2G1UA

Crystal structure of a putative transport protein (tm1088a) from thermotoga maritima at 1.50 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
137
structure length
137
Chain Sequence
b'KQKSKYIVIFGCGRLGSLIANLASSSGHSVVVVDKNEYAFHRLNSEFSGFTVVGDAAEFETLKECGMEKADMVFAFTNDDSTNFFISMNARYMFNVENVIARVYDPEKIKIFEENGIKTICPAVLMIEKVKEFIIGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein tm1088a
publication title Crystal structure of (tm1088a) from THERMOTOGA MARITIMA at 1.50 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 49
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2g1uA00
2XXBA 4AJHA 4NBWA 1UXJA 4BO0A 4CLDA 3RU9A 3HE3A 3NTQA 1MB4A 1E1MA 5JE8A 1HDOA 1AN9A 1ZKMA 1NWCA 3B6ZA 1WP4A 2OP1A 4JROA 1I3KA 3HADA 1UAGA 3JQAA 4P22A 3KYDB 3K31A 2PA3A 1R6DA 4RZHA 1SMKA 5IN4A 4PGFA 3NDIA 1X1TA 7ADHA 5C5IA 4X54A 5I8WA 5JBIA 1SOVA 2NTNA 3SXPA 5MDHA 2BD0A 1XU9A 1RWBA 4IBOA 5IAAA 2G5CA 4YT8A 2GZ1A 1D8AA 1E3JA 2E4AA 2JHFA 3DQPA 4HX5A 1H9BA 3WGOA 1HRDA 1J6UA 3GH3A 5DBGA 4YB8A 5ADHA 4RPGA 1P1RA 4W9NC 1AUPA 1H94A 2HK7A 1I33A 2V65A 4RQTA 1MV8A 3RC9A 3WGQA 4NBVA 4DQXA 2EW2A 2WWRA 3ZWBA 1TB4A 3W4JA 3VZPA 2HAEA 4ALIA 3UW3A 4FC7A 5BSHA 3GR6A 4O59O 1CWUA 1LDMA 3SLGA 2QRJA 2XF8A 3RQSA 3MEQA 3FRJA 5JDCA 3PRJA 4RF2A 4LRTB 3DMYA 4HNHA 1D1SA 2AE1A 1I0ZA 1XHLA 3CE6A 3PWKA 4L76A 5THQA 3WTCA 2C20A 4YRBA 1YVEI 1YB1A 2PH3A 2WM3A 4P4GA 4ND4A 3MJEA 1QMGA 4LGVA 1GEEA 1DJQA 2BKAA 3ULKA 3RUFA 3E82A 3F9IA 2BFPA 4E21A 4MPDA 4WE3A 4KP7A 1VJ1A 3F3SA 1AXEA 1ISIA 1ZK4A 2I6TA 4E3ZA 5T8KC 2W2LA 2O3UA 2W4QA 2RHRA 4I9NA 3Q11A 4MVJH 3VDQA 3TJRA 2VZ8A 4MVJD 1U2DA 3JQBA 3JQDA 4XGIA 2HMSA 5I8ZA 3OEWA 3H9EO 4XA8A 2GN9A 3KSUA 1NNUA 3GNSA 1P77A 3OIFA 2GGSA 1GCUA 3OM9A 2HDHA 5A9TA 2NTVA 3K2BA 3IP3A 1MC5A 2EP5A 1WPQA 3IKVA 2PD4A 5G0TA 3L6EA 1LDEA 1E7RA 2Z95A 3ZW8A 1WW8A 9LDBA 2X5KO 3L4BA 1J5PA 4BNLA 3I83A 1JA9A 2OP0A 5CHEA 1EK6A 3O4RA 3TNLA 1UH5A 1YL6A 1CEQA 5B1YA 3KTDA 5I9LA 3C8MA 2DT5A 3BHJA 1B3BA 1EFKA 3IP1A 2B37A 6LDHA 4HXYA 1EZ4A 1PL6A 2YUTA 4L4SA 1OZAA 2PTGA 4RF5A 1PJQA 3I4CA 3JQEA 2X0RA 4YT4A 5DULA 4LVUA 4Q3NA 4GLLA 2FRDA 3ITDA 1VJTA 2D3TA 4CODB 4JBGA 1EDOA 3NEPX 4E33A 3PP8A 1XU7A 3X2EA 3WFIA 3GK3A 3WGTA 3KHUA 3AU9A 1LDGA 5A5FA 1O9BA 1PSDA 4ONEA 2B69A 1DOHA 1F17A 1K2WA 1VE9A 2WYVA 1DO8A 3FWNA 5C7LO 2C5EA 3AW9A 1BXZA 3JQFA 3KLMX 4D42A 2HK9A 1MX3A 4A7PA 3CINA 5F5LA 3UAGA 4R3NA 1SAYA 2B0JA 1V35A 2G76A 1IHYA 2JL1A 3NYWA 3GAFA 3GF4A 3ZV6A 3D7LA 4PCVA 4TMFA 4WK6A 1KC1A 4MKZA 3ZWWA 2O3QA 2OORA 5DNAA 5G0SA 2B4QA 3JQ9C 4L4RA 4CUZA 4EI2A 3AM3A 4E6PA 4BKPA 4DYVA 4DA9A 2DTDA 4BO3A 2J8ZA 3PIIA 4I5FA 5IDYA 4QUKA 4MO2A 4O5OA 5TQVA 5KVVA 1LBEA 4E5YA 3E03A 2BF7A 4MVJE 3GT0A 2DM6A 2D5AA 2Q2WA 4CLOA 1T2DA 3IMFA 5TIIA 1ENZA 4IGFA 1DC5A 2Y67A 2F1KA 1E3SA 4JLWA 3WYBA 4BNKA 4PRKA 1DC6A 4J91A 2AEFA 4N5MA 2FR8A 4R01A 3JQ8A 2V6GA 4J16A 2VTEA 1BRMA 4RPJA 3ZI0A 5CDYA 3GG2A 2HKIA 5JAQA 3AUSA 2F00A 2NWQA 3LQFA 3D64A 3DOCA 3NDRA 4FW8A 4B3HA 2ZTVA 2JD0A 4GX1A 4J1SA 3GZ4A 3ONEA 8LDHA 1SEPA 4IDEA 5CPBA 3PJGA 5JYEA 4FGWA 4E0BA 1DC3A 2DUWA 1GDHA 3RUCA 3RC2A 1ONOA 2J6IA 4MKRA 4A0SA 1XWFA 3V1YA 4L75A 4L4XA 1JVBA 4K6FA 5FEUA 3CXRA 3UH1A 4GSLA 5EN4A 4FJ2A 3UCXA 2B36A 5L4LA 3KB6A 2P5UA 3VTZA 4ZHSA 3UOGA 4IJKA 3RVDA 3GEGA 3AY3A 3I6IA 4ZQFA 4FFRA 2IODA 3AY6A 1OFGA 4KWIA 1TT5B 1XEAA 4JQCA 5TF4A 3WS7A 4A26A 3MOIA 4BNNA 2VWPA 4WOKA 3B1KA 1E7SA 2EWMA 2C2XA 3M6IA 2I67A 2ZTUA 3GVXA 3CKYA 2DFDA 5EQDA 4L0QA 4M49A 1P1FA 4AL4A 1C1XA 1QYXA 2X23A 4XGKA 1UP7A 4O6VA 3ROQA 4YRDA 4CQMD 1AGNA 3KSZO 3JQGB 3GVHA 4NFYA 1ZK2A 2GCGA 2VT3A 2OHXA 3NTRA 1PS0A 1PR9A 4BGIA 2ZATA 3WYCA 1WWKA 2GDZA 1NWHA 2VHYA 4B79A 1UDCA 3ZV4A 2NV6A 3KYCA 5JMWA 5B4UA 4XRGA 1D4FA 5HRUA 4BQRA 1ENPA 1ZMOA 2NVBA 1DLIA 4WLUA 3DAGA 4PZCA 4RJTA 3G0OA 4RL6A 1RYDA 2YHIA 4IXTA 5JS6A 1Y8QB 1NFFA 4YJGB 4TRNA 1DHTA 4FS3A 4JJIA 2Q46A 4DIBA 1M75A 1PJSA 4BHTA 2HSDA 1XELA 4U6QA 4CM7A 1ISMA 4JN6B 3LT2A 1SZJG 3OP4A 4OIMA 1U2GA 4CMBA 4E5KA 1WDKA 4QSMA 1X7GA 2Y66A 2X9NA 2OBYA 2PGJA 2EJWA 1GADO 3EYWA 1BDBA 5MGBA 2X1HA 3FNFA 4LW8A 4Q3EA 4MJLA 3D3EA 1ZMTA 2GZ3A 2YJZA 5L95A 3GEMA 5FWNA 3EMKA 2HO5A 3VDRA 1PX0A 1KETA 2Q4EA 4AFNA 4Y8VA 1E3IA 3JQAB 4BNFA 2UYYA 1V8BA 4WEOA 5KJ6A 2VOEA 3H3FA 3GQVA 5BSFA 4XJTA 4WECA 4FOOA 4HP8A 2P4HX 1HEUA 3IJRA 4GKBA 5I7VA 1E77A 3DMTA 3RASA 4TWRA 2PD3A 4NMHA 3PWZA 3V1TC 4OXYA 1P45A 1DAOA 4E31A 3E8XA 2HMWA 3ZWOA 5F21A 1XDWA 3QJ5A 5DBFA 1KS9A 1SPXA 3Q0EA 4FFOA 1ZW1A 3KYDA 1V0JA 1V6AA 3U9LA 4IUYA 3WOHA 1LSSA 2OXIA 1AE1A 3LU1A 4QEDA 3GNQA 5T5QA 3NTOA 5G4KA 5KJ1A 3PHLA 4QECA 3RCBA 4RCVA 2QRKA 3EY4A 2P5YA 3RU7A 1PZFA 3V2GA 3GLQA 4DTIA 2P68A 1ONPA 1ZH8A 4ND2A 2VWGA 4CM5A 2FSVA 5CDSA 1N7HA 1SNYA 1DFGA 2X0JA 4ALLA 2W2KA 3DBHA 4L8VA 4YWJA 2GN8A 4FSHA 4R9SA 1KEUA 4FFMA 4EUEA 2Z5LA 3GN1A 3IUSA 1JDJA 3BYZA 1ZK0A 4D3FA 1K6XA 1E1KA 1M2WA 2C2YA 3A4VA 4ZQHA 1UJMA 3DL2A 3P2OA 1RKXA 4B4VA 1N9GB 4ZVVA 1KY5A 1RPNA 3B20A 3Q9UA 5BNIA 2DPHA 1XSEA 3H4VA 2XAAA 2YQ4A 3ZGYA 3RFTA 3EZLA 3EVTA 4IGEA 1G6KA 3F5QA 1K6JA 4GX5A 3WMXA 2YDXA 3RC7A 1HYEA 3JYPA 1QYVA 3BZUA 4B7UA 1FDWA 1PZHA 3KSDO 1E7YA 1Q0QA 1AXGA 2B5WA 1YBVA 3GDFA 2I66A 2EG9A 1K5HA 5TC4A 3WLEA 4FC6A 2NM0A 3U49A 3RAJA 1H5QA 5L7TA 4WGGA 3AOEC 4Z9XA 5I7SA 1I2CA 4KDFA 1NPYA 5CDTA 3EW7A 2NVUB 1GUYA 5L4NA 2ZK7A 3A06A 4B7CA 2IRWA 4B3IA 1HF3A 1EVYA 2PV7A 3I52A 4DXHA 3BTUA 5COQA 5G0WA 3INGA 3T7CA 1MP0A 2Y68A 1LDYA 1V3VA 1F0YA 4I5GA 1LSJA 3RJ5A 3SX2A 5HTOA 3AOGA 2PKQO 2J3KA 3FR7A 6ADHA 4BO9A 4RVGA 3SEFA 1KY4A 2DKNA 5BNFA 3OJOA 3GY0A 3ETGA 4I5EA 4XQGA 2G0TA 2Q45A 5LCXA 3JQ6A 3WLFA 3AK4A 1Z73A 3MJ4A 1QXSA 4GQAA 4QFDA 3E5RA 3AUUA 5TNXA 1KEWA 2IEBA 3INRA 3MWDB 5IDXA 5A1TA 3LYLA 1LC3A 4KQWA 3DFUA 3FBTA 3T4XA 3GHHA 1YGYA 2FOIA 3GOHA 1XA0A 2ZQZA 1ARZA 3S2FA 1Y81A 2GR9A 1PJCA 5A3JA 4LRSB 4IIUA 1LRJA 2IE0A 3AWDA 1JAXA 1VSUA 4J4HA 1JVSA 2ZYAA 3ZHYA 1BWSA 4XYEA 3AI1A 2C0CA 3UICA 1QV7A 1L1FA 1CDOA 4CMAA 2IXAA 3HDJA 4IPTA 3BHMA 2HMTA 3TSCA 3Q3CA 1C0KA 3KEQA 3H5AA 3JQ8B 5H82A 2LDXA 3K2EA 4UUPA 1PWZA 1P1IA 2EKLA 3T4EA 3FF4A 2VRBA 5KVCA 1VL6A 4FBGA 4BO1A 2EP7A 3QWAA 3ZV5A 3AI3A 3RFXA 4TRMA 4P38A 4PG4A 1LQTA 3CPSA 4KWHA 4A73A 1K6IA 4BIIA 3TZ6A 2VYNA 4TROA 4WCFC 4EUHA 1JWBB 1K89A 4GWGA 4DBVO 2ZQYA 3LT0A 3E9QA 3WBFA 5K0ZA 3QVSA 3EZYA 3PK0A 4JBHA 3L0DA 3JD3A 4CM9D 2X7HA 4S1VA 2PY6A 2WD8A 1ZXLA 3ASVA 5BQFA 2FR1A 4EJMA 4EBFA 4TZKA 1M66A 2FPIA 4F3YA 3RFVA 4OXNA 1NYTA 3QSGA 5DP1A 4DIFA 1HDGO 1PWXA 2DBQA 2AA3A 5DF1A 3ZWXA 5BSGA 1NR7A 4CLXA 3OIGA 3DOOA 4BO8A 5EPOA 4CM3A 4OM8A 1P9LA 4D46A 3A1NA 3TZKA 3ANMA 2A35A 3BXXA 3G17A 1NPDA 1GTMA 1IOLA 3O26A 4UVIA 1YOVB 4Q3DA 5DBIA 4BQPA 3DAPA 1LA2A 1H6BA 3KYCB 1GPDG 3E48A 4FOSA 4CV1A 1VPDA 2FP4A 1EQUA 4J9VA 3WB9A 3ZNQA 3TFOA 3PYXA 4ZQBA 4L74A 4K1LA 4WKGA 4BNXA 2J3HA 4XIYA 1JLLA 1IE3A 3W4IA 1UDBA 4HFMA 2C7VA 4BNMA 1DDOA 4ZU3A 4BO6A 4UEOA 4TKLA 4NBRA 1K0UA 3JQGA 3AJRA 4Y6PA 2O2YA 3V5NA 3KXDA 1DJNA 1EUCA 4O0LA 5B4VA 1ADGA 4NJOA 1X15A 1MFZA 3GVIA 3E6AA 1VC2A 3ZU2A 2OL4A 4IIVA 1Y7TA 4IS2A 2RBEA 1PS8A 1EFLA 2DU8A 3KETA 2IYPA 3PHHA 4LSWA 1NVMB 4LCEA 1Y8QA 3H3JA 3VVBA 4YJGA 1BXKA 1GD1O 3GDGA 4J1TA 1DRUA 2VRCD 4J9UE 4NR0A 5JFOA 1Z45A 3FNGA 3FR8A 4ND3A 3ZHBA 4D0SA 1IZ0A 1HKUA 2CF6A 1EVJA 1HYHA 1X0XA 3U0BA 5HWSA 1DIBA 4W9NA 3ZWVA 2X9GA 5HS4A 4J43A 4NU6A 3I4FA 1PEDA 2A9FA 3PIDA 4PN3A 1EK5A 3HZZA 3DDNA 2Z1NA 4RQUA 5IFLA 2VYVD 4Z0HO 1EUDA 3QWBA 4YAEA 1RM3A 4B4WA 3ZN2A 5L40A 5ICSA 5K6AC 2D4AA 4FFNA 4IS3A 4IDDA 4CL8A 4NDNE 3QQPA 1LSUA 3MZ0A 4MIYA 2BGMA 2AQ8A 3KRTA 2R00A 4L9RA 4MVJF 4DQUA 5THKA 2W8ZA 4FGSA 4H7PA 5G4KB 3DXFA 3UN1A 5COBA 1UR5A 3QV1A 5FI3A 3UGKA 3DTYA 2VUSA 4J2HA 2GPTA 3AFNA 4CM1A 2WMDA 4ZRMA 3MJCA 1PQUA 3H9JA 2CDCA 1WAMA 3OQ1A 1C14A 1HDYA 4AJNA 4YVFA 3HQ4O 3P7MA 1QR6A 2W2KB 3DBHB 4J7CA 1U4SA 1WMAA 2BFMA 2Y1FA 3EK2A 3F4BA 1LLUA 3ANNA 3JYNA 2ZYGA 3NDJA 4HFJA 4OQYA 3RKRA 4NFHA 3TPCA 2OZPA 1G0OA 4KDEA 4WJZA 4ZQEA 4E5NA 1HDCA 3I9KA 3OH8A 3PFFA 3K73O 2NTJA 3TWOA 1GQYA 5JCJA 1V3UA 1Z82A 1HDZA 2X58A 4AG3A 4UAGA 3I6QA 1FDSA 5A4DA 4B4UA 2BFAA 2E37A 3CEAA 4KZPA 4Q9NA 1KC3A 3TOZA 5JC8A 3U4DA 5AXAA 1BXGA 4GH5A 4H3VA 4OKIA 1J49A 1I8TA 2R2GA 1DRWA 4GBJA 1VKNA 1DB3A 3PJEA 1KIFA 1PR3A 1R0LA 2DQ4A 1KEPA 5L53A 1ONNA 4FN4A 3WGGA 4CMIA 4CMGA 1QKIA 3K30A 3LF1A 5EMHA 2OGUA 4JGBA 4QTZA 4YPOA 3M1LA 2ZB8A 1NQ5A 2PKRA 1U3UA 1VKOA 5C37A 1N9GA 1I30A 3I9JA 4E30A 1GUZA 4E5PA 1ENYA 2D8AA 4CM8B 5IZCC 1X13A 3QVOA 2GSDA 4M55A 5ITWA 4YBZA 4ROSA 3ASUA 1QYDA 4XZ3A 1ADCA 2W90A 3WNVA 4GGPA 4IMRA 2GN4A 1PZGA 4BNYA 2DC1A 5AXBA 1N1GA 3WR5A 4O63O 2NQ8A 3OJEA 3HB4X 2WTBA 4B7XA 5U9CA 3SJUA 1SC6A 1TXGA 3PXXA 2Y1GA 1MUUA 4BO5A 4U0KA 1P0FA 3DZKA 1H6CA 2NVUA 4YDRA 4FIZA 5EL0A 3JD2A 4A5OA 1VJ0A 5JXWA 2JD2A 4LN1A 3C1AA 4DMLA 3NJ8A 2EF1A 3FWZA 4LSMA 4QT0A 4K6CA 3IDSA 3RBZA 4IQGA 4XDYA 3V2UA 2Y1CA 1Y8RB 3ORFA 3PGXA 4AJPA 3GDOA 4HUJA 3OIDA 1ZEMA 3PWSA 2Y0DA 1JKFA 1NAHA 3Q1LA 4M89A 3BMOB 2Y0EA 2HRBA 5IDWA 3LT4A 4KUGA 3OFSA 4CL3A 4HKTA 4A27A 1VLLA 2C54A 5CAEA 4BB6A 3JV7A 4WCFB 3ZHXA 3R0IA 5U4QA 1KBZA 4AJ1A 3KLPX 4P8RA 3BA1A 3KEOA 2JKVA 5TX7A 4AJ4A 3NKLA 1CF2O 1PZEA 4JCOA 1V9LA 4U0JA 2G1UA 4G65A 3C7DB 2OUIA 3FCOA 3DBLA 2FY8A 3PI7A 1GV1A 5EESA 2TMDA 3FNHA 3L4BC 1Y9EA 5GY7A 2IZZA 4RGBA 5DP2A 5IN5A 1VRWA 1SEVA 3GHYA 2O50A 4R5MA 3WYEA 4NG5A 3QRWA 2FMUA 2Q50A 1P1JA 2BMAA 3TN7A 1OOEA 2PGLA 2OO5A 2VQ3A 1ZFNA 2Q2QA 2ZYDA 3C7CB 3GC6A 3MJTA 4FFLA 3TRIA 5K9ZA 4CV3A 4J0EA 1GFSA 4BGVA 4CLRA 1FDVA 1EBFA 1RM4A 1O6ZA 4CR6A 3ZU3A 3WTBA 4RV9A 4E4YA 3KYBA 5JY6A 3ANLA 1YB5A 1I3MA 4TRJA 3EUWA 3V1UA 2P4QA 2HLPA 4J4TA 1GL3A 4CMEC 3F4LA 2CDAA 1ADBA 2ZB3A 3IKTA 3W8DA 1YRLA 4NPCA 3ZWCA 3ROKA 2DLDA 1DC4A 1I36A 4IJWA 2V7PA 3QWFA 4TRRA 4DRYA 2J3IA 4F46A 3Q9NA 1GUFA 2VCYA 3K8ZA 4CR7A 3RROA 4YXFA 1H6AA 2UUOA 4F6CA 4FPXA 3BHIA 5JSFA 3S2GA 1UAYA 3PLNA 3JQAD 1IPEA 4Y67A 3ROMA 1D1TA 1A71A 3VPGA 4JIGA 2D0IA 3PPIA 2QQ5A 4ESOA 3H65A 1FXSA 4TZTA 4BVAA 5FI5A 3VPXA 5KKAA 2CD9A 1UP6A 1GZ4A 4QFCA 4XQCA 3H9QA 2Z1MA 4BMVA 4YRAA 3U5TA 3LDHA 4EGFA 4H16A 3E9MA 4F45A 1ZXBA 4NBUA 2FR0A 1JQBA 2SCUA 2TMGA 4XEHA 1X0VA 2XXJA 2YW9A 4E5MA 3R6DA 4BNZA 1GCOA 1UDAA 3E5MA 3O03A 4NHEA 1YOVA 1YBMA 4N5LA 5JCXA 5DOZA 3OECA 4GX0A 2NNLD 5EINA 4R68A 4BO7A 2AG5A 3DHEA 4EDFA 4W7HA 1WZEA 1G0NA 3TZHA 4DPLA 2X5OA 3PYLA 4WPGA 5A3VA 1R0SA 1NTOA 2P9GA 1S7CA 1ZUD1 2VHVA 2ZKLA 3NT5A 1TEHA 5JO0A 5CEJA 5CEFA 2X0IA 4FJ1A 1HLPA 1O94A 2P2SA 3NUGA 5H83A 3TL3A 3BIOA 4BKQA 2G82A 3EVNA 3WGIA 4M54A 2GNAA 1EMDA 4CM6A 3C1OA 3VPHA 3QLJA 4JXKA 4N7RA 1RYEA 1LUAA 2QZ9A 4DLLA 4MKXA 3KOUA 4CJXA 4CMKA 2W2LD 2JFHA 4JJFA 1E5LA 1M6WA 1YH3A 4R16A 5C7OO 5IF3A 1E3LA 4UEKA 2POQX 4XDZA 1GV0A 1N5DA 4Y6RA 5KIAA 3D3WB 1AHIA 2VTDA 4N54A 5F5NA 1B8VA 1ORRA 3MJVA 2UDPA 5CPFA 5TJ9A 2ZB7A 3H8VA 3OSUA 3RSHA 4PLTA 5T67A 1NPTO 1PJBA 1Q7BA 3NGLA 5KVSA 2QRLA 4AJ2A 4GVLA 2HJSA 4LCJA 3WBBA 1HTBA 3ST7A 1ULUA 2CSUA 1O95A 3D5TA 3U4HA 3PTZA 2ZTLA 1PU2A 2X9VA 1MG0A 1TA4A 1E0DA 4IM7A 2OFPA 5ENDA 4DUPA 4Z3KA 1E5QA 2GRAA 3DAFA 4D41A 4YTEA 1IUKA 3W8FA 1TVEA 3DZBA 4C7KA 5AYVA 4GAEA 5A9SB 2EJVA 3K5PA 5IZ4A 4U8GA 4WCDA 1U28A 1IYZA 3UFXA 3LF2A 2GO1A 1YWGO 2DVMA 4IDAA 1Y5RA 4HBGA 2H1SA 3OJFA 4Z0TA 4ND1A 1E1NA 1OAAA 4Y98A 2GASA 4D43A 5HBRA 1BXGB 1A7KA 3D4PA 5JY1A 4ND5A 3RUAA 2YHUA 4GPD1 1MGOA 5DCYA 2UV8A 2NU6A 3QP9A 2BGLA 4HNGA 3WWYA 3PVZA 1ZNQO 3I9LA 3OQBA 4HY3A 4MVJP 2EKPA 3KBOA 3AOEA 4CMIB 4W4TA 1A72A 4S3MA 2EGGA 1C0IA 1N7GA 1ML3A 5DOVA 4MINA 3IJPA 2CFCA 2DFVA 4OOFA 3QA9A 4XQEA 3GGPA 2ET6A 4BO4A 2NVWA 3VVCA 4HWKA 1DBVO 3EHEA 3GRPA 2CDBA 4E2ZA 4J1QA 3VZQA 3RBXA 4J49A 3OJLA 1ZSNA 3Q2KA 2BLLA 4PLCA 3QVXA 3VPFA 4EW6A 1Y1PA 2V6FA 5ER9A 1LTHR 2Y99A 5LDGA 1Q7GA 4CLEA 3L9XA 4ALMA 4JK3A 5B4TA 2CVQA 4LMRA 4UUNA 4WLNA 4BNJA 5ER6A 4QXMA 1NQAO 2FHSA 3FPCA 3VTFA 4DYDA 2HMUA 2RHCA 3JCZA 4LVCA 3T7EA 1DPGA 2QHXA 4PLPA 4CM8A 4DIOA 2CUKA 1LRKA 3WGYA 4G81A 5JMPA 4XGNA 1J0XO 3QY9A 3DFZA 1O89A 1CQJA 1I01A 5T57A 5JDIA 1FDUA 4OO3A 1DAPA 3GRKA 2B83A 3CSDA 3M2PA 1R37A 1X7DA 5ITVA 4AJLA 2YZ7A 4LMPA 1U1IA 1U5AA 3DBVO 3R3JA 3WMWA 2EIHA 4R9RA 2AEMA 3LSYA 3I5MA 1XR3A 2D5CA 2X8LA 2WE8A 4OJNA 1LQUA 2WYUA 3G1UA 4H15A 4J4BA 1X1EA 2O4CA 3IAHA 3TZQA 2HQ1A 4TSKA 4U5QA 4PLGA 3H9GA 4BNUA 2GF2A 1A5ZA 4C4OA 4CV2A 3AI2A 4GVXA 3H5RA 3WGHA 4R1NA 3PHJA 2RCYA 3PJDA 3EC7A 1R0KA 2R6JA 4RF4A 1Y8RA 3HDHA 1ADFA 1GQQA 4PG7A 3HSKA 5F1OA 3KO8A 2JJYA 2PZKA 2VT2A 4M8SA 5JW6A 1N1EA 2EW8A 3VC7A 2Y0CA 3DZFA 1JN0A 3QIVA 3DBLB 2PWZA 4PZDA 3BMOA 1BG6A 2C59A 4KMSA 4Z9FA 4RORA 2CNBA 1U3TA 1NXQA 1CERA 4IQ0A 2JFGA 1OBFO 3NRCA 3WJ7A 3L9WA 1XKQA 5F1PA 4AJEA 4WCFA 4XB1A 3ENKA 5IXSA 1A9YA 3F1KA 1T1RA 5TJHA 1HDRA 2BRUA 5T64A 4PIVA 4DPMA 4CLRB 1U9JA 3OF2A 1I24A 4AJJA 4R41A 3WWZA 4MIEA 1MC4A 2XOXA 1YONA 2FN7A 1PGQA 1HE5A 1KEVA 2DAPA 4IINA 4ALJA 3F1LA 2JAPA 1WDLA 3KM0A 4GWKA 4Q39A 1RJWA 5T8KA 1JW9B 4Z6KA 4ID9A 3SVTA 4OAQA 2C07A 3OEYA 3GNTA 1TI7A 1HYGA 1IY8A 1T25A 1P3DA 3ON5A 5ILGA 2Q49A 5L9AA 2ZB4A 2WD7B 2I99A 1E6EA 4JP3A 1L7DA 1YQXA 4DREA 1H9AA 3NJ4A 4NIMA 4GL4A 5TGDA 3GEDA 5DT9A 4BNWA 4XR9A 3GVPA 5F3RA 4CPDA 5BT9A 4B3JA 3C1TA 4MVJA 3CH6A 4OHUA 2FWMX 4IDFA 4BMNA 3SC4A 3PLRA 4J1NA 4NU5A 1QRRA 2J5RA 3V2HA 1CJCA 3RC1A 4YYZA 2IZ1A 2IZ0A 4YAGA 1PGJA 1PL8A 1SOWA 3AFMA 2PFGA 1X14A 2B4TO 3UCFA 1U3WA 1UZMA 1V3TA 2ZIZA 3C24A 2QX7A 4I5DA 4UVEA 4XCVA 4PLHA 1E7QA 3GGOA 2Q3EA 3MCVA 2JCVA 4IZHA 5A02A 3WNQA 1ZK1A 4CMHA 3C7AA 2Q4BA 3JD1A 1LJ8A 2O3RA 3FI9A 4CR8A 5JAIA 1VSVA 2ZJ0A 1F12A 4GKVA 3WSWA 1UXGA 1I3LA 4G5HA 1KYQA 3L07A 2FZEA 3LVFO 1I3NA 3ZCXA 5IDQA 3ZWAA 4R51A 1QORA 1Y6JA 3K6JA 2FPGA 1GU7A 4DL9A 3WFJA 3BMNA 4QX6A 4BOYA 1JKJA 1HT0A 1VM6A 1YJ8A 4YT5A 3RJ9A 3L4SO 3ZNPA 4BKRA 3H2ZA 1HDXA 4BKOA 1XG5A 4BO2A 1KOLA 1B3RA 3EDMA 4R4JA 1QG6A 1O5IA 2WSBA 3AM4A 5JLAA 4J7UA 2AE2A 3UXYA 1NHGA 1LLDA 5H81A 3ZU4A 3O38A 1CIVA 3F47A 1YQGA 5FF9A 3BMCB 1PJ2A 3I9MA 5L7YA 2Q1TA 4CV0A 2Q2VA 1E6UA 5L4SA 4OH1A 1LLQA 2D2IA 2AQHA 4ZN6A 1VI2A 1A4UA 3G49A 3OA0A 4DMMA 1IL0A 4Y9DA 5A9RA 3GFGA 1HE2A 3S2IA 4BGUA 4WASA 4YAJA 1PJTA 1MA0A 1BTOA 1R16A 2J5QA 1J4AA 3AUTA 1B8PA 2V6BA 2VZ0A 3DTTA 5B12A 3Q2IA 3GG9A 2DBRA 4RLSA 4E2XA 2BI8A 3HN7A 1DIAA 2CVZA 2EERA 3W4KA 3FPLA 4Q3CA 4I1IA 1YS4A 1WVGA 5TSDA 1R15A 3VH4A 4KUEA 4II2A 3WX0A 2DBZA 1E6WA 4PLYA 4ZGWA 3VHRA 1QV6A 4WOJA 1E7MA 1XQ1A 4YJHA 1W0CA 1LDNA 1HZJA 1IPFA 1QLHA 2JAHA 1FF9A 5KOIA 3VAZA 4DPKA 4MP3A 1UXKA 4FD3A 5I7FA 3CMMA 1FDTA 1NQOA 1GYRA 2X4GA 3D3WA 3GGGA 4YR9A 3ADPA 2Q1WA 4R5HA 4YAIA 5HM8A 4E13A 3VH2A 2PLAA 3N74A 5I9NA 2VNAA 2I65A 4B4OA 4FJ0A 1Q2XA 4INAA 2QYSA 3S2EA 1E1LA 1F8GA 1EE9A 1IHXA 3RUHA 5TS3A 4NH4A 2UVDA 3EGOA 2AG8A 3E1KA 2JCXA 2YQ5A 4L73A 4RPKA 4E12A 1HE3A 4ALNA 4TVOA 2A94A 1AHHA 1I10A 4MOWA 1XQ6A 3ZU5A 5TT0A 4BL5A 4I08A 3DZHA 2V6MA 4XJSA 3GAZA 2GUGA 3JYQA 2AXQA 3KV3O 5A06A 3DC2A 1KVQA 5A9SA 1P44A 5KCZA 4QQRA 4EEXA 2VHXA 1PJ4A 4DLAA 5IZCA 3NV9A 1H2HA 3UF0A 3WGZA 5KKCA 4CM4B 4BUCA 4CM4A 4RF3A 1YKFA 2EGHA 2PZJA 1Z7BA 2HCTA 4XB2A 9LDTA 4CQMA 3KZVA 1GZ3A 3JQCA 4R54A 4B8WA 3H2SA 4J7XA 2GD1O 3WIEA 4PVCA 1DIHA 1Q7CA 1QSGA 1F06A 1D3AA 3KVOA 2HMVA 4XQ9A 1C1DB 3NAQA 3U62A 3ZWMA 3HNPA 4OGWA 4BNGA 4CMJA 4CQLA 3TF5A 1UXIA 3OETA 4CUKA 4E2YA 1OC4A 4ITUA 4J2OA 1B2LA 3TL2A 2AEJA 3G79A 4FCCA 2NU8A 4FQ8A 2R00C 4YJFB 1BVRA 2NLOA 2OBNA 4DBZA 1LXCA 1P33A 1ISJA 2AQKA 3ICPA 1ZSVA 3WSVA 3K92A 4EJ6A 4I9HA 4OMUA 1XGKA 5EERA 4R1SA 2VZ9A 4PLZA 5BNTA 3DBRB 1P1KA 3GN2A 3WG9A 4C7JA 1PS9A 2WE7A 5JPIA 1EBUA 4IMPA 4P4LA 4YA6A 2AQIA 3VKUA 3UUWA 2VYND 1GR0A 1MLDA 2FSSA 3N58A 4AJIA 4J3FA 5IG2A 1GEGA 3V8BA 2BHLA 2VUTA 2VN8A 1OMOA 2O3TA 5AVOA 3D4OA 2ZCVA 3K96A 1ZVMA 4MVJM 2PGDA 1U7TA 5JDCC 1XLTA 3DR3A 3QWIA 2P9CA 4U6SA 1NASA 3U09A 1A7AA 1KERA 4DLBA 3JQ9A 1ZZEA 1HXHA 3PZBA 3INTA 2C82A 3GMSA 4IQ8A 2RH4A 3IUPA 4NK4A 1G1AA 1HLDA 3DEYX 4BNVA 1T24A 4ZD6A 5FYDA 3FTNA 1A4IA 3UCEA 3JD4A 3JQBC 1WMBA 4WNIA 2CF5A 2EKQA 5U1PA 3NGXA 1DSSG 4ALKA 4XWYA 3DHYA 4K26A 3U3XA 3E9NA 2AMFA 2XPCA 1NX6A 3GPIA 1H2BA 4PLVA 3SJ7A 3GZNA 2OOSA 1YXMA 1ZK3A 5CDUA 4IDCA 2PZLA 1W4ZA 4UVHA 5TLSA 3UHAA 5A5EA 3JQ7B 3NT2A 1GPJA 2O2SA 3B1JA 3LC2O 4RPHA 3PHGA 4XYMA 4CMEA 2GN6A 3C85A 5FFFA 5IXYA 5L45A 1WDMA 4YCAA 4R69A 1GYQA 2X22A 4D7AA 2IXBA 1JU9A 3TFQA 4D45A 2CZCA 1BW9A 1JAYA 3A14A 2VOJA 1QP8A 2IDZA 3GVCA 5GZ1A 1NBOA 2NU9A 2YFQA 4I8XA 1CQIA 3O9ZA 3HN2A 4IZIA 4DGSA 1PQPA 4N5NA 3FNEA 4GX2A 3PHIA 1YL7A 3U4CA 3QE3A 4GLOA 5GMOA 3ADOA 4OKNA 3EAGA 3BTVA 2C29D 2WD7A 3ETDA 1HSZA 4JNKA 4PRLA 3RUIA 3STHA 1PGOA 3PQFA 5AQ1A 4K9DA 4IDGA 3IOYA 1VL0A 3JQFC 4NZ9A 3PDUA 1JKIA 4RVHA 1DLJA 1ULSA 4WNCA 3PZRA 1PQWA 3ROPA 3IIEA 3QVWA 4TQGA 4UUMA 4R3WA 4PG8A 4FDAA 4XRRA 1UZLA 4BV9A 1YL5A 2ILTA 3ZZNA 1O0SA 3COSA 2QIOA 2Q1SA 1U8FO 1R4NB 1M76A 4IDBA 3AUAA 4UEJA 1N2SA 3R1IA 5COAA 1EQ2A 4II3A 5LDHA 1PTJA 2PH5A 1KVUA 4RDIA 4JP2A 1DIRA 4UVDA 3VZRA 4RZIA 3GA0A 4M86A 3KUXA 3BMNB 1IB6A 7MDHA 5EJ2A 4UULA 4HADA 4PG5A 5C7IO 1E92A 5I7EA 3DO5A 3A9WA 1B16A 5G0VA 2ZTMA 4KTTE 5CDGA 3G3EA 1OC2A 1UP4A 1FMCA 1XYGA 2HU2A 5JAMA 3SBOA 3AU8A 5JO9A 3LLVA 1Z6ZA 4OQZA 4WLFA 4RO0A 3VH1A 3D1LA 5KVQA 3DOJA 2O4UX 2HJRA 3P2YA 1U8XX 4KUHA 4OOEA 4BMSA 2Q1UA 4A2CA 3HJAA 1XIVA 3ZV3A 3P19A 5IJZA 3BMQA 2O3JA 3VOSA 2HRZA 4HFNA 5A03A 3TDKA 4GGOA 3BTOA 4AVYA 5JCJD 2CY0A 1P31A 5AXDA 1ZIDA 3DONA 5JNLA 1JTVA 2BH9A 3L77A 5DDIP 3ZNOA 5KJCA 2X0NA 5TRTA 2X5JO 3HG7A 3JYOA 5CP8A 4YQZA 3B70A 3I9NA 1EVZA 3HFGA 1ZJZA 2O7SA 1C0LA 3IC5A 4I9UA 4DVJA 3W1VA 3M2TA 3WXBA 1S6YA 1ZJYA 1ISGA 1NM5A 2W98A 1ZEJA 3RKUA 3BMCA 1A27A 2YFHA 4XYLA 3MTGA 3RWBA 4CUJA 3VH3A 4AJOA 3FTPA 4F6LA 3L6DA 4MVJG 4Z0PA 3O8QB 1Y9AA 2YV3A 4YACA 4BNHA 4D3SA 4NJMB 2RH8A 1Q0HA 3AY7A 4RPLA 4E2WA 1N8KA 3F6YA 3G1TA 1P1HA 2WYWA 1NR1A 4BNTA 2A92A 3S8MA 4Q3BA 4YAKA 4J6FA 1CETA 4XD2A 2YDYA 3UKOA 3FN4A 5CEEA 5CG1A 4RVSA 1B8UA 4EEZA 5JAZA 3RBVA 1E3WA 4ZA2A 2J3JA 1NP3A 4R1UA 3WJAA 3ICCA 4K28A 3LC1O 3RI3A 3M1AA 3PYMA 3ZHZA 1R4MA 4OXKA 4YJHB 1DFIA 5DN9A 2O7QA 4ILKA 3ZW9A 4CMCA 1U4OA 4PLFA 4EZBA 1KVSA 1WLYA 4PLWA 1LRLA 5A05A 3OA2A 4CM9A 5A04A 3FD8A 1DFHA 1LDBA 2VUUA 2H9IA 1PIWA 3HFSA 3CZRA 3RIHA 2B5VA 3WQQA 3ENNA 2YV2A 5AXCA 3BAZA 1NHWA 3OQ6A 1I32A 3ZWNA 5DZSA 4AICA 4MDHA 3QW2A 2PZMA 3BTSA 1ZCJA 1CYDA 2VHZA 3OJ0A 1ZO8A 5KJEA 4D79A 4W7IA 1EVIA 2BELA 2DTXA 4UUOA 4Q3AA 4D3DA 1BMDA 2QG4A 3ITKA 3GFBA 5KTKA 4CQMB 3LLSA 4WLVA 5KJFA 4EUFA 5G0UA 2AHRA 2QW8A 3H9UA 2WDZA 1R66A 2O3SA 4FR5A 1GYPA 1B15A 1H6DA 1P0CA 4CLHA 4E32A 1MG5A 4XYBA 4CQLB 1DIGA 4JBIA 5TT1A 4J90A 2BI7A 1T2AA 5KNLA 2E49A 3GUCA 5HA5A 2JD1A 4IY1A 5JYDA 1HE4A 1XCBA 2B4RO 2DBVO 3NX4A 1I2ZA 2QYTA 2C5AA 2HK8A 3H5NA 4FFPA 3WQRA 3RD5A 3DMTC 1BHSA 2YY7A 3HWRA 1GZ6A 1JWAB 2JCYA 4NK5A 4BS9A 1ISFA 3I1JA 4ZICA 1YB4A 1C1DA 8ADHA 2CMDA 1LSOA 4D44A 3GMDA 4BKUA 1PGPA 1NQTA 2EXXA 5ILOA 1M6HA 4URFA 2J5KA 3FBGA 2Y05A 1F14A 4IJUA 1Y5MA 3WIDA 4M87A 3IQDB 1YJQA 2Q99A 2FPPA 3U4IA 3S55A 1I2BA 4YJFA 2CVOA 4YQYA 4NNJA 4LISA 3TQHA 2H6EA 2BGKA 5ENVA 4A03A 5I9MA 1RM0A 3N7UA 4GMGA 1MXHA 2VRCA 3VZSA 1HL3A 1GY8A 2WEKA 1LEHA 1C0PA 1ZBQA 4BNIA 2Y1EA 3A28A 3F46A 2GZ2A 3DBRA 4GMFA 3CIFA 4PVDA 3JYLA 1L7EA 2GLXA 2E48A 5HS6A 5C3MA 3WICA 1ID1A 2RAFA 1E7WA 1BGVA 1GQ2A 2VYVA 3F5SA 1DEHA 3B1FA 4BGEA 1FJHA 2G17A 3I9OA 4IXWA 3HHPA 3TOXA 1BDMA 4MP8A 1RM5A 4MP6A 1OI7A 4GSKA 4JJGA 3H6KA 5JC1A 3D4NA 3X2FA 5ICMA 4D0RA 4XKJA 1HWYA 2O48X 3DB2A 4EITA 2VHWA 3FHLA 4DWVA 3I23A 3GZNB 1NFQA 3PFWO 3HDYA 3CTMA 1B7GO 1W8DA 2GYYA 5G2OA 1LLCA 5F1KA 2WJPA 1Z75A 2Y1DA 2ZCUA 4J0FA 3JD0A 2GERA 2YV1A 3FSRA 1WZIA 1HSOA 1UUFA 1BSVA 2NADA 3CMCO 4WEQA 2I3AA 3MJSA 4OYRA 1Q1NA 5G4LA 2I3GA 2C7GA 4A10A 3LT1A 1P74A 1SB8A 5L7WA 5CG2A 2B35A 2PKQP 1K3TA 1YE3A 3OICA 4R1TA 5ES3A 5T6BA 2VWQA 5DCWA 4EYEA 1BW9B 3UVEA 5GZ3A 1F8FA 3PEFA 1B0AA 2PR2A 1YQDA 3IL2A 3OBBA 3LZ6A 4MVJI 5JDIC 2X6TA 1ISHA 3CUKA 1WNTA 2Y1OA 5AOVA 1LU9A 2H63A 3R3SA 3OHSX 3JQ7A 3JTMA 3Q6IA 4YJDA 4XR4A 3ZWPA 2D1YA 2O23A 2X86A 3ABIA 5CFZA 3RUEA 3IS3A 4OSOA 1D7OA 1T1SA 1NVTA 1SCUA 3CZMA 3RUDA 4YT2A 4XYGA 1DXYA 2E82A 3MTJA 4WLEA 2P91A 3W6ZA 1IULA 4CLOB 1M67A 1DHRA 4XX0A 3DZGA 1U3VA 2VWHA 1N92A 1Z74A 3PQDA 1SBYA 1BVUA 3HB5X 4RVFA 4KOAA 3LC7O 5LC1A 3SC6A 2PNFA 1YO6A 4DC0A 2AW5A 1Z7EA 4Z9YA 1ENOA 3ETEA 2A4KA 2ZJ1A 1B26A 3MWEB 1NVGA 3PJFA 1LI4A 1ZSYA 1UZNA 4UVGA 1WXDA 4PFJA 2OMEA 1VL8A 2IYOA 2NSDA 4RVUA 2I5PO 1HZZA 1IZ9A 4GI2A 3HUDA 3ONFA 1LC0A 2QZZA 1YDWA 1EDZA 4HFRA 1KVTA 4P4NA 1T4DA 5BSEA 4B8ZA 2I9PA 2UAGA 5L51A 1T2FA 2EV9A 1YDEA 1PGNA 1U5CA 1X7HA 2UUPA 1R4NA 1NFRA 3W6UA 2PD6A 2JHGA 3DZIA 4PG6A 4Y6SA 3I3OA 1MFPA 2H5LA 2YYYA 2I76A 2DUUA 4ZRNA 3WDSA 4FB5A 3MOGA 1T2CA 1EUZA 2NUAA 3BMQB 1T2EA 1PJLA 4O1MA 1W6UA 3GPDG 4BV8A 3DZJA 1O8CA 4TVBA 2P9EA 3PGJA 2LDBA 3VPSA 1UXHA 4OSPA 4QO8A 2FZWA 3ZH2A 1C1XB 1NAIA 4LK3A 1TT7A 1Q0LA 4XIJA 4RLHA 1SO8A 5BR7A 1KVRA 1E3EA 5B37A 3PDJA 1FK8A 2VNSA 1PL7A 3D0OA 1QLJA 3AM5A 2NQTA 3ZWYA 2E6UX 4Z3DA 1YBAA 4NFSA 4RDHA 2D59A 3QHAA 3VKVA 4ZQGA 4WLOA 5K6AA 1TT5A 2HUNA 4NBTA 2DTEA 3C3XA 1R12A 5L3ZA 4KQXA 1C3VA 4BB5A 1LX6A 2YHIB 3ZDFA 2IEDA 3QWHA 2DPGA 2NU7A 4ZJUA 1CRWG 5EIOA 3SLKA 3H7AA 1W73A 3HDQA 4G2NA 4QO7A 1DRVA 4U7WA 4OL9A 3E18A 4UREA 4W82A 4AJKA 4KTVE 3GUYA 3W8EA 1U7HA 1A9ZA 3K9QO 1E3WB 4PZEA 4DQVA 4N18A 1EEHA 5GZ6A 4W6ZA 3TZCA 4W99A 1QYWA 3NT4A 3S1LA 4IJVA 1GAEO 3DHNA 5EQFA 3DWFA 3O8QA 1R4MB 2EHDA 1HETA 3LK7A 4HV4A 5DCUA 4NJMA 3ONDA 1EE2A 4TKMA 2NACA 3OMLA 1T4BA 2EEZA 1QYCA 4RVDA 3WQSB 5KWEA 1H93A 1TLTA 3L6OO 5J23A 1LNQA 3JSAA 3ZNNA 4JX8A 1H0KA 4M1QA 1PJ3A 3D5QA 1B14A 4MIOA 1T26A 3P5SA 2Y93A 4WUVA 2RIRA 2JFFA 1SB9A 4DC1A 2PK3A 1MXFA 1I5RA 4NI5A 4EJ0A 3PQEA 2BFOA 4YEDA 3QVTA 4NQZA
chains in the Genus database with same CATH superfamily
3JAWB 4AJHA 4BO0A 4YAUA 1TJYA 2D5LA 1NMQA 1IRIA 1R8YA 5LJIA 5ALGA 1GARA 3SSMA 1RLTA 3CUEF 5AOCA 1SWVA 3G5TA 1D5WA 1R88A 3RS8A 1Y7PA 4JROA 2JAWA 5AJHA 4Z51A 1HR0B 1RMYA 4OGKA 3CN7A 1R6DA 2VDKB 1L4GA 2WIAA 1RJFA 5KX5B 1SHTX 4PGFA 3NDIA 2EGUA 2JBAA 1IK6A 3ESCA 7ADHA 3L1KA 1WSBA 1T8YA 2XE6A 2Q4OA 3OM0A 5C5IA 2EU8A 4FT2A 3MGGA 1JR3E 4EVSA 2BD0A 4Q5IA 5F7ZA 2O1XA 4IBOA 3FCSB 3ZI7A 4R81A 3TUZC 5D5HA 2G5CA 5IULC 2GZ1A 4OF4A 5JCOC 4Y30A 5DBEX 1OWMA 4XWOA 1H9BA 3PNOA 1HRDA 1J6UA 1L4BA 1STOA 4XGQA 2G07A 2J3MA 1JXAA 4A0QA 5ADHA 4RTPA 4NEQA 5JSZB 1AUPA 1H94A 2I2XB 2D1FA 3OKPA 4OLJA 1P9NA 1OYYA 2Q4RA 2W6JD 2YVQA 3G7SA 3U13A 3WGQA 1J7KA 4G6ZA 4NBVA 3V8MA 1GSHA 3QNUA 5AR1A 4AZ3A 4P3PA 1ZPDA 2EW2A 4NYJR 1PNRA 3ZWBA 3A6PC 3OQIA 5JT1A 3S2UA 2OD2A 4DHEA 5T3UA 5A1JA 2Y1WA 1MX9A 2R60A 4MW9A 4WW0A 3GR6A 1D2RA 3LVQE 3OKFA 1SUEA 4HG2A 2EP8A 1LJLA 1EWQA 1GNRA 1W88B 2CC2A 2P3LA 4F71A 3UB2A 4WBNF 3RQSA 2NSHA 3C3WA 4GMHA 1XTTA 4B6SA 1YVDA 1B6RA 1VCHA 2HZ7A 4JR0A 3PRJA 5GVRA 2GEDA 1ZOPA 1XTVA 1HURA 1WV1A 2BTQA 1D1SA 3EGVA 3CE6A 2O2CA 1RS0A 1VTKA 3IVXA 3WTCA 2C20A 1ZM7A 2J7PA 4MITA 5IK2A 4D82A 3MJEA 3OKAA 3Q8MA 4LGVA 2ADOA 5E4JA 5KC9A 2BKAA 1TUEA 1VE6A 1OBVA 1PX2A 2IHZA 2PYDA 4IZ6A 3RUFA 4G23A 4WXEA 4ACAA 3O5AA 3MPUA 3NHZA 4M9UA 4WE3A 5EVCA 1E2HA 3F3SA 5GGXA 5C5CA 4KXYA 1RQNA 1YK0A 2D5BA 2IXGA 2R11A 2ODTX 3LCMA 4G0WA 2XECA 3HFJA 2I6TA 2GHTA 5EMNA 3E9RA 5A2GA 2O3UA 4I9NA 4KR2A 4P31A 3VDQA 2FEAA 2FPRA 1D2EA 5C4IA 1RPTA 1U2DA 1WPXA 4EI8A 1FQOA 4PZUA 5IYZF 4PIPA 4F1KA 4C7OB 1UPFA 2AX3A 1OA1A 3H9EO 4OBXA 3TDMA 2WJWA 2FE1A 3A7DA 4YRZA 1NNUA 1U0SY 1IBMB 4G1EB 1JG3A 2PBLA 3OQHA 2G1JA 5CMLA 5A9TA 5IKPA 1Q20A 2NTVA 1L8AA 4C6HA 2VJQA 2EP5A 3AUYA 3IRVA 3IKVA 3IQGX 3NC0C 4F92B 2P78A 5G0TA 2WPDD 2PA0A 3U7JA 4Q00A 4C14A 5CFRA 2Z95A 4KLAA 3ZW8A 3M81A 5I9SA 2X5KO 3T6KA 4AZWA 2IBMA 1NATA 4MWZA 4C6SA 1JA9A 4HDCA 5HK9A 3PKJA 1EK6A 1L6RA 3O4RA 1CEQA 1ZNXA 3C8MA 4K40A 2DT5A 5H4HA 4ZZ0A 3DC7A 3DKIA 2CL5A 5IDVA 1SIWA 1A7UA 4HI0E 4PTLA 2IELA 3RS2A 2B37A 4G0YA 3WAKA 4ENPA 4HXYA 3OZSA 3B2QA 1L1QA 2QJOA 4L4SA 4RF5A 4RJJA 2ZWOA 5H16A 1PJQA 3AW8A 3JQEA 2TYSB 4NJEB 3TKAA 4YT4A 5DULA 4L8GA 4LVUA 5E3IA 3RRNA 4FQ5A 4MQBA 3P2MA 1FP1D 2D3TA 4Z53A 5K45A 5JJLA 4DNXA 1CQWA 4UE2A 2J0EA 5J4HA 1XAGA 1XAJA 4D0NA 1CDDA 2EEPA 3AU9A 2EAUA 4KIFA 1O9BA 1PSDA 4ONEA 5GIOE 1G9TA 1DOHA 1RJ9A 2BUBA 3N9IA 1DO8A 2QORA 4KIWA 4LY0A 4GEKA 3JQFA 3KLMX 1IHDA 4J3JA 5BOVA 3VYUB 3WNBA 3H5LA 3UAGA 3A6DA 4R3NA 1OFTA 1V35A 2BGGA 3NHBA 1O58A 2HIMA 1QS0B 2D1SA 3E9EA 2JF0A 2JL1A 4DCGA 3GF4A 4HGYA 4PCVA 4WK6A 1PT5A 3AM1A 1KC1A 3ZLJA 1Z18A 4XM2A 2Q0QA 5EUMA 1Z6XA 3ZWWA 4OD0A 2HRCA 1VKHA 3C0KA 3OCUA 2HBQA 3H84A 3ZIUA 4DYVA 2ATXA 1SWWA 2G77B 4U3JB 1M1YE 2OT3B 2AUTA 1E63A 1KI9A 4JS0A 5TEVA 4ZYZA 4QUKA 3AKDA 2ZVPX 5C80A 2PBFA 2WSYB 2AVDA 4E12A 4E5YA 4CIWA 1FX0B 2BF7A 2DR0A 2BDEA 3CVWA 3HMKA 3SQXA 2D5AA 2QI9C 3AF4A 4CLOA 2O5RA 3HBFA 1D2GA 3IMFA 1CEXA 3L6BA 1ENZA 2JLCA 4HVAA 5L6MB 2LR0A 2F1KA 1CY0A 3NDBB 2WJ6A 5DWQA 4GIBA 5DTJA 2LVBA 2AEFA 4N5MA 3QJYA 2CNKA 4R01A 1TCBA 3DYVA 2KQUA 3A11A 3KEGA 2V6GA 3LX6A 2VTEA 2A59A 3VO9A 3VNQA 2H29A 2HWUA 4BVBA 1BC5A 2XF2A 3ZI0A 2H2HA 2HPHA 2WIFA 1KFKB 3Q8XB 1CV2A 3NDRA 1XF1A 3D64A 3DOCA 4FW8A 2Q0SA 2WTXA 4K46A 4LXQA 2JD0A 2PGXA 5E1MA 2ZUBA 4P9NA 2NUAB 3GZ4A 3QPUA 4Q3LA 8LDHA 4B7ZA 5JROA 3RRJA 2FB9A 2PWAA 3L0SA 3EARA 4FGWA 2PYIA 1DC3A 1I2MA 1QZ3A 2E9SA 2IYAA 3EJWA 2VR1A 2I71A 1V3QE 4J0JA 2GZDA 4TS1A 4D80A 3K1ZA 2O20A 3L6RA 4OXXA 2YBEA 3AP3A 3UJ6A 1E6MA 4K6FA 1TK3A 2PVPA 1ECPA 2JGFA 2PL9A 1UM9A 2Q7XA 4GSLA 1EFCA 4WZAE 4ZIRB 4PHFA 1Z16A 4P98A 2I7TA 4G84A 1S01A 1WEHA 3RAPR 2I6QA 3KAKA 3V7YA 3I6BA 2HU8A 1EFPB 3RVDA 1MX1A 4JLUA 4WY5A 1IU9A 2B8WA 2L82A 2OQRA 3GJYA 1OFGA 2CNDA 1P2GA 2QL6A 4J29A 3OO1A 2CV0A 2HMAA 2J6HA 3LHSA 3NBZC 3LXXA 3PU6A 1E2UA 5E2AA 1T0HB 4DDMA 2VWPA 1WABA 2E1RA 5H80A 1I4DD 2C2XA 4Y6GB 1Z3IX 3GVXA 4B2IA 1COWD 1BCSA 3NNSA 3AI7A 1F9EA 4M49A 4U9UA 1TU3A 3GIWA 2X23A 1FU7A 4JVMA 4MA5A 4O6VA 3DDUA 4EHAA 4GOXA 3ZE7A 4YRDA 3ZHTA 1AGNA 2WFMA 1XE3A 2O0LA 3JQGB 3GVHA 3TEFA 1ZK2A 5E6RA 1F0NA 4D9KA 3PNVA 3T5TA 2JB9A 3NTRA 2Z8XA 2AG6A 2ZATA 1J0CA 1OZHA 5JSUA 8GPBA 3ZZUA 3U3OA 4EHHA 2JLUA 1UDCA 2WDPA 2WIBA 2NV6A 3KYCA 4QJBA 5AW1A 2IQIA 3F8WA 4XFJA 5B7GA 4FFBA 4Q9KA 3URMA 4TQ9A 3SG0A 1QV9A 3U3MA 3R40A 4RL6A 2ACWA 2EWVA 1D5CA 2JJ1A 3LBYA 4DV4B 3QX8A 4OHCA 1DZ3A 4IG9A 4L8WB 1L4NA 2Q46A 5C8ZA 1VSBA 1M75A 2Q5LA 3MSXA 4PX3A 1F48A 2DJIA 3A4LA 2Q9UA 1ISMA 1HNZB 4OIMA 1SZJG 4RE5A 4GM4A 3GRAA 3OCVA 1U2GA 4ESEA 5LZ2A 4DLUA 4CMBA 4ENWA 5AVKA 4YRTA 2H2FA 1HMYA 1X7GA 2Y66A 3ELUA 3HCPA 1SRRA 3IHTA 3C97A 2VDOB 1G4HA 2EJWA 3EYWA 4XH9B 5C34B 3T7AA 1XMXA 4M9SA 5CA1B 1IBKB 2J08A 2AN9A 4TL6A 4L07A 4CKZA 4IIBA 1MJNA 3ABZA 3D3EA 1R5NA 2GZ3A 3UAOA 3TBKA 5L95A 4XQ0A 1Y33E 1WUTA 2XNDA 3VDRA 3DE0X 3VNAA 1PX0A 5CIYA 2Q4EA 5JAPA 1E3IA 1Q95A 4BNFA 3NBYC 1FW8A 3ENQA 4Z7NB 3X1KA 3THXA 2UU9B 5KJ6A 4PYIA 2O8CA 3I04M 2GX6A 5HHTA 3W2HA 1Q12A 1YTLA 1VI6A 1AKRA 2GEJA 3C5VA 3NBXX 4WECA 1PBNA 1XZGA 1ZUNA 3IJRA 4GKBA 2QUBA 1B42A 3FOBA 3RASA 1M1ZA 2PD3A 4NMHA 3S2SA 3STYA 3OU2A 1MAUA 4C5AA 1V96A 1EA5A 3G9UA 5EYPB 4D9IA 2VSQA 1DAOA 1SD5A 2A5GA 4E31A 2F7SA 3EBPA 3FAKA 1LFDB 4JQYA 4YIHA 4ZAFA 5F21A 4BMDA 1LZLA 3QJ5A 3HI6A 3TXAA 4I1PA 1EGAA 2D13A 2FZ4A 1KS9A 2OVFA 3Q0EA 4FFOA 1ZW1A 4NRDA 3STTA 2EJTA 3D7RA 3QTLA 4Q9HA 1H3FA 4ENVA 2RK3A 4OK6A 1EE1A 3CB4A 1O4VA 1V0JA 3RYFA 4F96A 3M5PA 4MWOA 3WOHA 3DVQX 1V2HE 2WPNA 1DQRA 2JGJA 2PLFA 4RHUA 2VPZA 3LU1A 3GNQA 5AI4A 1Z39A 2HTFA 4D6XA 4F8YA 2O8DB 2B30A 4IO1A 1FYDA 1UC5B 1JFSA 2JFOA 1QHSA 2FK7A 3KUCA 4RCVA 3RCBA 4YCCA 2DHDA 5B64A 5KYWB 4D5GA 4EB6B 1JHAA 2I3BA 2P5YA 3E2MA 4QFMA 5FPPA 1CY4A 1T8UA 3IQEA 4DTIA 1L5FA 2DKOA 1S2OA 1U0RA 2PSFA 1MR3F 2FSVA 1H2ZA 3NHRA 2MYUA 1SNYA 2XNSA 4V2IA 3M89A 1C3LA 3A1FA 3RODA 4L8VA 4DSOA 3RYCB 1XAHA 4DKJA 4FSHA 1EXVA 5AIAA 1KEUA 1OGJA 4QOFA 3SI7A 4EUEA 1KH3A 4AMYA 3D3QA 3O84A 4R6WA 4BE9A 4YMTA 4GW3A 1KEEA 1E1KA 1M2WA 1JQ5A 1YMUA 2SKDA 5JD6A 4ZVVA 2EL9A 3V8QA 1RPNA 3F6EX 2Z6UA 2JRCA 1KU0A 4G1VA 4OLFA 5AESA 5BNIA 3H4VA 3TI7A 2XAAA 5FORA 4OI4A 3IAAA 4EATA 3G5UA 3KKPA 3GEHA 3ZEIA 4IGEA 3KKNA 2ZIXA 3WMXA 1MGPA 2PMKA 2RGRA 2XB6A 2HGSA 4XWKA 3BZUA 1JHQA 3M5DA 3PDWA 4OP3A 4K9LA 4N0DA 1CJSA 1SHZA 4A5SA 1O6FA 2AF4C 1AXGA 1JHXA 2B5WA 3CIOA 4LV6A 4UMDA 3DLCA 2XDQB 1T9DA 3PR1A 3RT9A 1ISPA 3MN1A 1W36B 3QUTA 4Z4GA 2NM0A 2P9ZA 3J7TA 3U49A 3IX7A 5L7TA 1ZHHA 3RSQA 2CYAA 3IVMA 2C84A 3DOIA 1ATIA 1H0SA 1MO3A 3EA5A 2WG2A 2ZYUX 1SXGA 1YZHA 2A86A 5CDTA 1GUYA 1B73A 2HPAA 3ITEA 1ZZGA 1DWQA 1NJFA 2ZM6B 4IIFA 3R4CA 2IRWA 3KQYA 3L7NA 3HACA 1Z28A 4KC0A 3IQIX 2XYRA 4HDRA 3I52A 3X43A 3BTUA 1JFFB 1T8RA 3PICA 5G0WA 4H1VA 3W3ZB 2WZCA 2G83A 3QOYA 1WVMA 3SCZA 2C88A 3AC0A 3R9KA 2I4NA 4I5GA 3VV3A 2C3MA 4IHJF 1H23A 1S3GA 4TL8A 3TXYA 4BQRA 4R8KA 3RVMA 5LWQA 1XDZA 1GNSA 3B53X 2WHPA 1Y6GA 5IM4F 5FT9A 1X8XA 2H2IA 4LZWA 1CE8A 2Y2VA 3LZDA 4JGIA 1Q15A 1KY4A 4RVGA 1Y4SA 1Q6YA 5BNFA 3OJOA 3UB4A 3KLNA 3DKPA 5C1IA 1XZMA 5TGZA 3U19A 2CK3D 3ICOA 5P21A 4KLRA 3JVDA 3V00A 1YC5A 1NUPA 3MJ4A 4QJ4A 3VR6A 5BW4A 2ZITA 3CFYA 4GQAA 5B53A 2BUAA 3E5RA 1F2DA 2HEIA 3DKKA 2D7DA 3INRA 3R09A 2H9AA 1LC3A 4PQYA 2IEAA 3K15A 4RA6B 3GHHA 3MBIA 1OGIA 1VHWA 5JNTA 3R41A 4KQKA 4O4LB 4RVNA 4XOIA 5HIJA 2ZQZA 1DOAA 1ARZA 1QHHB 4Q05A 4Z2AA 1Y81A 1NBMA 1OH8A 1B8OA 1OX4A 4GI7A 1HNWB 1NF9A 1N2CA 1Y1TA 3L5KA 2DUJA 4RLFA 1QOPB 4EVRA 4GU5A 5A3JA 5K0JA 1WBBA 3TIGA 4ZVMA 1BMQA 2XQGA 4IMJB 4ZK2A 2QSUA 2HF8A 5FBHA 2X4IA 1EFTA 1VBMA 2ZRBA 3ED5A 3L7MA 2JVIA 3G2LA 3AFHA 1IZYA 1BWSA 3FYSA 2P2NA 1THMA 1Y80A 3AI1A 3N76A 3PVSA 1L1FA 4KI7A 4RM2A 4JU8A 4CMAA 4BIMA 3IV7A 4RX1A 4ZTZB 3HDJA 5IFKA 1PUXA 3N8NA 2XT9A 1Z9BA 1U0HC 3Q3CA 4TQUS 5EKTA 4JLPA 1C0KA 5FKJA 2RDMA 3PPVA 1ZONA 4HH3C 5H82A 3RR2A 2IH5A 3CS3A 3V8PA 1KKUA 4BB9A 2VDUE 5HF8A 4G1UC 1AXRA 3CLHA 3K2EA 2WJ3A 3SKVA 2Q9BA 4AKTA 2XD9A 3TGWA 2V7XA 4DAOA 4B47A 3TE7A 2VRBA 4MWSA 1R9JA 1VL6A 2IX3A 4CKWA 2G0AA 2R0QC 2ZIVB 3WLPA 4DJTA 2PG3A 3A31A 3ELWA 3LPLA 5E8JA 1XDBA 3REQA 1VYTA 4CKCA 5JWRA 3IV9A 3KB2A 3FMFA 1LQTA 5AP9A 4WFIA 5H3CA 1AKEA 3HM2A 1P39A 4D9NA 3SS9X 5JRJA 4OI0A 2O9JA 1YFLA 4ZZ3A 2NZ8A 1ZGJA 4GWGA 4CFSA 3LT0A 4WWHA 2F1IA 4F3NA 2BRUC 3FDZA 1P4GA 2F64A 2VAVA 3K1AB 4X45A 4JBHA 4ZO9A 5KTYA 2YRXA 2WQ6A 3ZIAD 3N3AC 4B8YA 2B1GA 3UYLA 4UDOA 3ET4A 2PY6A 1RWOA 1ZIXA 1ZXLA 3G8DA 4QYXA 3K70B 1K4KA 4WADA 2V54A 2FR1A 4EJMA 2DPLA 3DVAB 4QJ3A 1N2GA 4JLOA 4G24A 5H3HA 4EBFA 1NOJA 4TZKA 5IKMA 3K0SA 2FPIA 4L15A 3K4QA 1OZ0A 5F33A 4F3YA 1GPNA 4OXNA 3PNPA 4R7ZA 2DBQA 1WR8A 2AA3A 4ZC1A 1G8AA 4O4HB 3JWIA 1KIAA 1RCUA 2JFQA 2POCA 2FEPA 1DQNA 3OIUA 3QPDA 2YL2A 3CKMA 1WULS 1TDJA 1D09A 3QPVA 3TD2A 5BVHA 2VVTA 3KR0A 5AW8A 1V4NA 2M1XA 3DEHA 2ZRKA 4X20B 4Q1VA 1F2UB 1D0VA 2R62A 2VRWA 4UXJA 5CVEA 4F6RA 1NPDA 4RWEA 2VHTA 4GUDA 1Z22A 5G3YA 2O2ZA 4NOJA 3R7SA 4WX2B 1Z34A 4TV8A 2XRZA 1H6BA 4URYR 3UMRA 4XLLA 1FPQA 1FRFS 2PRKA 5J2UA 2GQ0A 4YO7A 2J0UB 4F38A 3K0CA 3ZNQA 3QG1A 3TFOA 1AK9A 4AT1A 1KKMA 1US8B 1YJBA 4JHLA 4L74A 4NZZA 1A9RA 3LHIA 2AB0A 5EJGA 3Q87B 4W9RA 1JLLA 3WLOA 1IE3A 4H0CA 4UAUA 3WWPA 2QV7A 2BHNA 4HFMA 3DCYA 3GD5A 4CT5A 5JISA 3IH5A 2WSSA 2BT4A 2VJKA 2IYWA 3PQ3A 4NBRA 4W5JA 4EY4A 5I7UA 2CT8A 5PNTA 2H1VA 2CLOB 1MOQA 2JVKA 4K05A 4UJ5A 4A8JC 1HE8B 1QG4A 2K7ZA 4WNAB 1V11A 3V5NA 2Q6IA 1DJNA 2RHHA 3U2QA 4QNRA 2F3PA 2IP1A 4NJOA 2N1BA 3W1EA 4B2YA 5I51A 1VC2A 1I13A 2R87A 3QUCA 1DX4A 2QE7A 3K3PA 3TTTA 3ZU2A 2DJ5A 1KAQA 1Y7IA 1ISRA 2RBEA 3GU3A 4L0DA 1TCAA 2G9UA 3PUJA 4Q1FA 8AT1A 1UOEA 3P0EA 4G07A 1XPOA 3WZLA 3F3YA 1RWMA 4FZVA 1VB5A 5IMSA 4CEHB 2A67A 1Y8QA 4R2IA 4YJGA 1U0BB 1KDPA 1BXKA 2GMWA 2C3YA 2VQDA 2W2OA 5LKAA 4WJLA 2G28A 4YCNA 1IB0A 5LIPA 4J9UE 4NR0A 5BUCA 1CBUA 2H4ZA 4LV8B 1Z45A 1OPRA 1V16B 1JDSA 3NC1C 3WHLA 1V6CA 4BYMA 3EEFA 1DBPA 5IBRA 5HWSA 2FMIA 1HFEL 3ZWVA 1Z56C 2X0KA 3EIUA 4LZAA 4H08A 2A9FA 4PN3A 1JJIA 5IFLA 3D4LA 4Q7QA 1EUDA 2OHFA 3JZIA 1YUMA 5BSMA 2R5FA 3HEBA 4FW9A 4MRSA 3AEXA 1PHRA 1CULC 3FB4A 5ICSA 5K6AC 1FRVA 2ZPUA 3Q41A 1OTHA 1ES9A 4FFNA 3CW2A 2RGCA 3GRZA 2IJGX 3FVVA 4EVIA 1K97A 1XRRA 2X3FA 2NYAA 2PGOA 3F6PA 2QRUA 3FCCA 4ZYWA 4G5YA 3KOXA 3ZH9B 3A2NA 1DCTA 2BGMA 2QMZA 4ARZB 3FNBA 4DQUA 2VHQA 5THKA 2HOQA 2W8ZA 2WWIA 4FGSA 4RAQA 4XB6B 1W76A 4R2JA 3MB5A 4JFRA 5G4KB 3WL7A 2H54A 1ECCA 3JAKB 2CJPA 4F4JA 3QV1A 5FI3A 3VFDA 3MRSA 4X8HA 3GXBA 2WMDA 1EWVA 2XTZA 4K9SA 2IHYA 2JI8A 1PQUA 1YFZA 5CB4A 3DEZA 4J8PA 3TCNA 1VE5A 1A9OA 1FLAA 1YDFA 2X1VA 3ONVA 1HDYA 4N39A 4BP3A 1FJGB 5KNCA 4Y2SA 1IG0A 3DBHB 4J7CA 2CL0X 1LNSA 1U4SA 5IXYA 2NU6B 2WF7A 1G7TA 1LLUA 1TZBA 2ZYGA 4RIGA 1XRMA 2WTUA 1REQA 2H06A 3OZAA 4OQYA 2GRJA 1G0OA 4KDEA 1Q21A 4E5NA 2PH7A 2PZGA 3I9KA 2FGKA 4PBTA 4YECA 3O8CA 2R97A 2NTJA 1TEVA 2JLXA 1VBNA 2Y9PB 1ZM2A 3EEQA 4LVOA 1DI0A 3AERB 2C99A 2HA7A 3A6KA 3CZPA 3I6QA 4UAGA 2H00A 3HCNA 5A4DA 1EM8A 2BZ0A 4HGPA 1SBCA 3TOZA 3U4DA 1TQDA 2MCFA 2OLEA 2LCIA 1IAVA 1JMKC 2B2CA 2R2GA 1A0OA 1JPVA 3KVYA 3LHDA 3C4QA 5DXJA 4AS3A 3DW1X 1I1QB 3LOUA 3S2ZA 3C5WP 1XNGA 4E22A 3LUAA 4JKYA 2JFBA 2P3SA 3KBBA 4WH0A 1RC1A 3L7BA 4TKVB 4YHBA 5CDFA 2QD4A 4D1YA 2BC9A 5DHQA 2J5BA 4CMIA 2BV3A 1Z6YA 4CKXA 3W3AA 4MAAA 4G0ZA 2OGUA 1N6KA 5DEIA 2Y27A 1OLUB 4QTZA 1FTNA 1NX9A 3M1LA 1Z6QA 1RPJA 4EHFA 5C53B 4CE6A 3V4RA 1VKOA 3MW8A 5C37A 3IO3A 3DHVA 3I9JA 1QGAA 3RTBA 3HZHA 4R2XA 2WSLA 6AT1A 4PN7A 3QOWA 2GSDA 3KZMA 3TD6A 4YBZA 2OC4A 1NUQA 4E7OA 1GTZA 3H8JA 4C2BA 4XZ3A 1NVXQ 1ADCA 3MFQA 1MC1A 4S1NA 1PKEA 1EGVB 4GGPA 4IMRA 4P53A 2R1VB 1GKUB 1GGEA 2GM3A 2GN4A 4X92A 3KZKA 1PZGA 4BNYA 3W2GA 5M2QA 2DH5A 5IBQA 1NUTA 1Z2NX 2NQ8A 3GEEA 2QBYB 4B7XA 5JTUA 5EZYA 1RAGA 2JKZA 1UAAA 1SC6A 1P4JA 2ZVDA 1MUUA 1HO3A 4X1IB 3WLAA 5MF6A 4NWIA 1PUJA 2NVUA 3UBTA 1P4RA 2N9UA 1KAGA 4HX9A 1P8AA 2C2MA 1YS9A 5JXWA 4JI4B 3HRHA 3PHCA 3BK1A 3JVUA 4R84A 2C5SA 4FONA 1QHGA 4LSMA 3O3NB 2N42A 4K6CA 4KU4A 4JI2B 4XVHA 4IQGA 3AFOA 3KLBA 4ZU1X 3V2UA 4PNHA 5AUNB 4R0NA 1Y8RB 1EXDA 1TKCA 1J06A 1X70A 3QVKA 2Z2ZA 3PGXA 3LKVA 1FYVA 4KFUA 3GDOA 4AO8A 2R6AA 1GG5A 3VNBA 1I14A 1FYXA 2CD7A 3K0AB 4MB2A 2ZR9A 4QASA 4JR1A 2BEUA 1ATZA 5DBOA 1CX9B 5IDWA 1DC7A 1P5JA 1MQAA 4K8OA 4KUGA 1VIYA 4R8MA 1GAQA 4CTMA 4A27A 3ASZA 1ZJJA 3F6SA 3RQIA 3L7JA 4QELA 3JV7A 2B2NA 1GPMA 2CGEA 3DM5A 4WCFB 2B98A 3BRWA 4EBBA 3ZKAA 1JSCA 3GLFB 3P9CA 3U3ZA 4MCHA 3HJCA 4G4GA 3R0IA 1W87A 4ZCPA 4DQKA 4I4TA 3KLPX 4P8RA 5TX7A 4FOTA 1CF9A 1JEDA 1FUUA 1GITA 3UT5B 3W8NA 5IVPA 1V9LA 3BH7A 4KPUA 5EHZA 1H2AS 3C7DB 4R8RA 1H4SA 5KDDA 1U81A 1V48A 3FX2A 4WZBA 2XLCA 1GV1A 4UEWA 2BN4A 2EDAA 3LGAA 1A77A 3SF8B 3TM5A 4PAGA 3R3HA 3TSWA 4W6QA 1TADA 2LBPA 3IQFA 4OHXA 2M32A 5D6OA 4LNUA 2UUAB 1YCGA 2YWJA 4ZCIA 2NO6A 1R9NA 2ISQA 1C3EA 3K9FC 2H1WA 3DPSA 3FHCB 1QCYA 4JB8A 1V2GA 4B6PA 4WUVA 4KN5A 3UOGA 2VQ3A 2JIMA 3ZHVA 2JDID 2ZYDA 2FLWA 3MJTA 2OM6A 2X6RA 2ZS7A 5EXEA 3RIGA 1NXWA 1DAGA 4MWEA 5K9ZA 2Q5OA 2WK1A 1GL7A 2ODQA 1OTYA 4LJKA 1KDOA 4EJFA 2E4VA 2VC2B 1JA0A 1O6ZA 1RM4A 3ZU3A 3BEDA 3RSGA 1A9TA 1Y63A 2H7XA 3R3YA 4PAOA 5K4AA 3QQ5A 4GPEA 1VKZA 4B3BA 1TD1A 4P92A 4RV9A 2Q1XA 1CP2A 4RUKA 4IOMA 2YUIA 1QH1A 3DE7X 3DXXA 4OQQA 1QRUA 2HEGA 4XE5A 2ZJBA 3EUWA 2HL6A 2RB4A 3WIVA 5IBPA 4P6VF 3OTIA 2OC9A 1GL3A 1TTHA 1E89A 1Q91A 3R5JA 4JA2A 4TTRA 1Y37A 1ZCFA 3CNLA 3NONA 3OURA 2ZB3A 5I8PA 3IKTA 3RVSA 1ECBA 5FTNA 2C5HA 2E0IA 2VG8A 4TTAA 5BQXA 1K8QA 1FFWA 3OZRA 4WBNB 3R9WA 1QRAA 5FI1B 3AJDA 4IJWA 2V7PA 4ZI7F 2B8TA 4RULA 3OCXA 2J3IA 4F46A 1OROA 3Q9NA 3ES9A 3F3KA 3ND9A 2VA8A 3V34A 3LQKA 3RROA 1H6AA 5K4GA 4TPKA 3BFJA 3C4JA 2ZDQA 4URVR 4WN9B 2W2PA 1YZGA 3M6FA 1OKKA 2QZSA 1U0OC 4RA9A 3S2GA 3QENA 5HUHA 5J1SB 4JMLA 1B0ZA 3TBHA 3B51X 3P9XA 5A4FS 4DV7B 1T9AA 4KXMA 4Y67A 5JADA 1IY0A 1ELOA 1A1SA 3HYLA 2RGDA 2ZJAA 5ESRA 3GROA 2QQ5A 4X63A 4CZ2A 4Q4CA 5K03A 4QYSA 5FI5A 3VPXA 2IT1A 2PX5A 5KKAA 3VHLB 4KNYA 1UP6A 2GI4A 2Z1MA 4MNTA 3UXMA 4YRAA 3U5TA 5K01A 3F90A 2ODEA 3PFBA 4IIJA 4KIUA 4F45A 1ZXBA 1SOAA 4XEHA 1SVKA 4MTCA 5IYZB 2R68A 2ZJZA 3EC1A 4ENRA 2XXJA 5AFSA 4Y3UA 2CMFA 1Q84A 1U7XA 3R6DA 3AWIA 3RH0A 3BJMA 3S5UA 3S2YA 4D8XA 5KYNA 2IS1A 4JLJA 4BFVA 4YJ2F 1FS5A 2XB9A 5EIEA 5FLXA 3PDHA 2O2HA 3NHKA 4BN5A 5KOJA 2NNLD 5EOVA 2JIOA 5F64A 4YASA 1BA3A 2EZUA 2XRYA 4HS9A 1Z17A 2AR0A 1WZEA 2N0SA 3AUJB 4DPLA 4DCMA 2J9XB 2NN3C 1R0SA 1FFXA 1P0MA 1KR2A 1S7CA 2ZKLA 2H1CA 3IVCA 3NT5A 4N47A 5JO0A 1W1UA 2BFDB 3RTCA 4ARCA 2X0IA 4LZZA 3NAMA 4KFSA 3SYLA 3ECAA 2XCIA 3A1TA 2JJ2D 2P2CA 4X95A 3S68A 1K3UB 2G82A 3C8HA 2OFXA 4M54A 4J75A 5B2ZA 4DWWA 1KWKA 4IX1A 4UD6A 3NWPA 5H1YA 1TM3E 4CM6A 1IN6A 4EGAA 4Z7QB 3NCHA 2F3RA 3QLJA 5EIAA 2VDNB 1G41A 1LUAA 3P2IA 3Q8WA 1Z68A 3KJEA 5FOUA 4UCXA 1BU5A 3INYA 4KQJA 1TK9A 1L8LA 3BIWA 3T3MB 1J07A 4LE1A 4TSFD 2RHLA 2W6PA 1P8JA 3V4LA 2I7CA 1L5QA 4HH1A 1QC5B 1XQXA 2YW2A 4XDZA 4BFXA 1GV0A 4C3VA 3PQCA 1N5DA 4HUQA 1WSDA 3KD3A 4X61A 1OQAA 1XEFA 4N54A 1IHUA 2NX2A 4NENA 3EQ2A 2D1TA 4LHYA 4TV9F 5F5NA 2D0PB 2R1UA 1Q22A 2UDPA 4H17A 4MYHA 5TJ9A 3IBCA 4KXWA 3BAFA 3FAZA 3R5SA 1KXJA 4PLTA 1BCRB 2GFQA 1PJBA 1EFRA 1Q7BA 2AI1A 2PGAA 2VJPA 2Z5VA 1IOZA 2C4TA 4RXMA 5K0SA 5KVSA 3HVRA 5A0VA 1QDLB 1F7UA 5IVHA 2EATA 2GCOA 1VSTA 3BN3A 3ST7A 5JVDA 1YZQA 3D7KA 1NXSA 3EY9A 3DP7A 2X9VA 5ESDA 2ONKA 1TA4A 4IM7A 2OFPA 2I22A 4DUPA 1HOXA 2GRAA 2J31A 4ND8B 3DAFA 4D41A 4YTEA 1RAAA 4HLCA 1IUKA 3RNLA 4BX2A 4DEYA 3A6ZA 2B4YA 3NW9A 3FROA 4FUTA 4O2BF 2G9ZA 1ORHA 1KI1A 1KQNA 5AYVA 4QXQA 2EYUA 5EKDA 4GO1A 4XM0A 1DU4A 4IYRA 2GLTA 4DYHA 3H5OA 4MMYB 2GO1A 3CNNA 3CNQS 3JARA 1RRMA 2AS0A 1JQKA 3F4KA 5IC6A 4MTLA 3CONA 4QDZA 5K09A 1U5BA 3HB7A 2OMKA 4MX8A 3WRYC 4IV0A 1OAAA 2V7UA 5DM4A 4EPVA 3WI7A 4LYYA 1XLUA 3KQOA 2XTJA 3PXDA 4B6GA 5HBRA 2OXTA 2RI1A 1X94A 2CCJA 5B5SA 3USCS 1DGQA 3RUAA 1KMMA 1RI5A 1SZCA 3LA8A 2ZWAA 2AOUB 1F8YA 1GZ5A 3NETA 5HKBA 2GXAA 2REXB 4P58A 1C4XA 2BGLA 2V8BA 2VCEA 3A9SA 1ZNQO 3KQWA 4FWTA 1IWOA 1ZD1A 3N5CA 4JI1B 3L18A 4S3MA 4URUR 3RE1A 5C4MA 1WB4A 3A1SA 2VPXA 3HA3A 3DOFA 3PUHA 4OQEA 3IJPA 2IHKA 2NU8B 3VR4A 2EFHB 2DFVA 1ODKA 4DLXA 4XQEA 3GGPA 1DELA 4Q4DA 3HTXA 4JLAA 3PDIA 1TCUA 1F0PA 2YICA 3BL6A 4DM4A 3BM5A 4PXAA 5BYJA 3VVMA 1P72A 3QBDA 4FYYA 5DH9A 3AVXA 3GRPA 1NVVQ 2CDBA 1A8SA 2R25B 1ZL0A 2FF7A 5D01A 4RTJA 3HVJA 3OC6A 1CUCA 221PA 3R20A 4H7EA 4RHXA 4GLBA 1ZSNA 2AN4A 4H7JA 3LJKA 4EO4A 1RZRD 1N78A 4QTYA 1GAXA 1Y1PA 1T29A 1M0SA 2I55A 3A04A 1RPZA 2HJVA 2OBFA 4KQ9A 4M8KA 5LDGA 2G25A 1TVKA 2H59A 2MMCA 2IS4A 2PX3A 1P60A 3BCSA 2R96A 1NQAO 3VYWA 2ZDHA 4LVCA 1P29A 3F98A 4L6CA 4QC2A 1YVRA 4QG7A 4CM8A 1ZCZA 1LRKA 2NUPB 5JMPA 3LC0A 3ZE6A 4M36A 4HSEA 4WA8A 3BEOA 1OV6A 4XGNA 4XSHA 1F1JA 3KDAA 4KMMA 3TLAA 3L1IA 1K3FA 1QB8A 1K8RA 2B83A 3F96A 1GG8A 2QG9A 4JJZA 3CSDA 4TXLA 1G7CA 3M2PA 5BVGB 1KU6A 3PCRB 2D8MA 1Q1GA 2XKJE 3SJZA 1U1IA 1U5AA 2B6HA 1DEAA 2WNSA 3WMWA 4DA4A 4JI8B 3FOAA 5I9TA 1I6MA 2AEMA 2G8NA 4MRAA 4J3NA 5CM8B 1R9MA 2D5CA 5HCUA 1B6SA 1Q0PA 2WE8A 4D96A 1LQUA 2WYUA 2GHQA 2W0MA 3LL4A 2IYZA 3TZQA 2ORED 3KFXA 4QZVA 3PF8A 4TSKA 4U5QA 3K70D 4BNUA 3FYCA 1O77A 2GEKA 3H86A 3JWHA 4RSMA 2H0QA 5BPHA 2CV1A 1GR1A 2VDLB 4GVXA 1J8VA 4PR3A 5TQ2B 1PW7A 2ZT7A 4Z4CA 4I50F 2WY2D 4RF4A 4MQ6A 4LRWA 1KHTA 3HDHA 1E5DA 1Z36A 1SG9A 2JJQA 2P8JA 2R48A 2GM4A 3DYBA 3HSKA 3K5IA 1MN6A 2PZKA 3VC7A 3AG5A 3BSSA 2COUA 4JODA 3D4BA 4FI3F 4ER6A 2C59A 4Z9FA 4MVWA 4PQGA 2W6JA 1NXQA 2M6KA 3T4PA 3GIDA 4V0SA 4PM4A 2EX4A 4MW0A 4OSEA 1XTUA 5CT6A 3L9WA 1ZH0A 3FUXA 5F1PA 1Z4OA 3K6SA 2FXIA 3M6UA 2ID4A 3GAAA 3ENKA 4ZC8A 1NOKA 1TF5A 2CHVA 3MQFA 2MYTA 1K06A 4CKYA 3E2PA 1ZU5A 1T5IA 2BRUA 4Q0MA 5T64A 4BQSA 4WESA 3EPJA 1EK0A 2COEA 2NW6A 2VSXA 4WIAA 1U9JA 3EQ7A 1I24A 3A1VA 3OF2A 4AJJA 1JG7A 4YAWA 1QO0A 3RRFA 2PSJA 3O47A 5KINB 3OOWA 1M83A 1EZ1A 1EFVA 2FUKA 3KJXA 3ZXIA 4K9QA 1HE5A 1RYBA 3NEAA 3A9RA 4G5XA 4IINA 4ALJA 4EYEA 2GF0A 3PFGA 4KI0A 5ILGA 3ON5A 1IY8A 2Q49A 3LECA 4UMFA 2ZB4A 1B6TA 2A9KA 3CNHA 3GW8A 1R0ZA 3LXRA 4DREA 1MPXA 1H9AA 1KEEB 3OX3A 4GL4A 5ULLA 1AGXA 1L7BA 3U4QB 3PUZA 5DT9A 4BNWA 4CPDA 4HTAA 3DAHA 4B3JA 2P3OA 3C1TA 3IPLA 4K6KA 1Q1AA 2FWMX 2OGWA 1QIFA 1XEWX 4BMNA 1JHPA 1QRRA 3T9AA 3V2HA 1ZS9A 2IXEA 2YVUA 4QHTA 3ZHRA 4MV0A 2VDVE 2VQSA 3MOSA 1PL8A 1SOWA 3DCIA 1RVV1 1W0KD 3SYNA 2PFGA 4P1ZA 3D6HA 4CT0A 1VL1A 3N0WA 4XUCA 4CIDA 2B4TO 2J3EA 1DBSA 1WQ3A 3EW9A 1GSAA 1R3UA 3E23A 1FFCA 4ZMBA 3DHWC 3BWVA 4I5DA 4NSNA 2FEKA 4ZZ2A 1Z5OA 1D9ZA 1X80B 2VK8A 1T0JB 2WPDA 4ISBA 4PLHA 3JZFA 5C4GB 2ATCA 3FMVA 2ZR0A 1JB1A 1N2JA 2X9LA 3NXKA 4UOZA 3WNQA 4LDJA 2DFTA 1O95D 3QBJA 3J7AC 1PLLA 4CMHA 4QJ5A 2B61A 2Q4BA 3JD1A 1C9DB 1VE1A 1LY1A 2JCGA 3FI9A 3ND7A 2O8BB 1ST3A 4GKVA 1IOWA 4ZKDA 3H1FA 2B21A 1TVCA 3UYKA 3L07A 1I3NA 3GJ6A 3E7PA 3GFOA 2CWDA 4YFVA 5IDQA 5K8JB 4FXPA 3EIHA 1YZNA 1YCDA 1S2LA 3FOZA 2AMLA 5IJWA 1SUDA 3WFJA 5EKSA 5CA0F 4BOYA 4WZAA 3FFTA 1JKJA 1HT0A 1MORA 1O2DA 1VM6A 4ZXPA 1KYWA 3RJ9A 4ATNA 4BQNA 3F0TA 1E8DA 2WABA 1XG5A 3QUAA 4XSGA 4KAJA 2VF5X 4DMFA 1P6XA 4RSGA 4HAUA 1R6UA 3S1SA 4OHYA 2WSBA 3E9YA 1ZIPA 3B3FA 4J7UA 1A8QA 2AE2A 3OE1A 1RCTE 3BDIA 3EAQA 3UXYA 1WTAA 1LLDA 4MPPA 3EXIB 3O38A 3CZCA 1C7RA 4QGAA 4RK4A 3IR6A 3TOSA 1QFSA 5FF9A 3KC2A 3KQHA 5HIMA 2Z9BA 1QQBA 1N8TA 2A4MA 1W5TA 2P9HA 4UTPA 1E6UA 1VMEA 3UWPA 1LLQA 2WLSA 2QRGA 5A5VA 1NN5A 3G49A 3OA0A 1P3Y1 4IHJB 2ZIGA 1ADJA 1JXOA 5DNDA 3BCHA 1KYZA 4FT4A 2ZJYA 4G4JA 2IIPA 3MAGA 3GFGA 2H0RA 2HNBA 3NVMB 3UJAA 1G59A 3JR3A 4J03A 2ZYVX 3CPHA 5BRJA 3DTTA 3IIIA 3IT3A 3KELA 5IAGA 3OZEA 3WIBA 5JHGB 2IBTA 5B12A 3ONNA 4DLVA