2G1UA

Crystal structure of a putative transport protein (tm1088a) from thermotoga maritima at 1.50 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
137
structure length
137
Chain Sequence
KQKSKYIVIFGCGRLGSLIANLASSSGHSVVVVDKNEYAFHRLNSEFSGFTVVGDAAEFETLKECGMEKADMVFAFTNDDSTNFFISMNARYMFNVENVIARVYDPEKIKIFEENGIKTICPAVLMIEKVKEFIIGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein tm1088a
publication title Crystal structure of (tm1088a) from THERMOTOGA MARITIMA at 1.50 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 49
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2g1uA00
3DMTC 2DPGA 3CH6A 3AUTA 3BMQA 4F6CA 2EP5A 1LRJA 3S2GA 8LDHA 3EAGA 5FWNA 2E6UX 4NK4A 4WASA 5T5QA 5A4DA 2JHGA 2ET6A 2Q99A 3KSZO 5EN4A 4E4YA 4IDCA 3NT2A 3E9NA 3U9LA 2JFGA 4OGWA 5G4KB 4CM6A 3NJ8A 5F5NA 1NX6A 1SEPA 5BSFA 4NH4A 4S3MA 1B26A 1D7OA 1Z74A 3FNGA 3WNQA 1J5PA 2YDXA 1EDOA 5H82A 1H2BA 4NJMB 3MJ4A 1HDYA 4PZDA 2BLLA 2Q1SA 2ILTA 4KTVE 3M2PA 5T67A 4F46A 4JQCA 2V6FA 2AEFA 3CE6A 2AHRA 3GVHA 4XYLA 2C2YA 2UVDA 1E7SA 3D4OA 1V3UA 2OP1A 2V6MA 2W8ZA 4J0FA 4YJFB 4J16A 2NUAA 1P1RA 1RWBA 1XELA 2X23A 2ZCUA 4KQXA 1KVQA 4NBRA 1KETA 1WDKA 3GUCA 1VL8A 4IDAA 4BNVA 1ZMOA 3ZI0A 2HMVA 4HADA 4GWGA 1VPDA 4CM3A 4TRRA 3AI1A 1GQ2A 5ITWA 5TGDA 3E48A 4DBZA 3HUDA 1WNTA 4U5QA 1GQYA 3C85A 1O5IA 3ZGYA 2J8ZA 4DL9A 3PYMA 1PR9A 4IJUA 4AJJA 5KVCA 4EZBA 4BNGA 1G6KA 4YQYA 1UZLA 2WM3A 3RFTA 3ENNA 1DHTA 4OOFA 1PGQA 2C29D 4MOWA 5JPIA 5JC8A 4ALIA 3FPLA 1Q0LA 1T24A 3WSVA 3GEGA 3LC2O 2EKLA 4IS3A 3TZQA 1E3WA 1A4IA 2VTEA 1YBMA 4B3IA 1HT0A 1GL3A 2PWZA 1MC5A 3EUWA 3JQCA 4I8XA 4MJLA 2TMGA 3L6DA 4KWIA 2TMDA 5HM8A 1UXGA 1MXHA 4K9DA 3QLJA 4RQTA 3OMLA 5IN4A 3D0OA 4Q3BA 2B36A 1ZMTA 3KO8A 4CLEA 2NU6A 4IDEA 3VKUA 4PLVA 1EE9A 4FFRA 2ZYDA 4BMNA 3GVCA 2BFAA 4QUKA 5EQDA 3SLKA 1KVUA 3BIOA 3O03A 4GX5A 1K2WA 4JJIA 4CL3A 1ZSYA 3RCBA 2Z95A 3JQ9A 4QXMA 1VJ0A 3KLMX 1CF2O 5EQFA 2XXBA 4IDFA 1HSOA 2ZIZA 3AOGA 4RVUA 3DAGA 3DZJA 4IPTA 3RU9A 1GCUA 4W7HA 3PGJA 4CM1A 4YBZA 3V2UA 1NFRA 5COQA 4W6ZA 2I65A 4HUJA 4ZN6A 1GPDG 2J3HA 3I6IA 2FN7A 2VWPA 1F8FA 1OAAA 4EGFA 1F0YA 3NTOA 1VE9A 2GZ3A 4LVUA 3WXBA 1YE3A 2EF1A 4O1MA 1GFSA 3EC7A 1DHRA 4R3NA 1XIVA 5A02A 2ZQZA 1NFFA 4M55A 2GASA 3RUEA 1OMOA 4CODB 3ITKA 3EVTA 4AJHA 4J1TA 3H9JA 5KJ1A 5DNAA 2X5OA 3ZNPA 4U6QA 4NR0A 4MKZA 4W4TA 2E82A 1PSDA 3DAPA 4WNCA 3E1KA 1QV6A 5GZ6A 4XQ9A 1PR3A 1X1TA 4HKTA 1A4UA 4LMPA 1UJMA 3VPFA 3OIDA 1UDCA 1J4AA 5CG1A 1Q0HA 1C0LA 3JQ7B 2Q1WA 1YOVA 3STHA 1AN9A 4DIFA 1JAYA 1V3TA 2XAAA 3BMCA 3RU7A 2YV1A 4E12A 4Y98A 2E4AA 3E03A 4Z3KA 3V1UA 4ND4A 4E33A 2B0JA 3RUHA 5BNIA 3MJSA 4OL9A 3ZU5A 3V2HA 1EQUA 1E7QA 5KJFA 4GH5A 3NT4A 3NUGA 4KOAA 4NJOA 1E6EA 1BDMA 1GADO 1O8CA 4YA6A 3OJOA 4WCFC 1CEQA 4YJDA 2DLDA 3R3JA 1SCUA 4E32A 1HWYA 3A9WA 1DAPA 4GX1A 1PS0A 3EGOA 3DTTA 4CMJA 3B6ZA 3FI9A 5G2OA 5G0UA 4YAGA 2Q2VA 2UAGA 3G0OA 3DZKA 1LNQA 3ZW8A 5IJZA 3FTNA 2FSVA 3NRCA 4YWJA 1OI7A 4XDZA 3TZ6A 1ISHA 4FOSA 1ZCJA 3ONFA 3WLFA 3X2EA 4R1SA 5THKA 4IQ0A 4F6LA 4CL8A 1I30A 3GR6A 1R66A 4NG5A 3LZ6A 4E2ZA 3Q2KA 5A3JA 5L4SA 3RC9A 1Z45A 3PHLA 5BT9A 3N74A 4D46A 3JCZA 1E7WA 3TWOA 2B5VA 2PY6A 3JQBC 2W98A 3F1KA 3ETGA 2J5KA 4M49A 1Q1NA 1R0SA 2CNBA 1ZEJA 3L0DA 1AHIA 1ID1A 1PJ4A 3U49A 1M66A 3WYEA 2R2GA 1I33A 4XDYA 4D43A 2I6TA 4ND3A 3R6DA 3UW3A 4EUFA 2NQTA 3KYDB 2X7HA 2P9CA 3TFQA 3HJAA 4KUEA 4BO7A 4B7CA 2GCGA 3BTUA 5JCJA 4R5MA 1SO8A 4BNZA 3DZGA 1HDZA 1RM4A 5A5FA 1P77A 2O2SA 2Y68A 4RLHA 3LDHA 4XGKA 1GYQA 4GPD1 5C7OO 3AI3A 1I2BA 1SC6A 4PLGA 1VC2A 5DP1A 2W2KA 3W1VA 3F5SA 3Q6IA 2YHIA 1XGKA 2H1SA 4J49A 3PHGA 2R00C 1PJQA 2GF2A 4NFYA 4PLCA 2CDBA 1GUFA 1LRLA 4NJMA 3WBBA 3NAQA 2V6GA 1AXEA 3DWFA 4CV1A 1BVUA 4WLOA 3VVBA 1EBFA 1Z82A 5KIAA 2AQKA 1I10A 1ZH8A 5B37A 2P2SA 4GI2A 3CEAA 4J0EA 4XX0A 4GLOA 4PGFA 1LQTA 5JW6A 5EIOA 3F4LA 3VC7A 5ILOA 1GUZA 3BXXA 3I6QA 1IB6A 4CUKA 1EQ2A 4R68A 5T57A 4YAJA 3FBGA 3R3SA 3ZV5A 1DFIA 3A14A 1T2AA 5KVVA 3VOSA 3KZVA 3DC2A 1K89A 3HADA 4TKMA 1L1FA 3SEFA 3NJ4A 5EESA 2BHLA 4ZQBA 4AFNA 3H65A 3ITDA 4L74A 2CVZA 4J91A 3O4RA 3UKOA 3MJEA 4QSMA 1K0UA 2X0JA 4JP2A 3VKVA 5DOZA 4CR6A 2E49A 1PJ2A 4BKUA 1IYZA 1G0OA 2PA3A 2EW8A 4WE3A 1B8UA 4YJHB 3RUDA 1LEHA 5JDCA 1ADGA 1U3VA 1MG0A 4UVEA 4YRDA 5K9ZA 1FDTA 1TEHA 2P9GA 4CMIA 5KTKA 1RM0A 5ER9A 3ETDA 3IJPA 4ID9A 1XG5A 3WTBA 1DRWA 4QFDA 4CLRB 4BL5A 4D45A 5I9LA 1T26A 4JNKA 1ZK3A 4BNHA 4CQLB 3JD2A 3NGXA 3RI3A 3AM4A 5GY7A 2I9PA 3I9OA 3TOZA 5ES3A 4RF4A 4DLAA 1BHSA 4YPOA 3VTZA 5HS4A 4HBGA 1YQDA 3WGZA 2JD1A 4NU6A 3K8ZA 4DREA 4K28A 3VH2A 1VSVA 2V65A 3IUPA 5L4LA 4TVOA 1U2DA 2O3QA 4ALJA 2P4QA 3DTYA 1I36A 4XJSA 3D3WA 3V2GA 3EZLA 5EJ2A 4ZHSA 1BGVA 2X9NA 3W6UA 1E0DA 4BGIA 3LU1A 1LI4A 3UFXA 3PRJA 5L7TA 1Y8RA 2IXAA 4EEXA 1YXMA 1D1SA 1PZFA 3C7CB 2DFVA 1PU2A 5U1PA 2DU8A 3VAZA 1CERA 1QP8A 4RVFA 4BS9A 2C82A 3ZWPA 1PZHA 5JLAA 1U4SA 3VH1A 1QG6A 2ZJ0A 4HFJA 4ZJUA 5AXDA 2NVUA 4IJVA 3INTA 4JROA 1EUCA 2W4QA 4UUPA 4DBVO 5EMHA 1X7HA 2HAEA 5CFZA 4E2YA 2EJVA 3PYLA 1UP6A 1PJSA 3BA1A 4DYVA 3VPGA 5GZ1A 4XD2A 4E2WA 3DHNA 2AA3A 4DC0A 1N9GA 4TZTA 3IIEA 4M86A 4FN4A 3U5TA 2UYYA 3R1IA 4B79A 3DO5A 4J9VA 4FB5A 2BKAA 3TQHA 3MOIA 1R4NA 1PGPA 3GN2A 2CF6A 1NWHA 3PFWO 3HZZA 1U3UA 3VDQA 3GFBA 4LCJA 4WOKA 1NXQA 5IZ4A 1YBAA 2C5EA 1OFGA 3O9ZA 4GMGA 2WYVA 4YT4A 3DONA 4CUZA 2YV2A 1R0KA 2ZTLA 4NBUA 3KBOA 4K1LA 3FR7A 3DHYA 3UN1A 1PGOA 4I5GA 1X7GA 5DOVA 5G0SA 1ZZEA 1E92A 2B4TO 2PGJA 1HDGO 5A05A 2ZYGA 2IXBA 1P33A 2HUNA 1LDEA 2GGSA 5CPBA 2GR9A 5JAMA 1F17A 3DEYX 3ROPA 1U8FO 5HRUA 3ZWMA 3Q1LA 4YEDA 1PGNA 1BTOA 3ZWWA 3HDJA 1FF9A 5EPOA 5J23A 1SNYA 1I0ZA 2ZK7A 3H2ZA 4TMFA 4QO7A 3VZRA 4XEHA 4L75A 1NVMB 3T7CA 1V6AA 3ZHXA 4FJ0A 2Q2WA 3H5RA 3GDOA 3OEWA 1DAOA 3AOEA 4MINA 4RPKA 3GNTA 4O0LA 2AW5A 1QYCA 3WSWA 1B0AA 1F06A 2B37A 3TZCA 3U0BA 4YTEA 4RF2A 1NQAO 5KJEA 5IZCA 2EP7A 4MVJM 1EK6A 1P9LA 2OXIA 2NU9A 4XR9A 2WSBA 1NBOA 5JO9A 2FZEA 3K73O 2X22A 3INRA 1JTVA 1I32A 1C3VA 4CM9D 5AYVA 1F14A 1HDOA 4N54A 4DVJA 2FPGA 3T4XA 1IULA 3UHAA 1KY4A 2J3JA 1PJCA 1I3MA 4CM4B 3I4FA 2ZQYA 2OZPA 5U4QA 5ER6A 3D5QA 3UUWA 1KOLA 2DTEA 3I9JA 3O26A 4CJXA 1E5LA 4R9SA 4FFPA 2X5KO 2Z1MA 3NDRA 1DPGA 3OICA 4IGFA 5B1YA 5F1OA 1FK8A 1T4DA 2NLOA 2G0TA 4P4NA 2CVOA 3AUSA 5T8KA 1LUAA 3ROQA 2O7SA 5DBFA 2NADA 1HF3A 5ADHA 4JBHA 1CQIA 3KYCA 1U2GA 1RM3A 4E5MA 1DIBA 3LT1A 1PS8A 1TT5A 2BGLA 2UUOA 3LLVA 4LSMA 1V8BA 1NNUA 3HB5X 2PV7A 5A3VA 4BUCA 4YCAA 2NQ8A 3PEFA 2EKQA 1LSJA 2IYPA 2VNSA 4H3VA 3ZU4A 1WWKA 1WMBA 2NTJA 4D44A 3TNLA 1CIVA 2D5CA 4ZRMA 2PH5A 2VHVA 5H83A 4CM5A 1Q7CA 1EK5A 5JBIA 1Y8QA 5JO0A 1DIAA 3QHAA 2X0NA 5BQFA 3F46A 3RBZA 5CEFA 3SC6A 1TB4A 4OYRA 4JJFA 4U8GA 5JNLA 3F6YA 4R1UA 5CDUA 4UULA 4D3DA 4DMMA 2PZLA 2YFQA 1MG5A 2Y66A 4J6FA 3U4CA 2C20A 4BQPA 2P91A 4Q3EA 4PLTA 5ILGA 3IC5A 3WMXA 2C54A 2IYOA 4Q3DA 2D4AA 1QR6A 1ONPA 2CMDA 4E21A 2NTNA 2P5UA 5JDIC 1ZIDA 4I5EA 3G17A 3LC1O 1D3AA 2EKPA 4AJNA 1J6UA 4Z0HO 2ZB3A 4WCFB 5THQA 1DLIA 2SCUA 4OXNA 4DPKA 4HX5A 1VL6A 2FY8A 1PJBA 4F45A 1ENZA 4IBOA 2Q49A 2UUPA 1KYQA 2DQ4A 3ENKA 5BNTA 2GDZA 1GYPA 2I5PO 1MA0A 4WOJA 3NDIA 4QX6A 4JGBA 5G0TA 3RUAA 3ZU2A 4L76A 1IUKA 4W9NC 1FDWA 3PJFA 4N5LA 4NI5A 1BXGB 5DBIA 3JYPA 2C7VA 4J1SA 1SAYA 3FWNA 4M54A 2X58A 2PZMA 3DQPA 5KWEA 4CR7A 4F3YA 1N5DA 1DFHA 3HB4X 2E37A 2Q1TA 4HY3A 1LLCA 2RH8A 4TSKA 1UR5A 4RGBA 2HMTA 4XB2A 1DIHA 4BO2A 4B4UA 3WGYA 3V8BA 3PVZA 3QWHA 1MGOA 4WEQA 4CMBA 1KC1A 2PLAA 1LDBA 4NFSA 4AJPA 1DIGA 1C1DB 2GSDA 2OL4A 2CDCA 2I99A 3GRKA 3JD3A 1LX6A 4EBFA 4RVSA 2NU8A 1Y9AA 1YL5A 3ZW9A 5A06A 2GPTA 5AXCA 3GVPA 4MVJD 3RAJA 2VT2A 2GO1A 3I4CA 2X1HA 5L7YA 3BMOB 1ULSA 2EG9A 2X86A 3C8MA 3SXPA 3H6KA 4I1IA 2AG5A 4MDHA 4RDIA 2DVMA 5IDXA 2HO5A 5TJHA 5T64A 3CPSA 4GKBA 5TNXA 3OA0A 3ZNNA 1LC0A 3ADOA 1O94A 1ZJYA 4PLWA 4DYDA 4FC7A 1QYVA 2D0IA 4EJ0A 4L73A 3EVNA 4CM7A 2W90A 5CEJA 1W73A 4J43A 3S2EA 4WEOA 2PFGA 4BO6A 1KY5A 3GK3A 3BMNB 1XLTA 4IJKA 5F21A 4BGUA 2VNAA 2OO5A 3H3FA 2H6EA 1BMDA 4FFNA 2IE0A 2POQX 3GEMA 1M75A 4XR4A 1U3WA 3E9MA 3VHRA 4FOOA 4EI2A 3VVCA 2RHCA 3ZV3A 3ZZNA 1PL8A 2Y1CA 3SC4A 3WFIA 2IEBA 4BO5A 4CMHA 2P9EA 1MX3A 3FNFA 2OMEA 4D42A 5HWSA 5FF9A 3IKTA 1P1KA 4AICA 3PHHA 1C0PA 1XA0A 5L7WA 1BW9B 5LCXA 4CQMD 4YJGA 3CXRA 1W8DA 1T2EA 4ONEA 3ETEA 3K2EA 4Y6PA 2BRUA 1QV7A 5HS6A 1H93A 4R69A 1IY8A 5L51A 2ZATA 3A06A 3E18A 1T25A 4MKXA 4E5PA 2XF8A 1QYDA 4WCDA 4TZKA 4D0SA 4ALMA 1X0VA 2HSDA 1EVYA 1ZK2A 5IXYA 3CUKA 4RCVA 4NDNE 1KEVA 5JS6A 3NDJA 3P19A 4LVCA 4BO0A 4H15A 3DBHA 4QECA 3KVOA 5FYDA 4BO3A 4YDRA 4I08A 1U9JA 3K92A 1QRRA 2BD0A 3K31A 1GZ6A 3FNHA 5KKCA 1M6WA 1YJ8A 2CY0A 3S8MA 4INAA 5T6BA 4G2NA 4WLVA 5B4TA 3CIFA 4FDAA 3C1OA 4U0KA 1LDNA 4NK5A 1RYDA 3TZHA 2Q2QA 1UDAA 3UVEA 1PQWA 1LSOA 1GTMA 1Q7GA 2DKNA 3DMYA 3V5NA 1E7RA 1PL7A 1ZUD1 1ZXBA 2I66A 2O3JA 3EMKA 3BTOA 4GQAA 1XYGA 1WDMA 4DIOA 3DB2A 2PKRA 2JCYA 4BNLA 1MFPA 2DBRA 3GDGA 4NFHA 3WB9A 5IAAA 2GN4A 1TT7A 4BIIA 3OEYA 2CDAA 4XIYA 5FI5A 1AE1A 1NM5A 2JJYA 1N8KA 2BF7A 3I52A 1BSVA 1KS9A 1K5HA 4IY1A 1JWBB 4WLFA 4WPGA 1GU7A 3M1AA 1LA2A 2GRAA 2HRZA 2WD7A 2FOIA 2O3TA 3O8QB 4WECA 4JN6B 4XYBA 4N5MA 1B8VA 5DCYA 1YB1A 4ALKA 3P7MA 4WJZA 4PLPA 5COBA 1GZ4A 4WNIA 4J1QA 4G65A 4OSOA 4CM8B 1H6DA 3GN1A 2D59A 1P1FA 3NTRA 3ON5A 3AU8A 4Z9XA 3PGXA 3PLNA 2JCXA 2VYNA 4I9UA 4MP8A 2QIOA 5TLSA 1R12A 4ESOA 1FXSA 3W6ZA 1JDJA 2JKVA 1CRWG 2NACA 4RQUA 1ZVMA 3JQ9C 4Z9FA 2HLPA 5DT9A 2DPHA 2FPIA 5EL0A 3INGA 4HNHA 4J7CA 5CEEA 4I5FA 3JQAB 3AY3A 2H5LA 3K5PA 3GY0A 4RV9A 3RUCA 1UUFA 2EGGA 4DA9A 5MGBA 2QRKA 1HZJA 3E9QA 3L9XA 2VOJA 4ZQEA 1U3TA 4CMEA 1ADFA 4IZIA 4RO0A 3C1TA 5AQ1A 3QE3A 4GBJA 1C0IA 4X54A 3FD8A 3ABIA 3WIDA 4PN3A 1LU9A 3ZH2A 5KKAA 3AY7A 2PH3A 1JKJA 3TF5A 3A4VA 2Y1GA 5JSFA 5DF1A 3QWFA 6ADHA 2PTGA 2IZ0A 1IPFA 1C1DA 1P31A 1R4MB 1B16A 2WYWA 1MB4A 3IKVA 2Q4BA 3WGQA 4ZVVA 3AJRA 1QSGA 3DOOA 2QW8A 5A9SA 1ZXLA 4R5HA 4I9HA 2NWQA 2D8AA 4MIOA 3MJVA 2B35A 1R15A 3LT0A 3H5AA 4FW8A 1OZAA 2VYND 1SEVA 4RPHA 4UUOA 3MWEB 1H9AA 1NAHA 3OJ0A 1DDOA 3ROKA 4FJ2A 1XDWA 4NNJA 1YB5A 1LTHR 3JQ8B 4HP8A 2YZ7A 4XB1A 2X5JO 4E30A 1EE2A 1MP0A 2V7PA 2C0CA 4UVGA 2FR1A 4OXKA 3N58A 1H5QA 5TJ9A 1EUZA 1P0CA 1N7GA 5G4KA 2A4KA 3HWRA 1GD1O 1UXHA 3RQSA 4R16A 4XYMA 3ZCXA 3H4VA 4NIMA 3L4BA 1DSSG 2VZ0A 3QVWA 4PZEA 3UAGA 4OO3A 3ZWXA 3HQ4O 3A28A 4PG8A 2J5QA 1NQTA 1P1HA 4A26A 1O6ZA 1H6BA 1Y5MA 1HYHA 3VTFA 1LDMA 4H7PA 1WDLA 3OQ1A 1Z7EA 4YJFA 1DXYA 1HE5A 1T2FA 4PZCA 2B69A 2EW2A 1ZW1A 3OSUA 4PG7A 1QXSA 4ALLA 3GA0A 3KUXA 4HFRA 5I8ZA 3I9MA 4PLHA 1EUDA 4ZQGA 3JYQA 3FBTA 1DOHA 3ICCA 4J4HA 2QRJA 3S2IA 3VZSA 1PJTA 4E13A 4R54A 5IDYA 5TX7A 1IOLA 1E1LA 2OHXA 2AE2A 2JL1A 1RYEA 1D4FA 2VHXA 4R41A 5DBGA 2O4CA 1NASA 1VL0A 1SOWA 4IIVA 2PKQO 3W4JA 1P74A 3DDNA 2X0IA 4RPJA 1YKFA 3I1JA 4CLOB 2EV9A 1LDYA 2BH9A 4HV4A 1ZSVA 3FRJA 1Q7BA 2EHDA 4N5NA 1RKXA 2X0RA 5JCJD 3ZWNA 2R6JA 1JAXA 1N2SA 1JA9A 4OIMA 2QX7A 4Y8VA 3ZV4A 3PLRA 4GX2A 5JY6A 3LYLA 4B8WA 1E3LA 1DRUA 1P0FA 1KIFA 1Y5RA 1NQ5A 3ASVA 4QO8A 5I8WA 3PHJA 4ND1A 4CMCA 4ZQFA 4PIVA 2VHZA 3MJTA 3QWIA 2QQ5A 3DBLB 1PWXA 3GGGA 5HBRA 4BV8A 5I7VA 5IN5A 3I23A 1T1SA 4MVJE 2WTBA 1ZK4A 1EZ4A 3M2TA 2OORA 3GVIA 1C1XB 3ONDA 4A03A 3PDJA 1X1EA 4L4SA 4RVGA 3G79A 3JQGB 4B3HA 1U5CA 3PQDA 4UVDA 1L7EA 4XQGA 5JAQA 2G5CA 1LQUA 5F1KA 5HTOA 1B3RA 4AJIA 4NQZA 1CJCA 1V35A 2HU2A 7MDHA 3PZBA 3CMCO 1F8GA 3ORFA 4JXKA 3I3OA 4DTIA 3NEPX 3HSKA 1T4BA 1YQGA 7ADHA 3MWDB 2YHUA 3JYOA 4ZGWA 3QVOA 5FI3A 1WAMA 4KMSA 2I76A 1HE4A 4J9UE 4AJ1A 3EDMA 3ASUA 3M6IA 3ZNOA 3G1TA 4D3FA 4O5OA 3P2YA 4PCVA 4JJGA 5L53A 3WNVA 3UGKA 3TJRA 3DBRB 2CF5A 4J4TA 5JDCC 2O3SA 4DIBA 3WYBA 5L45A 3DFUA 2XXJA 4IXWA 1NHGA 1BXZA 4TVBA 1UZNA 3H5NA 2O7QA 2Q50A 2O23A 3IDSA 1PJ3A 3O8QA 2B83A 5COAA 1BWSA 3QVTA 2A92A 3EY4A 5TSDA 4Q3AA 2ZYAA 1OOEA 4IM7A 3W8EA 3FN4A 4A7PA 4U0JA 1XQ6A 1Z73A 4FGWA 1Z7BA 4A27A 1X14A 3I9NA 4GKVA 4OOEA 3D4NA 3GEDA 1E5QA 2QHXA 2ZB8A 4B4WA 3GQVA 5AXBA 3DHEA 3JQ7A 5DULA 4PG4A 5HA5A 4GGPA 5CDSA 4TWRA 4XGIA 3QY9A 1VSUA 4RVDA 4RORA 3TFOA 5L4NA 1N7HA 1Z6ZA 3O38A 2X9VA 4LMRA 1OBFO 3JQAA 3WWZA 3GAZA 4YRBA 3TPCA 4CV2A 4MKRA 1LRKA 1K6JA 4CLHA 3FTPA 1PQUA 2ZTMA 4BNUA 4BV9A 4MP6A 1NVGA 4RLSA 4BGEA 5IDQA 3HNPA 5IFLA 1LBEA 3UCFA 2EGHA 3WWYA 2VN8A 4J3FA 3IOYA 4LRSB 3GFGA 3WQRA 5A03A 3Q2IA 3BMQB 3H7AA 4MVJP 4EYEA 3V1YA 3B1KA 2G1UA 1JU9A 1UP4A 4XQEA 1EVIA 1XSEA 3HHPA 5CDYA 1U1IA 3NX4A 4W99A 3GZ4A 1LLDA 4FJ1A 1A27A 1YVEI 4U7WA 1P1IA 3OJFA 2VWQA 2HJSA 4PRLA 3PQEA 2GYYA 3Q3CA 4IDGA 1DBVO 1A7KA 3FWZA 3QRWA 3QWBA 4BMSA 3GF4A 4CR8A 5CHEA 4O59O 2RHRA 3IS3A 4TQGA 1NR7A 1ADCA 1R16A 3TDKA 3G49A 4E6PA 3F47A 4BNKA 1MLDA 3KEOA 4YQZA 1Y81A 2I3AA 4TRMA 3UCXA 3KYDA 1A72A 4GAEA 1HKUA 5BSGA 4LW8A 2PD6A 5DDIP 2P5YA 2Q46A 4PRKA 5MDHA 2IZZA 2IZ1A 3ANNA 3Q9NA 2DBZA 1J0XO 3LQFA 2WJPA 4D0RA 1IE3A 4FFLA 1JWAB 2AQ8A 4DGSA 4FSHA 3WS7A 1IHXA 4CMKA 1VKNA 5ENVA 3WFJA 4ZQHA 1X13A 1DC6A 4FCCA 3F1LA 1XCBA 4MVJH 1PQPA 4A73A 4U6SA 4ZU3A 5JMWA 4XCVA 3H9GA 3GGOA 4K6FA 3GH3A 3HN7A 2P4HX 4TRNA 1ISFA 1BDBA 4GGOA 1H94A 3OJEA 1I2ZA 3AOEC 1D1TA 3GUYA 4Y6RA 4EW6A 3UXYA 4OM8A 2AEJA 3UICA 2Z5LA 3RJ9A 2C5AA 3AUAA 1V3VA 4P22A 5IZCC 1I3NA 1A9YA 5C5IA 4FS3A 1NWCA 3RFXA 4KUGA 1GY8A 2C2XA 4YT8A 4EUHA 4RPGA 4K6CA 1XWFA 4MVJF 4EJMA 2BMAA 4IQ8A 4WKGA 4P4GA 5LDGA 2A9FA 4JBGA 5IXSA 3ST7A 3A1NA 1A7AA 2VRCA 3KRTA 4AVYA 1B15A 2AQHA 3EW7A 3PIIA 4H16A 4DQXA 4CLOA 1M76A 1VKOA 4IMPA 3RFVA 1G1AA 3GNQA 4XWYA 1NPYA 1IL0A 1MUUA 3SX2A 3CMMA 2PNFA 4PVCA 4YJHA 2DBQA 4KDFA 1FDUA 3K9QO 1PIWA 4EITA 5T8KC 4E5NA 4CLRA 2JAPA 1B8PA 2PZKA 2Y1EA 3VZQA 5KJCA 4PVDA 3OH8A 3DFZA 1MFZA 1HXHA 4CQLA 1BG6A 2NVBA 4Y9DA 5JE8A 1ZO8A 2FP4A 1I2CA 1W6UA 4LISA 2GN6A 4YT5A 5DCWA 4IUYA 1T2DA 3B70A 4GVLA 1YONA 1TLTA 4B4OA 1XHLA 5I9NA 4II2A 3GRPA 3PZRA 3I9LA 2VZ8A 2LDXA 5G0VA 3ZDFA 1GCOA 3GPIA 3QV1A 2JAHA 1RPNA 1VJ1A 2BI8A 3QVXA 4AG3A 4PLYA 1E7YA 2QYTA 2QZ9A 1DB3A 4IXTA 1DO8A 1E6UA 1X0XA 5KVQA 4KP7A 4NU5A 1YOVB 1EBUA 2VUSA 3HFGA 4DPMA 4BNNA 3BMCB 4A5OA 4B7UA 3EZYA 4OJNA 1ZBQA 2J3KA 2BI7A 2VHWA 3NT5A 3SBOA 4BOYA 4CMAA 3DBRA 2WMDA 2Y1FA 3KOUA 3RUIA 3T4EA 3AFNA 3UOGA 1O0SA 3EK2A 2GLXA 5K6AA 3SJ7A 1K3TA 1G0NA 3SVTA 3HDQA 2C59A 3JQFA 4R4JA 1C14A 1JVSA 1LDGA 2D5AA 3DMTA 3QP9A 1DC3A 2GNAA 2QRLA 3WQSB 3WGOA 3OBBA 5DZSA 1NR1A 4B8ZA 2WYUA 4J2HA 4A10A 1ENPA 3ZHBA 2DT5A 1BXKA 3PK0A 1ZKMA 4YXFA 4E5YA 4UAGA 4BB5A 4AJLA 3BHIA 3C7AA 3DR3A 4R3WA 2GZ1A 3W4IA 4JK3A 3WG9A 2PR2A 2QG4A 2B4RO 5L3ZA 1CDOA 3I5MA 5G4LA 2A94A 5I7EA 2B4QA 2YV3A 4ZA2A 1E3JA 3AU9A 1OC2A 1TI7A 4PLZA 2V6BA 1YDEA 3TZKA 2OBYA 4BNTA 2ZKLA 1C0KA 3BAZA 4CV0A 1CQJA 1GV1A 3LK7A 4J7UA 2I3GA 1X7DA 4IIUA 3D4PA 4W82A 3OM9A 5C7IO 2HMUA 3B20A 3JQEA 2G17A 1DLJA 4J7XA 2JD0A 1XR3A 2IDZA 3F5QA 1O89A 1WP4A 4DMLA 2PGDA 3ZHYA 2HQ1A 3WX0A 2XOXA 2YQ4A 1M6HA 3TSCA 2WE7A 2X4GA 3AM3A 3KLPX 4ND2A 4P4LA 1HETA 4DQVA 3RKUA 2CUKA 3GZNB 1A71A 3JV7A 4XJTA 3OHSX 2GN9A 3OQBA 1N92A 1I24A 3P5SA 1FDSA 3U3XA 5FEUA 1YDWA 4YAIA 2Q3EA 3DZIA 4WLEA 3JQ6A 2W2KB 2YHIB 1HL3A 3E82A 3E8XA 3JSAA 3OETA 3P2OA 3OECA 2H63A 3KXDA 1KVRA 3RVDA 5JY1A 4C7KA 3H2SA 1H0KA 2BGMA 2RIRA 4UREA 4AJ4A 3LSYA 4A2CA 4UVIA 4LSWA 1T2CA 5A9TA 4ROSA 2BELA 2O3UA 1U5AA 4BNYA 5AVOA 5GMOA 1YBVA 1ZSNA 3BHJA 2JD2A 3VZPA 4C7JA 1JKFA 4QFCA 1GUYA 3GT0A 3SLGA 1IPEA 3ZHZA 4DXHA 2OGUA 1HSZA 1TVEA 1DIRA 4CM4A 1R37A 2AEMA 1LSUA 3GGPA 4KTTE 1LLUA 1WMAA 4GMFA 4BB6A 4BKPA 2VUTA 2OFPA 4IMRA 4Z6KA 3LF1A 1VI2A 9LDBA 1A9ZA 1B7GO 3GG2A 3VPHA 1H6CA 1E1NA 1DJQA 3WOHA 5LDHA 4BGVA 3H3JA 3UCEA 4OXYA 4PFJA 3ANMA 3OFSA 5L9AA 3NTQA 2VRBA 4KZPA 4CLXA 2J6IA 3W8FA 2PD4A 2DAPA 4CMIB 1Y6JA 4NBTA 4MVJG 1EFKA 4YT2A 1E3IA 3WQQA 2VHYA 1XU7A 3GOHA 4OMUA 4BO8A 5CG2A 1I5RA 3ZV6A 3RBVA 1NHWA 4MO2A 4DPLA 4J90A 3DZFA 3S55A 2X6TA 4CUJA 4L4RA 2Y05A 4NZ9A 4TROA 4UVHA 2WEKA 2JHFA 4L4XA 3WJ7A 4NBVA 3GG9A 4FD3A 3D3WB 2CZCA 2VOEA 2FWMX 2ZB4A 4KUHA 2W2LA 2D2IA 1Y8RB 3MEQA 1ONNA 1S6YA 2YW9A 1HDCA 2Q1UA 3G3EA 4D3SA 1JQBA 4JBIA 2O50A 2A35A 2I67A 3JYNA 3NKLA 4GSLA 5BSHA 2JFFA 4Z9YA 1QLHA 1HDXA 2BFMA 3PDUA 3GPDG 4JP3A 2F00A 4R1TA 4L0QA 3RKRA 1I01A 4WCFA 1AXGA 3ULKA 3GNSA 1DRVA 4JLWA 3D7LA 1VLLA 1MC4A 2NVUB 2IEDA 2YJZA 6LDHA 4LN1A 3COSA 5ICMA 5H81A 3S1LA 4YAKA 4HWKA 4PG5A 4WLUA 3DOJA 3RD5A 1I8TA 4RL6A 3OA2A 5I7FA 1PZEA 3WGTA 1KBZA 3PXXA 4P38A 1N9GB 5FFFA 5JAZA 3QVSA 1BXGA 1P1JA 4Q3NA 1GAEO 2D1YA 1R4NB 1YL7A 4G5HA 3WGGA 4BKQA 3VDRA 4UEJA 2RBEA 5KOIA 3D5TA 4Q39A 5JCXA 4OSPA 4E31A 4QT0A 5A1TA 3I9KA 3ADPA 4OHUA 3RIHA 4D79A 2EERA 1U7TA 1YS4A 2AMFA 3C1AA 1CYDA 4GL4A 3QWAA 3ZU3A 3IJRA 3JQBA 1NTOA 4EDFA 4YACA 3B1FA 2DTXA 4FR5A 1XQ1A 4NPCA 2ZTUA 3AK4A 3TOXA 1T1RA 2W2LD 4GVXA 4BNJA 3D1LA 1WVGA 3KSDO 3E5RA 3PFFA 2GN8A 4R1NA 1PZGA 5JXWA 1OC4A 1UZMA 5F1PA 1N1EA 1BVRA 8ADHA 2X9GA 1HE3A 5TRTA 2IODA 3OIGA 3B1JA 1AGNA 1EFLA 3PJGA 1Y9EA 4GWKA 2C07A 3WIEA 4BHTA 3BZUA 2PKQP 3BMOA 3QQPA 3I83A 1YQXA 1ZJZA 1DFGA 4LGVA 4FQ8A 2HK9A 3BTSA 3JD4A 2Y67A 4YVFA 2BGKA 3HFSA 3MOGA 2R00A 4UEOA 4GLLA 3FPCA 3TL3A 1V0JA 1QLJA 4R51A 1XU9A 1E77A 1L7DA 4CMEC 2NM0A 1TA4A 5ITVA 1WXDA 4Y6SA 3FF4A 1GPJA 3HG7A 1ZEMA 3HE3A 2Q45A 2EEZA 3OQ6A 4RPLA 1QMGA 1SB8A 5JYEA 1QKIA 4Z3DA 3KSUA 1E3SA 2E48A 4RF5A 1ENYA 9LDTA 2FR0A 2VUUA 1WZIA 2ZB7A 2DM6A 3BMNA 4OKNA 4B4VA 2ZJ1A 4DWVA 4Q3CA 3BTVA 1D8AA 1HLDA 1XKQA 3MTGA 1IZ0A 5TT1A 4OAQA 2UDPA 1E1MA 1LXCA 5I7SA 3RSHA 3IUSA 1MV8A 3K6JA 5AOVA 2OP0A 3CSDA 2VTDA 2OBNA 1YB4A 2RH4A 4KWHA 4N18A 1KVSA 3KYBA 3MZ0A 2GD1O 1ISMA 3GZNA 2UV8A 3V1TC 5C37A 1HEUA 3JTMA 3PJEA 3EHEA 1DC4A 4WK6A 1GV0A 3AY6A 3W4KA 4BNMA 2VT3A 1BW9A 4ILKA 4C4OA 1JVBA 2GERA 4AJ2A 1W4ZA 3ZWCA 1VRWA 1N1GA 2HJRA 3IAHA 4HXYA 1ZK1A 2Y99A 3SJUA 2FSSA 4Z0PA 3L77A 5IDWA 1QYXA 3PYXA 3PWZA 5A5EA 3KYCB 4PG6A 1UXJA 1NPTO 1DC5A 1NVTA 4ITUA 4UUNA 3ZNQA 4D41A 1ORRA 1TT5B 1O95A 2Y0DA 4HFMA 1LJ8A 1WPQA 1NYTA 5TQVA 1K6XA 2AE1A 1Z75A 1F12A 1B3BA 1HYEA 4BNXA 1QORA 1P3DA 3E5MA 3L4BC 1Y8QB 4XYGA 1AUPA 3VH3A 4Q9NA 1JKIA 1K6IA 1YJQA 1E6WA 4AL4A 4XRGA 5B4VA 1TXGA 1HE2A 2Y1OA 1WZEA 3MCVA 3PJDA 2EJWA 4IS2A 1SBYA 2PGLA 4GSKA 5TT0A 4IQGA 2VZ9A 3L9WA 3QA9A 4M8SA 2DUUA 4HNGA 1IZ9A 1W0CA 5JFOA 2G82A 3ZWVA 3KV3O 3MTJA 3ZWBA 1E1KA 2NV6A 4K26A 4DQUA 5L95A 4OQZA 3ZWYA 4R9RA 1DJNA 5JYDA 1E7MA 3RASA 4TKLA 3S2FA 4BO1A 1NQOA 4LRTB 3F3SA 1YL6A 3JQDA 4ZICA 2BFPA 4BNFA 3AFMA 2QYSA 1WW8A 4BNIA 4OH1A 3AI2A 2HMSA 3UF0A 1HDRA 4E5KA 3LVFO 3WBFA 3WICA 3IP1A 2DC1A 2PK3A 5F5LA 4CV3A 1BRMA 1P44A 4XIJA 3TRIA 3IP3A 5GZ3A 2PD3A 3PP8A 4QTZA 3NV9A 1KERA 3WGIA 4DLBA 1VJTA 5JC1A 1Y1PA 3HN2A 3KTDA 3W8DA 1WLYA 3RBXA 2HMWA 1Q0QA 1LLQA 1SMKA 3DBVO 4MVJI 2RAFA 3QSGA 3N7UA 4ALNA 4NMHA 3RROA 4CM8A 2PZJA 3D3EA 4I5DA 1V9LA 2EIHA 2YQ5A 4L9RA 4RF3A 2DFDA 5TIIA 5B12A 1KEPA 3K30A 2NVWA 2NSDA 2D3TA 3H8VA 4YAEA 4IZHA 4RZIA 4XA8A 2EWMA 3U4DA 1IHYA 4CQMB 4CMGA 3WTCA 1EMDA 4FPXA 3WDSA 2O2YA 2P68A 3T7EA 4YR9A 1FJHA 2C7GA 3CKYA 5ENDA 1VM6A 3U62A 1H6AA 4RDHA 2FHSA 2H9IA 4PLFA 1PGJA 1PS9A 2CD9A 2HK8A 1H2HA 1SZJG 1ZFNA 2AQIA 3KB6A 4KDEA 2YFHA 4O63O 3CTMA 4BKRA 1PWZA 1JN0A 1SB9A 3PI7A 1ISJA 5CDTA 2FR8A 4Y67A 1UH5A 2HK7A 4CM9A 3EYWA 2JCVA 1NAIA 1ZNQO 2BFOA 1EDZA 2DTDA 4XRRA 1R4MA 3OF2A 4NBWA 3ZWAA 3KEQA 3ROMA 4XZ3A 3ZWOA 2Y1DA 2HCTA 4FIZA 1KC3A 5KVSA 3D64A 3WLEA 4IINA 2O3RA 4OKIA 2FPPA 5JMPA 3GHYA 3GVXA 4DC1A 3CINA 2WDZA 3TL2A 2GUGA 2ZTVA 1ISGA 3WR5A 5K0ZA 4UUMA 4DRYA 3DZBA 4ZD6A 1MXFA 3IQDB 3E6AA 3Q9UA 3DL2A 5DCUA 1PJLA 2WD8A 2WE8A 3LT4A 5DP2A 4E0BA 1CWUA 4JX8A 4MIEA 2CFCA 3AUUA 4XQCA 5CDGA 5KCZA 3F9IA 4ND5A 2Y0CA 3R0IA 3JQ8A 3PWKA 3JQAD 1ISIA 3AWDA 4YJGB 1GYRA 5EINA 1GDHA 1HTBA 4AJOA 4R01A 1S7CA 4ZRNA 1DEHA 1GR0A 1RJWA 4DUPA 3ANLA 3H9QA 4P8RA 4BKOA 4IDDA 4M1QA 5C7LO 3H9EO 3RJ5A 5I9MA 1LC3A 4BO4A 3KETA 5LC1A 3CZMA 1KEUA 4FBGA 5G0WA 2G76A 2HKIA 3GAFA 4IGEA 3DAFA 3FR8A 4RZHA 2NTVA 2WWRA 4S1VA 1I3LA 3C3XA 4B7XA 2J5RA 3PHIA 1ADBA 3DBHB 4RVHA 3GMSA 1JLLA 1UAGA 1E3WB 2NNLD 2NU7A 3U4HA 1YRLA 3IL2A 3PQFA 3TN7A 1NFQA 4IDBA 1X15A 1B14A 1U4OA 3H9UA 1R6DA 3DZHA 4M87A 3QJ5A 3M1LA 3DOCA 3PIDA 4BVAA 3OJLA 4AJEA 3PTZA 4XGNA 5JDIA 4KQWA 2VYVA 1M2WA 3WMWA 1GQQA 2CSUA 1A5ZA 1FDVA 4JCOA 1UDBA 4OQYA 1O9BA 3AW9A 1YO6A 1GZ3A 4UEKA 4XKJA 4LCEA 3BHMA 2YY7A 5CAEA 2AXQA 3ZN2A 1E3EA 4BNWA 4GX0A 4EJ6A 4YB8A 1Q2XA 5TC4A 3HDYA 4HFNA 4XYEA 1ARZA 3KHUA 3GDFA 4WLNA 5CPFA 1B2LA 5A04A 2CVQA 4FC6A 1ULUA 5F3RA 1ZK0A 4W9NA 1FMCA 4MP3A 4I9NA 4J1NA 3L6OO 4EEZA 5JAIA 4E3ZA 2O4UX 3G1UA 5DN9A 3CZRA 1J49A 1HLPA 4J4BA 3HDHA 1QYWA 1UXKA 4L8VA 2FMUA 3LT2A 3DBLA 4QEDA 3F4BA 4G81A 2VWGA 3IMFA 1LSSA 4URFA 1EVZA 3DXFA 3RC2A 5IG2A 4JIGA 5ICSA 1C1XA 2WD7B 2YYYA 4DLLA 5KJ6A 4MIYA 3JQGA 3AM5A 4CLDA 5BR7A 3BYZA 1GEGA 2HRBA 4YRAA 4BQRA 5TF4A 3FCOA 4IJWA 1UP7A 1HYGA 4WGGA 3Q0EA 4MVJA 1HZZA 3GC6A 4NHEA 2VYVD 4YYZA 2Y93A 2HDHA 2GZ2A 1JW9B 2Q4EA 4LK3A 5B4UA 2VQ3A 3K2BA 5CP8A 1U8XX 1Y7TA 3FHLA 3LC7O 2XPCA 2RCYA 2VRCD 3RWBA 3WJAA 5A9RA 3K96A 1SOVA 1KVTA 1KEWA 1AHHA 1PX0A 1YH3A 3LF2A 4N7RA 3FNEA 1YWGO 3QIVA 4TRJA 1U7HA 2FRDA 2OUIA 2VWHA 3VPXA 2AG8A 3MJCA 5BSEA 3GMDA 4BMVA 3VH4A 2Y0EA 4EUEA 5L40A 2Z1NA 1RM5A 3L4SO 2QZZA 1NP3A 1HRDA 3L07A 4D7AA 4Z0TA 5TS3A 4W7IA 3U09A 4A0SA 2B5WA 5BNFA 3ONEA 1ML3A 3C7DB 2F1KA 2IRWA 1PEDA 4FFMA 2OOSA 1R0LA 3C24A 1U28A 1UXIA 1H9BA 4J2OA 2DUWA 4M89A 2YUTA 2FZWA 5IF3A 3QW2A 5KNLA 1ONOA 1YGYA 4FGSA 1NPDA 1P45A 3JYLA 3OP4A 4FFOA 3PWSA 3X2FA 3Q11A 4QQRA 3NYWA 3VPSA 1I3KA 1PTJA 4II3A 1GEEA 3KM0A 3NGLA 1UAYA 5A9SB 4WUVA 3RC1A 3RUFA 3PPIA 3WGHA 1ENOA 2JFHA 5C3MA 3WYCA 4CQMA 2LDBA 3LLSA 4BO9A 1EEHA 2EXXA 2YDYA 4AJKA 4RJTA 3GLQA 2J3IA 2ZCVA 3GHHA 1EVJA 2X8LA 5AXAA 1PL6A 1SPXA 3ICPA 5EERA 5U9CA 3L6EA 1CETA 3UH1A 3OIFA 2DBVO 4O6VA 3FSRA 1XEAA 2VCYA 3RC7A 1M67A 3JD0A 4CPDA 5K6AC 3JD1A 4E2XA 3JQFC 4MPDA 2O48X 4B3JA 3U4IA
chains in the Genus database with same CATH superfamily
4HQLA 2DPGA 3HM2A 4ZKDA 2H0QA 3SF8A 3BMQA 1JG4A 4F6CA 4ZCPA 4ZV4A 3NHLA 5ABPA 3RYFA 3DEHA 3EAGA 2E6UX 3B1WA 4NK4A 3H13A 4NULA 2JHGA 1JMYA 2ET6A 5EN4A 3RRNA 3WKDA 3KOOA 4IDCA 3NT2A 4LE1A 3E9NA 3U9LA 2JFGA 4M7RA 4OGWA 5G4KB 3SSAA 4CM6A 5LUAA 3B9RA 1I7QB 2D7DA 3GIWA 4NOJA 4LYYA 1IAQA 1GSAA 1SEPA 4NH4A 3K32A 1B26A 4INOA 4NL4H 1J5PA 3DV0A 1TPYA 1NW5A 4KPUA 3V7FA 3SVZA 3MJ4A 3WP1B 4PZDA 4KTVE 5T67A 2XDQA 3JZAA 4O2AF 5JPDA 3R0JA 1S01A 1NJ6A 1J8DA 1V3UA 2JJ2A 2VP0A 3E3LA 3QBJA 4KFUA 1PR1A 4YJFB 3CVYA 1XBTA 3PFGA 2NUAA 4ZDKA 5HZKA 1T6XA 1XELA 4MEAA 2Z2IA 3BQ9A 4QU5A 4BQEA 4DA6A 4BMPB 4NBRA 4XJVA 3TIVA 5KYVA 1KETA 4QELA 2J6BA 1A96A 2P6UA 3FSGA 3GUCA 4FR0A 4ZJZA 2IXEA 3UWMA 1Z2EA 2R1ZA 3ORSA 2D1FA 1IXSB 2FPRA 4HADA 4NJEA 3U3ZA 4TRRA 2GF0A 2JAUA 2KJQA 5TGDA 3TR5A 1EDEA 5KAPA 4G0OA 1W94A 2ZUWA 3KXKA 4L22A 5F51A 5K4AA 3GBVA 1Q74A 1UMDA 3B52X 3RRBA 3ZGYA 1VJRA 1NKTA 2OFOA 4O4JF 4RYDA 3RS3A 3Q7RA 3UKDA 1CY2A 1YR9A 3P94A 4EZBA 5IYZF 5BWLA 4YQYA 3EFBA 1UZLA 2WM3A 1X19A 1JQEA 2AYYA 2H0RA 4KZKA 1LQ2A 2C29D 2CXNA 1T8PA 5JC8A 1IRXA 1L5OA 1UBSB 1MX1A 4HAWA 4Z0NA 3U4MA 2J9ZB 3O94A 4E09A 4FI3F 5EZYA 2VTEA 3U3JA 5SZKB 3B9QA 4V3CA 2PWZA 5KOHB 2QUAA 3INYA 3OZGA 3TH5A 5FOTA 1S3IA 2VPYA 4FSDA 5B5SA 3VX4A 4IHAA 2Z1DA 5GQSA 1UXGA 3OURA 1Y6QA 2XXAA 3DLPX 2ST1A 3OMLA 3HLTA 4LZPA 2WZBA 4A6EA 3DVQX 4IDEA 1N2BA 1EFPA 4WXYB 3OUZA 1EE9A 3A1VA 1BDJA 4CT5A 3NTLA 3GVCA 3WK4A 1LPMA 4QT4A 3W5DA 1E8DA 1KVUA 3BIOA 3U7HB 2WB2A 5C32A 2FPMA 5B2ZA 2EZ9A 2BFDA 3RM3A 1K2WA 5CITA 1GZHB 4CL3A 1ZSYA 3HU3A 3USZA 3FMGA 1QUEA 2D00A 3BA6A 2XXBA 1C50A 2WJIA 1DEXA 2ZIZA 3I9V6 3P96A 4PZAA 3W8RA 4CG2A 1MB2A 2G8NA 3E8MA 3PC8A 4W7HA 5I7RA 5JD4A 1A1VA 2XUPA 4MUAA 5HZHA 4KVFA 2HYDA 4YBZA 1HOTA 3AHCA 4JC4A 1JR2A 5KQMA 1NFRA 2MSCB 5CA1B 3L84A 3CT6A 1FRNA 1HE1C 1ZGZA 2JW5A 3JAWA 3LIIA 2VWPA 1OAAA 1N2JA 4CTOA 1M2VB 4LDNA 3D6TB 1YE3A 2EF1A 1JEOA 1GFSA 1W9HA 2OAQ1 3EC7A 4HX2A 1JDBB 4O4IF 4R3NA 1Z4PX 3SZRA 2IZOA 5A02A 2ZQZA 1NFFA 1IWBB 2BV3A 2Q3FA 2QT1A 3I64A 3V4LA 2D62A 5LOVA 3FGPA 5KWVA 3TIIA 5B6PA 5ALNA 3DL7A 1TQHA 3L8FA 3AVVA 3I2KA 3HZRA 5AVUA 5JJCA 4HMQA 4L57A 3CLKA 3LECA 1Z5OA 4M1YA 1Q0ZA 3E9RA 1T9GR 3SDZA 4MAMA 4N39A 1QV6A 1RHJA 5GZ6A 4XQ9A 2YWXA 4KH0A 4LMPA 1P0PA 1JILA 3C3BA 1DQRA 1SIBE 1UDCA 1VA4A 2DFTA 1AGYA 4G8CA 4JELA 4G56A 4N7JA 1YOVA 3TMAA 2RJ3A 4UU7A 4EB8A 1HEYA 1U1GA 1DOZA 1XU4A 2CZGA 3AEQB 5EUMA 1MW9X 2XE8A 5AM1A 4MR9A 1DAGA 5C1OA 2ZE8A 1E1RA 1QK3A 1VCNA 4RIHA 4BVFA 3V8VA 2QV7A 1DX9A 3G8BA 3T3HA 8ABPA 3HKBB 3DCIA 3MJSA 4FCVA 4OL9A 4A2PA 1E7QA 5KJFA 1S7GA 2W22A 3NT4A 4KOAA 2IBSA 2NXCA 3ZCVA 1TO1E 3P9XA 2GRUA 2HNKA 2PX8A 3UJBA 3G5AA 1DJLA 1EHYA 1GADO 4OXXA 1L0BA 1SOUA 3K15A 4YA6A 2MSDB 1N2CE 2DLDA 4GYYA 4DCJA 2I2BA 1F0KA 4AP5A 2R2AA 3A9WA 1Q83A 1Z39A 1PS0A 2GPNA 3WGNA 1HMYA 1L5WA 3MS4A 3BWXA 3O7WA 3HB0A 4UM9D 2O2XA 4I36A 2XZOA 5E1MA 4S1NA 3G0OA 2OBBA 3KK0A 1LNQA 1DBSA 3T6KA 5IJZA 2H1OA 2MYUA 2WNSA 3QHQA 2QD3A 1WRBA 2Q3CA 3GLRA 1OXKB 3WLFA 2WHRA 1VBFA 3OCUA 4FOSA 5EMKA 1RI2A 2WKRA 3KOXA 5H02A 3H2KA 2P9JA 1I30A 2IHYA 5L4SA 4ZZ3A 4MV8A 2GM3A 4YV7A 2JJ1D 3TPZA 1SIOA 4JJ4A 3JCZA 4F04A 1XD9A 3FUCA 2AKYA 4BX9A 1G7CA 1RZ3A 5CM9C 3PR2B 3I05A 2OA0A 3R6GA 3QFCA 2H52A 4LPKA 1R0SA 2CNBA 3EXHB 3U6BA 5AW2A 1PQYA 4I4CA 1I33A 4DE5A 4NF2A 5FTJA 4UHHA 1KK1A 2WM2A 4EUFA 4B3RB 1RBYA 1ZJ4A 2D2XA 5LBIA 4D9JA 3L1VA 5CRIA 1C8LA 2F1IA 3A04A 2QN6A 1JHMA 3D6MA 3HJAA 4BO7A 4BN0A 3IXLA 1RQLA 2RHJA 4MWCA 3FGZA 3IALA 3DZGA 1GZSA 1MJGM 3OM8A 4QOHA 4UHEA 3VOBA 3LDHA 2HXGA 1YAHA 3EZXA 2AC4A 1GYQA 2RGDA 6ABPA 2AMVA 2MINA 1XJCA 3RUPA 3Q1KA 1SC6A 1OD6A 2B20A 3DE3X 4PLGA 1VC2A 3W1VA 4RHTA 2H1SA 2I33A 4J49A 4URYR 1D2HA 4KPYA 2OMKA 4BLVA 1KJJA 5DJ5A 4PLCA 2CDBA 3UK6A 4DLVA 2RKOA 1GUFA 3IKLA 1E79D 1JFVA 5BPHA 2HDWA 2PRKA 1OIWA 3QLVC 3LPAA 1BVUA 2OLEA 2RHHA 4WLOA 2MSLA 2W37A 3EUAA 2VTVA 3G13A 4JP1A 4X41A 4KN8A 5AK6A 5GJCA 4R6XA 3RSQA 3NP9A 4BMCA 2F3TA 1DE0A 2SECE 4J0EA 1RWQA 3HVJA 3KQPA 5B37A 3C6QA 1EE1A 1FQWA 1E9EA 1LQTA 5DX8A 3E5HA 2HL6A 2WUFA 4EHHA 3L06A 2YXBA 3F4LA 5EIOA 2C2BA 2PIAA 1IB6A 2VC2B 3CEJA 4CUKA 4L51A 3S70A 4C05A 4R68A 3GT4A 3OOYA 3HY4A 3SPXA 2W6CX 2ZRPA 3FBGA 4ZVPA 2II6A 1HQDA 4IP0A 5KVVA 5AJUA 2EHJA 1P4RA 1SCKA 4WBSA 4TKMA 4OBXA 3T7RA 3NIGB 1LF5A 4KQKA 1T3LA 3H04A 2JDID 3FSEA 4L08A 5JECA 2D0PB 2MSEB 3R20A 2FSIA 3VKVA 3GL9A 5DOZA 5HJ7A 5HGXA 3E23A 1OI2A 4UOEA 2VDJA 1G0OA 3AKYA 3LL7A 4R2MA 4YUYA 4QOEA 4BZQA 1BEEA 5K6RA 5B2EA 1LEHA 3FVRA 3ZXUB 1U3VA 3QMMA 1JHUA 5KTKA 3C6YA 2EJTA 3SDSA 4CMIA 4EJFA 3REQA 4JA2A 2A5LA 3IJPA 4K3UA 3WTBA 4CUZA 3AF6A 1QHHA 4CLRB 5JQGA 3UWKA 1THZA 1W4LA 4JOSA 3D5EA 1L3IA 2XB8A 4CQLB 3K70B 4X00A 4E4TA 1CBUA 3L6UA 3M34A 3NGXA 3BD7A 3L1JA 4OV6B 3RYIB 1SKAA 2I9PA 2R96A 3N7TA 2FP4B 5F3WB 4RF4A 5TQ0A 3ZYCA 4O3MA 3R8CA 1QNLA 1QO0D 2JRLA 3P2KA 3W0LB 4DREA 3K8ZA 1UK7A 3CLVA 3G82C 4KWTA 4R1PA 4UHBA 1EX9A 2GBFA 5AJYA 5LWHA 2C0QA 3AR5A 4PSVA 4ALJA 2P4QA 3DTYA 4XVQA 4D9IA 4G5QA 1EDBA 2D1QA 1L5FA 4HLCA 3VBEA 1ZC3A 3EZLA 5EJ2A 2PVPA 2BDUA 2XNJA 3V2GA 1MZPA 4DDWA 5C8YB 4LG1A 4HCJA 3URMA 3PDIB 2HF7A 4ZJPA 1HOXA 3GLIB 3FOEC 1LI4A 2J7KA 3A1UA 4K40A 3UUGA 4QXRA 1U6KA 2EKBA 2IXAA 3YASA 4EEXA 3GEBA 4RANA 2IH4A 2QTTA 4F1KA 4AW9A 1C4XA 1E89A 2DFVA 3UHFA 1B42A 5E4FA 4CFSA 2C7BA 3T7SA 1R5JA 3D54D 2J9GA 1E2MA 4EHIA 1CJMA 4D92A 3FDZA 4RVFA 2BP7B 2ZRJA 3BWMA 9MHTA 4BC1A 5FV7A 4MW6A 2OBLA 4L2IB 3D7SA 4Y0AA 1P5RA 1W8IA 2ZJ0A 5AOCA 1E66A 5AXDA 2NVUA 3K0FB 4BFSA 3INTA 1TJ3A 2LVBA 4YK7A 2W4QA 4LJYA 3DUFB 5EMHA 5K3DA 3IDQA 2HAEA 1KXJA 1R74A 3E70C 3AP1A 2EJVA 1R0CA 4XOUA 5CFZA 1AS0A 1C9KA 2PHZA 2BSAA 4OLJA 5LP6C 3VNAA 4B3TB 1XDZA 3D6VA 3DHNA 5KDDA 2BKUA 1E9CA 3A9VA 3ELBA 4I8IA 2QPLA 4JHLA 2MSKA 3IHLA 1LZKA 4M86A 3U5TA 4PYQA 2XD4A 3DO5A 4WMLA 3WL7A 4AY5A 3C74A 3OCWA 5DTMA 4P4SB 1P7PA 3UHPA 4C20A 4EI7A 1NWHA 2B4AA 3CEPB 4HZUB 3BXOA 2I2AA 3AFGA 2INGX 3ORYA 3VDQA 1LBHA 1CZOA 1YBAA 2C5EA 1WVMA 4C6RA 1OFGA 4EB6B 3ELYA 4GMGA 4LNUA 3UW1A 3WZLA 4M83A 1D1PA 2DY1A 1QOZA 2PM8A 2YV2A 3DONA 4PTLA 3EQ6A 3HU5A 5H3CA 6CHYA 1I7PA 1P9RA 2B8NA 3FR7A 3L6BA 1QK5A 4MPTA 3R9KA 2Y3IA 3ZE1B 3DHYA 4B6EA 2CJXA 5JRDS 2WYIA 1KPIA 1TVKB 3MQ2A 4RFLA 4RKRA 4ZANA 3IBFA 1T6BY 2M1ZA 2B4TO 4J7AA 4TTSA 3T1TA 2ZYGA 2NO4A 4LQ4A 3SS7X 2VYFA 5CT6A 2IXBA 2IHTA 4G1UC 3LPCA 4BEBA 2C3PA 3WO1A 2VJQA 5KMGB 1EU1A 3RVMA 1AQYA 4KO4S 3I53A 3TTUA 5ALMA 4LF8B 2QSJA 2CB0A 3TZEA 4NCBA 2GA8A 1UMCA 4KCGA 3NWPA 1NVXQ 1T5BA 1LX7A 1H4TA 1UBHS 3DDCA 3UGTA 1ZU5A 1I9GA 4JC0A 4B6RA 2HTEA 5EPOA 3BZBA 2MT9A 5J23A 3NANA 3G23A 3KSRA 3WKCA 2A1TR 5DNDA 1ISRA 3UPDA 3ZLJA 2WICA 3FTCA 2AD1A 4XEHA 4D4HA 5KYYA 1FJGB 1SUAA 4LXIA 4F97A 3DNFA 3NHPA 1A2QA 4I6JA 1JSLA 4MS3A 4BCBA 4AZ3B 4EG8A 4Z1OA 1CUWA 1QE3A 1Z4KA 3OEWA 4RXUA 1DAOA 3ESQA 4JS0A 1NXPA 1MX5A 2X14A 4RQAA 5EWLA 4KO3S 4YS6A 4EKIA 4EYOA 1U1FA 2R62A 3FNIA 3R74A 3ZE6A 1B0AA 1M1YA 3KUKA 3U0BA 2O7NA 3M70A 4KYIB 3CNHA 1NQAO 1XUOA 2CCJA 1ZHHA 5KJEA 3LCJA 2FR8C 2BBOA 4MTLA 1OH8A 1P9LA 4IHKA 3LRPA 4EHLA 4XR9A 1KHHA 3ITEA 1DBPA 5JUWA 1DT3A 3OLYA 2PTHA 2FZEA 4ZAXA 5EI5A 3HDTA 3INRA 5JOQA 1KYTA 1JS1X 5FLKA 2G1AA 5EJEA 2I80A 1IDN1 5AYVA 3H18A 1Z9BA 1MB0A 1ZOLA 2LW7A 1TC2A 2RIPA 2VH1A 3L0BA 2HIGA 3N2YA 4YECA 1X8JA 1FDRA 4YCBA 5KYTA 4GLBA 1OLSA 1KY4A 2J3JA 1I3MA 1N5MA 3D4LA 2ZQYA 1UOEA 2BFNA 4JSYA 4S1WA 5KCMA 1MPTA 3RHFA 4EGQA 4N48A 2DTEA 3O26A 1F2UB 4FFPA 2Z1MA 4FU0A 3NDRA 1DPGA 1LBIA 4IGFA 4BLRA 4F3RA 3UAXA 4LJKA 3SIPA 4P4NA 1CUGA 2CVOA 1S8AA 4LDPA 4D8VA 1I94B 5CG2A 1LUAA 1IDOA 2O7SA 5DBFA 2G9ZA 4DV2B 2C78A 1HF3A 1ITZA 2WA2A 5AHKA 3HA5A 5G41A 5B3LA 4Q1CA 2G7MC 2Z3ZA 2HF8A 2RE8A 2CK3D 3UMGA 5IVHA 4IG4A 4E5MA 5BYAA 1DIBA 1SBIA 2ZRHA 3ELUA 3LT1A 2BGLA 2UUOA 3K05A 4KXYA 4WFQA 3UJCA 4RHFA 5E4JA 2NZ8A 1V9CA 1XXLA 3HGTA 2XVYA 4F5YA 5HE8A 1GA1A 3O5AA 3A9TA 2EKQA 2OKCA 4H3VA 4RTJA 1WWKA 3N7AA 2NTJA 1JLMA 3WKBA 3KOZA 1UZAA 4DV7B 5H83A 4ZT3A 1P5ZB 1EESA 1Q7CA 5I4IA 5JO0A 3QF7A 4MRRA 3F46A 1N5RA 3KJFA 3A4IA 5ALXA 1TB4A 3C3JA 1OLOA 5H5JA 3RBZA 3SC6A 4K9OA 5K0GA 3PEYA 4QDZA 3RYHA 1G8KA 2AG1A 1W5SA 2NZVG 3HKEB 4IOLA 1Q7RA 1MG5A 4UU1A 1H8EA 2CXTA 4P0TA 4HEA1 3QBVA 3TW0A 2OGWA 2QTVB 4BQPA 5GONB 1QZZA 4PLTA 2FDXA 2RGNC 3L04A 4YI5A 1YULA 4KXWA 3VU9B 5KNCA 2IYOA 5DYYA 5FBZA 4P3KA 5BVHA 2P9TA 1LH0A 1KO7A 1QR6A 2CMDA 1KAGA 2VG8A 1WHTA 2NTNA 4B09A 4E21A 5JDIC 2IS1A 3LUPA 3Q3IA 3IQGX 4GOMD 3A3KA 4WFKA 3VR4D 3MS2A 3EXFA 3LC1O 1D3AA 2EKPA 1Z2OX 4TPKA 4QUEA 3M4YA 5ECDA 3UJ6A 3ZH9B 2VKTA 4ACBA 1JTEA 5THQA 1V26A 4NZMA 1DLIA 2SCUA 2XOEA 1VHTA 2I4LA 4OXNA 2NUTA 1E0AA 1HI9A 4IFBA 5F1YA 5D00A 3KFXA 1HV8A 3MB5A 5DM2A 2PXCA 1PJBA 2Q49A 1G20A 1KGDA 1RAIA 2UUPA 1B43A 3O3CA 2CYAA 3AF2A 1ULHA 5BNTA 5D3QA 2GDZA 2I5PO 2FPIB 4P7FA 4WOJA 3T7JA 3NVKI 2QX9A 4LJ9A 2J3EA 2JLRA 1IUKA 3L93A 2F2TA 2KS6A 5DRTA 2QZSA 2UXBB 2QTCA 1BXGB 4H18A 3DNMA 4QOGA 3CF4G 1DAEA 1SAYA 3FWNA 1SD5A 2X58A 2OYSA 4G86A 2PZMA 3LBFA 4FYIA 5KWEA 2MR5A 4UBOA 4CR7A 4NNPA 1P75A 1DKUA 1IJFA 5IU6A 3HB4X 1XD2B 4PNHA 3HK2A 2AYZA 4GF5A 3MJFA 4TSKA 5D6NA 1NVVR 4MW1A 3W5UA 4XB2A 1DIHA 2BP7A 2VPIA 3MG9A 4L4YA 5EIBC 3WGYA 1EQAA 3TOSA 1WBBA 3QFTA 1MVOA 5AJXA 1IQUA 2APJA 2GBLA 2ZI4A 4XUEA 5DHPA 5A0VA 5JJ5A 4AJPA 2BEVB 2XKBA 3SZUA 2YRWA 1DTWB 2QRUA 3KLBA 4C6TB 2WHXA 3E0XA 2CDCA 4IVPA 3GRKA 3H84A 4CCSA 5IUJC 3L7MA 2PX0A 1RAFA 1RCUA 1GKYA 2XDWA 4EBFA 1HZZC 1K4YA 4HQKA 2ZWOA 4TM7A 1N2ZA 2BFEA 2YFYA 3EVEA 4CIXA 4NOLA 3QX3A 2GPTA 1D9XA 1OI4A 1SXIA 1C7JA 2VT2A 2WT8A 3PPYA 2GO1A 5L7YA 4AU1A 1WXWA 3BMOB 2FSHA 3C8MA 3SXPA 2BKEA 1R8QA 3LXMA 2XMGA 5YASA 1NQUA 4MDHA 1QV9A 1QTQA 2HT1A 2J3LA 2GJAA 1EG2A 5IDXA 3BK2A 3HPRA 5T64A 1AKRA 1ULBA 2JAXA 1DEAA 1WCXA 5GM2A 4YAUA 3GRFA 2QUHA 1AKEA 3QXSA 4H0FA 1LC0A 1C7IA 1VKJA 2A7XA 1O94A 2D7CA 2Z9DA 1KP2A 1YUMA 4PLWA 4RA9A 2HF2A 4WBNF 5IHXA 1QYVA 1Q7TA 1T6ZA 2V4UA 3OFND 3TD9A 3EVNA 3H2IA 4HDAA 2GTPA 4ND8A 4X90A 4A0RA 1E8MA 5CEJA 1PW5A 1O08A 2G09A 2PFGA 3OT1A 4ZI2A 3RB8A 2H2WA 3FZEA 2A9JA 2G3YA 1XRPA 2AZ4A 3W5SA 3CZ4A 5HIMA 2XYVA 3S8YA 4E33A 2OO5A 5AP9A 4BTLA 2O8CA 4O4HA 4P54A 4P31A 3HVUA 2Q4DA 2B78A 2RI6A 2C57A 1T4CA 3COPA 1CRPA 1DAIA 1WCV1 3GEMA 4X3CA 2IWHA 3VUEA 5HILA 3KPVA 1U3WA 3E9MA 4XR4A 1ZD2P 4YMIA 3VHRA 2J33A 4L3OA 4LHZA 5JEDA 3ADBA 1BA2A 3I42A 3LA6A 4LUCA 4MIKA 5TPWB 3ZZNA 4DV4B 3SC4A 2B8JA 3TXXA 4OX9B 4FCTA 5HWSA 5FF9A 1JB1A 3PA6A 3G0IA 3JY6A 3UAOA 4EY8A 4UOZA 5L7WA 4JVMA 3CX8A 3GEHA 1OU0A 1VIDA 1BW9B 4EA6A 4OL0A 2I4NA 4YJGA 1BE8A 2F8MA 4YLEA 5MF6A 2XZLA 1MQ8B 2X8JB 1W8DA 2XITA 3BFJA 1ZD1A 4ZP1A 2MDTA 1JG3A 3B6IA 2WWVD 4ZTUB 2W6JA 4DIKA 3AP2A 3RTGA 1PK9A 5HJ2A 1IY8A 1QDUA 4D8TA 5E1OA 5L51A 8ATCA 3RJTA 3A06A 4C14A 1D4AA 5A62A 1Q19A 3CF0A 5D5HA 1SGWA 4BV2A 4QDOA 4D0SA 5EYPB 3T3DA 4GOKA 4ALMA 1X0VA 4WY5A 4XTCS 4QZVA 5ANRB 2XTJA 5K4HA 4LFAB 1WQ4A 2P9QA 3GFRA 4NDNE 5JSKA 4CT4B 4F4DA 4EPVA 4LVCA 3KCQA 2HA4A 2F55A 2HGZA 3KB2A 3DBHA 4CTJA 3TIGA 5GONF 4WZ6A 4DLWA 4GNKA 4K86A 3RQIA 4I4TA 3K92A 4LWPA 2Z2KA 2IU6A 3GRYA 5KKCA 5BN5A 1AT1A 3IAS1 3AFOA 3LJKA 2J9XB 4DQKA 3EIEA 1EFAA 3LLMA 2R6AA 4Q01A 1P2VA 5F33A 1BA3A 1YJ8A 3G2MA 4G63A 2VSNA 3F2VA 3S8MA 5T6BA 2EKDA 1UF9A 4WLVA 4A6PA 4JUCA 1I2DA 1GZ5A 1VXOA 2YXLA 3EWNA 3HY6A 4V0ME 1YZ3A 1V3QE 3N2NA 5EAIA 4MUGA 4U0KA 5KYXB 1LDNA 3W1WA 1GG5A 1JI3A 1NUQA 4DA8A 4G8JA 1ZCZA 1GTMA 2PZEA 4K9RA 4X20A 4RNCA 2FSPA 5KPDA 4QM7A 3V5NA 2GHRA 3DTVA 1ZI8A 2WF7A 3N8DA 5BO5A 1QMPA 2PT5A 2Q7XA 2NX2A 1SWWA 1XYGA 4ZI7A 1AUXA 1WDMA 4DY6A 4IKOA 5FOWA 4DIOA 3JAMA 2BTEA 1FUYB 4A15A 2ZUUA 2JCYA 3KKEA 2D2FA 1GPLA 2ZG6A 1GUBA 4K6OA 1MFPA 4ZO4A 3VSDA 5K8CA 4OJYA 2GN4A 4BIIA 4NMWA 4EG4A 2IY8A 5L8VA 5AVYA 3K5HA 1DG9A 1G4HA 1Z2CA 4WNAA 3ZVLA 2XRFA 1E6MA 1V1RB 1H2AS 4G84A 1CR0A 3KTAB 2A1UB 2BF7A 3I52A 4EPTA 1BSVA 1QIIA 2QM7A 2A84A 3VNBA 2JGLA 1DRKA 3N0WA 2QRVA 2PGAA 4WLFA 5CH8A 3EISA 3B9BA 3DL0A 4WPGA 3U3OA 3QXGA 5K20A 2VDPB 2HRZA 4RAQA 5JS8A 2WD7A 1UM9B 3MPOA 3UMBA 2O3TA 4WECA 1YDFA 1US8A 3KHTA 2L19A 4LFBB 4GQIA 4XYBA 2QQEA 3ANTA 4N5MA 5DCYA 1Z4NA 1ECGA 3NUQA 3ESRA 3HB7A 4ALKA 2J7PA 1C1HA 1NG9A 1J2EA 5G1NA 5COBA 1RCTE 4WNIA 3E1SA 4BFVA 1W47A 2F48A 4MI9A 1VE3A 2J41A 3O93A 4NENB 4W7SA 4F9TA 1LK0A 2PL9A 3GN1A 1EFHA 2QDXA 2SBTA 3KQTA 4UTXA 2JCXA 3VISA 4I9UA 3U56A 2ZETA 3BIXA 5TLSA 1R12A 1S4MA 1JU4A 4ESOA 1JDJA 3OY7A 1ZVMA 1FPQA 2HLPA 2ODWA 4Y2RA 2Z6QA 2FPIA 2GSWA 1OWLA 4LXTA 1RRKA 2OHHA 3PC8C 4MUXA 2Y2UA 1NN0A 4LRUA 2H5LA 1FFYA 2V97A 3K5PA 3DDZX 2W6MA 1QAOA 2IEGA 2EGGA 4M38A 1H2RS 5JNVA 5MGBA 4D26A 5AO9A 1TF5A 1BDHA 3E9QA 3L9XA 4ZQEA 1L4FA 1U3TA 3GW8A 4LRYA 4ZYZA 1N2IA 5ITSA 1MO2A 2BGGA 2WWXA 3N3AC 4D3XA 1CT9A 1U31A 4YP6A 1KYZA 3AHJA 3WIDA 4KW7A 4M9RA 5K3CA 3E22A 1G5TA 4LTDA 2Q3JA 2QP4A 2V3CC 1SD1A 3KE9A 3ZDRA 1IN8A 2I1VB 2Y1GA 4WY2A 5DF1A 1C7RA 4MV6A 4I4LA 3ZDYB 5LNK1 1CUSA 3PNYA 3WZMA 2IZ0A 3WRYA 1IPFA 3M4ZA 3PT9A 3ZY6A 1R4MB 1Y5IA 2WPDA 1N75A 2FGJA 5ECYA 3AHHA 1KJZA 2CBZA 4HAIA 3AJRA 4V24A 3DOOA 5A9SA 2GPBA 2IYZA 4RH1A 5P8WA 4HEHA 1YASA 1Z56C 2NWQA 4I9HA 1X86B 1NVWQ 4MIOA 4EFLA 5JZVA 2JIZA 2NPIA 4NARA 4IWXA 3MUNA 3T9DA 1R15A 1NOKA 1OW3B 1XKTA 1GPUA 2P90A 3LT0A 1R6TA 5B1EA 5BV1A 2F7SA 3VVLA 4PZUA 2VYND 2C3MA 3P26A 4TLLB 4RPHA 5CFQA 5GTDA 3MWEB 4PYNA 2B0CA 2FFJA 1MKYA 3KEGA 1LI7A 1PFUA 5GGXA 3T0FA 3HVKA 2ODPA 2CCKA 3N07A 3H0CA 2EDAA 3RHSA 3CLUC 3ICOA 3T7IA 5K0CA 2HEGA 5BURA 2CZQA 1XVAA 1ONSA 3I92A 4JENA 3TBHA 1JSZA 1EE2A 1X94A 3K1AB 3LTEA 3TCNA 3EVDA 5H8WA 4P0PB 1EZ1A 4HDCA 1ETHA 3E9CA 1SG9A 3CIOA 4PHTA 5AVZA 2FR1A 2YXDA 2XWSA 4Q66C 2HJWA 1SXQA 4LRWA 4X1OA 1EUZA 1NE2A 2V7QA 1GAXA 3I6BA 2ZPTX 4XYMA 1WDWB 13PKA 1TD9A 3AF4A 4X7RA 2VO1A 3R7DA 4PN7A 1ZD5A 3X1MA 4L02A 2J5QA 3AUJB 1P1HA 5AM4A 2H1LA 3HH8A 4GE3A 1UKCA 4A26A 1RJ9B 3A3NA 1DL5A 5JTTA 1D6MA 2ZU6A 4U02A 4K87A 1LDMA 3QMVA 4H7PA 1VZ2A 2B4KA 2CXXA 2W83A 3HKDB 3R76A 1T8YA 3M3PA 3OZSA 1Z0DA 3Q15C 4GPZA 5FNVF 1HE5A 1T2FA 1DWPA 4QBTA 3U9SA 1RQPA 4FKMA 4TKVA 1ZW1A 2J5XA 3P0EA 1DV2A 2CLEB 3L4EA 3U2QA 1OE0A 2C1ZA 4PLHA 1D04A 3CXUA 5LYJA 1IY0A 3EPJA 1QDEA 3T3OA 5I3ZA 1FJXA 3GLGB 3VZSA 4E13A 1PJTA 1AKUA 5IDYA 1GNLA 1FTQA 2AE2A 2VHXA 4R41A 2O4CA 1GPNA 1DCMA 5ENZA 1SVWA 3TCKA 1P4GA 1XNQB 3RJMA 4XGRA 4AKHA 3N3BC 4TWJA 2C4TA 3GA5A 5H4HA 3V4OA 1KO4A 1R7RA 4RK4A 1V1JA 3N6VA 3WAKA 2X42A 3FRJA 4TMTA 1UFRA 1H23A 2XYQA 1ORWA 5F7ZA 1BHJA 1IJKA 3JVVA 3ZXIA 1J5EB 3HU1A 4P84A 3LE8A 4YLYA 3NOVA 3MOSA 5ES4B 4RH0A 5JCJD 1GQRA 2ZSJA 3ODPA 3G68A 3RARA 1QRSA 1JAXA 1N2SA 2ZJ8A 1IY9A 1D6JA 2ZR9A 4MQ6A 3PLRA 1NV9A 2O8NA 3E84A 3GLHA 3KVRA 2NSYA 3D7NA 3LYLA 3WLQA 2AXPA 1NQ5A 1FU7A 1O97D 4QO8A 1TADA 3O7MA 4I55B 4G01B 4EVRA 1V37A 1WM1A 3OE4A 1JIQA 2Z5VA 7GPBA 3D2LA 2QQ5A 2JK0A 3F9CA 3MSCA 1B1AA 3GGGA 2P6PA 3G0DA 1YRBA 2DUNA 4F93B 2G71A 2AN5A 3QG5A 3MTQA 4JOQA 1JLKA 3E9YA 4MVJE 4RD3A 1W96A 3OCVA 5EUCA 2GCPA 4OD0A 3M2TA 1NR5A 2VLBA 5DW3A 4A03A 3NJRA 3ETJA 1X1EA 4HGQA 4RVGA 2OHVA 2V1UA 5KYXA 3O1LA 1U5CA 3G2PA 3QEKA 4RM3A 3ZGNA 4J0KA 5M34A 1A5TA 2COEA 4DILA 2CLMB 4R81A 3VOTA 4K1XA 2HRQA 1EX7A 2R3SA 1NJ2A 5BMVB 1T5IA 2WINI 1T91A 1OREA 7MDHA 4RVCA 1DWOA 4UFPA 1Z7WA 3PXEA 3CE9A 3ORFA 2QWXA 3RAFC 4PO9A 4DTIA 2IU0A 3NEPX 4D8UA 1MA3A 4GKKB 1YQGA 2XSZA 1M2GA 1O6BA 3A70A 3KZKA 1A9PA 1U8UA 5B58T 1QIHA 3HCAA 4XFJA 3ELDA 3V8PA 4J9UE 5HZMA 4D6YA 8MHTA 5ALEA 1Y3IA 3ASUA 3M6IA 3R3ZA 2BL4A 3AINA 2W6NA 4LA4A 1YQTA 5AR1A 3WNVA 1TCCA 3UGKA 1G9TA 4J4TA 5FOQA 2F90A 3CX3A 1CTQA 3FGOA 4MS4A 3CLTD 4IXWA 1NHGA 1BXZA 2O5VA 2PMWB 4CVNA 4OLFA 1PV4A 4AI6A 1NF8A 2ZSBA 3F6CA 1NJSA 5B1DA 5TE9A 2WJVA 1BE0A 3G88A 2R1TB 1G3UA 4WKBA 1D0VA 5ALVA 1BWSA 4W1SA 3D8HA 1AC5A 1W4BA 4ZVSA 4FP9A 2EBFX 3EIHA 1EFVB 3IPXA 1L1EA 3T3GA 4TM8A 3ODGA 5JS1A 4IM7A 3WV5A 1SVUA 1II9A 2C5FA 1WQ3A 1WMDA 4U0JA 4A7PA 2GK3A 3MVEA 1Z7BA 1FFGA 3GRZA 3I9NA 4DHWA 1DJMA 4RK6A 4P08A 1OX4B 1UKYA 2WFLA 1XVUA 3LUAA 5AJVB 4B4WA 4EABA 3H2YA 3PPVA 3JQ7A 4YWHA 1XTPA 4JWKA 4RK5A 5DK6A 3ILVA 5DULA 4TYWA 1YZHA 5BRNA 4DDMA 3BRWA 4RSRA 4HXEB 4ZARA 4OI1A 3V1LA 2HI0A 4XGIA 3I8OA 3QY9A 1CY0A 1L8LA 3EDRA 3OPVA 4JQZA 5TGTA 1SELA 2ACVA 3LHIA 2NUPA 5CH3A 4B2YA 1YB2A 1E0JA 4FK8A 2P4EA 2VQSA 1HUQA 5WRFA 4BJ1A 4UQLA 4LMRA 1OBCA 1EM6A 3TNDA 1OBFO 5HUJA 3L01A 5K7SA 5A1JA 4TUYA 4IGAA 3I5UA 4GICA 2FK7A 1VCIA 2GETA 2E4YA 3R44A 4MKRA 2PT6A 2XADA 3KR2A 5DT2A 1CJSA 3F98A 4KIUA 2VHJA 4BNUA 2QG9A 1MPXA 4MP6A 1N77A 3HYNA 4Y6LA 1NN1A 2QJOA 4CEHA 4F8EA 5IFLA 5E6RA 3WWYA 5IJ9B 2HLDA 3GWZA 1IB0A 1TA0A 2YOHA 4LRSB 1XZDA 3HYLA 5AW3A 4KNWA 3TK1A 3H7AA 4FYPA 4MVJP 4EYEA 3NWJA 4AN4A 1KY2A 3GFTA 4WN9B 4P4UA 5FTKA 4JI3B 2V5VA 1UANA 3HMKA 1ZJ6A 1JU9A 3TLEA 1WZNA 4XQEA 4JI2B 3FCEA 1YIAA 1CZKA 1FVOA 5CDYA 5IT5A 4WZAB 2CVHA 1OFIA 2G04A 3M81A 3USES 3D1VA 2G40A 1A27A 1U3DA 1KSFX 5DHSA 1XMSA 4U7WA 3R7LA 4R7TA 4FGZA 3L46A 1NLUA 4L0CA 4RS3A 4R71A 1M83A 3KD3A 3T9CA 1L7OA 2WIKA 3W6NA 1ZAYA 2GYYA 3BIFA 4IDGA 4LJAA 2LKCA 2VTKA 2O1SA 5GM1A 4DOMA 1JFTA 3D02A 3GF4A 1BS1A 4CR8A 1SXJE 1RXVA 1Z15A 2M6SA 5IBRA 4E6PA 1NR7A 1ADCA 3TG8A 2H06A 2ZSDA 4TSRA 3EFOA 1TMOA 4YQZA 1Y81A 4TRMA 4AECA 3TQQA 3BJZA 2OLJA 2C7PA 1DADA 2YQZA 1A72A 2QW1A 3KYDA 4GAEA 4MZDA 2NPFA 3LVBA 4LW8A 4O4LA 2FFQA 2Q46A 1NI5A 1U7ZA 5KNCH 2IZZA 5J40A 2CNDA 1A50B 1EWTA 1IE3A 1KJIA 1TQ4A 1JWAB 1Z7YA 1KIAA 2IBMA 2KI5A 2R66A 2XCOA 5TQ2B 3TGPA 3WS7A 5BWBA 1KQOA 3R6LA 2EG5A 5E0OA 1Z6QA 1CXZA 1X13A 2C4WA 4L5YA 1QIJA 2I3BA 2I4MA 2QLNA 1JF8A 2R97A 4U6SA 5JMWA 3GJZA 5D86A 2Q0XA 2R7KA 4BE7B 3QX9A 3GGOA 4K6FA 2W2XA 5EEGA 3ENQA 4M8KA 4G5XA 5EUQB 1GFWA 1ISFA 1BDBA 3FFAA 2HSZA 1L6IA 4UBMA 4HT3B 1D1TA 2FMIA 2ZUDA 5FUBA 5K0TA 3LSTA 2IW1A 2OUKA 4RFSA 4OM8A 1LB1B 4MLDA 5DO9A 5H4GA 3DH0A 4NABA 4JHXA 1FXWA 2Z5LA 1IXRC 3KZ1E 5FWDA 4DZZA 3RJ9A 5HJEA 3R23A 1TJPB 1V3VA 4DN6A 4RESA 3GRVA 1GQFA 4QEZA 4KUGA 4EUHA 4LF7B 4KQEA 4L9SA 3ZTWA 1W0KD 1ODLA 3VKHA 5J5CA 1DUIA 4WKGA 4ZHQB 1XEXA 4Q82A 1BN6A 4KBYA 4QYIA 3AGPA 3JQPA 4CKWB 1B15A 1OASA 1WB4A 3AF0A 3K1ZA 4Z4HA 3WMGA 1DUSA 2W6OA 2ZI7A 1XQYA 1V4BA 4IMPA 3SBXA 4BU0A 3GNQA 1N3YA 1NPYA 3PICA 5C35A 5I7WA 3OCJA 1V11B 3SX2A 4PVCA 3T7TA 3TGWA 4V38A 4YJHA 2DBQA 1TRKA 3GCGA 1VLVA 3GUZA 1X7ZB 2PYIA 3WHLA 2VDMB 3FW1A 3QNMA 2JLBA 4EITA 2PCJA 2REQB 4V1CB 2J0EA 1GRRA 1MV5A 4B2IA 1L7NA 3COWA 5FWAA 1JBKA 4CG3A 2N46A 4WINA 5C4IA 4P33A 1ZHOA 1E2JA 2WMOB 3C2QA 3OD1A 3AUXA 4EPYA 1B8PA 4M7OA 4PVDA 3EQ8A 3OH8A 4YO8A 3E2IA 5DM60 4KQIA 1HXHA 1KSJA 1BG6A 1PKEA 1NC1A 5DM0A 5FXMA 3MMSA 1MJ5A 2WHPA 1COZA 4YR7A 2V54A 2GCIA 1XPRA 4ZQCB 2VA8A 4WA8A 3SKYA 1RRVA 1XZKA 2RGCA 4GP7A 4AZ0B 3EOAI 5K3SA 4YT5A 2C61A 4C7VA 3OWHA 1OFUA 2HCFA 1T2DA 2K87A 5IFKA 2LTAA 4JLVA 1TLTA 1XHLA 2H65A 1X2EA 3OCXA 5HFNA 2HHCA 2AJ8A 3I04M 3K7EA 2H1IA 4JL6A 3F7MA 3ILYA 3C3EA 1KTVA 1IHOA 4MYTA 1M1UA 4PS0A 1R9JA 1X92A 2F3UA 4GOJA 4KLNA 2XECA 4Y9RA 2FN4A 2C84A 2FQ1A 1KR5A 2XW6A 4IXTA 3TQTA 3TXAA 1E6UA 1X0XA 2BEUB 3EXEB 3IAAA 3NXSA 4I99A 4L15A 5KVQA 1QX4A 1ZINA 2VUSA 3HFGA 4B76A 1J2TA 1MNQA 3BDVA 3DYBA 2GTIA 3BMCB 3FMFA 4A5OA 2GD6A 4F3NA 4JLNA 1ZBQA 2J3KA 4JUAA 3WLHA 1QQ6A 5CYPA 1VJCA 3URKA 3VOAA 3E4DA 1N3IA 4M1ZA 1WCWA 4YLGA 5DHAA 3G6WA 1E6LA 4F3KA 3RUIA 3FYUA 1QGDA 2BGNA 3E0QA 4IILA 4L6AA 4B3CA 4Q1DA 1XO1A 4DLRA 4Z54A 1C30B 1K3TA 1G0NA 5JSUA 4R4JA 1RS0A 3UANA 4CN9A 3F97A 4X1KB 4DJTA 4KEAA 1ZIYA 2CXQA 1DC3A 2GNAA 2C4KA 2IPOA 1SCUB 3ZHSA 5JCPA 4CHGA 1REQA 3K70C 1K9VF 1RE1A 5F77A 1EFVA 2PYDA 4FDUA 2OM6A 3F8WA 5MN6A 4YCMA 5M2QA 5FT9A 1PHPA 2WYUA 1M1NB 1GG2A 621PA 3U1VA 2O2HA 3UH0A 3SIWA 3FLAA 3FDXA 3LY8A 4NE9A 3UZUA 1ZJ5A 4BB5A