2G1UA

Crystal structure of a putative transport protein (tm1088a) from thermotoga maritima at 1.50 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
137
structure length
137
Chain Sequence
b'KQKSKYIVIFGCGRLGSLIANLASSSGHSVVVVDKNEYAFHRLNSEFSGFTVVGDAAEFETLKECGMEKADMVFAFTNDDSTNFFISMNARYMFNVENVIARVYDPEKIKIFEENGIKTICPAVLMIEKVKEFIIGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein tm1088a
publication title Crystal structure of (tm1088a) from THERMOTOGA MARITIMA at 1.50 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 49
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2g1uA00
3GN2A 1LSOA 3WDSA 1CQIA 3DBHA 3IC5A 2ZYAA 2Y1FA 3WJAA 3IL2A 3VPHA 4L4XA 3X2FA 3KOUA 2V7PA 2NLOA 3SLKA 1O6ZA 3RSHA 2XXBA 3CSDA 1VM6A 4CR7A 3ZWVA 5JCJD 2HK8A 2NTJA 3OH8A 3JTMA 1KYQA 3KXDA 4QXMA 4DQUA 4EJ0A 3EZLA 3QVOA 1JKJA 1O95A 1UUFA 3IAHA 3I3OA 3H3JA 3GT0A 5ENDA 5C5IA 4YJGA 4D0RA 4BKQA 1ENYA 5JDCA 5JDCC 5I8WA 1LDYA 4EJMA 2JJYA 4E5NA 3V1YA 3BHJA 3RUAA 3ETEA 4NU5A 1Z45A 5JCXA 1N9GA 1XEAA 1V9LA 3V8BA 5JMWA 3OIFA 1M6WA 3CH6A 2UUPA 5JYEA 3H5NA 3PZBA 4LVCA 4TSKA 1SOVA 4N7RA 4EDFA 1Y9AA 5L7YA 3JD2A 1O89A 5IN5A 4BNUA 1AGNA 4BQRA 4J2OA 1P1IA 4GI2A 4Q3EA 1D8AA 2GNAA 5KJEA 4FR5A 5TJHA 1JVBA 3R3JA 4NK4A 2R00A 2VHWA 3GMSA 4YWJA 3QWBA 3B20A 3GFBA 5EINA 2PGLA 9LDBA 5C37A 1XA0A 1TT7A 4E12A 2NVUB 1QYCA 4DL9A 1X0XA 1QMGA 1I2CA 3NDRA 5KJ1A 4M86A 5JDIA 5JDIC 4Q3AA 5A04A 3T4XA 2O3QA 5CEFA 2G17A 4NH4A 1WP4A 3E18A 3PYLA 4WNCA 2WTBA 4RPLA 4F6CA 2OBNA 2VT2A 4PIVA 4IQ8A 1CF2O 3GDFA 3ZH2A 5EPOA 3AJRA 4UVHA 4XYGA 5A9SA 5FI3A 2C54A 1QR6A 4DVJA 3QHAA 4GWKA 1R4MA 1PL6A 1Y81A 1TVEA 2Z95A 3ETDA 5GZ6A 1E7WA 3JQ8B 4Y8VA 1ADFA 1NX6A 4DLAA 1NFFA 1PSDA 1SBYA 3AK4A 1ADGA 4A27A 3DZHA 4ZICA 1OBFO 1GU7A 4EYEA 4Z0HO 4DC0A 1GV0A 1GY8A 2OGUA 4RQUA 1KVTA 3GG2A 3AI2A 3JYLA 4XRRA 5AXAA 1UAYA 3TZHA 4IS2A 1AXEA 1D4FA 1R4NA 4JJFA 3AI3A 4TVBA 2Q2WA 5EL0A 2X9VA 4BNIA 5CEEA 2VUSA 4PZDA 1ZEMA 3NRCA 4FW8A 5JFOA 1LLQA 5U9CA 3D3WA 5TSDA 4J7CA 1MC5A 3GUYA 3WTBA 2B4RO 1B3RA 5DCWA 1U3WA 5HRUA 5FF9A 5JYDA 1OFGA 1LLCA 3H9GA 4OAQA 1ZJYA 3CXRA 3P7MA 2AHRA 3GEDA 4CM8B 3PQDA 4UUMA 4WK6A 4KOAA 2BD0A 4K9DA 4TMFA 4C4OA 4GLOA 2DC1A 1CJCA 2PD3A 3DB2A 4NPCA 2NWQA 1R6DA 5DCUA 1A7AA 4W7HA 2IE0A 4J4HA 4QEDA 3RUDA 1ENOA 1EUDA 1HXHA 1O5IA 1HE4A 3HDHA 4OSPA 3MJVA 3I1JA 1MXHA 3C8MA 3EAGA 1I32A 1IPEA 3AFNA 1ZCJA 5BSGA 2G76A 1YRLA 2WE8A 1YKFA 3WGTA 2YJZA 1HF3A 5GZ1A 2DUUA 4YRBA 1P1KA 3Q11A 3O4RA 3K9QO 4PRKA 1XGKA 3IMFA 1L7EA 3LLSA 1JKFA 4DA9A 5G0TA 4BNMA 5AXDA 1I3KA 4WPGA 1GD1O 1JN0A 3Q2IA 4IJWA 4F6LA 2NVUA 4OJNA 1D1SA 3HHPA 2RCYA 1HYGA 1ZUD1 4KDEA 3GPDG 4D0SA 1T1SA 1QXSA 7ADHA 1C3VA 1XWFA 4JLWA 3ZDFA 3NYWA 5CPFA 4B79A 3KETA 1PS8A 4KWHA 1IB6A 1C0PA 1DRWA 1RYDA 3VH4A 1U4OA 3GHYA 4YT5A 2B0JA 2YFQA 2D5AA 2FP4A 3JQ8A 2JL1A 1T4DA 1UXIA 1GCOA 2BFAA 3DMYA 4RZHA 5IZCA 2GZ2A 5IZCC 1DDOA 4HNHA 1ARZA 2B36A 1YOVB 2G1UA 4YQZA 3ZCXA 4OMUA 4NBUA 3PHGA 1ENZA 3WNVA 1Q0LA 1JWAB 1W6UA 1VE9A 1EE2A 3GGGA 3I9MA 4DQXA 3PLRA 3FPCA 1CIVA 2OBYA 1U2DA 5DF1A 1I2ZA 4IGEA 4URFA 3KSZO 4N18A 4NJOA 3C7DB 3ZHYA 3E82A 4HV4A 3PIDA 5G4KB 5TX7A 4FOSA 3QLJA 2HJRA 2ZATA 2BI8A 3ANLA 4LN1A 1LLUA 4XIJA 4CV3A 2NQ8A 1E3WB 3P19A 4FJ1A 1V0JA 1R16A 1UDBA 4FS3A 3ZNOA 3G79A 4XGIA 4PLFA 1PJLA 2PZJA 1A4UA 4CM8A 3QJ5A 1QYXA 4MJLA 2QQ5A 2VCYA 3ZU5A 3IJPA 2A4KA 5U1PA 3GGOA 1HLDA 4NQZA 3B1JA 1HETA 1PGJA 3KTDA 3AW9A 5COAA 3AOEA 2AE2A 3LZ6A 4NBWA 3FRJA 3R1IA 5I9LA 1NPTO 5G2OA 3OA0A 2LDXA 4PFJA 4FGWA 4F45A 5I7FA 4OOEA 4WLOA 3PFWO 5DBFA 1VKNA 2JAPA 4LRSB 1L1FA 2DFVA 2Q1TA 1ISFA 3GZNB 2SCUA 3L4BA 1T26A 3ZGYA 3L4BC 5IN4A 3JQCA 4NIMA 4XB2A 3FNHA 1PQPA 3OEYA 3RFXA 4BHTA 1BVUA 2NU7A 3RU7A 3RUIA 5I9MA 1F14A 1KVUA 3ENKA 1ZMOA 1I3NA 4R41A 3K96A 1SOWA 2AMFA 4WJZA 3WYBA 3Q1LA 2G0TA 3FR7A 3VPSA 1QLHA 4MVJA 2CF5A 3DC2A 1Q7GA 1UXHA 3PQEA 5A1TA 3OJEA 1H9BA 1C0IA 1KBZA 1X7GA 2ZK7A 2X7HA 1JAXA 4IJUA 4D42A 2O2YA 1U9JA 2CNBA 1PJSA 4UVIA 3U4CA 4B4OA 1SEPA 1Q7BA 3RUEA 3NGXA 1WMAA 3PWKA 4XB1A 1H6BA 1N2SA 3H9QA 3L6EA 3S8MA 3PJFA 3TRIA 4AJ2A 4ALJA 5A4DA 4JNKA 4M49A 3CUKA 5ADHA 1PZGA 2VWPA 2YHIA 3HB4X 4RPGA 1Y8RB 1OC2A 4EEXA 4MOWA 3OJ0A 2BFPA 3UOGA 1YOVA 2V6FA 4NBRA 5JXWA 1YGYA 4U0JA 3C1OA 4UUPA 3QWAA 4BNXA 4CM7A 1DLJA 4TZTA 1F06A 1CDOA 3EVNA 4Y67A 4Y6SA 3PHIA 1YBMA 2IZ0A 3D4OA 4RDHA 5A5FA 4CR6A 2C29D 5KJFA 4E4YA 1N92A 4DWVA 1MFZA 5HBRA 3KM0A 4E2YA 2C2XA 2OZPA 2BHLA 2QIOA 4Z3DA 3VDQA 1R15A 4OYRA 5IXYA 3SJUA 5G4KA 2NQTA 3JD3A 1YL5A 1Q0QA 4OQZA 4PVDA 2I9PA 3OJOA 3H3FA 3DZKA 3WS7A 4K6FA 1CWUA 1HE5A 2X9NA 1V3VA 1VL8A 2Q1SA 4IQGA 2VZ9A 1G0NA 2Y1EA 3PGXA 3ASUA 4GSLA 1IYZA 4BIIA 1IHXA 4BV8A 4A73A 4H15A 2XPCA 1I3MA 1LSSA 1UR5A 4U6QA 3S2GA 1DSSG 3PDUA 4UVEA 4PG8A 5I7VA 1P74A 2GASA 3ENNA 4JBIA 4II3A 3GAFA 1CQJA 4MP8A 3T4EA 3WIEA 3GVIA 3BHMA 3FTNA 4YJHB 4AJHA 3CKYA 6LDHA 3GZNA 1LNQA 3NGLA 1IUKA 1EK5A 2I76A 5AXBA 2Q50A 4E3ZA 4IXWA 3PWZA 2VYNA 2OP1A 3L9XA 4HKTA 1A9YA 4A03A 2D8AA 3EHEA 5JY1A 2DAPA 3DOOA 2O7QA 3AU8A 4LCEA 5KVQA 2PNFA 1DB3A 3F1KA 5AVOA 3HG7A 3OHSX 1PZEA 2P5YA 2YY7A 3MTGA 3BTOA 3D7LA 4BO4A 4KMSA 5DNAA 6ADHA 2ZTUA 3VH3A 1GFSA 1GPJA 3BIOA 2E49A 4HWKA 3TL2A 3OICA 4RQTA 4U7WA 1UJMA 3FNFA 5MGBA 3PJDA 2QRKA 4YDRA 3H7AA 1A71A 3QVSA 3INTA 1Q2XA 2WD7A 1KOLA 4PLWA 1X1EA 4AJNA 4XKJA 3RKUA 1B8UA 1E6EA 1AHHA 2HKIA 1WLYA 1XU9A 5ILGA 4OIMA 4LRTB 5JAMA 1ONOA 4EITA 3A06A 1KVSA 5ITWA 4Z0PA 4D7AA 1T2AA 1Y8RA 2H9IA 4PLZA 3BMCB 2FSSA 4MIYA 1PEDA 4BNNA 3PPIA 2VYVD 5LDGA 3KEQA 3IUPA 4IUYA 4ONEA 3RVDA 1GYPA 3KHUA 2QW8A 3ZNPA 1GL3A 4P8RA 5TGDA 3UXYA 4E31A 3GA0A 5DDIP 4L75A 1OI7A 1DJQA 1U4SA 4BO0A 3AY7A 1KC3A 2PLAA 1ZSNA 2VWGA 1B8PA 4DLBA 4BGEA 1U5CA 2V6MA 4TROA 3JQ7B 1UH5A 3MTJA 1GYQA 1E3LA 4FPXA 1SMKA 1R37A 4E6PA 1DOHA 5A06A 3JSAA 1EVJA 5EESA 1EVZA 4PG5A 3RASA 3EUWA 3EW7A 1O8CA 3JD4A 1DHTA 4L76A 4FB5A 1WMBA 1KEPA 1T2FA 1ML3A 2GGSA 4D3SA 4XIYA 4FJ2A 4Z0TA 3NV9A 4DLLA 3VZRA 4FQ8A 5IDYA 3MOGA 1D7OA 1HL3A 1HTBA 4YRAA 4H16A 1Z6ZA 2HK9A 1KETA 4YEDA 5DN9A 4OL9A 1N5DA 3ZU2A 2HU2A 1H6CA 2HMUA 4KUGA 4YJHA 4JJIA 2Y1GA 3G1UA 4DXHA 4GX2A 1GEEA 4CM9A 3G17A 3AWDA 4DGSA 2DTEA 2Q2QA 3CIFA 4WUVA 5ER9A 3RCBA 5LDHA 5CDTA 3RJ5A 3VPFA 2YV1A 3UFXA 5CHEA 3ONFA 2HUNA 3D1LA 2P4QA 5TQVA 1YB4A 1M66A 3ZWYA 3JV7A 4G65A 4HX5A 3AM3A 3OQBA 4PG7A 5IXSA 3ZW8A 1LDMA 5ENVA 3O03A 3QE3A 4N5MA 3S2EA 1P1HA 1ULUA 1DRUA 4R54A 3GDGA 3WX0A 2PZLA 2B5VA 3IS3A 1DFIA 3P5SA 3F5QA 1LI4A 3ONEA 3RROA 2GN4A 5GMOA 3WQSB 1I24A 1ZJZA 3TDKA 3ZWOA 4E0BA 2ZQZA 3HN2A 1DXYA 5DZSA 2GPTA 3STHA 2VZ0A 5A9TA 3UAGA 1R0LA 2VTDA 4YAGA 5KOIA 3WBFA 1CEQA 3ZU3A 2PTGA 1WZIA 1XQ1A 3DZBA 1WXDA 2HO5A 3CZRA 5LC1A 1DIRA 1PQWA 3GR6A 1K6JA 4AVYA 4CM6A 1EBFA 3GOHA 4ND1A 3WFJA 2Y1CA 3BMCA 4WGGA 3HB5X 1ULSA 4ZQHA 2D0IA 4EZBA 4CMEA 5T5QA 3I83A 2DT5A 3LT4A 3JQGB 4PLVA 2WSBA 5DBIA 4MKXA 2IDZA 4DRYA 1N9GB 4NMHA 3H9EO 1MG0A 4KUHA 3V5NA 4R1UA 4CPDA 5A02A 4PLCA 3ZWMA 4BNVA 2EGHA 5DBGA 5JY6A 3TZQA 3PHJA 2C59A 2Q1WA 5F5LA 5C7OO 4KZPA 4ZU3A 1YE3A 2VYVA 5ICMA 3NTRA 4LISA 5DULA 3NT4A 1D1TA 3T7EA 3OQ1A 3JQ7A 2PKRA 1M2WA 4AFNA 1GDHA 2ZYGA 2PWZA 1T2DA 3ETGA 3DO5A 4ALNA 4J7XA 4N54A 3GRKA 3GFGA 3JYPA 4II2A 4PGFA 2X5JO 1ZK3A 3IKTA 3VOSA 1E1LA 1YB5A 2BFOA 2Q99A 3DWFA 3LK7A 4OQYA 1XSEA 4HP8A 4S1VA 3ZV6A 2Q1UA 2W2LD 1SAYA 2I65A 4LCJA 3FR8A 4RPKA 5ER6A 5ICSA 3L77A 1XU7A 5A9RA 4G81A 3DZIA 2HMWA 2O7SA 2CD9A 1R4MB 1MG5A 3WGGA 1E3IA 4CV1A 2OFPA 1GADO 4XCVA 3RWBA 1I5RA 1GQ2A 3H2ZA 5CDSA 4YAIA 2G82A 2Q4EA 4AJ1A 4KDFA 4BO1A 4BNLA 1T24A 3MJEA 4UVDA 5U4QA 1QYDA 3FN4A 1I3LA 4LSMA 1G1AA 2C2YA 3WQRA 3E5RA 3OMLA 1R4NB 3EC7A 4O5OA 2J3KA 3ROMA 4INAA 1VI2A 2I3AA 1ZXLA 1B14A 2RH8A 3BAZA 4M55A 4NDNE 3W8FA 5C7LO 1C0LA 4IDDA 1MUUA 4XYLA 3IJRA 4Z9XA 5FI5A 1JDJA 4R3WA 4CMGA 3DHEA 3MCVA 3D3WB 2B5WA 2PD4A 1DRVA 1W8DA 1B16A 3L4SO 2RIRA 5B1YA 5IZ4A 2DKNA 3DAGA 3MEQA 5J23A 4J4TA 3I9KA 2ZCVA 4R1NA 3PTZA 3ADOA 1LRKA 4LW8A 1VSUA 2ZTMA 3ZHBA 4CL8A 4BKRA 2D3TA 4NBTA 4L0QA 4U5QA 3GGPA 4CV2A 1SB8A 3I9NA 3JQ9A 3KV3O 1ZO8A 4GKVA 3UKOA 2AA3A 3JQGA 1OZAA 4R69A 1F12A 2UVDA 3G0OA 3A14A 1DJNA 3CEAA 3Q9NA 3FCOA 3OQ6A 1YXMA 2H5LA 2BLLA 1JAYA 5BNTA 3R6DA 4KTTE 5EQDA 5THQA 4IBOA 2PK3A 4KQWA 2VHZA 1VLLA 3DFZA 4HADA 2DUWA 3RKRA 5TIIA 4R9SA 1LRJA 3LQFA 4F3YA 1WVGA 2IZ1A 1DHRA 2HK7A 4CMKA 1O94A 1UXJA 4IM7A 3I52A 2EF1A 3TOXA 4A7PA 2AQIA 1HZJA 4HXYA 3QQPA 3UHAA 5DT9A 4CLEA 5KNLA 3AUTA 2R00C 1ZH8A 4ID9A 3DZJA 1K0UA 4ZA2A 2P9GA 1YL7A 1EVYA 4BB5A 5ILOA 1R66A 4JN6B 4QTZA 4OXKA 3LT2A 4UEOA 2X0RA 2NACA 1LDEA 4JBHA 2GLXA 1ZSYA 1E1NA 2JCVA 2PA3A 1ONPA 4YJDA 2HMSA 4ESOA 4CL3A 1DIBA 4CMJA 2DBRA 3GK3A 3HUDA 2YDYA 1Z75A 1WAMA 4ILKA 4D79A 3KYBA 3W6ZA 1EDOA 4CMAA 1PWZA 4AJJA 3LU1A 1DIHA 2W2LA 4A5OA 4FC6A 4B4UA 1KY5A 4U0KA 3VC7A 4BOYA 1NBOA 4RVDA 3U09A 3ROPA 1EE9A 2GYYA 2NSDA 3RU9A 3K6JA 1YWGO 3UCXA 4LMPA 1RM3A 3VKVA 2HCTA 4XGKA 4OM8A 3FNEA 4WLFA 1E5LA 1IZ9A 2Y1DA 3I23A 2PFGA 3I6IA 2ZQYA 2FHSA 3ZU4A 5FWNA 1BSVA 1LXCA 3ZWWA 5MDHA 1X7HA 3CE6A 3IP1A 1GTMA 1WWKA 3LLVA 4DUPA 3KRTA 4OH1A 2JHGA 1UXGA 2ZKLA 1UP4A 1V8BA 1RPNA 4I9HA 3M2TA 4JQCA 1GUFA 1F8GA 1HYHA 5FFFA 4DIFA 1XELA 4R5MA 4J43A 1NWHA 4B7XA 3R3SA 4BS9A 1EDZA 4ZQGA 1B3BA 1YDEA 1NAIA 1U7TA 5JSFA 2BMAA 1K6XA 4TZKA 1LRLA 2I6TA 4Z6KA 2B4QA 1IHYA 4RF4A 3GNSA 4TRRA 3WGOA 2CDBA 2QZZA 4CUJA 4MO2A 5FEUA 3E6AA 3S2IA 4E21A 2OL4A 3BXXA 1NPYA 3ABIA 3HSKA 5KKCA 4GMGA 4BKPA 1J0XO 3TFOA 4YVFA 4YR9A 4Y6RA 1B8VA 1GAEO 1I8TA 4PLPA 1P9LA 3GVHA 4I5EA 4MVJD 2NNLD 1Y7TA 1Q0HA 1JVSA 2QG4A 2DPGA 2GO1A 1MC4A 2NM0A 4CQMD 5JO0A 3FTPA 3W6UA 1AHIA 1YQDA 3ORFA 3K8ZA 5TLSA 4DMLA 3EZYA 4G5HA 4J16A 2W8ZA 3ROQA 4W9NA 4HBGA 4MINA 1LDBA 5AYVA 5CP8A 5JBIA 4BNKA 4CQMB 4BO6A 3PHLA 1RWBA 4MPDA 3WSWA 3WYCA 3RC1A 4BGVA 1RM4A 4J90A 5TJ9A 2EHDA 4GGPA 4RVUA 3M1AA 5L45A 2O3UA 5CG2A 2GERA 1LJ8A 2GRAA 2DM6A 2XXJA 4JJGA 2GD1O 4WASA 4XQCA 1EFKA 3ZZNA 2IRWA 1Z74A 4ALIA 4GX5A 2YHIB 2PH3A 3A1NA 5EJ2A 1BW9B 1ZW1A 4YBZA 1PQUA 2GUGA 3Q2KA 5TF4A 3DBVO 2FZEA 4ZRNA 2FMUA 1T2EA 4I9UA 4P38A 8ADHA 1H2HA 4E2ZA 4X54A 1D3AA 1GUZA 2JD0A 4XRGA 3K2EA 4B4WA 2BH9A 4J91A 2VRCD 2GZ1A 4P22A 4AJPA 2DVMA 3FNGA 4RVGA 4Q9NA 2D4AA 1X15A 5COQA 5C7IO 3TL3A 1YDWA 2JHFA 4NNJA 4NI5A 4CV0A 5A3JA 1H6DA 5AXCA 3W4JA 1Y1PA 3BMQB 4IZIA 1PGOA 4IDBA 4RF5A 3HN7A 4L74A 2PH5A 1PJ4A 3PI7A 3M6IA 1Z73A 1GV1A 1VSVA 1MP0A 2YW9A 2EXXA 4FFLA 1GR0A 3PFFA 4QFCA 2VNSA 3PJGA 5KIAA 4IDGA 2CVOA 1WNTA 1XCBA 1EK6A 4D45A 5CEJA 3AOEC 3BZUA 1U3TA 5HA5A 2YUTA 3LF1A 3F9IA 3BYZA 3RFTA 4K26A 5CDGA 4YAEA 1HEUA 1RM5A 2VYND 3I9LA 4FOOA 2O3SA 4J1QA 3CINA 3FHLA 2X1HA 2AG8A 1JU9A 2W90A 4AJEA 4MIOA 5I9NA 1Z7EA 5TT0A 1B7GO 1DIAA 1W0CA 1MA0A 2YDXA 1QKIA 4O1MA 2ILTA 3GDOA 2D1YA 2Y66A 4RV9A 4AJIA 4B7CA 5HM8A 3T7CA 5H82A 2JAHA 2EERA 3OEWA 3BA1A 3FWZA 2I66A 3JYNA 4Q3CA 5B4VA 1YB1A 5DP2A 1U7HA 4MP6A 1FXSA 2GN6A 2JCYA 2IEBA 4RCVA 4AJLA 4I1IA 3WLFA 4BGUA 1TB4A 2FR1A 5JC8A 3JQEA 3AUUA 4RVSA 4CQMA 2DBQA 4WLNA 3FSRA 1XHLA 1BTOA 5F1KA 1JKIA 3RC9A 2VUTA 4WEOA 1E7RA 5TC4A 4CM4B 3WGQA 3PHHA 1YO6A 1PL7A 3EYWA 2P68A 2W2KA 2WD7B 3JQFC 3JQFA 2J5QA 4CMIB 1B0AA 4B7UA 5IDQA 2ET6A 5HS4A 4KUEA 1ZSVA 4BO2A 5JE8A 3BTSA 4EW6A 5BR7A 2VN8A 1KY4A 3WWZA 1BW9A 3W8DA 3TJRA 5DCYA 1AUPA 3DMTA 1EEHA 2W98A 2RH4A 3DMTC 4DPMA 3S55A 3VTZA 2X9GA 2Y99A 1TT5B 1H0KA 2NUAA 1K3TA 5EN4A 2JD1A 3U3XA 5L9AA 2HJSA 4BNZA 4LK3A 5JPIA 2QRJA 2ZJ1A 1A9ZA 5A5EA 3KUXA 3F4LA 4ZQFA 4W7IA 2BF7A 1HDCA 2GF2A 1VPDA 3WNQA 1YS4A 3ITDA 3V1TC 3GLQA 1P45A 3RBXA 4IDCA 2A9FA 2AEFA 2DQ4A 4BNGA 4OKNA 2VRCA 3BMQA 2C0CA 1PTJA 4E13A 1M75A 1Y5RA 1LSJA 1OC4A 1UAGA 3OP4A 4W6ZA 4QO8A 3QVTA 3TNLA 1T25A 2I5PO 4Y98A 4GX1A 3HNPA 4AICA 4CM9D 4YAKA 4RF2A 5CDUA 1XQ6A 1BHSA 2PGDA 5L40A 1U2GA 2GDZA 2X5OA 3UN1A 1VL0A 4BVAA 3WSVA 3H65A 2HSDA 3TQHA 3VAZA 2J8ZA 4IZHA 3W4KA 2CZCA 1K89A 4IJVA 3E9NA 4IPTA 1HDZA 3E03A 3NT5A 2A94A 3NTOA 1G0OA 1J49A 1YVEI 3DAFA 3IDSA 2V6GA 3WWYA 1IE3A 1H93A 4IDEA 5JAQA 1FJHA 4XDZA 2CMDA 1MLDA 1X13A 2Y0CA 2UV8A 3JQ6A 1U28A 4XD2A 5EQFA 4B3JA 2ZB7A 4G2NA 4XQ9A 2HRZA 1ID1A 3W1VA 4CM4A 3AM4A 4MP3A 4IS3A 5IDWA 3E5MA 3ZNQA 3MJTA 1DIGA 1PJCA 3E9QA 4CMIA 2BGKA 2DU8A 2EP5A 1JWBB 2WYVA 3MJSA 2CSUA 4E32A 4UEJA 2FPIA 3ZWNA 5KVVA 2EW8A 3GUCA 5H83A 4IDAA 1HWYA 3B70A 2Y1OA 4FN4A 3IQDB 4CM3A 3PEFA 4I8XA 4MVJM 3U4HA 1V35A 2WJPA 1IL0A 3KLPX 4LSWA 5C3MA 1BXKA 3F47A 1UZNA 2EEZA 1TT5A 1PGQA 3OJLA 3U0BA 3AY3A 4PLYA 1KVQA 3OFSA 4OOFA 4KP7A 3U4DA 2DLDA 1OMOA 2C5EA 5L4NA 2X0IA 4I5GA 1CYDA 3GVXA 1V3UA 5CFZA 3ON5A 2V6BA 2VZ8A 3ZI0A 4GQAA 4K6CA 2FPPA 3FBTA 5F21A 5JAZA 1DLIA 3LYLA 4HFRA 2OP0A 3CPSA 1RJWA 4PVCA 4WNIA 2X22A 2OORA 4RPJA 1ONNA 3BHIA 4OKIA 1ZXBA 1HDXA 3I6QA 4J1SA 4QQRA 3KVOA 4YT8A 3GPIA 3ZWCA 3ZHXA 1ISGA 2VOEA 4TQGA 4XR9A 5G0VA 3SVTA 4FGSA 1VKOA 4QECA 1SZJG 5GZ3A 3PP8A 1TEHA 4CM1A 3RI3A 3FI9A 5TRTA 1K6IA 3KB6A 1BMDA 1HSZA 3QVXA 3HDQA 2J5RA 4GL4A 4JX8A 2FR0A 4EBFA 3GQVA 1A4IA 2OOSA 2EKLA 3ZN2A 1C1XB 2GN9A 3H5AA 2IZZA 3PJEA 5COBA 3VZSA 3SXPA 3TWOA 3RFVA 1ZK2A 3WB9A 1SNYA 2OO5A 4ALKA 2BFMA 3V2HA 4E5YA 4WOKA 4YACA 5DOZA 4BMSA 1NM5A 1PU2A 3LVFO 1GQYA 1EZ4A 4M8SA 3U49A 4BGIA 4TRNA 4Z9FA 4IJKA 3UH1A 3PGJA 4F46A 3K5PA 4P4GA 1QV6A 4J6FA 4KTVE 1WW8A 4IIVA 2NU6A 4O63O 5B12A 5G0WA 4DQVA 4EGFA 3LT0A 3SLGA 3IUSA 2XOXA 4FFPA 1TXGA 5B4UA 1QSGA 4I5DA 1U1IA 4CLOB 1KEUA 3RC2A 2HMTA 1DC3A 3BMNB 1DO8A 1VL6A 3NJ4A 4JCOA 3IOYA 4MVJG 4E5MA 2GZ3A 3F3SA 2UAGA 1RM0A 2X23A 3F5SA 1UDAA 3MOIA 4YT4A 2NVBA 1XLTA 2AEJA 3AY6A 3CMMA 3QA9A 2IXBA 4AJOA 1FDWA 4RJTA 3HJAA 1GQQA 4QX6A 4CMEC 3GVCA 3ASVA 4A26A 2PD6A 3PYXA 3I4CA 1UZLA 3NEPX 4YTEA 4E2WA 3WOHA 1SO8A 3CZMA 2JFHA 2RAFA 4U8GA 4M54A 4ITUA 2R2GA 1XR3A 1GEGA 2FN7A 1U3VA 3PXXA 1LLDA 3WTCA 1LC0A 1XG5A 5L53A 1Y9EA 1H2BA 4MKZA 3ZHZA 4K28A 4MVJH 1LQTA 2BGLA 3GRPA 3QWHA 2H63A 3H8VA 1E1KA 4CLDA 2EG9A 2POQX 4EI2A 5L3ZA 4Q3DA 4KWIA 1HDYA 1TA4A 2NTVA 1C14A 2O3JA 3CTMA 4K1LA 4JGBA 2IYPA 5JAIA 1GZ4A 1NPDA 4IXTA 5JMPA 2Y67A 4DMMA 4B8ZA 2IYOA 1PZHA 4BNTA 1IULA 1NHGA 2O23A 4YYZA 1HZZA 1U8XX 3I4FA 1P1JA 1PX0A 4NFSA 4BQPA 1PJ3A 2D5CA 3ZWBA 4BMVA 5F1OA 3RAJA 5ITVA 1AE1A 1NVGA 1C1XA 2Z1NA 3E8XA 4TRJA 1QLJA 4OSOA 4A0SA 3P2OA 1B26A 2J6IA 4BKOA 4BO9A 1A72A 2GSDA 1P1FA 3SC4A 4L8VA 3P2YA 4XA8A 5IDXA 1P31A 3GH3A 3IP3A 4E33A 3ZV4A 2CVQA 4IINA 2UUOA 1SPXA 5T6BA 3A4VA 3JQBA 1ZK0A 3JQBC 4FFRA 4MVJE 1E7MA 4RL6A 3Q3CA 1P44A 3DL2A 2Y05A 2B35A 3HDYA 1ADCA 2P91A 3ADPA 5GY7A 1HRDA 1NFRA 3F6YA 3SBOA 3E1KA 1Z82A 1E5QA 3DHNA 5L7TA 4N5NA 4OO3A 4CLOA 5KKAA 1QYWA 2JFFA 3JQDA 4XQGA 3BMNA 1P0CA 4JP2A 4DBVO 4ZJUA 2Y68A 3VPXA 4BNFA 4GSKA 1EVIA 1M67A 1YJQA 2FZWA 3WMWA 1ZEJA 3L07A 5ES3A 4YT2A 2YV3A 4QO7A 4ZRMA 3I9OA 3JQ9C 2EW2A 2EJVA 3KYCA 1V3TA 2NU9A 2X86A 1VJTA 4JBGA 3O38A 2ZTLA 3QY9A 1YH3A 5L95A 3INRA 1DFHA 5G0UA 4ROSA 1G6KA 3LDHA 4RVFA 5KCZA 3U5TA 2RBEA 3QWIA 3B1KA 3JQAD 1N7GA 5BQFA 3TZCA 3NDJA 3SC6A 5IG2A 2ZB4A 1PJBA 2DBZA 4RVHA 2O3TA 3WYEA 1AN9A 1Y8QA 3KBOA 2VQ3A 3LSYA 3CMCO 5BSEA 3RIHA 3EVTA 4UREA 1NWCA 3DDNA 3JQAB 2ZCUA 4J49A 1M76A 3FD8A 1ZFNA 1ZNQO 1YQXA 1XIVA 2IODA 3QP9A 4PRLA 4A10A 1J6UA 4JROA 2Q4BA 3HWRA 3MZ0A 4GKBA 4OGWA 5L4SA 1H6AA 1KIFA 2C20A 5DOVA 5A03A 4BO3A 3S2FA 1NTOA 4NFYA 3GZ4A 3OM9A 1N7HA 4O6VA 3B6ZA 4GVLA 4HFJA 4RLHA 2DPHA 5AOVA 4L4SA 4QUKA 2B83A 1E77A 4XQEA 4RDIA 3V2GA 1K5HA 2VTEA 5JO9A 4AL4A 4NG5A 3L6OO 1H5QA 1PR3A 3LF2A 4HUJA 1E7YA 1LUAA 4WLVA 4XZ3A 2AG5A 1HDGO 3EGOA 4XYEA 4BMNA 2NTNA 5DP1A 3RBVA 1HE3A 4R9RA 3QIVA 2WYWA 2VT3A 5BT9A 3ZWPA 1P1RA 2DFDA 4D46A 1NP3A 3DBRB 4PCVA 1ORRA 5KWEA 2IXAA 3K30A 4H7PA 5HS6A 4PG6A 3D4PA 3ITKA 3TZKA 5HWSA 4GPD1 1WZEA 4NZ9A 4OXYA 1TLTA 4XEHA 3DONA 1B2LA 2TMDA 5T8KA 5T8KC 4AG3A 3MWDB 3OA2A 2E6UX 1NASA 2QX7A 3NDIA 4IGFA 1NXQA 1I33A 3RC7A 3MJ4A 3VH2A 4NHEA 1BGVA 2HRBA 4DC1A 1E6WA 3I5MA 4MVJP 2HMVA 3DTYA 1IOLA 1N1EA 4UUNA 1ZMTA 4XX0A 2WE7A 4DYDA 3WGIA 1DC6A 1I0ZA 5IF3A 3D0OA 3G3EA 1BRMA 2NADA 2AXQA 2Z1MA 4GMFA 2ZB3A 5L7WA 3QVWA 4LGVA 4DYVA 1VJ1A 2FWMX 1KEWA 3EK2A 4PZEA 1ZZEA 1R0SA 1T4BA 4BO7A 4CUZA 2GN8A 1EQ2A 4DTIA 3DAPA 2CF6A 4UAGA 1TI7A 2CVZA 2YQ4A 5CDYA 3S1LA 3X2EA 1HDRA 1PJQA 3F4BA 4FBGA 1HDOA 3N7UA 2TMGA 4QSMA 3GAZA 3NJ8A 4BL5A 1PGPA 1SB9A 5JCJA 2G5CA 2A92A 1CETA 1FMCA 1Q7CA 4WCFB 4BB6A 3JQAA 2DTXA 3E9MA 1IY8A 2EV9A 3UGKA 3LC7O 4AJ4A 3PRJA 4FD3A 2CUKA 5F3RA 7MDHA 3A9WA 5H81A 4D3FA 1UDCA 5CPBA 1BXGB 3IIEA 3DBLB 3AU9A 3AOGA 4J1TA 4W9NC 1T1RA 1QRRA 3TZ6A 3HDJA 3AFMA 1M6HA 2CDAA 4ND5A 3RUHA 2EWMA 1BDBA 3HE3A 2C7VA 4UEKA 1O9BA 1L7DA 4M87A 1X7DA 3U62A 1SC6A 2VNAA 1I2BA 1E7QA 2BI7A 4RZIA 3RUFA 3H5RA 1PS0A 1GZ3A 3PVZA 1DAPA 2W2KB 4MVJF 4UUOA 1ISIA 1LBEA 2BELA 2Q45A 2UYYA 4NFHA 1KERA 1NQAO 3GNQA 3ZV3A 5JC1A 5T64A 4GWGA 1NQ5A 4M89A 2FRDA 4OHUA 4RGBA 1Q1NA 3ZV5A 1N1GA 1NR7A 4WEQA 1JLLA 2D59A 2R6JA 1NNUA 2WDZA 2YQ5A 3DBRA 2C5AA 4J3FA 3GC6A 1GUYA 1ZBQA 5L51A 3GN1A 1HE2A 1ZK1A 1NHWA 2PKQO 4R01A 1MB4A 3K73O 4DIBA 1EQUA 2VWQA 3QRWA 4CMBA 4S3MA 4CLHA 1Z7BA 2B69A 4R1TA 5T57A 2NU8A 2YV2A 1J5PA 2VOJA 2I99A 1BWSA 3UUWA 4CLRB 3OIDA 1KC1A 3GG9A 5EERA 5I7SA 3L0DA 4M1QA 2BGMA 3ICCA 4WLEA 3SJ7A 2ZIZA 3VVBA 1E92A 3QV1A 1B15A 3C1TA 3PQFA 1QG6A 1HSOA 2O4UX 2P9EA 4IMRA 1LTHR 4YXFA 5K6AA 1GPDG 5K6AC 4EEZA 1NYTA 4RF3A 3Q9UA 2X0JA 2I67A 4RLSA 1ZK4A 4BO8A 2H6EA 1BDMA 1BXZA 1WPQA 4P4LA 3TOZA 4ND4A 3HFGA 4NR0A 4BNJA 1PIWA 3WBBA 2O2SA 4IQ0A 1P0FA 4KQXA 2RHRA 5JS6A 1SEVA 2WEKA 4TKMA 3KYDB 3VZQA 4L73A 3PK0A 1I36A 1X14A 4A2CA 5CAEA 1A5ZA 1FF9A 2B4TO 4ZQBA 3C7AA 3JD1A 1SCUA 2H1SA 4LMRA 3RJ9A 4IY1A 2AEMA 1BVRA 3ONDA 1DC5A 4WCFA 1IPFA 4WE3A 4WCFC 1QORA 2AQ8A 4LVUA 1NFQA 3IKVA 4H3VA 2CY0A 4TVOA 5KVSA 2P5UA 1ZVMA 3WQQA 1GCUA 5BSFA 4I9NA 1YQGA 2Z5LA 1BXGA 1PJTA 1XDWA 1KS9A 4B3IA 2A35A 3DBLA 4FCCA 1LDGA 2ZB8A 1N8KA 1VC2A 3OECA 4RPHA 2E82A 3GF4A 3JYQA 5I8ZA 3DZGA 3GEGA 3INGA 3GVPA 3WFIA 1PR9A 4JXKA 5FYDA 3WG9A 4CQLB 1KVRA 1MX3A 2EGGA 3O8QB 1JA9A 3KO8A 3LT1A 1A27A 2FOIA 1ZIDA 3GY0A 2P9CA 5K9ZA 4EUHA 2DBVO 1E3SA 1JW9B 5JNLA 1K2WA 2AQHA 3A28A 4DPLA 4ZN6A 2J3JA 4WKGA 4N5LA 4RO0A 1T2CA 1W73A 4O59O 2X4GA 2XAAA 4YRDA 4NJMB 3NX4A 4PLHA 4XDYA 4Z3KA 2JD2A 4Z9YA 1A7KA 2WD8A 4R3NA 5T67A 4BNWA 4I5FA 4IDFA 3U9LA 3K31A 1OAAA 2Y0DA 2W4QA 2JFGA 3WMXA 2CDCA 3DEYX 3NTQA 1E7SA 1XKQA 3G1TA 3NUGA 1LX6A 1X1TA 1P3DA 3MJCA 1R12A 1VRWA 3ZWAA 5JLAA 4BO5A 4PLTA 3LC1O 4JP3A 4CLRA 3KEOA 4MIEA 4GH5A 2F1KA 1KEVA 4GVXA 4ZHSA 4E30A 3ANMA 2E4AA 3DOJA 4IIUA 4L4RA 3WGYA 2YZ7A 2PV7A 2FY8A 1VJ0A 1MXFA 4BNYA 5AQ1A 3PWSA 1I01A 1YJ8A 1PWXA 4AJKA 3QWFA 4QFDA 4J1NA 1F0YA 3H9JA 4OXNA 1FK8A 1UP6A 4R16A 4J9UE 4XJSA 4W4TA 3TN7A 4E2XA 5THKA 3RQSA 2IEDA 3VH1A 1QYVA 1RYEA 2YHUA 1QP8A 2DTDA 2P4HX 2E37A 1NAHA 3LC2O 4ND3A 5F5NA 3KYDA 1E3WA 1NVMB 4R5HA 3C24A 3OF2A 2X58A 3COSA 4B8WA 3ZWXA 3ZNNA 4PG4A 3F46A 4GAEA 3FBGA 4C7KA 3PYMA 4P4NA 3KSDO 1PGNA 2WMDA 3HFSA 1P77A 2C07A 1CRWG 2OUIA 4W99A 1ADBA 1HKUA 4YAJA 5F1PA 4J4BA 5G4LA 1DBVO 5L4LA 2WYUA 3KSUA 2AQKA 2PKQP 3FPLA 3H6KA 2GCGA 3EMKA 1LQUA 4Q3BA 4XYBA 2QYSA 4CQLA 3O8QA 3WR5A 1PZFA 4ZVVA 3PLNA 4ALMA 4R68A 4UVGA 2FPGA 1MFPA 2V65A 4UULA 3DOCA 1XYGA 3SX2A 4MDHA 5BNFA 3ROKA 4PN3A 4XWYA 5K0ZA 1PS9A 3VZPA 2I3GA 1P33A 5EMHA 3AUAA 3ZW9A 4CMCA 2WWRA 2VHVA 1E6UA 2X8LA 4EUEA 4NJMA 4FFMA 4BKUA 1UZMA 3TPCA 3L6DA 3TFQA 3UCFA 1I10A 2JCXA 4DPKA 3I9JA 1WDMA 4R1SA 1ENPA 3DR3A 2X5KO 3PZRA 4WECA 5CG1A 1I30A 3DTTA 1GYRA 3ULKA 3WGZA 2J5KA 3W8EA 1ZKMA 1OOEA 2OMEA 4WOJA 1E3JA 3GHHA 3WICA 3OJFA 2O48X 4YJFB 4D44A 2HAEA 3BTVA 2HQ1A 3Q6IA 3DXFA 1AXGA 1V6AA 4FIZA 4YA6A 4C7JA 2AW5A 1YBVA 1YL6A 1FDSA 2NVWA 3AI1A 4PLGA 2C82A 3R0IA 2FR8A 3NKLA 4WCDA 2QHXA 5IAAA 1UP7A 1X0VA 2O4CA 3KZVA 2JKVA 3EDMA 2Q2VA 4J7UA 1NQOA 4FSHA 3VVCA 2P2SA 3UF0A 2VHXA 3D64A 4W82A 1U5AA 1WDKA 2X6TA 4L9RA 1F17A 3JD0A 4JIGA 3GNTA 1EFLA 4J0EA 2EIHA 2X0NA 2YFHA 4XJTA 4Y6PA 1E1MA 3V2UA 2ZJ0A 1CERA 1WDLA 4D3DA 4EUFA 2NV6A 3N58A 1RKXA 4HNGA 5HTOA 3EY4A 4Y9DA 2Y93A 4DBZA 4GLLA 1NQTA 3H2SA 2VUUA 5A05A 1NVTA 1S6YA 1C1DB 4DIOA 3ANNA 2Q3EA 4BV9A 3DHYA 3OIGA 2HLPA 4PZCA 4Q3NA 3O9ZA 4B4VA 1DPGA 3HZZA 3FF4A 2HDHA 4GX0A 5A3VA 3UVEA 3VHRA 2O50A 4J9VA 3KLMX 3WXBA 3K92A 3FWNA 4YPOA 1S7CA 3BMOB 3C85A 2E48A 4BNHA 4ZQEA 2UDPA 1FDUA 2EP7A 1HT0A 2ZTVA 4QT0A 4WLUA 1ISMA 2PZMA 4GGOA 3AUSA 5G0SA 4CJXA 4EJ6A 3NT2A 1NR1A 3OSUA 1EBUA 1E0DA 2C7GA 4CM5A 2YYYA 1BG6A 3V1UA 4CMHA 1LA2A 1FDTA 2BKAA 1FDVA 1MV8A 3DFUA 4CLXA 5B37A 2QZ9A 4ND2A 1ISJA 2CFCA 1DC4A 5TT1A 3GEMA 1LC3A 3TF5A 2B37A 5KJCA 3OBBA 3KYCB 2O3RA 2Y0EA 3DBHB 3RD5A 3D5TA 4YQYA 4BUCA 2VRBA 5EIOA 1PL8A 1Y6JA 3Q0EA 1PJ2A 2PR2A 1LU9A 3F1LA 1EUZA 2VWHA 2F00A 3QW2A 5IJZA 3D3EA 3H9UA 3B1FA 3GMDA 4HY3A 4JK3A 3D5QA 1UXKA 2J3HA 2FSVA 3D4NA 2OHXA 4J0FA 4CR8A 3L9WA 1DEHA 3VKUA 2QYTA 9LDTA 4MVJI 2Q49A 1Y8QB 5KTKA 3WGHA 2EKPA 3WLEA 1R0KA 4YB8A 4YJGB 3JYOA 4ALLA 1C0KA 1H9AA 5IFLA 4TWRA 4Q39A 5KVCA 4YJFA 2WM3A 3E48A 1E3EA 2BRUA 2PZKA 4FC7A 5KJ6A 1O0SA 1GZ6A 3NAQA 3WJ7A 3M1LA 2VHYA 4D43A 3MWEB 1EUCA 1YONA 1U8FO 1H94A 1MGOA 3C1AA 4MKRA 3HADA 1HYEA 3OETA 1JTVA 2EKQA 3DZFA 1DAOA 1Y5MA 4TRMA 4GBJA 3TSCA 1EMDA 1HLPA 3K2BA 2GR9A 2LDBA 4NBVA 2XF8A 3H4VA 3WIDA 5BSHA 4E5PA 3SEFA 1QV7A 5TS3A 4RORA 4J2HA 1LSUA 3UICA 2QRLA 3RUCA 5I7EA 4YCAA 4XGNA 3VDRA 2ZYDA 3ST7A 1U3UA 3AM5A 4B3HA 1ISHA 1C1DA 4FDAA 4ZGWA 3QSGA 4HFMA 3PDJA 1LEHA 2PY6A 2RHCA 2PGJA 1W4ZA 3C7CB 4CUKA 1JQBA 2D2IA 4NU6A 4XYMA 5A9SB 4DREA 5TNXA 3U4IA 4I08A 2OXIA 3JCZA 4U6SA 3PIIA 5JW6A 3VTFA 3BMOA 3BTUA 3N74A 5LCXA 4ZD6A 4E5KA 3DQPA 4R4JA 4HFNA 2AE1A 1YBAA 3ICPA 3W4IA 2J3IA 8LDHA 4FFOA 2Q46A 4CODB 5B4TA 4IMPA 3RBZA 1IZ0A 3O26A 3G49A 4NK5A 4TKLA 4FJ0A 1F8FA 3UW3A 4FFNA 1DFGA 2EJWA 3VPGA 4D41A 4O0LA 4XR4A 3HQ4O 1J4AA 1LDNA 4R51A 5BNIA 3C3XA 3UCEA 3M2PA
chains in the Genus database with same CATH superfamily
2WM8A 1LSOA 3GN2A 4UD6A 1UT5A 2B61A 2ZYAA 4ZOBA 4UCFA 3EZXA 5EIBC 3DWGA 3WADA 2XNSA 3FWHA 3V8VA 1IVNA 3CSDA 3V9PA 5AW2A 1UMCB 4CR7A 4M1WA 2QRMA 2HK8A 1QIMA 1RQ7A 4R05A 4X24A 2C8LA 4PICA 2GEJA 1KSGA 2QBYA 3IQEA 3JTMA 3R41A 3KXDA 5J40A 2CE2X 2WFZA 3ADKA 1TRKA 4H0FA 2OUKA 3QVOA 2YNMC 4DEYA 3G7UA 1NG1A 5ENDA 2NUTA 1EH5A 4JBNA 4X6LA 3IHLA 4O2AF 5FPHA 4BKQA 5JDCC 4C6RA 3FCSB 2PUCA 1OBVA 4LJ7A 2HA3A 1G7SA 4E5NA 3OQMA 3V1YA 4H7IA 3GLHE 5JZ9A 5ESDA 2Q6OA 1F3LA 1EFPB 1X1SA 1H2XA 1RXUA 1Z45A 3EF3A 1TMGE 3FPFA 5JCXA 4OYLA 5EJ7A 5FUWA 1TJ4A 2UUPA 3PZBA 1T9HA 3NBXX 2ATIA 2F48A 3SE7A 3I58A 1P17A 2XMRA 3TSYA 3U3RA 1Y9AA 2NXCA 3ZVLA 2PWAA 2P30A 5CTJA 4QHTA 5E2AA 2KMLA 1MAVA 4GEGA 3GGDA 1BH2A 3BXGA 2IYNA 1DCFA 5K4HA 2AMVA 2JLUA 1RYYA 3FA2A 3A25A 1GR1A 1KMIY 3KTAB 4GM1A 1KI3A 9LDBA 1XA0A 3SYTA 2CV1A 1TT7A 2XMQA 1OH5A 1QQAA 1X94A 1GXSB 1WCYA 2JI7A 1QYCA 4DADA 1X0XA 3QELB 1JHRA 4M86A 3LGAA 3PKIA 5JDIC 3GRFA 4Q3AA 5A04A 5FH9A 2IZ7A 4Q4AA 4Q3LA 4OBBA 1CVIA 4A5SA 7REQA 1N77A 5F9FA 4RPIA 3V7FA 1CS4C 2I29A 1WSAA 3BJIC 2WTBA 3E18A 2YCBA 3B1WA 3PYLA 1HQCA 4I14A 4KNVA 2MMGA 2OBNA 1Q0PA 3QPVA 1DTWB 1TGVA 3RSCA 3URKA 4C14A 4FMDF 3ISTA 5EPOA 5C4IA 3D3KA 4HUQB 3KSRA 4AUEA 5CIQA 1YZHA 1NIPA 4GWKA 3PNKA 1SIWA 2I2WA 4AKEA 2ZUDA 4CDMA 4M9CA 1XQ9A 3NBMA 3IPRA 4AROA 1NX6A 1SBYA 3AK4A 1ADGA 2PSDA 2PRJA 3JVEA 2C2MA 2GBGA 1OBFO 3IE2A 3HJHA 3MMXA 3QPWA 4LDPA 2GPYA 4LYYA 5EE3A 4EYEA 1GV0A 1GY8A 4TVSA 4IRXA 5ALXA 3RYHB 1XMXA 1A0OA 5EYPA 3GG2A 3JYLA 4XRRA 3P9NA 1UAYA 4D92A 1D4FA 1R4NA 4JJFA 4NP6A 4BBJA 1E1QA 1QO0D 1RPTA 2OY0A 1USUA 4BV3A 2GK3A 1V9SA 4C87A 2PS0A 2OGTA 4YJ3A 2X9VA 1K5DA 3KKOA 5CEEA 5JSQA 3AEXA 5KNCA 1ZEMA 3NRCA 4FW8A 1NNEA 3E9EA 4JAVC 1PR5A 1Z6PA 3D3WA 4FUTA 2P79A 4J7CA 1YBHA 1MC5A 1N2CA 2B4RO 1YRAA 1VP3A 1XZIA 3OQPA 1PKEA 4TMKA 3LTNC 2Q0XA 3G5MA 5HRUA 2IXGA 3WI7A 1DBQA 2Z3WA 1EFUA 1OFGA 4OAQA 4UAUA 4BY9E 3QXJA 4FOTA 2WK1A 3F71A 1AQUA 1YJXA 3BJRA 3GT3A 4ZT3A 4UUMA 3M6AA 2XVAA 3DE0X 3NYQA 4KOAA 1SUSA 1UEJA 2C84A 4N6NA 1GIAA 4U7HA 3C3WA 5SYMA 3S28A 4YDQA 2DC1A 2PD3A 1KEEA 1UK6A 1GOTA 3IVAA 3V6MA 4AUKA 1T0BA 3OZUA 2WWHA 3THWB 1NP6A 1PT9A 4CQNA 5HJ5A 1ENOA 4ENSA 1W46A 2RGRA 1TF2A 3D31A 1VIMA 2GYUA 2QTVA 1XCMA 3E9CA 5A7GA 3W5JA 4BTVA 2IHYA 3QW4B 5HOQA 4Q1AA 1VBNA 2RHBA 3T5PA 1TMYA 1N5IA 1FYXA 2C2WA 4NC9A 4X92A 4YXWA 1YKFA 4PXAA 3WGTA 1HF3A 2J45A 5GZ1A 2AC4A 2DGDA 1N1DA 1JTEA 1M6NA 1WU7A 2EL9A 3DR5A 2JBHA 5HK8A 4D2IA 3K9QO 5K8TA 2NX2A 4H7EA 4A3SA 1IOVA 1GZ7A 1GITA 2B9VA 3IMFA 4EB0A 3LLSA 1M7HA 2V7VA 4ZCTA 3I9V6 1DUSA 1TYBE 4CIBA 1NRWA 3A2MA 1AK9A 5J59A 1I3KA 4WPGA 1GD1O 4R8MA 1DDIA 2CDRA 1HYGA 1MQAA 5H80A 2QI9F 1T1SA 2VJBA 2EWWA 3ANXA 1C3VA 4JLWA 3VGJA 3NYWA 3D4BA 5LQRA 2XSZD 3R4CA 4PHFA 4LDRA 3LRPA 2GS9A 1D4ZA 1O7JA 1WQ4A 4N0PA 1Z5ZA 2P90A 4RFVA 5G41A 4XWOA 2EZ4A 3F9RA 4IH9A 5FOUA 4KWHA 2TMYA 1UANA 2XKJE 4WFJA 1D0IA 2HA7A 3OJCA 4WRRA 1FRZA 2BFDB 3TR5A 5IVKA 1PWEA 4S1OA 2PNJA 1ZLYA 2DHEA 2YOGA 2ZTSA 1R74A 4YT5A 1Z35A 1A4RA 3A2NA 3LKVA 5AI8A 1KO1A 4ZT2A 3N3AC 3TNJA 3W06A 2XUJA 3UY4A 2D5AA 5ALWA 4FZVA 1DAEA 1QRAA 2WUWE 2VKTA 1Z2PX 3BH7A 2QTAA 4UE2A 4D8XA 4ZCMA 4PC1A 5EJMA 4UAJA 3ZW7A 3KIPA 2Z09A 4RZHA 3O9VA 2GZ2A 3BCHA 3TAHA 2GKOA 3IXMA 4HNHA 5IZCC 4AJOA 1Y7LA 2J07A 1Q92A 3G2NA 4AZ3A 4YQZA 1KK0A 3KSBC 1ESMA 1UT6A 5FCDA 3ZCXA 1DWPA 3OTWA 3TH5A 1OFIA 5LA6B 3TNFA 4ESHA 1C9DB 1EDDA 1GVNB 4MS3B 2OSBA 4EQ6A 3RHTA 1JWAB 2R6R1 1Z5VA 3GGGA 3I9MA 1YNSA 3IUEA 3BD8A 5DBOA 1T36B 1XKLA 3FPCA 4ND8B 5AUOB 2OBYA 1ZONA 5K3BA 1U2DA 5JUWA 2Z2JA 2A5DA 2GCOA 3KSZO 4N18A 5GONA 5E3HA 3KHKA 4CQJA 4GZ6A 4OQXA 5TX7A 4JJZA 2GFIA 3FPJA 4LN1A 2BI8A 3ANLA 4RZQA 4D9JA 5JSKA 4P81A 4Z4CA 2QTCA 1SK9A 1OIVA 4B4OA 4R1MA 2XT9A 4BP3A 4FJ1A 1V0JA 3PT5A 1IM5A 1YCFA 4MI3A 1UDBA 5KYXA 2QNIA 4HMPA 3TOSA 4PLFA 5HZMA 5HJ7A 3OQIA 1QYXA 4MHOA 4ZI3A 2XRFA 1XCLA 3ZU5A 3IJPA 1OLXB 1WD7A 4G23A 4X3CA 1FQJA 3AFOA 1Z5NA 1JIKA 3SD7A 1HLDA 1VHLA 2C99A 1HETA 3OPYB 2LXNA 5EWMA 4FILA 3GLIB 1YA4A 2QN7A 4NBWA 1KHTA 5I9LA 1QJ4A 4KXVA 4UBNA 4KFSA 4LUCA 4AY5A 4JYZA 2ZP1A 1FFXB 2GPJA 1CQJB 2XOKA 2C04A 1WHTA 2FZ5A 3L41A 5I7FA 4OOEA 4WLOA 3SHTA 3GCXA 1VKNA 3FPEA 1NSYA 4LRSB 3T61A 5KUTA 1IJEA 2DFVA 3ENWA 3GZNB 2JGJA 1T26A 3L4BA 3L84A 4OF4A 5IN4A 1JXQA 2ODTX 3JQCA 4NONA 3AB7A 3FHOA 3OEYA 1A8SA 2A5FA 2NU7A 2GWHA 4G0WA 1VP9A 1GZ5A 5I9MA 5ENZA 4DMUB 3ENKA 1ZMOA 2XZDA 3EFHA 3UATA 4F4JA 3C3KA 4R41A 1SOWA 3L0SA 1A98A 1E2QA 4WJZA 3Q1LA 2IS4A 1JHUA 3G0CA 3VPSA 4MVJA 3OLXA 2VH5R 3UAYA 3FVQA 1H9BA 2HLDD 4RY0A 2WAMA 2W2PA 2JIRA 2X7HA 4O1HA 1JAXA 4JD5A 4D42A 4TLLB 1MORA 1U9JA 2IW1A 1TYZA 1E6MA 3IX7A 3U4CA 1LCIA 2IC5A 5IKXA 2XIJA 5DM70 3OHMA 2B1QA 4MMXB 3JWHA 2WU8A 4F1JA 1RAEA 2C7OA 1CF4A 1N2SA 1NNLA 4HYQA 2GJ9A 3L6EA 5EG5A 2VTBA 2BE9A 2PU5A 4AJ2A 3TRIA 5CT6A 1G6HA 5HRCA 3VU0A 3D8BA 5FUQA 2VPIA 1XZKA 1PZGA 4BVKA 2YHIA 3PEWA 4RPGA 2ZR7A 4QLBA 2ZTHA 1OC2A 4MW6A 4EEXA 3AF4A 1N32B 2IV2X 1PFVA 1YC2A 4QEKA 1YOVA 3T1TA 3N2KB 5JXWA 4CL2A 2GEBA 2C4VA 1MV5A 4UUPA 2GD0A 1DLJA 3FWKA 5ALZA 5F3DA 1YVUA 3WP0A 1CDOA 4C20A 4CM7A 5K05A 4Y6SA 3PHIA 1L5VA 4BKMA 5FWXA 2ZUEA 1R9JA 3TMKA 2IH2A 2O8FA 1E9BA 3SEAA 4TL6A 2C29D 1ECPA 3DEHA 1N92A 2V59A 4E4YA 4MUYA 4EYQA 1MR3F 3TPZA 5ADVA 4HGZA 4KXNA 4ATNA 5K99A 2P67A 1POXA 3QKRA 2OZPA 2ISCA 2I6QA 2CD7A 4OYRA 5IWCA 1MJ5A 1Q0QA 2WUEA 2I9PA 3AXTA 3OJOA 4ZFNA 1U2ZA 3OZTA 4FMCB 1GGNA 3CH7A 3HV0A 1HE5A 5ETJA 3RH0A 3ZCSA 4EF4A 1T3HA 1V3VA 2IZ5A 2KLHA 2X9NA 5JSZB 1YRBA 1XVIA 3UAOA 4ME6A 4F97A 1E1CA 4ZYLA 3AERB 4J0QA 3E5NA 5BQ5A 4MV1A 1QQBA 2WWXA 2QDKA 4PC7A 4CFYA 3ASUA 3H8SA 4BIIA 1IHXA 2FPKA 4TV9A 1GTZA 1B73A 2CWWA 2QMHA 3DEZA 1HL7A 3CIOA 4MKFA 2XPCA 4C0HA 1DAGA 1UR5A 4AMYA 5BPFA 1U0EA 3RVBA 3AF6A 3UT5B 5JJCA 1Z4KA 3NFYA 3ENNA 4FCVA 1XRJA 4DEVA 5AM3A 3AL0C 1VL1A 3NTVA 3GAFA 1EKXA 3B13B 3FTNA 3WHPA 5CB8A 5C8ZA 2JI9A 1QTQA 1V5EA 4V3BA 4XCXA 2AFIB 2QTBA 2VAVA 3BEDA 3Q88A 3HB7A 3RAPR 6LDHA 3LO5A 3NGLA 1AK1A 1IUKA 1TZBA 3BWXA 1N2IA 3HH8A 2P3QA 5AXBA 1VA4A 4E3ZA 4BX9A 3C5CA 3D6UA 2AOUB 4DLXA 3D54D 3UFXB 4DRXA 2L2QA 5KTNA 1OFHA 3L9XA 1J07A 3RVMA 3GH1A 4HKTA 4I3HA 4MQ6A 2NO1A 4WY2A 2TMKA 4A03A 3LHSA 1G2OA 1UMBB 3P0JA 1RPAA 4MICA 4LCEA 1DEAA 2B21A 3GQBA 1N7JA 3HKCB 4RC9A 2P5YA 2YY7A 1KYYA 3BTOA 4BO4A 4MWBA 4AN1A 4Q7QA 5DNAA 4G26A 1O4WA 1W5BA 3N8NA 1GPJA 2BEUB 3MGBA 3OICA 1GNPA 1WMEA 3FNFA 1KJYA 1ND6A 8ABPA 1VG0B 2CYAA 3PJDA 2FSUA 2AS0A 3KE9A 4OXRA 3SZ3A 1OWPA 2XW6A 4YV0A 1X8LA 1VPVA 2OWEA 7MHTA 5KMGA 1Z2CA 1HT3A 1Q2XA 2WD7A 4YASA 1FVXA 1Z39A 3M5PA 4PLWA 3IUQA 4FT4A 4FZ5A 4YP7A 4ZC1A 1CRLA 3ZE8A 5KTTA 3GJXC 1AHHA 1OZFA 1QANA 1UQUA 2B1JA 3KFVA 3LP8A 4IV0A 4US0R 4AS3A 1TA9A 4QDUA 2C1EA 2VSNA 5JAMA 1ONOA 1IM8A 1IMOA 2C3YA 2GKSA 4HJXA 4DLWA 1EVEA 5LQMA 5ISMA 3KAPA 3ZLJA 1OXXK 3GLFE 2IUTA 1EIZA 1Y8RA 3L01A 3BMCB 1GVHA 4IIXA 4K6MA 3LYUA 3STYA 3V7WA 4RTQA 2IYAA 4Q19A 4MIYA 3CLUD 1PEDA 2C3UA 4RWEA 4BNNA 5AJTA 1U8CB 4MULA 5LDGA 5HIKA 3KEQA 3HGQA 3WHLA 1OX4A 1U63A 3IVRA 3RVDA 2I2CA 1YIDA 3O8NA 3DVSX 4P8RA 1J2JA 3O90A 2IEYA 1WXWA 3GA0A 4E31A 4RCYA 4NAUA 2QUKA 4L75A 1BWRA 1ZZGA 1E3DA 1SQ6A 1U1GA 2ZAOA 2OPBA 2LIPA 1RJ9B 4QVGA 5JEEA 5JQGB 1ZSNA 3ES9A 4HB4A 1O1YA 3VOBA 1DWQA 1DKQA 4LV6A 2YJ4A 3PUIA 4Q7EA 4RXTA 2AZTA 2V6MA 3V4VB 4BGEA 4UNRA 5FX2A 1W1WA 1N6LA 3MTJA 4IL5A 1XKXA 3MMSA 1KSFX 4M22A 4UCXA 1MX5A 1R0WA 1R37A 1SBIA 1DOHA 4ZAYA 5A06A 4D26A 1CBUA 3PUVA 2OA0A 2GN2A 3RASA 5HVNA 2NIPA 2IIQA 4NZZA 2YMMA 1J56A 3FHCB 3BORA 1U5BB 2VSYA 3QH4A 2ZULA 3REQA 4NE7A 3TVDA 1DS6A 1UDXA 3NWJA 2XUZA 4D3SA 2Z6QA 4YGYA 4YR7A 4RTRA 3VUFA 2OZKA 3EWSA 1WCIA 1D7OA 2FUEA 2P0EA 1A7JA 2HHJA 2XYVA 4K88A 2JGDB 4MUFA 4CF5A 1Z6ZA 4H17A 3FGNA 5DHFA 1GWNA 3UB2A 4PONA 1SGWA 3GELA 1FVFA 2HU2A 3PXUA 4YS6A 4IJ5A 1QF9A 2CXNA 2V45A 4KUGA 4YJHA 4W5WA 2QF7A 3GXOA 4M60A 4ZDKA 4JSTA 3ZY6A 3GJ6A 3G17A 1EJ6A 3ZG6A 2AXEA 3QE4A 2DTEA 3U7RA 1A9XA 5IPFA 4YCMA 2Z3ZA 1OAOC 1SXJE 3G8AA 1DTSA 2BIFA 3RJ5A 1W8IA 3ONFA 1NLMA 3D1LA 2F4NA 5TQVA 3SHWA 3VC1A 3FAKA 5DK4A 4AX4A 1PEYA 3NOQA 5F33A 5IXSA 3OQBA 3B82A 4X0EA 1LDMA 1J21A 4IVRA 1VE7A 1DRUA 4LJ9A 1JE1A 3GDGA 2PZLA 1NMZA 4IXMA 5GWXA 3IS3A 2QLLA 2G9VA 3DW3X 3P5SA 5LNK1 1LI4A 1PAUA 2ODNA 3ONEA 4H60A 1P39A 4K9OA 2FTKE 3H8WA 4G5YA 4CHTA 4DIUA 2HT1A 2ZQZA 1V7PC 3HUEA 1QGUB 1LY1A 1S8OA 3N75A 1CUSA 3G5TA 3HN2A 4QT4A 1DXYA 1OAKA 2XLCA 1OU0A 1TCUA 4QVIA 5H8WA 2BHNA 1XF9A 3I64A 3EJWA 3UAGA 3NUQA 3NHJA 1F6BA 2P9QA 3B2NA 5KOIA 3WBFA 2C3OA 2PTGA 2C97A 4XOIA 2C7QA 1WXDA 2XUQA 2QG9A 1PQWA 3MXTA 4CM6A 2GYVA 2REQA 3CB4A 1EBFA 1TZJA 2XUAA 3GOHA 2Y1CA 5KBYA 4C07A 3V8MA 1B74A 2AI1A 1JEQB 4WGGA 3HB5X 2VPYA 4GKKB 2XTAA 2ZVPX 4EZBA 2JJ2D 5T5QA 3UMYA 2DT5A 4YROA 5EJGA 4FXOA 4HAZA 1VKHA 3BDVA 4G0UA 3L7NA 3A1EA 3BREA 1B6RA 1C7ZA 1GPH1 1P5JA 2CJFA 3DV0A 4KUHA 4CPDA 3OFVA 1T4MA 2EGHA 5JY6A 2WB4A 2J08A 3PHJA 4MS1A 4QUBA 4LYJA 2Q5EA 3CLUC 4M8LA 5CJPA 1Y6RA 5C7OO 1R6VA 3TG2A 1E5XA 1IVYA 2W6NA 2WICA 3A6HA 4NL4H 5M04A 4C5BA 1XJWA 3NALA 5JJ5A 2HJVA 3U16A 3OQ1A 1L8AA 3MINA 4AFNA 1GQSA 1Z2DA 3I73A 3JALA 2VNJA 1CUJA 1WPXA 3R44A 4Q4JB 2ZYGA 3RVRA 1N5OX 3E15A 2G28A 2B1IA 4L3OA 2PWZA 1T2DA 3ETGA 4HDAA 3VU1A 4J7XA 5T7BA 3TQTA 3UANA 2EBUA 3GFGA 1V4BA 5E1BA 4XPIA 3DV2A 3JYPA 3AR8A 2W70A 1MIOB 1JJFA 2X5JO 3ASYA 3MWLA 1FUIA 2BJWA 4GBMA 5K2MA 4B6EA 2WV9A 1TVMA 5HFNA 1YB5A 2BFOA 4RNDB 4IIJF 3LK7A 4MW0A 4OQYA 4N65A 4HP8A 1K08A 1Y63A 4S1VA 2CDNA 2Q1UA 2W2LD 1SAYA 3NC0C 3MTDA 1N2OA 4RPKA 4KIUA 5EXPA 1WPGA 1EM8A 5D85A 4HGNA 1L8QA 4G86A 4G81A 5KYVA 4PPFA 4MYSA 3R24A 4YCLA 2JAOA 1R4MB 2P6NA 5E3IA 4WK2B 3ESBA 4BRUA 2WZBA 4LV5B 4BAUA 1E3IA 4CV1A 3CKKA 1SU8A 3B85A 2FRXA 2H4ZA 4LX8A 5C18A 8MHTA 4RKEA 1UEIA 3HDTA 3OLCX 1E9DA 2QRVB 2P8SA 2QTWB 1DKNA 1S4MA 2Q4EA 4KDFA 4OJQA 5ELXA 121PA 3R3YA 3W8RA 1R5OA 4WOBA 2G07A 4BNLA 2QD2A 2D7DA 1ZOPA 2Z1DA 1P29A 4LSMA 1ECFA 3OMLA 4BP1A 4PAGA 1N5LA 2BMFA 3RF6A 1ZP6A 3W8FA 1VI2A 2I3AA 3BAZA 1B14A 2RH8A 4D4IA 1C0LA 2PX5A 5IK2A 1E2PA 3R6TA 2P2NA 5DSZA 3L0CA 5ARBA 5BSKA 1JDJA 2PSFA 2GK4A 3E7XA 4PQGA 3EE6A 1KJQA 3OTOB 2IPOA 1Q7EA 3I72A 4FHZA 5IZ4A 4JZKA 1L4HA 2ASEA 1VA5A 5FYQA 5FPKA 2Z5FA 3MEQA 2C96A 5BVGA 4TXLA 1UAAA 2EZTA 3SIPA 5FLKA 1I0LA 4O2RA 1GDTA 5LBUA 2ZTMA 5AJZA 5BORA 1C2YA 5AO9A 4NV0A 5ESWA 2ZI4A 2D3TA 4QOEA 2GD2A 4QNNA 1H85A 3GMTA 4G5XA 2LVBA 5CH5A 3U60B 4CV2A 2YC2C 3KV3O 2I6GA 4FDTA 1TEZA 2GWRA 4IAOA 3G0IA 2FPWA 1WKBA 5HFAA 1OZAA 3P0HA 1DIOB 1TOAA 1YR2A 5DTJA 4MV5A 1Y7IA 3G0OA 1PZXA 3A14A 1DJNA 1RRGA 3HXKA 5IJWA 2G40A 3FCOA 2F1IA 2WM9B 3OQ6A 5JS2A 4HN2A 2BLLA 4EJSA 1SXJD 5BYJA 1HRKA 3PDHA 5FPPA 5THQA 5BNTA 3COJA 4IBOA 4LBWA 1MHTA 2P62A 4L07A 2DUWA 1JNXX 2HGZA 1DHRA 1COZA 1GU1A 2ZVJA 2PWBA 1RAHA 1XEWY 1RKUA 1SXJB 1W4RA 2QUHA 3AGQA 3I52A 3CNEA 1NMQA 4MRRA 5DT9A 4CEIB 1Z29A 4XTRA 5CVTA 2R00C 4F0JA 1ZH8A 4HO1X 3DZJA 1K0UA 4LECA 2QT9A 1YL7A 2OWDA 5ILOA 4PO3X 1Z33A 2X7JA 4JN6B 4WBSA 4WNAA 2X0RA 1XWIA 5EKSA 1S0UA 2NACA 1HY3A 3EW9A 4P4SA 2R8BA 4U39A 4AF6A 5EMJA 3KLNA 4I9FA 3TOCA 5KNDD 2J7PA 5DYNA 1E1NA 1OKKA 1K8YB 1VPEA 2CMGA 7AT1A 2GTIA 4XJXA 2HMSA 2VH2A 4CIWA 5BQ3A 5T4EA 1K7YA 3JAKB 4PYQA 1KDYA 2ECFA 2I54A 3E58A 3GGCA 4MW9A 4PTZA 3V8EA 3RTGA 2YDYA 4HDMB 4ILKA 1LPOA 4D79A 2G83A 4MX8A 4AKSA 2PCJA 4QBFA 2R1UA 4AO6A 1NI4B 4ZT4A 3EH1A 2AG1A 1M8GA 1KQOA 5AK0A 2HWWA 2E6KA 3BB3A 2PLFA 1PG5A 1CIPA 3E9YA 4FC6A 4FMDB 2BR3A 3NHFA 1TZCA 1BHQ1 1LJUA 1EE9A 1NW8A 1OI3A 2NN3C 2F9MA 1V8PA 1Z0FA 2NSDA 2E4YA 1YWGO 3M1IA 4B43A 1FSPA 1RE1A 4FQ7A 1SVWA 4IW3B 4LMPA 4HAVA 4D80A 2J9YB 1JXAA 3RNOA 1E58A 4BECA 6ABPA 2HCTA 2WWVD 3ZKWB 2I1LA 4OM8A 1BAPA 1M1YB 2RONA 3TKYA 1SU7A 1MGPA 3I23A 1APBA 5DM2A 3FDJA 4LFAB 3MS7A 5EHGA 4MR9B 3FUXA 4MYRA 1H5NA 3IP5A 2XNDA 1UBLS 4HRVA 3CE6A 3LQKA 1P0IA 1UINA 3C98A 5CFMA 2VCEA 5LYJB 4HAUA 3KBBA 1NBHA 4YLEA 4EYSA 3K0FB 5EJ9A 3H42B 2JA2A 1CQWA 2X2EA 3VR0A 4FNMA 2XTZA 1UXGA 1AD2A 1NQVA 3KQHA 3P52A 3M2TA 4D25A 3BGVA 1HYHA 5BN4B 2O6HA 1QG0A 1MDFA 4NMXB 1XRSB 5K3OA 3INYA 3TQCA 5C1IA 2X0FA 4B7XA 2I7CA 1C2TA 3R3SA 2P2ZA 1NW6A 3WBKA 4BS9A 5JNTA 1F0NA 1U7TA 4I6GA 2O7VA 1MVOA 4GPIB 1JSLA 1DO0A 1MC8A 2AHOA 2QL6A 3VISA 3T38A 3M49A 5KMGB 1T1JA 3IH5A 1NBWB 3W5HA 1CDEA 1Q14A 4JBLA 3QF4A 3EWAA 2VP6A 4M4SA 2HK6A 1TUGA 1JAHA 1E63A 2I2XB 3L1UA 5KKCA 4YP6A 3N8IA 3TLJA 4KQ2A 1OZ0A 4FHFA 3TUZC 1SG6A 4OHKA 4ZCLA 2KSQA 4YR9A 2X4DA 5E7QA 1B8VA 4GDMA 1GAEO 3CBQA 2ES4A 4OU4A 4LYEA 3STUA 1XEXB 3CVUA 4QELA 1MKYA 5E7IA 4WKBA 3UMMA 1G7CA 1E5TA 2EZ9A 4WVFA 1SXJC 3UJDA 3QY0A 4QYSA 5IKEA 2PHZA 1E9FA 2GO1A 3KZCA 1MC4A 1IK4A 2B25A 3UMRA 2NM0A 2I91A 4TMWA 2C2BA 3IE0A 1OH6A 3W77A 3HBFA 5B2ZA 4J16C 3KAKA 4B6QA 1MX9A 5KWVA 3L0IB 3N2EA 4KDCA 3GEHA 1LDBA 2RKBA 3DKIA 3Q6NA 3QFFA 2DOKA 3W2EA 1WPRA 4KMMA 3Q3JB 3QUQA 1NQUA 3WYCA 1DC7A 4ER0A 4D99A 5FBRB 1ND5A 5TJ9A 1NBMD 2CE7A 1SUIA 4C03A 4BPRA 4XEUA 4C4ZA 2GERA 1LJ8A 4DB4A 2GD1O 3YASA 4YP0A 2AJCA 3VSAA 3ZGVA 2WNHA 3I42A 1JDVA 5B1HA 1NU6A 2PH3A 2VDJA 3A1NA 3CZ9A 5EJ2A 1G20A 3E1GA 1ZW1A 3T7RA 3ZJYA 4YBZA 3ELDA 4ZIRA 4MB2A 2BONA 2GUGA 3FTCA 3Q2KA 5TF4A 2ZUVA 3EDCA 4KE6A 1WU8A 4Y2RA 2HY7A 2FMUA 5AKKA 4P38A 2W6CX 4EKDA 1FB5A 1H2HA 2HRCA 2X3FA 3EC2A 2JD0A 3HKEA 4Y2GA 3I6ZA 4RTSA 4L2IB 1E9SA 2R8PA 4BMDA 2HT6A 3R3VA 2QRQA 1S9HA 3KZOA 4YRRA 4E7PA 4B4WA 4EHJA 4BFUA 2BH9A 4CI9A 3DPSA 2BKLA 1HKHA 4NCIA 4D81A 1MPTA 3D2AA 3PCXA 3EPRA 3TR0A 4OQEA 2G5PA 4Q9NA 1UKAA 5ITZA 4M7OA 5COQA 5C7IO 1BJRE 4A0HA 3TL3A 3OZ7A 1C41A 3B9PA 5KSWB 4NI5A 1QYIA 2WVGA 3FOZA 2YZKA 1XQYA 4MRSA 3GFSA 1AGPA 4KIGA 3M6LA 4FHEA 3EVFA 4TKVB 4ZT7A 1Y34E 4UBKA 1GGJA 3PT9A 4OA8A 3ZZ0A 2BMJA 3PYMA 4PX2A 2EW1A 3F96A 1GGHA 3PI7A 3ETLA 1TTHA 4U2EA 1GV1A 1L4FA 4RYLA 1T8PA 3WMEA 4UTPA 3VYSB 1U8AA 3ID6C 4BLPA 4ASUA 5FT9A 3PFFA 5AW7A 4XIIA 1KJWA 4NVRA 1SQFA 4AECA 1Q16A 5AKLA 2CVOA 3D7NA 2PXCA 3QENA 1OXSC 3O4VA 1O57A 4L8FA 1PSWA 1Z4LA 3QFRA 4L4UA 3TBKA 5JCOC 2JAXA 4BVFA 1DTEA 5CDGA 1KFKB 4KSBA 3CLTD 2VYND 1H1LB 3HCPA 1D04A 4FOOA 2O3SA 2W2QA 5DXAA 4P0PB 1RZUA 3M81A 2X1HA 4DV2B 3FUCA 2EU8A 2HQOA 2W90A 1ZH0A 4TT3D 4BLRA 4B81A 1V1RA 3RS7A 5KREA 4ENVA 5I9NA 1OT5A 3G88A 3G9UA 4C5CA 1W0CA 3ZE7A 3QI2A 1QKIA 3EBLA 1S2IA 3GDOA 1SJ9A 3K05A 3QYPA 4RZSA 1YR9A 1YQ9A 4WVLA 3U26A 5HM8A 2V3CC 1NNSA 3UMGA 2HGSA 4KCGA 2Q2NA 1I7LA 3ECCA 1KYVA 3MNFA 2ODWA 5DP2A 1ZXXA 3F6RA 4FB4A 1GQOA 3GFPA 4XIGS 1N6IA 2FFJA 4I1IA 3PSHA 4L8WB 4D6YA 4QYIA 1DKMA 3CFYA 4EQZA 3AUUA 4E5DA 2O8DB 4WBNA 2FPUA 4WN9B 4LNAA 4YI5A 2P1RA 2DBQA 2XODA 1BTOA 4I4LA 3WGLA 1O3YA 3DNMA 3LQ4A 2QI9C 2YWEA 4WEOA 3RC9A 2O2CA 3PG5A 1GFWA 1RRKA 2WQ6A 4HR7A 1QIHA 2OHVA 4RBNA 4AY6A 2JAUA 4IIFA 3TUIC 3UAZA 6GPBA 3UJBA 2P68A 3EN0A 1TZMA 3JQFC 1S96A 1DBIA 3FKJA 5EI5A 4X71A 5LZ4A 4P86A 5IAJA 4QA9A 4ZOQI 3IV7A 4QGHA 2PUBA 2FPIB 3MLBA 1G5HA 2J09A 1VJGA 3KQNA 3UMBA 5BR7A 3HA5A 3EDOA 1DBSA 1BW9A 3RSZA 3RIGA 3SR0A 3TJRA 3D6TB 4HH3C 4QXQA 4MVYA 1AUPA 2H85A 3DMTA 4XVRA 2IUYA 4UXHA 3N0WA 4ENRA 2CGEA 2XNKA 5ELMA 3CZAA 4JCCA 2AI3A 4XXHA 4XIFA 2FDCA 2CLHB 1KAHA 1E4OA 4KN8A 4K6HA 4X6UA 3T4UA 2JD1A 1H4TA 2CJWB 5L9AA 1GGMA 1NVDA 2HJSA 5FNZA 3TECE 3UHJA 2QRJA 2OGSA 1A9ZA 4MPTA 2JW5A 2BF7A 3DP9A 3LWDA 2ZIXB 1KOGA 1QE5A 1XX6A 2RHHA 4MJ7A 4P1ZA 1F38A 4RIFA 4UFOA 3MD9A 3R3ZA 2K2WA 3F6CA 3FCEA 2A9FA 2AEFA 3L3BA 3WKBA 3CWQA 2VRCA 3KKLA 3PNLA 5EP3A 1XI2A 1LSJA 3BSWA 2DFNA 1LI7A 3OP4A 2V4UA 4HL6A 4CVNA 3TB6A 1E2UA 4BQFA 1JILA 5ALRA 4AMBA 2WFLA 2I5PO 3O8DA 2I3BA 2ZRPA 3MAJA 3DTVA 1SUFA 1DCTA 4Y6OA 4CM9D 5CDUA 1BHSA 2PGDA 3DDOA 3IOMA 4RD4A 5L40A 3AR6A 1G2IA 2BM0A 1C7QA 1U2GA 3DL0A 3NONA 4C01A 1JH9A 2W71A 1ZCAA 2GDZA 2BDUA 4LC0A 1TCVA 1NMSA 1VL0A 5ITWA 3OURA 3H65A 4GQIA 3SOPA 2KE5A 2R60A 4KPUA 1VFNA 1H66A 2J8ZA 1V11B 2GTHA 4I1YA 5EKXA 2N3ZA 3GLTA 3WLJA 3OT5A 3KDSE 2IHNA 4LX0A 2FDXA 1K86A 3CLTC 4ETWA 1V4NA 2VJKA 1G0OA 1J49A 1YS2X 1YVEI 5JFTA 3IDSA 2O0MA 3LDFA 5I9TA 3GCWA 4B85A 1IE3A 3JAMA 2OQIA 2Q8QA 3RYFB 4YMUA 1TIKA 1OLUA 4JKYA 3PE3A 4N5HX 4BJ5A 4DCUA 3IRVA 1E5VA 2RH9B 1X13A 3E84A 1Z0SA 4XGQA 5IANA 1R18A 3IUBA 5LU8A 1XPJA 1I7NA 3P9YA 4PZUA 5C8YA 3K1ZA 1U28A 3CISA 3OEHD 4KQGA 2ZB7A 3QF7A 3UA4A 2BUAA 2H59A 1ID1A 3FZQA 2Z9CA 3AM4A 4MP3A 1N8SA 5D6NA 5IDWA 3X3HA 4G07A 1ZINA 3WDLA 4JP5A 1R2QA 3MJTA 3F3MA 4M0LA 3VPDA 1L1EA 1L7OA 2H1CA 1BS9A 1AU9A 1RXYA 3AL3A 1NSTA 4FCWA 4L1KA 4PO1A 2MR5A 3C5EA 3N8DA 3UJHA 4BNDB 4E32A 3IKMB 1K92A 2TSYB 2QSUA 4O0MA 5LQJA 2XA1A 1UFRA 4F86A 3IEPA 4WIAA 4RFLA 4ZDWA 3BXFA 4HCJA 1U9YA 1EGMB 3QMWA 3QX9A 3IQDB 4LJYA 3PEFA 4MVJM 4YPFA 9GPBA 2RGEA 2RK3A 4NMLA 3U7QB 2ZM5A 2V3VA 3KLPX 3F8TA 2XZOA 3ZGZA 1OD6A 3CX4A 3F47A 1UZNA 1QONA 4N7MA 5I4CA 1IM2A 1Y4DE 3U0BA 3ZDBA 3AY3A 4FK8A 3SNKA 1BMTA 3LX8A 3I1FA 4TV8F 4OOFA 3OCXA 4KP7A 2XCTB 2C5EA 3I8OA 3R0JA 3HCFA 4D4HA 1B42A 4ZHQF 1DKPA 5JCZA 1CYDA 5CFZA 3AF2A 2V6BA 3FUUA 3ZI0A 3N2GA 1DCMA 3STTA 1VBMA 3L0PA 4Y2YA 4GS5A 4LGYA 5F21A 1FDOA 1IUNA 2DG2A 1DLIA 1C8KA 2INGX 4MQEB 4HFRA 3SZUA 3CPSA 4A16A 4LBZA 1J22A 3HWSA 1U2PA 2X22A 5K0NA 1QAQA 2NPFA 4QJBA 4RPJA 1ONNA 3NHRA 2QMOA 4OKIA 1Z9BA 2IYEA 5HW0A 2KHZA 4QUGA 2F1HA 4RJLA 3B9BA 4H1TA 1CDDA 1HEYA 4JB3A 1Q7RA 2A9QA 3ZHXA 3ZWCA 5BRJA 2CYBA 2ZT7A 5LXTA 3GFVA 5GIPE 5A4MS 4XR9A 2W48A 5G0VA 3SVTA 4QECA 1VKOA 4OLHA 1EG7A 1UBKS 2HCBA 3CS3A 5TRTA 4I19A 1NYRA 1F2UB 3L93A 3SDBA 1K8ZB 3PBKA 3SF8A 1G5QA 2ZBRA 4ZI5A 3BK1A 2LWIA 4J0CA 1ZNXA 3HDQA 2FR0A 2HA6A 1SKMA 2C00A 5FLYA 4KXUA 1S3FA 3EPKA 3RAEC 2OOSA 2EKLA 3AZPA 3DJYA 2OK7A 1C1XB 3AFHA 1NRXA 1QZXA 3H5AA 4FS8A 4Q18A 5D5PA 1XK6A 2XEDA 4MKGA 4V39A 1JG1A 4W8GA 2SICE 5COBA 4Z9AA 3WB9A 3FTDA 1XRNA 1SNYA 4ZAGA 1XTSA 4PYMA 3OZEA 1X9IA 2ECPA 4AK9A 1PO7A 3HEBA 4IDQA 4E5YA 2Q5QA 5CA1B 1IHUA 2F90A 4H7DA 5DOZA 1NM5A 1RHJA 1OGJA 2FEKA 4MYDA 4ER6A 3NETA 4M8SA 3TCKA 2DWCA 2VYCA 4I7EA 5DN6D 2DR2A 3FNQA 3SJZA 3P45A 3CW8X 1GJRA 3PGJA 2FN4A 2J9ZB 3GP8A 2AR9A 2F3SA 1GA1A 3OI7A 4O4LA 2XCIA 3UUFA 1WOYA 1QV6A 2OYSA 4MAFA 3AKDA 4IIVA 4MYTA 4R8LA 4TSFA 4XFKA 3ZXUB 5G0WA 4DQVA 2FX2A 3OOSA 2ABWA 3R6WA 2QUAA 3LT0A 5JANA 2R6FA 4NDAA 4RZUA 2WDPA 3IUSA 1DOZA 1VHDA 1XK7A 3LBFA 2P4SA 1UFQA 5B4UA 2VDOB 2BYTA 4IX9A 4NOKA 1CEEA 2WJYA 2BL4A 2F4VB 3VTAA 1SC4A 2FOLA 4HLUA 2RGUA 4MB6A 3G9QA 3RC2A 4G1FA 4B83A 2VF4X 1C7EA 1HEIA 5AW5A 4ZTUB 2ZITA 1DO8A 3BGIA 1BOOA 4MVJG 4Q1BA 2IS1A 1RM0A 2YW2A 3IVXA 4CDNA 3CLKA 5G02A 2REBA 1TX4B 4A6EA 3EFOA 3F5SA 3MOIA 4YT4A 4MSUA 1XLTA 2AEJA 3MCWA 2FGJA 2HI0A 3K0CA 3CMMA 4LOIA 4NPAA 2A3NA 2H9YA 4PRYA 4X66B 1CLUA 1GQQA 4CMEC 3ZJ4A 3GVCA 1XZLA 1J33A 1BFKA 5LYJF 3STXA 3EXEA 3PYXA 3I4CA 4YTEA 5E1OA 3UFBA 1ZA2A 5DYGA 4C0SA 1MJNA 4OJKA 1NONA 2QA5A 4YO8A 2EFGA 1F48A 1W88A 3WYDA 1O0CA 4M54A 2PQMA 2R66A 4ARZA 1QTIA 3O8OA 3KOWA 4LOHA 1MD9A 4HS9A 4NOLA 1IQ0A 3FOAA 1U6KA 3FYSA 3B36A 4S24A 3ZPXA 5D1NA 1SKBA 1FQKA 2FN7A 3LG2A 3WTCA 5L3SB 4M98A 4N9QA 5HKKA 4BU0A 5E4JA 5EZQA 1XG5A 4A15A 5U4XA 1HOXA 4EY7A 1Y9EA 2O2JA 4MKZA 4O1IA 5TPWB 3ZHZA 5K4AA 4A2PA 1NRIA 3UTCA 3VYTB 4D8UA 3QWHA 3RS4A 4YUAA 3AIIA 4MA0A 3PXCX 1I7DA 1D03A 4EUNA 4DR3B 5MN6A 4KWIA 4HDRA 3BC1A 4Q48A 1JG6A 1GP2A 2N9UA 2NQ2C 2CLOB 2ZRMA 1JA1A 1CY6A 4IXTA 5JMPA 2Y67A 2ZBEA 2IYOA 1PZHA 2NZXA 3WY9A 1J2UA 4BNTA 1M0WA 2FQQA 2VK1A 4OQNA 4Q7MB 4YBRA 5AVXA 4YYZA 1N34B 2GX6A 1U8XX 2X1MA 3EYAA 2B7CA 4M0CA 3R0VA 1W2HA 1PKXA 4BQPA 2VDKB 3ACDA 5FOXA 4IIJB 5DYTA 5K0GA 4AG5A 1D9ZA 2YWJA 4XOUA 1XD9A 3PITA 1NVGA 3B9RA 4IGAA 4PPYA 1ZQ1A 2IY9A 1RWNA 2GN0A 4A0SA 2NO6A 4GOXA 3T9EA 4CCAA 5ESRA 4MDEA 3I28A 2AUTA 2RHGB 1A72A 2GSDA 3DCJA 3EGIA 4BO9A 3SC4A 4BFLA 4DNXA 1ILWA 5LOVA 2JLVA