4GKHA 2OIDA 5M53A 2GDOA 1KE8A 3MSSA 3FMDA 2VV9A 4F7LA 5BVOA 5CSXA 5KO1A 2R3GA 4QYHA 5BMMA 2QHMA 2UW5A 1XHAA 3JYAA 3HUCA 1PXKA 3IW5A 4D4RA 5JQ5A 4L3PA 3II5A 4S33A 3IK3A 4UB7A 4XLVA 3ERKA 3DXQA 1REJA 3OT3A 3SLSA 4AGUA 3CD8A 4BCFA 2BTRA 4UMUA 4XV1A 3NDMA 5I5ZA 1QCFA 4IANA 3ZYAA 3LE6A 3UOLA 4ZTNA 3D83A 4D4YA 5L6OA 4ZMEA 4RIWA 4RIYA 4APPA 4PDYA 5GZ9A 5I9ZA 1BUHA 4RIWB 3NIZA 4RIYB 3W18A 4ZY5A 4IWQA 2PZIA 1OL7A 4IWOA 4KD1A 4ANMA 3C4EA 4I5PA 4D0XA 2EUFB 2QG5A 4ARKA 2X2LA 4F08A 4I1ZA 4FZ6A 4ALVA 1W7HA 2ZVAA 1CKPA 5IEYA 5AV0A 3GFWA 4J8MA 4CQEA 2XA4A 3JR1A 3NWWA 4E6AA 4LQMA 4JRVA 3A7GA 1Y6AA 4TWNA 5I3OA 2Z60A 3KQ7A 4OTDA 4WD5A 3WF5A 4J97A 3R9RA 1XH7A 3R1SA 3LCTA 4J53A 1OGUA 4I5MA 2YCRA 4RVKA 2YABA 2C3LA 3KXZA 4FF8A 1AD5A 4MCVA 2WQOA 4EH5A 4QTDA 4FMQA 4CV8A 3EQHA 4UXQA 3VN9A 5EQEA 4DLIA 3D5WA 5KX8A 3OVVA 3PWDA 1OPJA 2RG6A 4FV9A 5AUYA 5T6KA 3QTZA 4C7TA 4PTEA 3R22A 4O6LA 1XR1A 4R3CA 3ZLXA 3E3PA 2XH5A 4TRLA 3BWJA 3PXQA 4M12A 4NM5A 4M97A 3LZBA 1PXMA 4DFUA 4CEGA 3VS3A 2OJGA 5HIBA 3LIJA 1YKRA 2PVYA 4IBMA 1SVHA 2I0YA 2VRXA 3OY1A 3SDJA 2ONLA 3T8OA 3R0TA 3ZM4A 5ANOA 1PXNA 3HRFA 5DOSA 2XP2A 3HRCA 4R5YA 1U5RA 3HMNA 5EHYA 2OFUA 3TT0A 5FGKA 2CGWA 3EQBA 2E9UA 1H08A 3GQIA 3O23A 4Y5QA 3W55A 4C4GA 1KWPA 3C50A 4FEQA 4CFMA 4FIHA 3E8DA 3ZLYA 2IG7A 4JG7A 2O0UA 3LMHA 2ITUA 4XP2A 2VWWA 4ZEGA 5ACKA 4YLKA 4YSMA 3RGFA 3I79A 4D0WA 3L9LA 3WBLA 1FBNA 1BMKA 3PDTA 4XS2A 4L44A 4TZRA 4EOMA 3L8SA 3GCVA 4EKKA 3NRMA 4IAFA 4YR8A 4I41A 3DKCA 4S30A 4XRJA 3FXZA 1MUOA 2ETMA 3ZH8A 1PXJA 5EK7A 4DTBA 3A99A 2UV2A 5L3AA 4MXCA 3R7YA 4AXAA 4FTTA 4YO6A 3QRJA 4DGMA 5FM3A 4KKGA 4GUEA 4XH6A 1Q99A 2EU9A 4RZVA 5HNBA 4O1PA 5CF4A 3MY5A 3QQFA 3FLWA 4JBOA 2R7BA 5FQDC 4D2PA 4EHVA 3I1AA 2Y4IB 3LLAA 4BI0A 4IC7A 3QQKA 4CT2A 2WU7A 4E4LA 4AX8A 4BIEA 3NX8A 4FNWA 1PXOA 4TWOA 3SD0A 3ZOSA 1TQMA 1QMZA 2RFNA 3KMWA 3RK7A 4RMZA 2JBOA 4F63A 3D5XA 3COIA 4GRBA 3HL7A 4PUZA 5KE0A 2W5BA 3CBLA 5T68A 4L7FA 2CKOA 3PYYA 4MNEB 1P2AA 2E9VA 4C8BA 5KBRA 4JBQA 2PMIA 2OSCA 2ZMDA 3P7CA 4NFNA 4H36A 4UMTA 3FUPA 1V0OA 3H10A 5ETIA 3AQVA 3ZZWA 4YO4A 4EORA 4DCAA 2CCHA 3EWHA 3RJCA 2FO0A 3BV2A 3F3WA 4XMOA 3SOCA 2Q0BA 3DFAA 2OFVA 3BQRA 3DTWA 2R3NA 5AR7A 3TNIA 4AQCA 5HO7A 5IU2A 3FLZA 3D5VA 4I93A 3UZTA 2C69A 4LGGA 1W0XC 2PUNA 5H8BA 4NH1A 4N57A 3G6GA 5EG3A 4CFWA 4RWIA 1MQBA 3MW1A 3MVHA 4D4VA 3UVRA 4UY9A 4X3JA 4J71A 4K18A 4RQVA 3B2WA 4PV0A 1H1QA 4F9WA 4HJOA 3A60A 3DPKA 4HCTA 3QD2B 3MTFA 4GU6A 1XH8A 2VX0A 4E4XA 3HX4A 3UP2A 4Y8DA 2RFDA 3FC2A 4EK4A 4IWPA 4YJRA 4QP4A 2R3JA 5F95A 5GHVA 2YDJA 4AT4A 4D2SA 3MFUA 1JSVA 4ANSA 2X0GA 1H1SA 4ALUA 4JLCA 2HZ4A 3KMUA 2YDKA 4ZK5A 3MBLA 3Q4CA 3N4UA 5KHXA 4ZZMA 1NT2A 4XBUA 1SMHA 2PE2A 1JWHA 4QNAA 3FQEA 2PULA 4AUAA 4TYGA 4QPSA 4C38A 4A4XA 4QTCA 3BCEA 4EBVA 3F6XA 4S34A 2G1TA 1PYEA 3H0YA 2ITQA 2WKMA 3S4QA 4N0SA 1V0BA 3BELA 4WRSA 4DBNA 4YJSA 1XBBA 4GYGA 4ZTMA 5CAUA 4R1YA 2V5QA 5JRQA 4M3QA 3Q5ZA 3CXWA 4TL0A 2J7TA 3PJCA 3R28A 3DBCA 3FLSA 3O50A 5A9UA 1NA7A 2NNWB 2J0MB 4N6YA 2C68A 4G3CA 3DLSA 5CX9A 2YCSA 3QF9A 4EH8A 3W2PA 3LFSA 4JRNA 2XNOA 3HKOA 2IZTA 5CAOA 2JEDA 3ZU7A 4PF4A 2Z2WA 3BV3A 2UVYA 3Q2MA 1PF8A 3UIUA 2X1NA 2IWIA 4IAIA 5EKOA 4CMOA 3OWLA 2HENA 4BCOA 4ID7A 3G2FA 4Q5EA 4IB0A 3BQCA 3MFSA 3HV7A 5IDPA 2C5NA 2WIHA 4CFUA 3ZZEA 2X9FA 4I4EA 3TJDA 4RIXB 3O8PA 4FV8A 1EH4A 3OCBA 3OW3A 4BTJA 4BZOA 3AXWA 4DITA 4WHZA 1H24A 1ZYSA 3OROA 2C6KA 2XBAA 5AM6A 3DDQA 5AUUA 4FSTA 4O0YA 2V55A 1RE8A 5HD7A 4CCUA 3TXOA 5AP5A 4FSRA 3ZONA 1GJOA 1IA8A 2EXCX 1CTPE 2QONA 5GJGA 4FKTA 5HVJA 4RG0A 1S9JA 5EFQA 2BFYA 3HUBA 3ZO2A 5DR2A 1NVQA 1Y6BA 3JXWA 4QP1A 4I6HA 5IEVA 4DF3A 4KBKA 5CF5A 5JMSA 3L8XA 5FEDA 4O82A 3LCKA 5CU6A 4XP3A 1H4LA 3Q4TA 4CFXA 1A9UA 3P7BA 4FSYA 4HYIA 5CVFA 4BB4A 5ICPA 4CFVA 3IECA 5ITAA 4ZSJA 2WGJA 3COMA 4HZRA 4A9UA 2QD9A 3EIDA 5LCKA 3CC6A 4TY1A 3FY0A 2B4SB 4U80A 3R83A 1ZMVA 2CKEA 5AAFA 3A62A 4AFJA 2O8YA 2X6EA 5LVNA 3NVMB 3HLLA 3O96A 4AN3A 3FQHA 1H1WA 4KSQA 5GNKA 3ZUTA 2XNGA 3QA0A 5M06A 3QHWA 2XIRA 4L01A 5EM8A 4F9AA 4K6ZA 2PUIA 4O7SA 2VTOA 3FHRA 3PJ3A 4JT3A 1URWA 4YNEA 4ZZNA 3PLAE 5GIOE 4C58A 2CGUA 3VUKA 4QP3A 4JBVA 4G3GA 5ANKA 2BZKB 3E8CA 4IAYA 3CPCA 2VUWA 3LHJA 2W0JA 4L3JA 2ZDTA 4FTCA 5HBHA 3QYZA 4CCBA 4MEDA 4XJ0A 2J4ZA 4LG4A 4CVAA 3HV5A 5DT3A 2W5AA 4XUFA 2R0UA 4KRDA 4QTBA 5KMMA 2EXMA 2PVHA 2Q0NA 3FSFA 3PG1A 2GNHA 4JQEA 5AJQA 4DN5A 1TQPA 5JZJA 3I81A 4D2RA 2OXXA 3UNZA 3FZSA 3AMYA 3EFJA 4AW5A 4EOJA 4KS7A 3TKIA 3QTWA 4ZSGA 4BGGA 3QCYA 4GMYA 3VAPA 4DH8A 5DRDA 4LL5A 4ZTHA 1Q8YA 1VJYA 4BDKA 1ZOEA 4IM2A 2BAKA 2P2IA 3DBDA 2BALA 3BBWA 2RIOA 3UZRA 3BYVA 4BI2A 4R8QA 2PSQA 2WO6A 4QP6A 2ESMA 4C59A 3R6XA 4V0GA 1ATPE 2X8DA 1IG1A 4BHNA 4CZYB 1QPEA 2F7EE 2JAMA 4IJPA 4Z9LA 4FKSA 3EH9A 4RX8A 3W2RA 3VULA 4AT3A 4OTGA 3BU6A 4KB8A 3EQPA 2J0JA 3C1XA 3LCDA 3MDYA 3R73A 4RC4A 1SVGA 4FKJA 4GV1A 4WSQA 4QMYA 3HVCA 3Q04A 3C4WA 1YHWA 2BVAA 4PDSA 4TWCA 3NNVA 3VUHA 5BUJA 3Q4UA 5M57A 2C6DA 4H3BA 1XO2B 4G1WA 3OW4A 2Z7SA 2OWBA 4TYEA 2GSFA 5EI8A 4F09A 1IEPA 1TVOA 3FI4A 5M08A 5DE2A 2C4GA 3Q9ZA 2EB2A 3EL7A 3KFAA 2VTHA 4ZOGA 5C03A 2V7OA 4JS8A 4CXAA 2UZEA 5EM5A 3VHEA 2RL5A 4A4LA 1H1PA 5AAGA 2VTTA 3AD4A 3OHTA 2JKOA 3C51A 5AV1A 3BHYA 4DG0E 1OL1A 1W84A 2J9MA 4IVBA 4AS0A 3G9NA 4QYEA 3NGAA 3SA0A 3O17A 2HXLA 3I0QA 3FWQA 4E20A 1OUKA 2GHLA 5IQHA 3QQUA 2X8EA 3GBZA 1J7UA 5EH0A 3PUPA 4GCJA 5EDRA 4FKOA 5CALA 1L8TA 2IPXA 2WMUA 2QU6A 4S31A 4X2KA 3UGCA 1H25A 4MTAA 3R7IA 5HKMA 3DQWA 4I24A 4AA0A 2B1PA 3G33A 1IRKA 3A7JA 3KB7A 4WA9A 3ROYA 4NSTA 4FYNA 4U8ZA 1BYGA 4FR4A 5E8WA 4Z55A 1PYXA 4FNYA 1REKA 2GMXA 4CFFA 4OAUC 4IDVA 4AOJA 1YXVA 3BU3A 4QMMA 3BYUA 2QLUA 3TV6A 1PMEA 3ID6C 2J6MA 2XMYA 4R7BA 2JIVA 5BVKA 4XX9A 3CJFA 2XNBA 4FVQA 2BUJA 4AE9A 5AX9A 3DAEA 3P86A 1F5QA 4L3LA 4FZ7A 3RHXA 5GZAA 3F88A 4O1OA 4XG9A 1Q4LA 3OZ6A 4DEDA 4IAZA 5EYKA 3BX5A 5FTOA 4JNWA 4EQUA 4ACCA 4P7EA 2PE0A 2AUHA 3AMAA 2VWBA 3MJ1A 3DKFA 5JZNA 4D28A 1UKHA 4QQ5A 3UPXA 4L46A 3W10A 4FV6A 4I22A 3NW6A 1E1VA 3QCXA 2BKZA 4IDTA 5AUWA 3M11A 2CGXA 4NW6A 3QX2A 4O0XA 4WIHA 2IVSA 5H2UA 3VWAA 5JFWA 3PY0A 3A61A 4QP2A 4OLIA 3HNGA 4O27B 2PWLA 2YCFA 4MXAA 3TV4A 2X4ZA 4F65A 4F7NA 2J0IA 4NK9A 5DEYA 5DT0A 4CKJA 3U55A 3EKKA 5DNRA 4DEAA 5I0BA 3CSVA 3R2BA 3MY1A 5M4IA 1UNGA 4GK2A 4LRMA 3UG1A 4C37A 2PE1A 4C4JA 5IMXA 2VTJA 5H8EA 4Z7GA 3WF6A 5A54A 3GCUA 3CQEA 4D55A 1BI8A 5M09A 2BTSA 3RPRA 3UO4A 4RJ3A 5EM7A 1J7IA 1ZYDA 4I92A 2ITTA 2ITOA 3AC4A 4ANNA 4EOOA 3VUTA 4DH1A 4BCQA 2VNWA 2F9GA 3QTRA 5JQ8A 3TTJA 2WNTA 4M0YA 2XKFA 2JGZA 3TACA 4BDEA 2YM7A 5D10A 4FSZA 3MWUA 2QOOA 4E4MA 2WAJA 4HVDA 4UZDA 5CYIA 3LCSA 2B54A 5K9IA 4FTAA 3QQLA 2QO9A 4D9TA 5I9VA 5FXSA 5DT4A 5FWKK 3GVUA 4B0GA 2CNUA 3CGOA 4HOKA 4BI1A 3QU0A 3OCTA 5HE3A 4B4LA 1Z5MA 4GKIA 3BHHA 4DH3A 5TR6A 4MAOA 1R78A 4O0WA 4BZNA 3OXZA 2BR1A 4BDGA 2Q83A 3PXFA 2HIWA 3CLYA 2FA2A 1R0EA 3FYKX 3IOKA 4CGAA 3RCDA 5L6WL 3Q9XA 1UU9A 3PVWA 4FK3A 3EFWA 4QMWA 5FDXA 3RPSA 5LVMA 5J9ZA 2UZNA 3FZTA 4EJNA 3QC9A 4QTAA 5HLNA 1SZMA 3NYXA 1Y8GA 5DPVA 3PG3A 3SXRA 4XEYA 4EZ5A 5HTCA 1BL6A 3D15A 4OUCA 5CF8A 4UV0A 2F49A 2XK4A 1I09A 4CFNA 4EEVA 4PL3A 1YXTA 3K5UA 4ASZA 3FZRA 2Y4PA 4U40A 4JJRA 3RNYA 2GFSA 3DBFA 3LXKA 4AZTA 2BZJA 3R8PA 3SVVA 3U87A 1V1KA 2R9SA 3Q6WA 2W4OA 3SQQA 1GIJA 3NUYA 5AADA 2CNVA 5FP5A 5E8VA 1M17A 4MWIA 4GIIA 4JX7A 3VQHA 4DCEA 2QKWB 3CTQA 3ETAA 3IS5A 3L9PA 1PKGA 4JVGA 4NJ3A 4FGRA 5K3YA 2HK5A 3M1SA 5I9XA 1X8BA 4Q2AA 2OGVA 3M42A 3ITZA 1WBPA 4XCUA 4FOBA 3UIXA 3H9OA 5CENA 4EOKA 4EK8A 5HE2A 2XIXA 4KIKA 1LP4A 3BGPA 3UVPA 2C5YA 4DEEA 1G8AA 1XBAA 4EH7A 4KIKB 2WTJA 5FM2A 3SXFA 5C4LA 5EI6A 3I0OA 5LQFA 2JFLA 5AP0A 2XIKA 3VS2A 2QOQA 3LFEA 3EQIA 2WMAA 4QOXA 5IPJA 2XBJA 5HU9A 2QO7A 1Y8YA 1VR2A 2ZV9A 4IZ5A 3CPBA 4XV3A 2NP8A 2QI8A 4V04A 5HLPA 4X6QC 4YC6A 1YWRA 3FI3A 3OY3A 4K0YA 5T3QA 3GC9A 3SOAA 3FLQA 4MNFA 3MH1A 3UO5A 5CVGA 4KBAA 3UBDA 2Y6OA 2VTIA 4BVUA 3IOPA 2JIUA 3F5GA 3EJ1A 5IG1A 2BZHB 2OZAA 1WMKA 3NZ0A 5A6NA 1ERKA 5I9YA 4IFGA 3QLGA 2R3OA 4M66A 3K3IA 4UWYA 4LMUA 4FT0A 5M56A 2XK7A 4A9SA 3AT3A 4FGBA 4XG2A 2YM4A 3AOXA 5EHOA 3NUXA 3R7EA 3ZC6A 3KXGA 3FXWA 3PIZA 4NUSA 1WBOA 5HD4A 4FE2A 1M7NA 1YXUA 3I5ZA 5DLSA 2R5TA 5AP4A 2ZYBA 4NM3A 2GPHA 2XIYA 3F9NA 3OF0A 3PVBA 4O0SA 3THBA 3OCGA 5E8XA 3PY3A 5CU3A 4TKSA 4YHTA 2VWUA 3FL4A 5CAPA 5FTQA 4KRCA 4E1ZA 3DKOA 4RA4A 4RT7A 2ZM4A 2ZOQA 5D1JA 1O6LA 4FK6A 4R1VA 1OKYA 4PL5A 4AG8A 2I7QA 4IQ6A 4GK3A 4NU1A 3ACJA 3NYOA 4Y46A 4BDBA 3T3UA 2ZMCA 4OBPA 4QMQA 2R3QA 3W16A 4F0GA 1U5QA 3RM7A 1MRVA 4CNHA 4G34A 3S1HA 4FSUA 3W1FA 1YQJA 4BIDA 3G15A 3F3VA 2X39A 4CT1A 3E88A 3E7VA 4FSNA 3PJ1A 2V62A 2RFEA 2YERA 4YZMA 2IN6A 4Q9SA 3GU4A 1PY5A 2B9HA 5DR6A 5AP3A 4ZZOA 4X2NA 3B2TA 3BBTB 4UYAA 4A7CA 5DN3A 5HBJA 3OD6X 4IX3A 3G51A 3ZMMA 1M2PA 1SYKA 5I9UA 3TZMA 4CMTA 4FTMA 5EOBA 1FOTA 3LVPA 3DA6A 2IVTA 3O2MA 2P33A 4D58A 1WBWA 3EYHA 3DNEA 5AX3A 3A7HA 4NFMA 5ANIA 2FSTX 3LXLA 5L8LA 5IEXA 2XS0A 5HI2A 3R9DA 5FXRA 2VWYA 4OBOA 5AV3A 2IZUA 1CKIA 1FPUA 1GY3A 3GOKA 4NZWB 4QMPA 3W8QA 4FEXA 1A06A 3H4JA 3CY3A 5I3RA 2G9XA 4YPDA 4F6SA 5JRSA 3OOMA 3LFAA 4PDOA 4F1OA 3UOJA 3DXPA 5AFVA 4GT4A 3DNDA 4BTKA 3KCKA 3KEXA 4MVFA 3V5LA 1OBGA 3RWPA 4BR3A 3L9NA 2XB7A 5C8KA 3ORLA 3VO3A 4ALWA 3LAUA 4DH7A 3TDVA 1NVRA 3I6WA 5CWZA 2QNJA 1OIRA 4PTCA 5DI1A 3F2RA 2WOTA 4FIGA 2QURA 3A7IA 4RBLA 2YJSA 3HV6A 2OG8A 2UVZA 4LOOA 1P4OA 3OS3A 4U7ZA 5CEPA 3DDPA 3RNIA 4WOVA 4ITJA 5HG8A 4LGHA 5HU3A 2X81A 4RFMA 3JS2A 3D2IA 3VUGA 4K2RA 5CU4A 3DBEA 4OR5A 3BRBA 4E5WA 4NT4A 4E8AA 4ZJVA 5H8GA 3S0OA 2W1CA 1ZAOA 3QA8A 5A4CA 4YJNA 4ANQA 3MJ2A 3DOGA 5CU0A 3SW4A 3FSKA 4MXOA 3HYHA 2ZM3A 1Q24A 4IB1A 4JG6A 3QRKA 1PMNA 1UNHA 3RVGA 4WG4A 3TCPA 5A4QA 2I6LA 4OTQA 2AYPA 1NY3A 4AZWA 5J7HA 2XYNA 4FKRA 4MD7E 1R39A 2GCDA 3DLZA 3O51A 2QOCA 3DB6A 1UNLA 3BKBA 3JY9A 4AGWA 3C13A 3IGOA 3BE9A 3A2CA 5CVHA 2BHEA 4RWKA 4L42A 2ZB1A 2GHGA 4APCA 5FEEA 3SXSA 5AR3A 5CF6A 4O6EA 3SG9A 4MBLA 5K0KA 3LMGA 4G3DA 3R02A 5BYZA 2YM5A 1CSNA 5FRIA 3E8NA 4PMSA 4BCMA 3GCQA 2C3IB 2OXYA 4YZBA 3KVXA 2UW9A 2J5EA 3ZCLA 4TW9A 2Z7QA 4IXPA 3R2YA 3BLQA 4K8AA 4BTFA 1BX6A 5JFSA 5HTIA 1SNXA 2XK6A 1STCE 4IX5A 5CLPA 3ZSIA 5BVFA 3NVKI 3FZ1A 4IB5A 3VS6A 1GZKA 2OIQA 2UW3A 3GC7A 4XHKB 2YISA 1E9HA 5CANA 4WG5A 3FKNA 4A07A 2VTAA 3P78A 4G17A 2R3KA 3ZO1A 3HV4A 5FP6A 2A1AB 4U0IA 3QZIA 4BDFA 2WMTA 5ACBC 4MXXA 4UMRA 1IA9A 4ACHA 3UQGA 4ZP5A 2WIPA 3D94A 3NYNA 4GFGA 5AIKA 2C0IA 3FL5A 2RGPA 3PP0A 5EW9A 4LOPA 1URCA 4BDJA 5CAVA 5LJJA 3MH0A 5FD2A 2JAVA 3OEFX 4IMYA 2BRGA 4L52A 4L68A 3G5DA 4RJ5A 4ONAA 4XRLA 4ZY6A 5K4IA 3GOPA 3HA6A 4IWDA 2HZNA 2UUEA 3R7GA 1RW8A 3FDNA 4RC3A 3BPRA 5EW8A 2A27A 1YHSA 4IM3A 4MNEA 4E6QA 2PVFA 3RAKA 4AGCA 3LQ8A 3QCSA 4PMPA 3QZGA 3QC4A 4ERWA 4QQTA 5BX0A 4PNKA 5JGAA 3ZXZA 3G90X 4FIFA 4C02A 2C0OA 4FICA 4AACA 1O6YA 2XKDA 5L6PA 1OKZA 1H8FA 1YWNA 4KABA 4YP8A 1M14A 4XG8A 4TYHB 5C27A 4EL9A 4KBCA 4KKEA 1U46A 2P55A 5HGIA 5KCVA 2Z7LA 4DAWA 4GS6A 3REPA 1GIHA 2PZYA 1ZY4A 3QTSA 3ATSA 4DH5A 3VF9A 3QTIA 5M4FA 2C5VA 1RJBA 2DYLA 3VC4A 3A4PA 3ANQA 3V3VA 4MYGA 3DZOA 2PU8A 3UYTA 3P5KA 4FX3A 4KIPA 1YVJA 3WZUA 3GT8A 4ZTLA 1V0PA 5IH5A 5BUIA 4MBIA 4ZY4A 4C34A 3KA0A 5BVNA 3MA6A 4H1MA 4P2KA 1P14A 2BDFA 3RZFA 4FTKA 5F20A 5AUTA 5IA0A 3F82A 3KN6A 4KA3A 5L2TA 1YRPA 4LUEA 4L6QA 3AC3A 2C6OA 2FH9A 4EKLA 5E8UA 2HW7A 3I60A 1BKXA 3HV3A 3R8UA 3HA8A 3EN4A 4YHJA 3PSDA 3B8QA 4L43A 3IDCA 3DXNA 3ZEPA 2ETRA 2WMVA 3C5UA 3IPHA 4BFMA 4EH6A 5IQBA 1WBSA 3V8SA 2J2IB 3LMIA 2BCJA 5LVLA 3OBGA 4KKHA 4OGRA 4ZLOA 4O7NA 2FVDA 3K2LA 3NNUA 1OL2A 5K5NA 3MFTA 4LOQA 2I0VA 3NUNA 3A7FA 3GCSA 3KL8A 1KSWA 2XJ2A 1PXLA 4YJOA 5DR9A 2A4LA 1U4DA 3V5WA 4C3RA 5CEQA 5M51A 4ZTQA 3ZHPC 1UU7A 4QQCA 3VW8A 4QP7A 3QUEA 2I1MA 4K33A 2BZIB 2NRYA 2IW8A 3DK3A 1M2QA 1Q97A 4QYGA 1UV5A 1Y91A 5TKDA 3WYYA 4FSWA 4AA5A 4BC6A 2GS2A 3TJCA 5HVKA 5JN2A 2PMOX 2PVLA 2JDTA 4G5PA 4TYJA 5LVPA 5EOLA 4U3YA 2HZIA 2YM6A 4FTUA 4FG8A 3SRVA 4I6QA 4QP9A 1ND4A 5E4HA 3SRVB 2JFMA 3W2OA 3KKVA 1ZLTA 1H0VA 4WBBB 4F9CA 2RKUA 1JNKA 4G2FA 4KS8A 2PHKA 1KE7A 3FHIA 3KRXA 5CY3A 2YIYA 4JAJA 4RIXA 2WXVA 3E87A 4F64A 4PPBA 1QPJA 3KY2A 4TNBA 4YLLA 4DT8A 1OPLA 4JDIA 2R3PA 5D12A 3LLTA 3WARA 4H1JA 5CZHA 4HPTE 4YJVA 5M4UA 4EOSA 3R8VA 4MHAA 3CTJA 3LFCA 4P4CA 5TT7A 2YACA 2GQGA 2NRUA 3R9HA 3Q96A 5TOZA 5BVDA 4BIBA 2YN8A 4QT1A 3UIMA 3CEKA 4CYJA 2GU8A 3QXOA 3TZ8A 3U4WA 3UMXA 2HYYA 4M8TA 3KRRA 1J7LA 4RWLA 4M13A 3O8TA 2BRHA 3FKLA 3LPBA 3DTCA 4L67A 5CSWA 3GUBA 5DIAA 5AR8A 3UODA 5JSMA 3FMHA 4A4OA 5DMZA 2QOLA 1DAWA 5J1VA 5KZ0A 3VBTA 4BDAA 3LFQA 4X0MA 2G2FA 5I4NA 5EQYA 1GNGA 1JKTA 4QPMA 1TKIA 1WBVA 2R2PA 4C4IA 1XJDA 2YIXA 3PSBA 4ZSLA 2GNGA 4JXFA 4EUUA 2WMSA 2OLCA 4DGGA 5A3XA 5TF9A 2R0IA 3GU5A 4YTIA 3RTPA 4M84A 5HHWA 4R7IA 5BNJA 5DRBA 5JFXA 2XEZA 2JDOA 2HY81 3EYGA 4C33A 2GNLA 3N4TA 4A9TA 3U54A 4B7TA 4AW1A 5B7VA 2VN9A 4BHZA 5L8JA 2PK9A 3BYMA 3OTUA 2OO8X 5JFVA 5FBNC 2VTMA 3OOGA 3V5QA 4JQ7A 3VUMA 4H58A 3V6RA 4DT9A 4FV2A 4QYYA 4E73A 2CGVA 3JPVA 2ITXA 2YZLA 3GP0A 4MXYA 4U9AA 4YJPA 2YZAA 4WG3A 3RI1A 2PY3A 2G15A 2XCKA 3BZ3A 4YBJA 4BGQA 4BKJA 4PY1A 1UKIA 5D11A 4NJDA 3WIGA 2WMBA 4U5JA 5F4NA 3UE4A 2BILB 4D2TA 4EHGA 2R3MA 2XYUA 3ET7A 3JUHA 4IW0A 3MVLA 2PZ5A 2ZV7A 2W4KA 3P79A 1JLUE 4KAOA 4MXZA 4XG3A 3ULZA 4HVSA 4YUQA 5J9LA 2PYWA 4M14A 2QR8A 3LFFA 5C4KA 1KUTA 2UW8A 4GEOA 1JAMA 1WVWA 2ETKA 3LM5A 3WE4A 1YDSE 2OK1A 4LYNA 1PMVA 4MBJA 4Z16A 3DZQA 3E7OA 5C01A 3SC1A 2UZLA 3BGQA 4H3QA 1U54A 5EYDA 4ENXA 3ORIA 4I0SA 1U54B 3DS6A 2R3HA 2C6IA 3L8VA 3V6SA 4O7YA 1GAGA 2AC3A 2PUUA 3EKNA 3FMJA 4RX7A 2BHHA 4Z3VA 2YWVA 3OXTA 2QHNA 2VO6A 4PNIA 1XQZA 3FC1X 3QKMA 4EUTA 2BDWA 1ZWSA 4JDJA 3HEGA 1FVRA 3AC5A 2G01A 5AWMA 4RJ6A 4RPVA 4B9DA 2H8HA 3RP9A 3K54A 5C8NA 4NYEA 1AQ1A 1H28A 2XKEA 5HG7A 3KRJA 3ZDUA 4FKVA 4HPUE 1ZARA 3CE3A 3HMPA 4DA5A 3MESA 2C1AA 5HCYA 3HP2A 1NXKA 3CR0A 3O7LB 4OTHA 5CEMA 5HX6A 4J95A 2EB3A 4OTIA 4OTRA 4O83A 3PE1A 1YXSA 2ITZA 4FTIA 4BCGA 4I20A 3GC0A 2QC6A 4L9IA 4IH8A 3VRYA 3KN5A 3EQCA 3G9LX 4OTPA 4FL2A 1CM8A 4DHFA 2HELA 3E92A 4H3PA 3BYOA 4QQJA 1RDQE 2B55A 2HWPA 4XOYA 2IZRA 1DI8A 1P4FA 1OIYA 4I23A 2O2UA 5IH4A 1Q41A 2J90A 3NUUA 5M07A 2VWVA 3D4QA 4RX9A 3IQ7A 3SKCA 4M0ZA 4EHEA 5ANDA 4YC3A 5KMKA 4D2VA 3HP5A 3BEAA 2E9NA 4S32A 4DE4A 1PHKA 5J79A 2CCIA 3QWJA 3UMWA 1F0QA 2WB8A 4AP7A 4ASDA 3QRIA 4O81A 4DC2A 4DG3E 2W7XA 2ZDUA 4YBKA 2CPKE 3F3ZA 1ZZLA 5TE0A 4BKZA 2B53A 4FOCA 3MTLA 5A4TA 1G8SA 2PVKA 3R9OA 4QTEA 4TT7A 2WQMA 4N4SA 4LFIA 3U8WA 4CYIA 4XV9A 3PA5A 5FTGA 2PMNX 3PPJA 4MX9A 4AZSA 1YOMA 4NIFB 3ZRKA 2YIQA 2I0EA 1YDRE 3ZRMA 1YWVA 3FLNC 3AGMA 4O21A 4RVTA 1GZNA 3PFQA 4LL0A 4KSPA 1T46A 4GH2A 2F7ZE 2W99B 4R5SA 3RAHA 5IQFA 3W2CA 4QRCA 5AR5A 3WF7A 4IVCA 4YPSA 3QGWA 3O0GA 3QX4A 4DFZE 2H9VA 5E90A 4EYJA 5IA3A 3ATTA 4F7JA 5H9BA 4IVDA 4OT6A 1KE5A 2IZSA 3PWYA 1XH6A 4NL0A 1Z9XA 3Q9WA 2Z02A 3PLSA 3FY2A 5D41A 5LMBA 3KREA 1NW1A 2HOGA 4O0TA 3EN9A 2X7GA 1WAKA 4GW8A 5E8ZA 4AAAA 1JVPP 4HNIA 3LCOA 4W9XA 5JH6A 4C57A 3NNXA 2I0HA 4BCJA 3MA3A 2VWIA 2XNPA 4UEUA 1YI3A 3ZO3A 1PMUA 3NIEA 4C0TA 4II5A 1Q8ZA 3TNQB 5E91A 2C3KA 4MQ2A 2QO2A 3SX9A 3F2AA 4DEHA 3VBYA 3AC8A 1FVVA 4EZ3A 3TN8A 4NTTA 4EK6A 3Q4ZA 3GU8A 5E8YA 1JPAA 4OT5A 3ZUVA 1OZ1A 3FMEA 2YIRA 2R4BA 3FXXA 3R7OA 4LUDA 3P08A 3FMMA 2BPMA 2CN5A 4F4PA 3COHA 3PA4A 2VTNA 3ZSHA 1QPDA 3LJ2A 1O9UA 2H34A 2WMRA 4CQGA 4F70A 3TG1A 2W06A 5GIPE 3NAYA 2JBPA 1YW2A 1MRYA 3VBVA 3CQUA 1OUYA 4EH9A 3UQFA 2WELA 2J0LA 2BFXA 4E6CA 2C1BA 3NUPA 4M15A 2Z8CA 4BDCA 4YZNA 4TN6A 4F9YA 5ANJA 3H30A 3D2KA 2WQBA 4ZMFA 4D2WA 2WFYA 2CKQA 4H05A 3RBWA 2UVXA 5AA9A 3UVQA 4DGLC 2C30A 3PRIA 2WZJA 4TNDA 3WIKA 4FBXA 5HG9A 5AEPA 4FT3A 4GT5A 2QCSA 4O7RA 4C4EA 4U79A 4BDDA 1JSUA 3W33A 4UMQA 4HVIA 4FNZA 4OAVB 3D0EA 4NW5A 5DHJA 3S3IA 3U6JA 5C1QB 3QBNA 4GSBA 2PPQA 4CKIA 2CKPA 4DYMA 4LV5A 4LGDA 4FTNA 3MH3A 3MIYA 5ANGA 3HRBA 5CEOA 4OBQA 1PXIA 3GENA 4KIOA 2H6DA 4NEUA 4DFBA 4K77A 2YIWA 3ZM9A 2R64A 4L45A 2OI4X 1JOWB 2BRNA 3ODZX 4UXLA 4F0IA 3T3VA 5C26A 2P4IA 2C6TA 4EWQA 3ANRA 2YITA 4F99A 4G9CA 5BVEA 1UU8A 3A8WA 4J7BA 4M7IA 3BHUA 3SGCA 3GFEA 4FKPA 4GVJA 2RSVA 3QQJA 3FE3A 4NCTC 5HLWA 2EVAA 3H3CA 5EYMA 3VJOA 5GJDA 4FTQA 5IA4A 2X9EA 2RG5A 3NSZA 3F5XA 4LMNA 3U51A 2IO6A 4EOPA 4IZYA 5FXQA 4UX9A 3ENHA 3KULA 2GQSA 3KULB 3TUCA 4C62A 3C7QA 3PE2A 4NM0A 2YFXA 4CLIA 1J91A 3D9VA 1M7QA 4HW7A 2VTQA 4FKLA 4QMOA 4A9RA 4D9UA 3VNTA 3LFBA 2ITNA 3QQHA 4PMMA 3OWKA 3VQUA 2HW6A 3F2NA 3POOA 3MPMA 3NNWA 3PP1A 4PPCA 3FBVA 3BGZA 4ACGA 3BEGA 5AP6A 4NWMA 2W05A 3ZXTA 4L00A 3Q3BA 4PP7A 2W1EA 2YDIA 2XEYA 3CY2A 3MN3A 5DVRA 4G6OA 2WPAA 4C4HA 4BZDA 5HORA 3PZHA 1JKKA 3DJ5A 4I21A 3ORMA 3AD6A 4GG7A 2PVRA 1VZOA 4WBOA 2WTWA 4FTLA 4W8DA 4ASEA 4DFLA 3NR9A 5HCZA 4BN1A 4L7SA 3MS9A 3WILA 3KCFA 4RJ7A 2QOHA 4Q9ZA 4RLLA 4U6RA 5GINE 4EBWA 4BF2A 3SAYA 1PXPA 1FQ1B 4O0RA 3BI6A 4ACMA 2E9PA 3OG7A 4GK4A 1OKVA 1YOJA 4CRSA 3EMGA 3UNKA 5FLFA 2ZV2A 4DGNA 4EONA 4EHZA 5JGBA 4IAAA 3WZKA 2XIZA 4AZEA 3CIKA 5KHWA 4N6ZA 3FPQA 3A4OX 4D5HA 3VIDA 5CT7A 2QKRA 3RAIA 5J7BA 2WEVA 4ORKA 4ZIMA 4C3PA 2R3RA 2WQNA 1Q61A 3Q53A 4FKWA 1YI6A 2KTYA 4HGTA 4FTRA 5DWRA 3KK8A 5BMSA 5CSVA 2OF4A 5AUXA 2OJ9A 2NO3A 2PMLX 2XNNA 1JBPE 4RRVA 3QQGA 2IJMA 2ZB0A 3C4FA 5AR2A 4O2ZA 4P5QA 5AV2A 3KK9A 4G16A 2G2IA 3PXZA 1UWHA 4P90A 4QNYA 4ASXA 4ZXTA 3UYSA 3IO7A 3NUSA 3D14A 5KMNA 3DV3A 4FV3A 5HCXA 3EB0A 4FIEA 4UN0C 4O96A 3BLRA 4C3FA 2QR7A 2OJIA 2VWZA 2NPQA 3Q9YA 1L3RE 1ZOHA 3D7TA 4FKIA 4Y83A 4JL9A 4PTGA 4L8MA 1KE6A 3D7TB 3UP7A 3Q6UA 5FDPA 2OJFE 1YXXA 2VU3A 3C9WA 2YJRA 1FINA 4BBEA 1YDTE 5B2KA 4RWJA 5IQGA 4KINA 1UU3A 2OU7A 2J5FA 4RIOA 3WF9A 3KXXA 4ZS0A 1KV1A 3LQ3A 3RK9A 4GIHA 2VGPA 4EYMA 3GNIB 2HXQA 2JKKA 3QXPA 2XK8A 3TIYA 4RJ4A 4B8LA 2WMXA 2CSNA 4BICA 4BTMA 3CD3A 1GZOA 4KIQA 3KRLA 3DAKA 2VO3A 5AUVA 2X4FA 4GYIA 4HGLA 3UOKA 4CG8A 4OW8A 3FAAA 2Z7RA 2WMQA 1OB3A 2FUMA 2O65A 2OIBA 5KMJA 4I0TA 2WQEA 2O63A 3C0IA 4IZ7A 3RINA 4KUJA 3Q52A 4ITIA 4FYOA 4GVAA 2Y8OA 3OC1A 3MPAA 3QTXA 2YHVA 4Y72A 3UG2A 3VS0A 3TV7A 3RPVA 4DFXE 4EQCA 3QZFA 2EWAA 2YEXA 4EH2A 3G0FA 3MGYA 2QU5A 3U9NA 3DGKA 5HNGA 3PTGA 1RQQA 4USDA 2HAKA 3WZEA 4XLIA 3QD0A 4EH3A 3DFCB 4FVPA 4MKCA 4YJTA 5EW3A 3EZRA 3FZOA 3LJ1A 3PPZA 2IVUA 2WTDA 2OKRA 4RFYA 3KMMA 2VO0A 4YNOA 4HYSA 1Q5KA 1MQ4A 3FYJX 5CI7A 4AE6A 4IFCA 1DAYA 2YLFA 3VRZA 4IX4A 3OFMA 3EZVA 3QFVA 4NTSA 4BY9E 3HDNA 3OWPA 5ANEA 3MV5A 2RF9A 3N9XA 4IEBA 4E3CA 3QKKA 4O7WA 5HZNA 1Q3WA 1SVEA 5DBXA 3PIXA 4FZAB 2IW6A 5AIRA 5K0XA 1M52A 2XNMA 4WNPA 4NCTA 1NVSA 3UNJA 4QYFA 3VVHA 4QMNA 4PX6A 3FEGA 1FGIA 4NKSA 4IVAA 3GC8A 1H0WA 4XG7A 3CGFA 3ROCA 1XWSA 5A6OA 4MF0A 5L2WA 2XUUA 3V5PA 1ZYJA 2QOIA 2BDJA 2FSMX 4WNOA 2ITPA 3ZLSA 3R21A 4AOIA 3TL8A 4QMXA 5IUHA 4U97A 5EDQA 1ZY5A 4FVRA 3KXHA 4UZHA 4NM7A 5DA3A 3GU7A 4IM0A 4CG9A 5F94A 5G6VA 3R1YA 4GUBA 5HICA 3VF8A 5KMOA 4IX6A 2PTKA 5DG5A 3TEIA 3AD5A 3MB6A 2XM9A 4YTFA 3EN5A 3FQSA 3IG7A 5FG8A 1P5EA 3P0MA 5A4EA 2X7OA 4DFNA 4ERKA 2YWPA 2XK3A 3RK5A 4YMJA 4KWPA 1VEBA 1WZYA 3ULIA 3OUNB 4AGDA 4BWPA 4Q5HA 2E9OA 2SRCA 2OF2A 4AN2A 5L4QA 3ORZA 2HCKA 1APME 5IQCA 3I4BA 1ZZ2A 3ZS5A 3ZUUA 1HCKA 4JR7A 4GJ3A 2GNFA 1GOLA 3NCZA 4FL3A 4HCVA 3UC3A 3L1SA 2O3PA 3PJ2A 3DCVA 4PRJA 4YJQA 4C2WA 4WSYA 1M2RA 3N51A 5IH6A 1A48A 5C9CA 3G0EA 4JDKA 3TUBA 3L8PA 2JKMA 4J52A 3DJ6A 2O5KA 3Q60A 2QOKA 3DQXA
chains in the Genus database with same CATH superfamily
1ZYLA 4FV0A 4RC2A 1GZ8A 2V22A 2LAVA 2VNYA 3CKXA 3KRWA 4RFZA 5L2IA 4G6NA 4ANOA 4O84A 4G6LA 1ZMWA 4OTFA 2WTCA 2BIKB 5HE0A 3ORPA 3WYXA 3PXYA 3QHRA 2PVMA 2A19B 3GU6A 3ZSGA 3G6HA 1LPUA 3Q32A 4FIIA 4QMSA 4QMLA 1ZMUA 4UWCA 2GQRA 4FI1A 3I5NA 5J95A 2F2UA 4J98A 3O71A 5CQUA 3IGGA 3V51A 3P1AA 3VBXA 2C6EA 1YHVA 2C6LA 4JX3A 4EJ7A 1PKDA 4I5HA 4FUYA 3ZRLA 3HAVA 3FKOA 3SG8A 4CZUA 2UZBA 2Y0AA 3EQGA 3OEZA 3P7AA 3RKBA 3R1NA 1E1XA 4D5KA 5IQEA 3FZPA 2XM8A 1KOAA 4X2FA 4BL1A 1JKLA 2IVVA 5CAQA 2C47A 3EFKA 2W9FB 3HMIA 4E93A 1IAJA 3BWFA 4TTHB 2XZSA 3LXNA 2VGOA 3I7BA 2XK9A 3PVUA 3DAJA 4Y5HA 3EN6A 2B52A 3MVJA 5LXMA 4IAKA 4WNKA 1H27A 3QUPA 1OPKA 2YLEA 4O38A 5E92A 3VUDA 3MIAA 4K1BA 4TYHA 3NW7A 2DQ7X 4RVMA 3EN7A 4XOZA 3E62A 5E1SA 2J50A 4PWNA 3HMOA 4RA5A 4X2GA 4C35A 3GGFA 4FODA 4FV1A 1XKKA 4AT5A 4BDIA 3E93A 3R8LA 2VTSA 1K3AA 4QD6A 3VONA 3Q5IA 4FNXA 4DGOA 4BBFA 4U41A 4DEIA 4USFA 5EQPA 1MP8A 5IA5A 5IZFA 2WD1A 1YI4A 4I4FA 4JBPA 4ENYA 2PL0A 4BCNA 1B39A 4BJJB 5IKWA 2W17A 2W1ZA 4C36A 1K2PA 3QCQA 3ENMA 3RMFA 5LWNA 3LXPA 4ITHA 5EKNA 5E1EA 4FEWA 2W4JA 5JGDA 3RPOA 1LR4A 3KGAA 4IE9A 4J96A 4C4FA 4DG2E 3R9NA 3ZTXA 2DWBA 2VTPA 2PVNA 3NPCA 4R7HA 4O4EA 4F0FA 4WRGA 3SW7A 3R63A 4EH4A 4JIAA 4ZSEA 4MD9E 4FA2A 5BPYA 2JKQA 2YAKA 4I6FA 4QMVA 5FUTA 2GS7A 4QMTA 3VHKA 3WOWA 4X21A 5E8TA 4ZTSA 5HIDA 4CMUA 5LWMA 4MH7A 3RAWA 4CV9A 2FSOX 4TYIA 2VD5A 1Y57A 3UDBA 3BIZA 3V8TA 4DEBA 3GB2A 3NUAA 4G31A 2BROA 2XKCA 1H00A 2PZPA 3P4KA 3OMVA 4R3RA 1OBDA 3M2WA 3DY7A 4PQNA 5AR4A 5L2SA 2WMWA 4S2ZA 2F57A 3IONA 4BWXA 3E3BX 5CQWA 4I5CA 2B9FA 3R1QA 4O7VA 2P3GX 3D5UA 4RJ8A 3FI2A 4X3FC 4Y85A 5FEQA 4CRLA 5BQ0A 3DK7A 3RALA 3QD3A 5ETCA 2CN8A 2WTKC 4FEUA 5DGZA 3C0HA 4JQ8A 4XP0A 5CSHA 5D7VA 3VBWA 2X2KA 3AC2A 4D4SA 2WHBA 5H3QA 2XF0A 3EOCA 5KMLA 4GL9A 1OGYA 2XVDA 3DB8A 4H39A 3W32A 3UPZA 1Q3DA 2VX1A 1H07A 1T45A 4AWIA 2JD5A 5KMIA 3MPTA 4O91A 4CSVA 2E2BA 4UALA 4JOAA 4C61A 3C5IA 4JAIA 4HVHA 3IDBA 5EYCA 2A0CX 4B8MA 3KXMA 4I6BA 4MUQA 3V5TA 4EQMA 1CDKA 3KXNA 4MWHA 4FKUA 4FEVA 4J1RA 1OL6A 4YJUA 5JEBA 2GNJA 5LARA 1KOBA 2YM3A 4MF1A 5B0XA 3W2SA 4HYUA 3TTIA 2OZOA 3QGYA 3AT2A 4J99A 4B99A 4BGHA 4FG9A 2XJ0A 3LM0A 4G9RA 3TWJA 3QZHA 4AN9A 3R04A 4FV5A 4W4VA 5CNNA 3U6IA 4F1MA 2GTNA 2V7AA 4QPAA 3WZJA 5J5SA 1ZXEA 2A2AA 2C5OA 2XNEA 2CLXA 2JDVA 3HMMA 3OBJA 4Y73A 1HOWA 2BAQA 4FTOA 4GG5A 5GZ8A 3I6UA 1ZOGA 3E64A 2JIIA 3C4ZA 5K4JA 2CLQA 2WTVA 3S95A 1LEZA 3FMKA 3SV0A 3JY0A 1OVEA 4JG8A 3ZC5A 4P5ZA 4XNEA 1FMKA 3OWJA 4FKGA 5HBEA 4LV8A 1OECA 4AF3A 3R01A 4EOLA 3RCJA 4USEA 4MK0A 4WKQA 3TZ7A 2YCQA 3HZTA 3F5PA 4J8NA 3RWQA 4D1ZA 2CMWA 2QODA 3GXLA 4O22A 2W1HA 5LMKC 4GFMA 3ZFXA 4F6WA 4WO5A 5J9YA 3F61A 1JQHA 3IW6A 4LRJA 3WZDA 1U59A 2QOBA 2EXEA 1OL5A 5KZIA 3DBQA 3ZBXA 4D1SA 1J1BA 4XBRA 3LFDA 3CCNA 5M55A 2VTRA 1Q8WA 3QRUA 1UWJA 2UW6A 4FZFB 4A06A 4HYHA 1DM2A 4BRXA 4RVLA 5J5TA 3H0ZA 3CP9A 3OTVA 4K9YA 1ST4A 4CZTA 2GTMA 2P2HA 2JITA 5CI6A 4U44A 5E7RA 4AOTA 4D1XA 4BKYA 2GS6A 3R71A 4F7SA 5JK3A 2JLDA 2DS1A 2ZM1A 3OUKA 4PPAA 3KF4A 2XJ1A 2VZ6A 3GQLA 3NYVA 4NKAA 2P0CA 3NS9A 4PDPA 4W8EA 5HOAA 3FJQE 2OW3A 4EC8A 3LFNA 3UQCA 2B9JA 3LQ5A 3QTQA 1OKWA 4BYJA 1J3HA 3PXKA 4FL1A 4EWHA 4FSMA 3QALE 4X2JA 4XYFA 4MQ1A 4LI5A 4G3FA 2WTIA 4M67A 1OM1A 5EM6A 3W0NA 3PA3A 2R3IA 5A14A 5K5XA 2PZRA 3R7VA 4DTKA 2DUVA 4ZTRA 3B8RA 3C4XA 4EC9A 5HQ0A 3O8UA 3Q2JA 1WVXA 3QRTA 4R3PA 4YZCA 5CNOA 3F7WA 4RSSA 1IAHA 3S2PA 5D9HA 2C5XA 3P5JC 5E8SA 4WNMA 3ZFYA 2CHLA 5F9EA 4FKQA 1CMKE 3HECA 4FT9A 1ZRZA 4AZVA 4E5AX 3ORTA 3W2QA 5HE1A 5IQIA 4L53A 4FZDB 4O0VA 1G5SA 4ANLA 4WUNA 5A46A 2WU6A 5IQDA 3ALOA 4WUAA 3KC3A 2J51A 2UW0A 1YOLA 3H9FA 2B9IA 2Y6MA 3IDPA 3TYKA 1H1RA 2OICA 4FT5A 4EOQA 5KUPA 4K11A 3EQRA 2BIYA 1CKJA 3PIYA 4V05A 3R8MA 3R8ZA 4UMPA 5KKRC 3P9JA 4W4XA 2OH0E 4O0UA 1Q62A 1PJKA 3CJGA 4BDHA 5CEKA 1AGWA 3EL8A 5AP2A 3HAMA 4V0GB 2W1DA 4B6LA 4LDTA 4YZ9A 5LCJA 1WFCA 1UVRA 1R3CA 2QQ7A 4X3FA 5AV4A 1BLXA 2R7IA 4RZWA 4X3FB 1W82A 4YC8A 4F6UA 3UC4A 3UTOA 2X2MA 3IW8A 4GFOA 4YU2A 1FMOE 1H01A 2WTKB 3MVMA 4F1TA 2BMCA 1Q8TA 3HDMA 5IF1A 5IA1A 4DTAA 4EK5A 3VW6A 4XG6A 3OP5A 3HGKA 4JI9A 3PJ8A 3UDTA 3F69A 3L9MA 5IA2A 4LM5A 3MFRA 1LEWA 5J87A 3TNHA 2V0DA 4NIFA 2I40A 3ML1A 3BHTA 5LVOA 4HZSA 3IW7A 1W83A 1Z57A 4ANBA 2C6MA 2J0KA 3VS1A 4W4YA 1WBTA 3UJGA 3U9CA 4A9YA 3AMBA 3JVSA 3T9IA 3UZPA 2VTLA 2QG7A 3ZBFA 4CTBA 1KV2A 5CU2A 2VWXA 4M68A 5GJFA 1KE9A 3UIBA 4O7TA 5CZIA 2CNQA 2UZDA 2VO7A 1IASA 3U4UA 3VS4A 4AA4A 1B38A 5TO8A 3PFYA 3V8WA 3TM0A 5BVWA 5HNIX 3R7UA 2UZUE 4FTJA 4O2PA 5IQAA 4EK3A 1QL6A 1I44A 4BCPA 2ITWA 4DLJA 3OXIA 4DINA 3F3TA 4CD0A 5B2LA 1IR3A 2B0QA 4O4DA 4QMZA 4FT7A 4E6DA 3SHEA 4YURA 1JSTA 4DFYA 2C0TA 2WEIA 4I3ZA 3DKGA 3E63A 3QUDA 4IACA 3V01A 3TKHA 3V5JA 5HTBA 2REIA 4YLJA 3WI6A 4O7ZA 3CKWA 4HVGA 5CEIA 3WF8A 3DT1A 3MY0A 5HVYA 5L8KA 5BYLA 4AZFA 3W0OA 4RLKA 2BKKA 4GJ2A 4QO9A 4HGSA 4N70A 4ACDA 3NCGA 3ELJA 3BYSA 2YAAA 5LMKA 5KNJA 4X7QA 3ZDIA 1JKSA 1FVTA 3FV8A 3BLHA 5F1ZA 3WE8A 2F7XE 3DU8A 2UZVA 2OJJA 2W1FA 3MI9A 1ZYCA 2W96B 5JT2A 1DS5A 2CJMA 4UWBA 4F9BA 4YSJA 3GCPA 1Q8UA 1F3MC 5E9EA 2X7FA 2XCHA 3PVGA 4JR3A 4M69A 3FI8A 4IHPA 4E4NA 4M69B 5CS6A 3VS7A 5J8IA 5DYJA 3C4CA 1BL7A 5DEWA 5HO6A 2CDZA 3PXRA 5IDNA 5IUGA 4W4WA 2ZJWA 4IZAA 3EQDA 2OXDA 2ZAZA 3CTHA 5J1WA 2W1IA 1WBNA 2VAGA 5M44A 5ETFA 2BRBA 3QYWA 4QMUA 3NEWA 2KULA 5BV3A 1PW2A 1WCCA 1MRUA 2UZWE 3OCSA 4FSQA 2FYSA 3O7LD 4HNFA 4TPTA 4UYNA 5KBQA 2QOFA 4I6LA 3GI3A 3ZO4A 4DBXA 2R3FA 1GIIA 3R00A 4RGJA 4MD8E 2R3LA 4E7WA 1UA2A 3RHKA 4YTCA 4IADA 3TI1A 1OMWA 4YHFA 1W98A 3V04A 2XRUA 3UDZA 2W5HA 1SNUA 3EFLA 4HGEA 2GNIA 4W9WA 4X6RA 2YA9A 2PVJA 4GU9A 4EI4A 2WOUA 3POZA 2ERZE 2UW4A 2ACXA 1H26A 4XG4A 5EHLA 3NFFB 4ZAUA 2HY0A 5HG5A 3F7ZA 2X8IA 3IW4A 3JVRA 1R0PA 4GT3A 4AW0A 3COKA 2JC6A 4JDHA 3ZLWA 4YGAA 5HIEA 3VJNA 2FSLX 2HZ0A 3KVWA 1W8CA 2LGCA 3QAME 4R78A 3EQFA 5DFPA 5CTPA 1BI7A 2UW7A 2YM8A 3PY1A 5CT0A 3AG9A 4DEGA 4ZJIA 5IISA 2JDSA 4U81A 3S00A 3N4VA 3MH2A 4I0RA 4I94A 2H96A 3PRFA 3OT8A 3QTUA 4IC8A 3LJ0A 5EDPA 5L2QA 3DJ7A 3UO6A 1PRYA 4O86A 4BCIA 4ZS4A 2GHMA 4ZSAA 1S9IA 3LW0A 4BCHA 4FG7A 4UBAA 3QLFA 3KU2A 5EI2A 3TKUA 4R77A 5KKRB 5AP1A 3PPKA 5DH3A 5CXHA 5B2MA 4AW2A 3QWKA 2F4JA 2OBJA 3NW5A 4EZ7A 3QKLA 4YZDA 3RZBA 4CKRA 1OIUA 1XBCA 3AC1A 1WVYA 2ZV8A 3K3JA 2IEWA 3AGLA 3LOKA 4FV4A 4IJ9A 3MYGA 4BYIA 2O64A 4E26A 4RQKA 5CXZA 5CSPA 3D7ZA 5C8MA 5HESA 3I7CA 4U3ZA 3CQWA 4U43A 4FUXA 5LOHA 3TNWA 5BUEA 4BWKA 2QLQA 5AA8A 4KNBA 3NAXA 1OIQA 2IW9A 3VS5A 2JDRA 2UZTA 3FPMA 3TZ9A 4DHIB 2RFSA 3QD4A 2ONLC 4IIRA 3GEQA 5G1XA 1FGKA 1OITA 5IUIA 5IMEA 3ALNA 3E8EA 1OI9A 1B6CB 1J1CA 3MB7A 3ORNA 1TQIA 2W9ZB 1VYZA 3P23A 3W8LA 2B7AA 3ACKA 5HEZA 4ZJJA 2XRWA 2VX3A 3FMNA 2ZFYA 4TWPA 3FMLA 4ZLZA 4RX5A 2QVSE 2ITYA 4G5JA 4WT6A 2HWOA 5A4LA 4BBMA 5CASA 3ODYX 2ITVA 5AMNA 3ORXA 3TNPC 5AAEA 5HX8A 3AKKA 2X6DA 3BHVA 5M4CA 1G3NA 2G2HA 3R30A 3C0GA 3TIZA 1XH9A 3TDWA 4U45A 4Y95A 3UOHA 2UZOA 3F3UA 2OH4A 3DK6A 2BRMA 3CS9A 1XH5A 3AT4A 4YTHA 1HCLA 2Y7JA 2W1GA 5D7AA 4AU8A 1XH4A 3A8XA 3BE2A 5LMAA 2F2CB 2GFCA 3TUDA 3FLYA 3EHAA 5I9WA 2PUPA 3RPYA 2ERKA 2OZAB 4PMTA 4Z7HA 3VUIA 4C2VA 3IKAA 2Y4IC 4XV2A 4JIKA 4BCKA 2XARA 5AP7A 3LKMA 4TXCA 4LRKA 1DI9A 1O6KA 3KF7A 5ETAA 3T9TA 4G3EA 3BU5A 3ORKA 3H9RA 3ZFMA 2AC5A 3ZEWA 3K5VA 4CLJA 1VYWA 5HO8A 5AUZA 1K9AA 4E5BA 3U6HA 4PL4A 2Y9QA 5BYYA 4FIJA 2BAJA 3F5UA 4PP9A 4EOIA 4IB3A 1XMLA 1QPCA 3QL8A 2FB8A 3PSCA 3PZEA 4OTWA 4QP8A 4V01A 3NLBA 3F66A 4CTCA 1SM2A 4R6VA 4FV7A 4AFEA 4FC0A 5FBOA 3VBQA 5JKGA 4HCUA 1LUFA 2FGIA 3RM6A 2C3JA 3E5AA 4U42A 5AM7A 4ZLYA 3NMUF 1R1WA 4GKHA 2OIDA 5M53A 2GDOA 1KE8A 3MSSA 3FMDA 2VV9A 4F7LA 5BVOA 5CSXA 5KO1A 2R3GA 4QYHA 5BMMA 2QHMA 2UW5A 1XHAA 4O4FA 3JYAA 3HUCA 1PXKA 3IW5A 4D4RA 5JQ5A 4L3PA 3II5A 3TMOA 4S33A 3IK3A 4UB7A 4XLVA 3ERKA 3DXQA 1REJA 3OT3A 3SLSA 4AGUA 3CD8A 4BCFA 2BTRA 4UMUA 4XV1A 3NDMA 5I5ZA 1QCFA 4IANA 3ZYAA 3LE6A 3UOLA 4ZTNA 3D83A 4D4YA 5L6OA 4ZMEA 4RIWA 4RIYA 4APPA 4PDYA 5GZ9A 5I9ZA 1BUHA 4RIWB 3NIZA 4RIYB 3W18A 4ZY5A 4IWQA 2PZIA 1OL7A 4IWOA 4KD1A 4ANMA 3C4EA 4I5PA 4D0XA 2EUFB 2QG5A 4ARKA 2X2LA 4F08A 4I1ZA 4FZ6A 4ALVA 1W7HA 2ZVAA 1CKPA 5IEYA 5AV0A 3GFWA 4J8MA 4CQEA 2XA4A 3JR1A 3NWWA 4E6AA 4LQMA 4JRVA 3A7GA 1Y6AA 4TWNA 5I3OA 2Z60A 3KQ7A 4OTDA 4WD5A 3WF5A 4J97A 3R9RA 1XH7A 3R1SA 3LCTA 4J53A 1OGUA 4I5MA 2YCRA 4RVKA 2YABA 2C3LA 3KXZA 4FF8A 1AD5A 4MCVA 2WQOA 4EH5A 4QTDA 4FMQA 4CV8A 3EQHA 4UXQA 3VN9A 5EQEA 4DLIA 3D5WA 5KX8A 3OVVA 3PWDA 1OPJA 2RG6A 4FV9A 5AUYA 5T6KA 3QTZA 4C7TA 4PTEA 3R22A 4O6LA 1XR1A 4R3CA 3ZLXA 3E3PA 2XH5A 4TRLA 3BWJA 3PXQA 4M12A 4NM5A 4M97A 3LZBA 1PXMA 4DFUA 4CEGA 3VS3A 2OJGA 5HIBA 3LIJA 1YKRA 2PVYA 4IBMA 1SVHA 2I0YA 2VRXA 3OY1A 3SDJA 2ONLA 3T8OA 3R0TA 3ZM4A 5ANOA 1PXNA 3HRFA 5DOSA 2XP2A 3HRCA 4R5YA 1U5RA 3HMNA 5EHYA 2OFUA 3TT0A 5FGKA 2CGWA 3EQBA 2E9UA 1H08A 3GQIA 3O23A 4Y5QA 3W55A 4C4GA 1KWPA 3C50A 4FEQA 4CFMA 4FIHA 3E8DA 3ZLYA 2IG7A 4JG7A 2O0UA 3LMHA 2ITUA 4XP2A 2VWWA 4ZEGA 5ACKA 4YLKA 4YSMA 3RGFA 3I79A 4D0WA 3L9LA 3WBLA 1FBNA 1BMKA 3PDTA 4XS2A 4L44A 4TZRA 4EOMA 3L8SA 3GCVA 4EKKA 3NRMA 4IAFA 4YR8A 4AXFA 4I41A 3DKCA 4S30A 4XRJA 3FXZA 1MUOA 2ETMA 3ZH8A 1PXJA 5EK7A 4DTBA 3A99A 2UV2A 5L3AA 4MXCA 3R7YA 4AXAA 3AKLA 4FTTA 4YO6A 3QRJA 4DGMA 5FM3A 4KKGA 4GUEA 4XH6A 1Q99A 2EU9A 4RZVA 5HNBA 4O1PA 5CF4A 3MY5A 3QQFA 3FLWA 4JBOA 2R7BA 5FQDC 4D2PA 4EHVA 3I1AA 2Y4IB 3LLAA 4BI0A 4IC7A 2XAOA 3QQKA 4CT2A 2WU7A 4E4LA 4AX8A 4BIEA 3NX8A 4FNWA 1PXOA 4TWOA 3SD0A 3ZOSA 1TQMA 1QMZA 2RFNA 3KMWA 3RK7A 4RMZA 2JBOA 4F63A 3D5XA 3COIA 4GRBA 3HL7A 4PUZA 5KE0A 2W5BA 3CBLA 5T68A 4L7FA 2CKOA 3PYYA 4MNEB 1P2AA 2E9VA 4C8BA 5KBRA 4JBQA 4QDEA 2PMIA 2OSCA 2ZMDA 4BJJA 3P7CA 4NFNA 4H36A 4UMTA 3FUPA 1V0OA 3H10A 5ETIA 3AQVA 3ZZWA 4YO4A 4EORA 4DCAA 2CCHA 3EWHA 3RJCA 2FO0A 3BV2A 3F3WA 4XMOA 3SOCA 2Q0BA 3DFAA 2OFVA 3BQRA 3DTWA 2R3NA 5AR7A 3TNIA 4AQCA 5HO7A 5IU2A 3FLZA 3D5VA 4I93A 3UZTA 2C69A 4LGGA 1W0XC 2PUNA 5H8BA 4NH1A 4N57A 3G6GA 5EG3A 4CFWA 4RWIA 1MQBA 3MW1A 3MVHA 4D4VA 3UVRA 4UY9A 4X3JA 4J71A 4K18A 4RQVA 3B2WA 4PV0A 1H1QA 4F9WA 4HJOA 3A60A 3DPKA 4HCTA 3QD2B 3MTFA 4GU6A 1XH8A 2VX0A 4E4XA 3HX4A 3UP2A 4Y8DA 2RFDA 3FC2A 4EK4A 4IWPA 4YJRA 4QP4A 2R3JA 5F95A 5GHVA 2YDJA 4AT4A 4D2SA 3MFUA 1JSVA 4ANSA 2X0GA 1H1SA 4ALUA 4JLCA 2HZ4A 3KMUA 2YDKA 4ZK5A 3MBLA 3Q4CA 3N4UA 5KHXA 4ZZMA 1NT2A 4XBUA 1SMHA 2PE2A 1JWHA 4QNAA 3FQEA 2PULA 4AUAA 4TYGA 4QPSA 4C38A 4A4XA 4QTCA 3BCEA 4EBVA 3F6XA 4S34A 2G1TA 1PYEA 3H0YA 2ITQA 2WKMA 3S4QA 4N0SA 1V0BA 3BELA 4WRSA 4DBNA 4YJSA 1XBBA 4GYGA 4ZTMA 5CAUA 4R1YA 2V5QA 5JRQA 3NFGB 4M3QA 3Q5ZA 3CXWA 4TL0A 2J7TA 3PJCA 3R28A 3DBCA 3FLSA 3O50A 5A9UA 1NA7A 2NNWB 2J0MB 4N6YA 2C68A 4G3CA 3DLSA 5CX9A 2YCSA 3QF9A 4EH8A 3W2PA 3LFSA 4JRNA 2XNOA 3HKOA 2IZTA 5CAOA 3UDSA 2JEDA 3ZU7A 4PF4A 2Z2WA 3BV3A 2UVYA 3Q2MA 1PF8A 3UIUA 2X1NA 2IWIA 4IAIA 5EKOA 4CMOA 3OWLA 2HENA 4BCOA 4ID7A 3G2FA 4Q5EA 4IB0A 3BQCA 3MFSA 3HV7A 5IDPA 2C5NA 2WIHA 4CFUA 3ZZEA 2X9FA 4I4EA 3TJDA 4RIXB 3O8PA 4FV8A 1EH4A 3OCBA 3OW3A 4BTJA 4BZOA 3AXWA 4DITA 4WHZA 1H24A 1ZYSA 3OROA 2C6KA 2XBAA 5AM6A 3DDQA 5AUUA 4FSTA 4O0YA 2V55A 1RE8A 5HD7A 4CCUA 3TXOA 5AP5A 4FSRA 3ZONA 1GJOA 1IA8A 2EXCX 1CTPE 2QONA 5GJGA 4FKTA 5HVJA 4RG0A 1S9JA 5EFQA 2BFYA 3HUBA 3ZO2A 5DR2A 1NVQA 1Y6BA 3JXWA 4QP1A 4I6HA 5IEVA 4DF3A 4KBKA 5CF5A 5JMSA 3L8XA 5FEDA 4O82A 3LCKA 5CU6A 4XP3A 1H4LA 3Q4TA 4CFXA 2A98A 1A9UA 3P7BA 4FSYA 4HYIA 5CVFA 4BB4A 5ICPA 4CFVA 3IECA 5ITAA 4ZSJA 2WGJA 3COMA 4HZRA 4A9UA 2QD9A 3EIDA 5LCKA 3CC6A 4TY1A 3FY0A 2B4SB 4U80A 3R83A 1ZMVA 2CKEA 5AAFA 3A62A 4AFJA 2O8YA 2X6EA 5LVNA 3NVMB 3HLLA 3O96A 4AN3A 3FQHA 1H1WA 4KSQA 5GNKA 3ZUTA 2XNGA 3QA0A 5M06A 3QHWA 2XIRA 4L01A 1ST0A 5EM8A 4F9AA 4AAYA 4K6ZA 2PUIA 4O7SA 2VTOA 3FHRA 3PJ3A 4JT3A 1URWA 4YNEA 4ZZNA 4DHJA 5GIOE 4C58A 2CGUA 3VUKA 3PLAE 4QP3A 4JBVA 4G3GA 5ANKA 2BZKB 3E8CA 4IAYA 3CPCA 1TFFA 2VUWA 3LHJA 2W0JA 4L3JA 2ZDTA 4FTCA 5HBHA 3QYZA 4CCBA 4MEDA 4XJ0A 2J4ZA 4LG4A 4CVAA 3HV5A 5DT3A 2W5AA 4XUFA 2R0UA 4KRDA 4QTBA 5KMMA 2EXMA 2PVHA 2Q0NA 3FSFA 3PG1A 2GNHA 4JQEA 5AJQA 4DN5A 1TQPA 5JZJA 3I81A 4D2RA 2OXXA 3UNZA 3FZSA 3AMYA 3EFJA 4AW5A 4EOJA 4KS7A 3TKIA 3QTWA 4ZSGA 4BGGA 3QCYA 4GMYA 3VAPA 4DH8A 5DRDA 4LL5A 2X0OA 4ZTHA 1Q8YA 1VJYA 4BDKA 1ZOEA 4IM2A 2BAKA 2P2IA 3DBDA 2BALA 3BBWA 2RIOA 3UZRA 3BYVA 4BI2A 4R8QA 2PSQA 2WO6A 4QP6A 2ESMA 4C59A 3R6XA 4V0GA 1ATPE 2X8DA 1IG1A 4BHNA 4CZYB 1QPEA 2F7EE 2JAMA 4IJPA 4Z9LA 4FKSA 3EH9A 4RX8A 3W2RA 3VULA 4AT3A 4OTGA 3BU6A 4KB8A 3EQPA 2J0JA 3C1XA 3LCDA 3MDYA 3R73A 4RC4A 1SVGA 4FKJA 4GV1A 4WSQA 4QMYA 3HVCA 3Q04A 3C4WA 1YHWA 2BVAA 4PDSA 4TWCA 3NNVA 3VUHA 5BUJA 3Q4UA 5M57A 2C6DA 4H3BA 1XO2B 4G1WA 3OW4A 2Z7SA 2OWBA 4TYEA 2GSFA 5EI8A 4F09A 1IEPA 1TVOA 3FI4A 5M08A 5DE2A 2C4GA 3Q9ZA 2EB2A 3EL7A 3KFAA 2VTHA 4ZOGA 5C03A 2V7OA 4JS8A 4CXAA 2UZEA 5EM5A 3VHEA 2RL5A 4A4LA 1H1PA 5AAGA 2VTTA 3AD4A 3OHTA 2JKOA 3C51A 5AV1A 3BHYA 4DG0E 1OL1A 1W84A 2J9MA 4IVBA 4AS0A 3G9NA 4QYEA 3NGAA 3SA0A 3O17A 2HXLA 3I0QA 3FWQA 4E20A 1OUKA 2GHLA 5IQHA 3QQUA 2X8EA 3GBZA 1J7UA 5EH0A 3PUPA 4GCJA 5EDRA 4FKOA 5CALA 1L8TA 2IPXA 2WMUA 2QU6A 4S31A 4X2KA 3UGCA 1H25A 4MTAA 3R7IA 5HKMA 3DQWA 4I24A 4AA0A 2B1PA 3G33A 1IRKA 3A7JA 3KB7A 4WA9A 3ROYA 4NSTA 4FYNA 4U8ZA 1BYGA 4FR4A 5E8WA 4Z55A 1PYXA 4FNYA 1REKA 2GMXA 4CFFA 4OAUC 4IDVA 4AOJA 1YXVA 3BU3A 4QMMA 3BYUA 4AXDA 2QLUA 3TV6A 1PMEA 3ID6C 2J6MA 2XMYA 4R7BA 2JIVA 5BVKA 4XX9A 4JMQA 3CJFA 2XNBA 4FVQA 2BUJA 4AE9A 5AX9A 3DAEA 3P86A 1F5QA 4L3LA 4FZ7A 3RHXA 5GZAA 3F88A 4O1OA 4XG9A 1Q4LA 3OZ6A 4DEDA 4IAZA 5EYKA 3BX5A 5FTOA 4JNWA 4EQUA 4ACCA 4P7EA 2PE0A 2AUHA 3AMAA 2VWBA 3MJ1A 3DKFA 5JZNA 4D28A 1UKHA 4QQ5A 3UPXA 4L46A 3W10A 4FV6A 4I22A 3NW6A 1E1VA 1W2DA 3QCXA 2BKZA 4IDTA 5AUWA 3M11A 2CGXA 4NW6A 3QX2A 4DHZA 4O0XA 4WIHA 2IVSA 5H2UA 3VWAA 5JFWA 3PY0A 3A61A 4QP2A 4OLIA 3HNGA 4O27B 2PWLA