2G2NA

Crystal structure of e.coli transthyretin-related protein with bound zn
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
NILSVHILNQQTGKPAADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTGDYRVVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHYHVPLLLSQYGYSTYRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The transthyretin-related protein: structural investigation of a novel protein family
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords Transthyretin-like protein
total genus 25
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2g2nA00
1SN2A 1FHNA 2FLMA 1DVYA 3A4DA 4PWHA 4YDMA 5IHHA 4TQHA 3P3TA 3DIDA 3OZLA 2PABA 3GPSA 5CLXA 4ABVA 5L4MA 1TZ8A 4IKLA 2QGCA 4IKJA 4L1TA 4TQPA 1KGIA 5AKSA 3P3SA 5CR1A 2H1XA 4IK6A 4DETA 3NESA 4PMFA 1TTCA 3CFQA 2H4EA 3P3UA 3GRGA 2B16A 3I9IA 3KGTA 4HISA 4TQ8A 3NEOA 3IMSA 5JIQA 4HIQA 3CN3A 4AC2A 3BSZA 3SSGA 3DO4A 5K1NA 4DERA 3D7PA 2G4GA 1BMZA 2WQAA 1KGJA 4TQIA 4ABUA 4ACTA 1DVSA 4MRBA 4TNGA 5CNHA 2NOYA 1IIIA 2B14A 3P3RA 3ESPA 2QGEA 3IMVA 2G4EA 3CN2A 1G1OA 1TT6A 3D2TA 4L1SA 5K1JA 5A6IA 3KGSA 5EN3A 4N85A 4Y9BA 1QABA 4FI8A 3CBRA 4TL4A 2ROXA 1TTRA 4WNJA 3NEEA 4TLTA 3IMRA 3I9AA 3Q1EA 3DJRA 5AKVA 4PWGA 4TNFA 2B77A 3FCBA 1DVQA 1TTAA 3GS4A 2H0EA 4PWFA 4TLUA 3CFMA 3KGUA 3B56A 4Y9GA 5E4OA 3ESOA 5CN3A 1THAA 2H0FA 3IPBA 3I9PA 1TSHA 2H6UA 5E23A 5AL0A 2TRYA 4D7BA 3U2JA 2QGDA 1RLBA 2F8IA 4Q14A 1F86A 5JIDA 5FW7A 2IGLA 4PWJA 1DVUA 1TLMA 1IIKA 5AL8A 1BM7A 1E3FA 4PVNA 3A4EA 3OZKA 4TLKA 5BOJA 5CLZA 3DGDA 3M1OA 4WNSA 4YDNA 3IMWA 4DEUA 5CLYA 1DVXA 1SN0A 3IMTA 3TFBA 5L4JA 2F7IA 5FW6A 1GKOA 1ZD6A 4PWEA 1FH2A 2QPFA 5AYTA 4DESA 3GS0A 3CN0A 3HJ0A 4IKIA 4IKKA 4MRCA 1E5AA 3DJSA 4I87A 5L4IA 3CFNA 3FC8A 3DJZA 3A4FA 1THCA 3IMUA 4HJTA 5FO2A 2GABA 2ROYA 1OO2A 1SOKA 5JIMA 3IWUA 1IE4A 4Y9FA 3QVAA 3TCTA 1BZDA 1SN5A 1F41A 1QWHA 1Y1DA 2FBRA 2QGBA 4KY2A 4Y9CA 4N86A 3CFTA 4DEWA 4PVMA 4ABWA 4TM9A 4FI6A 5DEJA 5AKTA 1DVZA 1E4HA 4TLSA 1TFPA 1TYRA 4I85A 5TTRA 2G3ZA 2G3XA 5HJGA 1Z7JA 4PWKA 1IJNA 4PM1A 1BZEA 4QYAA 3GS7A 4N87A 1BZ8A 4WO0A 1X7SA 3CN1A 4IIZA 4PWIA 5L4FA 5FW8A 4QXVA 3W3BA 4QRFA 4FI7A 1ETA1 2H0JA 1ICTA 5CM1A 3IWVA 1ETB1 3NEXA 4HJUA 4IK7A 5DWPA 4AC4A 5EZPA 2G5UA 3DK2A 3GLZA 3BT0A 1U21A 1X7TA 2G2PA 3ESNA 3CN4A 3DJTA 4ABQA 3IPEA 2QELA 2B15A 1ZCRA 2G9KA 4MASA 4TL5A 4I89A 1SOQA 2TRHA 3NG5A 4HJSA 2B9AA 4TNEA 1GKEA 3CXFA 2GPZA 2G2NA 5E4AA 3U2IA 4Y9EA 4PVLA 4TKWA 4PMEA 1TTBA 4ANKA 3DK0A 1DVTA 3GRBA
chains in the Genus database with same CATH superfamily
5G4MA 1JNNH 1TVBB 3RYMA 3OKOB 4I4WA 4PJ7E 2CCWA 1PLBA 1MY5A 2BX5A 1N7ML 4XZ4A 3JWDL 3QEQA 4FQIH 2AXFB 4X7SL 4MJ6B 3EBIA 3A6BL 1F6LL 2ICWB 2NQ3A 1DZ0A 4OM1H 2EC9T 4JM2C 1CF8H 1ZDSA 4HGWB 1RQ5A 3HHSA 1EK3A 4ODTH 1F4YH 2GSIA 4HSCX 3GSNL 1E6OH 2F68X 5C0RL 3HBQA 1OZUA 4WUUA 4LP4A 3L9YA 4M8VA 4AMKL 4MA7L 2R9HD 5AYUL 3X14A 4AWJC 1LEGB 2AKRB 4G6ML 4IOFC 1SLVA 4WO4A 3T77B 3ZDWA 1DQTA 4U1MA 3FMGH 2AVGA 4L48A 4MCZA 1F00I 3MRLB 1M2OA 2VO8A 3EGXB 3ARGB 3N40F 3BH9A 3SDCA 3BSHA 3ZL2A 3ZYJA 1TIUA 4AH2B 5F6HI 4AIEA 3HAEG 5IQ9B 4XXDA 4XAKD 4IGBC 4JDEA 4WTXA 4ZO6A 5ICXB 4RNRB 3W9EA 1HWGB 3D69A 2CU9A 3V55A 3UC2A 3UL4A 5K39B 1IVTA 1JGEB 4PTTB 1L9SA 3SDXE 3AY4C 5DI8A 4Y2DB 3TNMA 3U0PB 3FBKA 4H20L 4YDLC 1KIQB 4W6XB 2ADJA 1KCUH 3PREA 2B1AH 4JY5H 1DSWA 4L4VB 5HHVL 4FNLL 2E4TA 2P3YA 3GMRB 4PJ7A 1J8HD 4QTIH 2JIXB 2WXPA 3NZHH 4BRVA 1JFQH 5DEFB 4OIIL 4OIAA 5ICYB 1RIHH 1NAML 1SEBA 4KHXL 1RCYA 3U0TA 1BD2D 5E2UH 4JFPA 1PFCA 4X5WB 1CDJA 2ICEC 3KL5A 4ZYKB 4GEJA 3CX5K 3IJ7A 1LO5A 4DUWA 3TEUA 4P8QA 2XWEA 2X0UA 3COOA 4FNPA 4L4JA 2NSQA 4XCNA 2J1YA 4XXCA 4IRZA 4BFKA 1KTDA 4ELDA 3B7TA 4ZD3L 4B9IA 1JHTB 4X9FA 3SE4C 4M6NH 1PQZB 4MJ4A 4QHUB 5J12C 3HEIB 5GRVL 4PM1A 1CYWA 1DQML 1Q0EA 2F54A 4I1RA 4MNQB 4R4BB 5LO7A 3VXTB 3NAAH 5H4ZA 3J2PA 3RFRA 1LP9B 1N64H 3UX9B 4M5TA 3BP6B 4UMSA 2Y25A 1A4AA 4V33A 4NQEE 2G5UA 4Q4IA 3U4BH 3T1WA 2GFBB 3LKRB 4FLRA 3EGDA 2O5ZH 3EJQA 1OCZB 5HYJE 1U2CA 4DW2L 4PB0L 1KPUB 4HWZB 4MAYB 1FSKC 4FXKC 3QHFH 1KN2L 4N2KA 4NO5B 4UUJB 4EAEA 4KROC 1R33A 2A99A 4Y88A 5A2JH 1UZGA 3O3BB 1QNZL 5DO8A 5HSFA 2QTEA 2ZWLT 4GXUM 3HUJE 4P2QD 1JHTA 3WJLA 3ULUL 1YY8B 1G6VK 3ARYA 5D7LE 2GCYA 2HYMA 3AS1A 4IBZA 4JY4B 2VLKE 1JHKH 4G6AD 3O4LA 5L7XH 3QC5X 4XO4A 3CMOH 3RURA 3Q43A 1AKJA 5DEZA 1OSPH 2K4WA 1U8KA 2VW7A 5GJTL 7FABH 1G7HA 5MHSD 1NBCA 4OIBA 5I0WA 2A1WH 5A16B 3G5ZA 1FZMB 3RAJH 1F13A 3OQRA 4RESB 1TJHL 1HEHC 2QPDB 2ZUVA 2C5DC 2R39A 5AOMA 2XTJE 2YD1A 1G9NC 4Y2DA 2BNRE 3IDIB 3D2UD 3RVTC 1QMUA 1LO4L 1ZV2A 5DZPA 1I1AD 5CBAA 1VB9A 2Y9RT 1EAJA 1KOAA 2CO6A 2WXQA 3OX8A 1RLBA 3BUDA 4YFDB 4NO3B 5IIEB 2BNRA 4HHGA 3ULVD 2R1YB 3TA3D 3UXFA 5I8OH 2J6EH 4KX7A 1E30A 3RZCA 1CPUA 1G9HA 1OARH 4F33A 4P5TA 2PPDA 4Y19E 5DD0L 3TF7C 5CU9A 1PAMA 2ZWNA 1LHZA 4JFYA 2OCFD 4URKA 1CFQA 2Z64C 4N68A 4OKVB 1QTSA 1XSIA 2WXNA 1WK0A 3MRKB 4NQEB 3V0IA 3O3EB 1AGFA 4K5NA 1I1AC 3NZHL 5FGRA 5JW5B 1RZJH 3TWCH 2K4AA 3MTRA 2DWEA 4MJ5B 2QFPA 3ZKSD 4S1RL 4XCYB 2CGRH 4U1HA 3TCLA 2Z3FA 3K8LA 5CHNB 3ULVC 1EO8L 2C34A 2CMRH 3ZO0A 1ZTXE 3G6AB 4P5SA 4KROB 3RWFB 1NANH 4AJYV 1FVDA 3SD2A 4HIPA 4IBTA 2KKQA 3I50H 2CR3A 3RFZA 2DAVA 3OQ3B 2OTPA 5EBMB 2ZUQC 3EOTL 1X7QA 2GI0A 1NIBA 2XPZA 3P30L 4R84A 4N0CC 5G4NA 4HJIA 2DQJL 3ZL4L 5KSAB 2XZCH 5D6CB 3HG4A 4A7SA 4XVOA 5HY9B 4MQXC 4X0KB 1SPDA 4HJSA 4BK5C 3U2IA 5LNGA 5EBWA 4D0BA 5J1SC 1I8LA 2V6HA 3ARSA 2UX6A 1JV2A 3TO2B 4PBWD 3IFNH 4J6RL 5T33H 3CZSA 5I9QB 2A2QT 3CLFH 3D07A 5FGBC 3GMRA 4F9LC 2C4FT 4CMMB 1CT8A 2OLDA 2X4TB 2PTVA 5C0IA 4N20A 4KC3B 3UAAA 4PREA 1VFUA 4RAVB 2OR8A 1OOAA 3ZE0F 4JN2B 3V0WH 1M71B 2B16A 3DMMA 2BNQD 3CSGA 4PRHE 5CSZA 1BVNP 5DQ9B 3T3PE 2OMZB 1I7ZA 3N0AA 4Q9RL 1D7DA 1AR1D 1SMAA 3GSWB 1UM4H 5D7SL 2QGEA 4WK2B 3V5DA 1W0WB 1MCOL 1KB9J 5IEKB 1WP6A 3BFOA 3U0WL 1YYLH 2NXYB 4FQCH 3FSWA 3L45A 2P80A 1U58B 3MRCB 3WMSA 2F5AL 2R1YA 5BRZA 3E1ZA 5F9OH 2ZD0A 5IT2H 4M1GH 1U8IB 1N8ZA 1NWPA 4TV3A 1JYNA 3ULUF 4F2ME 1CLYH 4JFVA 3SGDH 5MEND 4NKDB 2WZ5A 2WGNB 1ID5I 2CHXA 5ECGA 3TA3C 5EV7A 1UTDA 3ZZLA 5EPMA 4LNRA 4DWHA 5BQ7A 1HDMA 1S3KL 3DX8B 4XNAA 4QOKD 4RGMB 3LZOA 1X9UA 4ODXA 4N22A 3SKJH 2V7HA 5A7EA 5IVOA 1M42A 1NUNB 4MS6A 1X6NA 1MFDL 4W4NA 4IKKA 4ZO9A 5C0GB 1OANA 2VABB 5I1GH 2B4CL 4R2GB 2FIRT 4TUOB 5AW2B 4AV0A 5DZOA 4K2UL 2AEWA 3B2DC 5DDHA 2WO2B 2X0VA 4JRXE 5D72L 1AGBA 4PJAA 4FG4A 5DHDA 3FO0H 1W6WA 2VNCA 2WN2A 4LKXB 3TN0D 4ELME 5L8JB 5ILTH 3GM8A 4GXUN 1OK8A 1YEEL 1L5GA 5KVEH 1NEUA 5AKTA 3DIFB 5CEYA 4YHKH 1DL7L 3ZTDC 4JNXA 1HH6A 6PCYA 3QORD 2F53D 4ZMPA 1XIWB 1ZLVH 1L3WA 5MP6H 3LKOB 4N2OA 2E3VA 15C8L 1GCFA 4L5FH 4D9RD 3BEVA 1HXMA 5M95B 3QDGE 4TPRL 2YGPA 4ELKB 2YQ3A 2G9KA 4HS8L 1QTYT 3PV6A 1EHLH 4MDIA 2J71A 1O5PA 5I82A 2CO2A 5I0DA 4HXAL 3DK0A 1U6AH 1G9ML 3BP7B 3T0EB 1BZ9B 3RPIB 4MSWB 3PWUA 4TQHA 2ZOWA 4QGYA 3ZPDA 4AE1A 4FA8A 1YY9D 5L4MA 1UWXH 4IKJA 1J5IA 1YYLL 3B5GA 1OGPA 3GGWB 2M83A 5A2LH 4GNKB 5I1EH 4JHAH 1DSYA 2F1BA 4N9OB 3KPLA 4HIQA 4M8QA 2C3XA 3HE6B 4MJ5A 4QHMA 3RWHA 5KVGH 4JG0H 4MXQC 3E6FB 4J3OH 1JGUH 1NCWL 4R0LA 2AK4B 4WTWA 1N19A 4JFWA 5FUOH 5DVPA 5KZCB 2BY1A 4I18B 4QTIL 4HIJB 1N5AA 1KT2B 1MCWM 3BN9C 3MUJA 5EORH 4KJWC 3QCUL 1EH9A 3VQMA 1Q9LB 3STBA 3LXBA 1U8QB 4OM0L 4XP6H 3X14B 4HOWA 3ELAT 4YDIL 5F6IC 3CVHL 3D51A 5DK3A 3FU9A 2WIIA 2WOYA 3HZKA 4UCFA 1JZ3A 4PJCB 3VGFA 3RLSA 2G5BA 1S9WB 5E23A 4M8QB 5I6KA 3LN4A 3AXLB 5C0BE 5AALA 3STZB 2VDQH 4CSPA 4TVPL 1E67A 2LGNA 4NYLB 4R5VA 4YPGB 1RK1A 3QFJB 2E75C 2FLRT 3CVHB 1A0QL 3KDPB 2NTFA 4FJYA 4F57H 2X6AA 1W0VA 2XWZA 3ARBA 1ZHNB 3PPSA 1D5MB 2QHLA 2YRZA 2Q0ZX 1SHMA 1W9XA 4NN5C 1LQSR 5FPIA 3MV9D 3SKJL 3X13A 4F7KA 1U8JB 4BE6A 4XMVA 3VH8G 4F3FB 1QYGL 4G8GD 1J1XL 3EXJA 3GMPA 3IAPA 5FV2A 1FFNA 1S5HB 2DDQH 4M5YH 4DF9A 3KM1A 1XGRA 3RUGF 4XZUB 3B8SA 3RJQB 2QL1A 3FN3A 2UYLA 4JZNB 5I23A 1IJNA 1T20A 1UWEH 2VWEE 1ZE3H 5F9WB 2VLKA 3WFBL 4N6RB 3MUHL 1RUQL 1ZVHA 2CKBL 1AQKL 3NPZB 5F7DA 5TE4L 3STLA 2UXGA 2YKLH 4KO5A 2D4DA 2ICCA 4PGJA 3IS1X 3KDMB 1UKSA 1IB5A 3B9KD 5LAXA 2R7EA 3D87B 2VMFA 1F2QA 3TN0B 1S7QA 4HZLB 1NCCL 3JVGA 4P46B 1OM9A 1MIML 1HIML 2HTLC 4RDQG 1TDQA 4CNIB 3CSYA 5I6PA 1IARB 4ODXB 2HPOA 3BP4B 3VYNA 1I7UB 4HJGB 4R2GD 2VDQB 4R7NB 1XGRB 1N2RB 5JHDA 1RHFA 4Z0XB 2GIMA 2OKMA 3ATEA 5CS7A 2G3MA 4GFTB 3QPXH 3AY2A 3FQ1A 4O2EB 4LRNH 3JV6A 4EN3A 4OD3H 2A73A 4AKQA 1JZ5A 5IHUH 4YBHA 2BK8A 4ZMAT 3NIDF 2XG5B 5BUAA 2A9AA 1A4KB 4QIRA 2GJ6A 4Z7UB 3U1QA 1RK0B 4K5PA 4MZ2A 4PJ5E 4HWUA 2ZYIA 2UWEE 3PUCA 1JWUA 4GLRI 1KWGA 4UOZA 4FNQA 3SO5A 3FN0L 2DI8A 3LH2H 3TYGH 2NY1D 4DN3H 5F72S 3HC3L 4MB1A 4L0PB 5DJAB 5FYJU 2A83A 5CJXA 3VXSB 1AJ7L 1E28A 4LQFH 5GGRA 4CVUA 3HS9A 2JJVA 3HI6L 4YWGH 1MJ8L 2UWEA 4PWFA 3B3IA 3KGUA 3MX0B 2VSKB 1EJOH 5AB0A 2ESVB 3IFPB 4Z7WB 2C3WA 3JV6B 1BGXL 4Q6IC 1KGUA 1IBHA 2XVBA 4P23C 4BXVA 2Y07L 4EN3B 3TO4A 3N44F 1Z9LA 3WFHA 3P3YA 5IT2L 2E7MA 1LGVA 3V8OA 1CJYA 3FUHA 3N85L 3UOAB 3ZT6A 5EU6A 4DKAA 3HZVA 5J3HD 1UWGH 1P5UA 2IH3A 1OT4A 3BD3A 2JKSA 3O4OC 3KVQA 3L4XA 2I9LB 1LO3H 4NZTL 2Q8AL 5E08L 5TFSH 3ZKXC 5E8EA 5DUPH 2OYKA 1E3XA 2E7HA 2HVKA 3QWOB 3TJHC 1F1GA 1THCA 1DTUA 3AFLA 5AOLA 4M5ZL 3HE6A 2BVUA 3QFGA 1VFOA 4IOIB 3D39E 1WHOA 4Y9FA 2P8MB 3MRBB 3WDHA 1S3RA 2EDJA 4J3OF 2RJMA 1I8IB 2F7PA 4AV5A 3I02A 1BREA 2OTWB 4NNYA 5E9DB 1ZT7A 1V3KA 2ZCLH 3O3BA 4ZFOL 4BUQA 1FZKA 1D9KD 1ZK9A 5FKPA 1U36A 5IJBC 1ORQA 4AXWA 1U42A 3EXLA 4HZLA 2FEDD 3DVGA 4P46A 3U9PL 4PCKA 4UNTA 1XH0A 2YD6A 4ZOEA 3WEXB 3DSFL 4RETB 1XGUA 3SCMA 4JY6B 3AAZA 2NY4C 2ALAA 1RZFL 2QVIA 3CZGA 2VXUL 2CR0A 1LO5B 4Z3TA 3D06A 2ED9A 2V3EA 2H8PA 4H2AA 5DK0B 4O02B 5C92A 1E43A 1K2DB 4RGNB 2WNGA 2HKAA 3ZR5A 4XCEA 4ACPA 5ACZB 3VB9A 1NAMB 4PJGA 1JCVA 1JHKL 2H26B 1TTUA 2UUDH 1DFXA 1PY4A 3NBNA 3I02B 5H37A 2DQUH 2HTKC 1NQBA 3FRPG 4ZMXA 4GRLB 4WI7A 2ODHA 4DGUA 5DD5H 4ONGL 4F8PA 5B3SB 4P46C 3PWLA 4WW2C 1L9OA 3HI1B 5K1NA 4CMHC 4JFUA 2HVJB 4AYFB 5IHLB 2X1WL 1UM5L 2HMID 1ZSHA 3QG6B 2BVPA 1FNAA 2BY0A 3OJDB 4JHAL 4JFTA 3CU7A 3VM5A 4PB0H 1AD0A 4R96B 1N7MH 3SKMA 4TL4A 1ZT1A 4TLTA 4TUKL 3F62A 3BUTA 4MD0A 2BNUA 2H0EA 4JFEA 3ULSA 2W88A 4JRXA 5PCYA 1UGKA 2BSRB 4JLRA 4M7KH 4M6MH 1MY7A 4N0YL 3DX6B 4MB4A 1MI5D 3LKPA 3K91A 4JPVL 3ETTA 3TVMC 4UIKH 1BDYA 4XPBL 2VL5A 5T3ZE 5IQ7L 2VH5H 5BOJA 1GH7A 1T89A 3OAYH 1ACCA 2DH2A 3N50A 2CDGB 3WE6A 2CIKB 1G7HB 1RZ8A 1MHHA 4GG6A 1BYOA 1OGTB 4UBDC 2X2JA 2UY6A 3E1F1 5LQBH 4OCSL 3HG1B 4POZD 2IVFC 4NPYB 2PR9A 1MFBH 1WRFA 4G8AC 4MD5A 3UDWC 1J8KA 4R90H 1XGUB 5B4MC 5HGAA 3TVMA 3BP6A 3O2VH 2XJLA 4G8EA 4TUJB 4JUSA 1T80A 1R34A 4N0UE 5ABDE 3LS4H 5H37G 4F1SA 5JW4R 2ZZUT 4ZS6C 4NQXB 1S7WA 3UIYA 5DJ8B 1E4WH 5DZAA 4BINA 5IWLC 4KU1A 1R3JB 1A22B 5KVFL 4OCYH 1T89C 4A2GA 4NKQB 3V6OC 1UFGA 1DN0A 4M7ZC 1H3TA 2XETA 4WTZA 3DRTB 1VACB 1BEYH 3RIFK 1O6TA 1SFHA 1M7DB 1UXSA 4UDTB 2LFGA 4X4ME 1I8UA 2YHGA 4OZIA 3QJFB 1KGCE 3MLVH 4E41E 1JWSA 4MQ7A 3QUZC 1JZEA 4XBPA 1ANUA 3QDMD 4KNQA 4Q6IB 3FNKA 3GIZL 4NQXA 4EN3C 5L8KB 1XGZA 2I5YL 2JQZA 5GRWA 2BJMH 1C1EH 4FLQA 4ADIA 2FH8A 1HHHB 3PWJA 4LLAA 4TTDC 4OFPA 1YAIA 5D2LB 4GSDH 5MEOB 2KC0A 3B37A 5IROA 2K7QA 3QZNA 3BIKB 1NLDH 3DV4A 3S9DB 1HE8A 2IBZX 4JFED 5L2JA 4JRLA 1YO4A 5C86A 1MJUL 1QO3A 1TNNA 1GTNA 3SPVA 3QFDA 5L0QC 3K4ZA 4KHTL 1UM6L 4MZ3A 1LDPH 4WY7L 1WLHA 3CHSA 4QRTB 5GHWL 4YXHH 4Z3IA 1A9VA 4PRHB 5AOZA 1KIPB 1SBBA 4NO3A 3PHOA 1EEYB 1I85A 3KPSE 5GJSH 2VDLH 1ZJAA 2AQ2A 5EU3B 5CWSA 2PP9A 2WXLA 4IOSA 1AKPA 3UYOD 5CR8A 2WLLB 3DHMA 1ITBB 1IEHA 5IV2A 2YD4A 4M1DL 4N0UB 4FNUA 4JJ5A 1GL4B 2HJFA 2W8CA 2O5YL 1M56B 4BSWA 4MQSB 4H2CA 4PJGB 3HE6C 3V0FA 2YR3A 4F2MB 3NA9H 2E6PA 4UBDD 4X99A 3EJPA 4HIIA 4AQOA 1J9QA 1G6RL 1UWYA 3ZMEA 1KCRH 2MOVA 3LNHA 5JXEC 2JXMA 1ND0B 5LLIC 1OGAD 3PV6B 3RIAK 5LG1A 2YBRB 4P2OC 3FT4B 4MZRA 3QUKA 3MUZ1 3O9WB 1KB5A 3GRWH 1DUYA 3BKYL 4N86A 1AE6L 3E8UL 5I0VA 4PJCF 4U7KA 3OPZL 1LD9A 4XMPH 4PRNB 4K4KA 2MTAA 3FTGA 4G80B 3C5JA 1Z1WA 2W9LA 3NDZE 2B08A 3D39D 4H13C 4ATTA 4G6KL 2W81C 1YEGL 2J8HA 1XD1A 4Y16A 1TQBB 4HIEB 4LQ1A 3ZTNL 2YIHA 5D1QA 3FQYA 5D5ME 2Q8AH 5JXED 2AMUA 5FF6A 4BFEA 4HMCA 1Q9OB 1E4KC 2XWBA 2GTWA 4U3CA 1KCWA 5DJDB 3P9LA 1C1EL 1OTUD 5KVDE 1T66C 2VIRA 3QAZB 4C83A 3FT4A 2VLMD 4I2XB 4BJLA 3UYRH 3ROLB 1KCKA 5IEHA 2JB5H 5LVEA 4LP5A 4N3UA 5DC0A 2WV3A 1BAFL 3ZT5A 5I5RA 1JF6A 5TDPB 3AXHA 2VDLB 2XQBL 5LBGA 4FFWC 1BQLL 1UCTA 2DH3A 4PLJD 4F33B 3RY5A 3RDTB 4YWGL 4L4TA 5AWNL 1LD9B 2ICES 3MJ8A 3AG1B 4OFYD 1A3RL 4HKBB 2DTMH 4PV1C 4K9EH 4M3JA 1NGXB 4K5OA 5BW7C 2D7QA 2DIEA 4JDZA 4L4TE 3MNZB 3GEWB 3H0TA 2W65A 1EEYA 3BMVA 2WP3O 1NFIA 4LCWB 5EOCL 3VFRB 1U8IA 2SODB 2OR9L 2XN9D 3WS3B 4X4YB 1KXQA 2BY2A 3UTQB 3KGSA 7PAZA 1T1WB 2WYTA 2EIBA 5F3BB 4G8GA 2WBJC 5D1QD 4X7TA 1YPZF 1RK0A 3QQ4A 4RA3A 2OJ1A 2P8PB 4I48B 3NN8B 2CO3A 4G7YL 1S7XA 2EDXA 1SHWA 2GHWB 2Z4QB 3LEXA 5LDSA 1JK9A 2MPVA 2XY1A 2WUCL 2Y7OA 4P2RE 4TSCH 3OKLB 2EECA 4U0RB 1UA7A 2UWEB 4KRMB 2EDFA 1OQOA 4P57B 4Q14A 2YKLL 4Q52A 2MQ0A 3TWYA 4YBQD 2YAPA 4XNDA 4BRJA 4I77H 4OGXH 1S7UA 4Q6IA 2K6ZA 1K5NB 2HT4D 3AXIA 3S5ZA 2HAZA 4HIHA 3HE7D 3CAFA 3B7YA 5C71A 4JREB 4XXWC 3UZEA 2H47C 3QFJE 2I7OA 1OLZA 1YNLL 4JL1A 2F7OA 4GI9A 5E00A 5MEOA 1NM9A 2EDQA 1TEFA 2ZICA 1O5DT 5HD8D 3FU7A 4P3CL 4D9LL 4DP6X 2NDGA 3ULVH 1N5YL 1N4XL 4FERA 4APXB 5EBLB 2ZONA 1JVKA 4Z7WF 1FL6B 1E42A 4I0PC 1ML0A 2UXFA 4AYSA 1RZ7L 3VXUB 2CAKA 4ELMF 3DOHA 5EZIL 1LO2L 2F2HA 3CDFA 3L4UA 4G8GE 2WANA 3O4OB 4Y5YA 3SE8H 3VWKB 4B9KC 4BUHA 4DZBA 1JFQL 2DOCA 4GKZB 3MV9E 3DMMC 1E4XH 2ATKB 2F18A 5GSRA 2N0KA 4FXGC 1E7VA 4G5ZH 5AVWB 3WG7B 5I1IH 4I1PA 2Z6FA 1OP4A 1M2VB 4HA1A 4ENED 1U21A 1MVUA 1ZSDB 1CDGA 1WG3A 2AQNA 4OZGF 4C58B 5ANHA 1AOZA 5E00B 3M6DA 1QRKA 1XDTT 3NRFA 4PS4L 4M6OH 2EXYD 1DBAL 2UZPA 2KLRA 4AK1A 4Y89A 4HWEH 4O4YL 4L1SA 5G5DA 1FRGH 2GIXA 4MJJA 1MHEA 5K9QI 3QHZL 1QPPA 3F6IA 5TF0A 4DCQB 1GOGA 3OMZA 3FT9A 4J27A 2GJZB 1E27B 2VYRE 5FHAH 3NSYA 3I75A 1EEUA 1XWVA 4UYQA 3P77B 3BC9A 1PG7W 3D0LA 4KK6C 4XOCA 5HHXL 5EEVA 4KXAA 1LE9B 3HI5H 2YSSB 3X2QB 3TNNA 5AAPA 1KTJA 3PG2A 2GJRA 3QB7C 4M62H 2VZOA 3HZ3A 4PCTA 2R69L 2PETA 2EYTB 2LU3A 2OSWA 1CXIA 3QO0B 1CBJA 1NMAL 4AYBA 3E6HA 4B9GA 1KDIA 4APQD 3T09A 4WWNA 2HFFB 2NR6C 1LDPL 4X6DB 4LP8A 2NNFA 1YEJL 4AZUA 5KBNC 1HHKA 3KPTA 1NPJA 3WKPA 2BVPB 1Y7VA 3CVHA 1XHHA 3ZU8A 1ZTXL 2QLYA 4XCCH 3QXTA 4JQIL 4Y2LA 4BSJA 5JDSB 2GUYA 5KVDL 2LU4A 2FATH 1INEH 4B3EA 2KZBA 4O2EA 3UADA 4HJEA 1JPFB 1LO3L 3HJEA 4NZTH 3GB7A 4Q9BA 5FO7A 2BNUB 1N8ZB 4JFEB 4V11A 3FUEA 1D5IH 1UA3A 4S1SH 4L8CA 2YD3A 4AQ8A 2YXVA 1I9JH 3GFUA 1P5VB 4YSCA 1AS8A 1KCRL 3ECWA 2OP4L 4X5XA 5FKAB 1NICA 2D03H 2Z92B 3EO0B 3GJEB 3OB8A 4XP1H 5AD0B 3H56A 3V5HB 5AZUA 4DO4A 4CVWA 1KFAL 3WELA 4X4MA 1Q0YH 3V4LA 3G6DH 4U2ZA 2F53E 1MELA 2A5UA 4PY8J 5HPMA 1FZJB 3S36X 1TCRA 3C6LB 3UJTL 2QGBA 2ZCHH 3BAKA 4RZKA 1EDQA 3FPXA 4P99A 4TM9A 3TPUA 3POHA 4DN4H 4JRXD 3FQRA 7FABL 1XFPA 1AXTL 5TTRA 2G75A 3LQMA 2VLJB 4XHQA 3PABA 1KLUA 3G7TA 5GIRB 4BBWA 3JTBA 3TOPA 3TN0A 3TBYB 1GGIH 4TTGA 4D8OA 5CKAA 5C0CB 2ZUUA 3Q5YA 2R1WA 2WW8A 3BLPX 2FGWH 3V5HA 3BCDA 3MPCA 5FA4A 5DHMC 1T83A 3WV0A 1VEMA 1JGDA 2GK0B 3IB4A 3AGVA 1MAMH 1XF4B 3D2UA 1SNRA 3KLKA 4G43A 1S7UB 2X9YA 5J4MA 1ZHNA 4ABVA 4LASH 1V5JA 2HLAB 2HZHA 3IDXL 4OZGB 3V0VB 3VWJC 1JPEA 4HX1B 3RWGA 3MLTA 4ERSH 4GT7A 3ARFB 3WEBA 2EC9U 1XBRA 3BP5B 4PRBB 5DD1L 3B1TA 3ILDA 3PAUA 3IMSA 1DZBA 1UD8A 2PXYB 2ZG1A 1CK0L 4L9DA 4MRBA 4LAQL 1IQWH 4KI5E 5HYQB 3O8XA 5HDQH 3NFNA 3L4YA 2ZTBA 3MREA 4OCNC 1DANT 2B0SL 4RISL 3IXAB 4F7CB 1WZLA 3NP4A 3P9MA 4M9OA 3RBGA 3CBRA 2VSMB 1QSFB 2BNQE 1P7HL 1DQIA 4LPUA 1DVQA 1RIVL 3N43F 5IB4A 4JHVA 4ADJA 5CZKA 3W5MA 3OM3B 2HT2D 4IRJD 3FT2B 2DWTA 1N67A 4KZCA 1ET7A 2JB6B 4TF4A 1PZDA 2BNQA 1CFBA 1NC4B 1RZQA 3Q44A 5DVKA 2CKBA 4DFHA 3OKDB 1V8HA 3OAUH 3O2VL 3PHOB 5DD5L 3ZE0B 3RZCD 5AW5B 3VMOA 3QW9A 1XTLA 3PP3K 1PX8A 1BM3H 3KPOB 4BA0A 3NH7H 4F15B 2HX8A 2O5NA 5D7JA 5C09D 1FH5H 5LGHH 3TO2A 1NA8A 2F54D 3HNSH 3I84A 3EUUA 3OJ2C 1CGYA 2VDOL 3BW9A 1A7QH 5EG6C 3LMJL 1ODAA 3QZLA 2V33A 4EUPA 1QSVA 2DRUA 2E7BA 3WHE0 5BOPA 4HEPG 1U92B 3RZCC 3X3FL 2JMRA 4KXZH 4RGOH 5BOZG 1JNJA 2WKGA 3FCSA 4DSYA 1FJ1A 1NIEA 2G2RB 4PJFF 3TWCL 4Z3JA 4NUJA 3FB8A 3BN9D 4PJ9D 3I6KB 2ZKMX 2CO4A 3EHBB 4PCYA 4YC2B 2CJUH 4JCMA 1LXMA 4N2MA 3HC0B 1DO6A 3MGTA 4XO3A 4YE4H 3HUJB 1Q0XL 4GQPH 1BVZA 1SJEA 5D1ZD 4L8DA 4FC3E 2C1PA 1Z9PA 5TD4A 1FNLA 4L29B 3WN6A 5INDA 4NHUB 3ZDXB 3S96B 5IFHH 2HKFH 4ZZKA 2H3XC 4YOKA 1OGTA 4A2MA 3BKCL 2OJZH 3SOTA 3ULVE 2AABH 1MFEL 3CZFA 1IZJA 3GM0A 4LCCA 2DQ6A 2JIXA 2VZVA 2WMPB 5ADPH 4AYMC 3PXHA 1DQDH 4ONGH 3HZVB 3L1FA 4Z5RB 2H41A 3W0WD 4Q74A 1YMHB 3H3KA 2BNRD 2R23A 2X1OA 3F3HA 3EJTA 2XTJD 5DHVB 4L3FA 4JFQA 4TPRH 4LGPB 2P8MA 3MRBA 5EZLA 4AQ8C 5I15L 4BFIA 3MA7B 3CN3A 3HAEB 3JV0A 5EC2B 3HC4H 4F7EA 3G5YB 4LFHG 4QXWA 4K7PH 3OHMB 4WSGA 5KW9H 1EXGA 1LWRA 2BVTA 1QLFA 2A77H 1D7FA 3BAJA 3ZZ1A 4F8QA 3ATDA 1AYOA 1A3ZA 5A6IA 2ZYHA 5MHSE 2EEAA 4HAGA 3L9BA 4F9PC 2CHNA 3KL3A 3PUUA 4J4PA 2AAVA 3JVGC 4E5XG 1K8IA 2VLKD 5I75B 1KIRA 4N2EA 1KJ2L 1S9YB 2PWGA 1MHPL 5H94A 2GI7A 5D7LD 3NK3A 2J12B 2WPGA 3BT2H 3OX8B 4KK9D 5EOQL 5FLUA 1TKWB 2FHCA 5BZXA 2D3JA 1MRFH 3JTSB 4F1ZA 4GS7C 4U4IA 2YXMA 5CBAB 3I9PA 1R0AL 1A6VH 4M7ZB 4D7BA 4JN2A 2YWYA 4HS3B 1UC6A 4P48A 4YFLI 4NCC1 1F86A 1CMOA 1MWOA 4Y2OB 1AAJA 4FFYA 3VFTA 1GY1A 2YFNA 3IDJB 3BZ5A 2H1PH 5HYJD 3IDUA 4NZUH 4NJAL 5J1TC 4JG5A 2D7PA 2UUDK 3SZ6A 4I3SL 3U46A 2F15A 1XH2A 5JYMA 3ARUA 1WF5A 3DTXA 1HHJB 4PGDA 4UT9L 4X4ZA 1IFHH 3E3QC 1CLYL 1KPVA 4D8PB 2G0KA 5EUOA 4WI3A 2BDNH 5TJWK 2YGVA 1OCWL 4JO8A 2LHAA 3ZKMD 1SN5A 1SJEB 1FG9C 5HVFB 5DF0A 2NT0A 4DEWA 2ITDB 2ZWKA 1X7QB 2WUCH 4TSCL 4XNUL 4XTRD 5FOBB 3FTXA 3EYFA 3AY4A 4LLYA 4PQXA 4PJBE 5JNYA 3BIAX 1V7NL 2XG4A 5F0LB 1KLGA 3FK3A 2FATL 5BV7L 4FZ8H 4YBQC 3AB0C 4N1HB 1PY0A 4JPQA 4HZ1A 3IGFA 1I8IA 4YDVA 3D0VA 3DX9A 5DVOA 4IK7A 3OXSB 3O4LE 2PYED 1X7TA 1AO7A 1PSKL 5HY9A 3D5OF 3P73B 4FNSA 4PRDB 4WI6A 3V9FA 2AS5M 1IC4H 3QP3A 5F7EH 4CUCA 4M1CC 1PLAA 2EDYA 1OAXL 3F12A 4X9IA 5HJ3A 3RL2A 4HSQA 5EWIL 4XPHH 5E1AA 2CHDA 2DPKA 5EULV 4G80A 2YEZB 2VERA 1Q94B 5E2VH 5FOBA 1CI5A 3SYCA 4XNXL 1C12A 4AL8L 4XVTL 1NDMB 1BP3B 5AWNH 4ZW7A 1NBVH 2HH0H 3B2UC 4ZS7H 5H35A 4MD5B 2WSDA 3DI3B 4MVBC 1OPOA 1PKQE 1KIUA 4L23A 3UBXI 2Z4QA 3N1QC 5DMIL 2FEJA 5F1IA 2F58L 3WNOA 1M53A 1PG7L 3DO7B 3IMVA 2IBBA 1G1OA 1OWWA 4QRTA 5LGJB 1A47A 3H7BA 2YOAA 3EG9A 3PWPA 5KSUA 1DSFH 5D5MF 4C4BA 4XNZB 4K5MA 3QG6A 3ZHKA 2OI9C 1RZJL 2WLLA 3EDDA 1YQVL 2OXHA 4FN0A 2AJYH 3FFCA 3QQ3B 1TEGA 1BLIA 1I1YA 1NGXA 2P5EA 4FQ1H 4GQ9L 3RGVC 1QI3A 1YYML 4G2AA 1GGYA 2APSA 2AK4D 3FSZA 3KHOA 4LSRH 4MD0B 3U36B 1LO0H 2Z65C 1PZCA 3RGBA 4KO7A 1YDPA 3FU0A 3L16A 4HLJA 4OBSA 2VITB 5BZDA 1QLRB 4LRIA 4WNSA 1FO0L 4G6JL 1DVXA 4YHLH 4WLCA 1SF3A 5GQBA 3SIKA 1GKOA 1NSNL 1QP1A 4NHCH 1U3HD 1HHGB 3S7GA 2ZPKL 4KK5C 4RAUA 5I73C 5I66A 1EJOL 1XXFC 1N3NA 1PKQA 1UA6L 3F7VB 3HB3B 4NJAH 3IGKA 3HAEA 5DR5L 4RGOL 3V8CA 1NL0L 3QCTH 3U7YH 3MV8B 4KFZC 5BCAA 4QHPA 1XL4A 4LHJB 3FF7A 2AZAA 1CO1A 1E8ZA 2JCWA 3OXRA 2HMIC 2LLGA 6CGTA 2YMTA 4HIEA 4TNVK 3K8MA 1RUAL 1JI2A 1UEMA 3QHZH 1VENA 2CUAA 4YR6B 4S0HA 5TH2B 2A0LC 4GH7B 4XXWA 3UZEC 3PYCA 1HCZA 2MKWA 4PJXB 4OCXH 1EO5A 4WI4A 3RL2B 2OA9A 3MRNB 4B3VA 3EJUA 3VE0A 1MHPH 5ITFA 3EYSH 3D12B 5DRNA 5KSBA 1OK0A 1TVHA 2VLRB 4YLQT 3TBSA 3L2NA 5FCSH 5IESH 3C8KB 1AGCB 2BFVL 3SPIA 1P2CB 1WAEA 2NUPA 1Q72H 4MHHI 5J0BA 2H6PB 2Q8BL 3GJFH 3JWDC 3H42L 1ADQA 2MCAA 1O75A 2DMKA 3WSQH 2IWGA 2X9ZA 4QY8A 4NAJA 5E6IA 4LPYA 2J5LC 2GBTA 3U6XA 4CSSA 4BSWB 1CU4H 4N8VG 4XPFL 3DX8A 3BLKA 2QGCA 4QKTA 4LSUH 5EBLA 1S3KH 3DV6A 4GSXA 1WUNT 2ADYA 1AG6A 3KPNA 3NJGA 1RJYA 1QTPA 3P3UA 5HI3C 4NWTH 3L4VA 3L4TA 1MCPL 3VXSE 4OV6F 1X9RA 4GW5B 4J3OG 4PJDF 3GSRB 3PDOA 5ID1B 3NAAL 5A6LA 1PTZA 4NN7C 4ACTA 3WDIA 1JIBA 4KGLA 4NNXA 1AHWB 2XXGA 3D09A 1U3ZA 3RVVC 3VXPB 1LWJA 1E5YA 4YHOH 4ZS6D 1JF1A 3TYFA 1W16A 1TJXA 3ETBF 3L3JA 3IU3B 4GQZA 1E50A 1F4XL 1DCLA 4BK5A 3NFNB 2VC2B 2YN5A 1SY6L 1KJ3H 2YAHA 1A6VL 3G5XB 2Y3NA 3UTZA 4CGTA 3GXFA 1SXAA 4WU5A 4DQOL 2AJZA 4IIQA 2HRPL 4K94L 2VXSH 2ARJA 2IDSA 3MBWB 3V0WL 1XGTA 4OQ1A 2C9VA 4OFVA 5IROC 1AMXA 1ZLWH 5DJCA 1E3FA 3RDTA 3MBED 2JI3A 3WFEL 1HSAA 3FFCD 2WN3A 2CNYA 3T0EA 2VMDA 3FZUC 2BP0A 4DPRA 3E38A 1A4KA 1OTTD 5J57B 3HA0A 1CD8A 2NY5L 4P07A 4ICWA 2VDNL 1SBSL 3BAEH 3CVHH 2BOBA 5D1ZI 1TZHA 2WXRA 4WGWB 3U82B 1F3RB 1J1PH 2B3IA 3GMLA 4XMUA 1KTLA 1AQHA 3FYIB 1IRAY 1HH9B 4FKKA 5DR5H 3OAUL 4WJ5A 2WP3T 3BZDA 4JPKL 4PW4A 3JWNH 4FZEH 1CTNA 3AQXA 3ZO9A 4OJAA 1OHQA 3NIFF 4MAYC 5IVXE 2BSED 2JKJA 1MRDH 1NSNH 1BZ8A 4Q56A 4UTBH 2DQIL 5FM8A 3LRKA 2XZAL 1BPVA 4PJAB 4LCUB 3N41F 4EF3A 4LGRB 2WB7A 1DBKL 1YPZA 4H44C 1BXAA 4KJWD 4PV8B 5IVXA 4K3DL 4NP4L 3K71B 5D55A 1PCSA 3BEVB 3IDNA 4JFPB 4X5WA 1BVOA 3JWNE 2CJUL 3HUJA 4ZX6A 2FGZA 5I0ZA 1JYXA 3Q06A 2WLYA 4OZIF 2XYBA 2A74A 5TDNA 1MJ7H 4BDVB 3KLQA 1QLRA 4X5QA 3FO9B 1I85C 3B34A 3VRIB 4JANA 4OGQC 4HMDA 4YC2C 3PL6D 4AENA 1U4EA 1J1OH 1MF2L 4L37A 3CDZB 2CKBB 4OFQA 4FJZA 2K6WA 4ZMTA 3D25B 3M7OA 1YN7A 2XT1B 4ZT1A 2BOLA 3JYCA 4L3EE 3F64A 1N0LA 2RAMA 1R75A 4ZMQA 2F58H 4O51B 1HXYB 1M7IA 3HE7A 5T1LD 4JPSA 4DUVA 4KZDL 4HAKA 2XV3A 5GGRB 3PDGA 2AGJH 1BCIA 3BH9B 4KKRA 2XZCL 2Z7ZA 4U1MB 2ZF8A 1L9MA 5CN2A 2ROXA 4KZEH 1XTMA 3SHSA 2XPYA 1TZGH 4OGZA 1W72H 5CFHA 2C26A 3GUTB 3IAGC 4EEEA 5IB2B 5D7IF 3SBWA 3ETBJ 2WWMC 4FXKA 4FNRA 2CPCA 4WFED 1M6OA 4M93B 4B97A 4O00A 2J8UA 3W0WE 1J8RA 1NCAL 1S5IL 4CJ0A 3HZKB 4K3GA 5IROD 4N4YB 2J2ZA 1H9DA 5L88L 3QQ4B 1AOHA 3IU4H 4PB9H 3LVEA 4RIRB 1IIKA 1Z0NA 2B1HH 5SWQA 3EYUL 3IJ9A 3GXNA 4WI0B 3AWEA 2OXGA 4WNQB 3LY6A 4MMXA 3CC5B 4PV9B 2W9EH 4DKEH 1I3VA 5BS0B 1A8ZA 2AK1H 3NQKA 4KFMA 5C0JA 4HG4J 3OMNB 5KANI 1DO5A 2D7TL 3WN5B 4ZMWA 3MRRB 2JCCA 3FUKA 3ZE0E 2A73B 4L2YA 2ROYA 4A1RA 4H8WC 3IWUA 3MLRL 4N1CA 2IV9A 3RX8A 4XAWH 2FWOA 5I75C 2DZEA 3QZWA 4H0HB 2GC4C 3TV8A 2DD8L 3PV7A 4OFYA 1BF5A 3H54A 3ZBMA 4KRPD 4KPHH 1CL7H 1J0IA 5DMJB 3HFML 4IBLT 4U05A 4LEOB 5B22A 3WDJA 1A14L 2AEQL 5MI0B 3DHJA 1B2YA 3QIWA 3QO1B 4HAFA 3L3GB 1MWAA 2ATPA 1X7SA 4QNPF 4KQ3L 2ITDA 1WT5C 4APXA 1MI5B 4NZUL 2H0JA 4HWZA 1HI6B 4MAYA 1SXBA 4CN6A 3GLZA 5EU5A 3EYUH 1AI1L 2XN1A 2WB1A 3RUGA 1FNHA 1R24B 1UATA 1B4LA 2ADFL 3UFIA 4YHNB 2DMGA 5I6OA 1T0OA 2PTTB 2XACC 4LMQI 4QRUB 3RJDA 2P5WB 3H42H 4YN3A 1RZ8B 4N6RA 2B2XL 4FFVD 2W94A 4KJQC 3WENA 4LBAA 2GT9A 2LV4A 1FHNA 3ARDA 4AI7A 4HOXA 3PJSA 4ZZFA 3M1BA 2DBLH 3DIDA 1YJDL 4FNLH 1MIEL 1NAKH 5AW4B 3OAZH 1FNFA 1N8OE 4GRWH 1TO5A 2XTJB 3TVMB 4WJG3 4GRWF 3OJVC 4OZFG 1J5OL 5AZ2H 5CEZL 4JCLA 4FD0A 4XPGH 3ZE1B 2DIAA 2AF2A 3HRPA 4PVBA 3HC4L 3QHFL 3V95A 5C0EB 1OHZA 5CGYC 2LW3A 2NW2B 4XP6L 3V0AC 4F2MA 1QABA 3IDJA 4EUPH 1RD6A 4E9SA 5MEPB 5J06A 4XMKL 4Z7IA 4OF7A 4PJGE 4MA8L 2CO6B 5ADPL 5INCB 4AIZA 3MNWB 3EO9H 3JYBA 3KMDA 2CKNA 1IEBB 8CGTA 1IAMA 4EDXB 4R4FL 3UZQA 1UD5A 2A9NH 4DTGL 2YAMA 5TE6L 1E65A 2GHZA 2RH0A 3FQXA 2YUXA 2I25N 4X7SH 4X8CA 2HLAA 2GJ6E 4NDMA 4Y5XC 1JSYA 3JSSA 2D2OA 4WFHE 2PCPB 2OZ4H 4FQ1L 4GQ9H 2IALB 4L1DA 4U1SB 4C56B 2NW2A 1W0WA 2QSTA 5F9DC 4XMTA 3HPLB 4Z78B 1MPAH 3INOA 4G1EB 4KH9A 1WZMA 3A4FA 4M8UA 5HGGS 3VGBA 1T0NA 3NVQA 2BVQA 5D5MB 5JQ6L 4JY4A 1AZZC 2YD8A 1A6PA 3V9EA 5DYOB 4FCAA 1OY3B 1A0QH 6PAZA 1BZDA 5IW3A 3QEGH 2Y2WA 1ASQA 1GRWA 5CIPA 1T1ZA 1JDCA 3OZ9H 3BP4A 3T9WA 1EEZB 1NC4D 1RMFL 2HLEB 1E5ZA 2R0LH 4M6AA 4OJFH 2QQNL 3D18B 3Q1SH 4B9ZA 3MFFA 1YEWA 1Z0MA 2NY3B 4XPAL 4UDTA 4P4RB 4DVRH 2RA1A 2H0PA 3S96A 1TTGA 1VACA 1VDGA 3LPFA 3ARTA 2CLZA 1CFNA 3FN0H 1KNOA 2Y4SA 4XVJH 3TYGL 3VWJB 2BHZA 4EQ2A 4PJBB 1OQXA 4Z0BH 2GPZA 5C8JA 4FE9A 2DM3A 1SHXA 3T3MF 3HR5B 4PHXA 2R0KL 5E95B 1VADB 5ESQB 5HDOA 4DVBA 1KSRA 5GRJL 5EZIH 1ADWA 3VRLF 2Q76B 4LU5L 4MMXB 5FUCC 4D3CH 1R47A 5KS9E 2RFXB 1SY6H 1U0QA 4LRNL 4AK2A 5EDSA 3TVMD 3TBBA 4YDLB 3A22A 3BMWA 1J8SA 3LKNA 4NLHA 1PF3A 1MJUH 1NCNA 1XGPA 1JK9B 1ZLSH 4XP4H 1IAII 4OVVA 2DWEB 2OXHB 1E8YA 2F19H 1AC0A 3SEPA 1MIMH 4H8UA 1HCVA 2ZOUA 1BAFH 1KIPA 3DX7B 1UZ6F 5E2TH 1P9MC 1KIRB 3NCJL 1G9NL 2X41A 4AM0Q 4PJ7B 1S8DB 5I1KH 5C0CD 1TTRA 2VOTA 4ONOA 5EFIB 1MKFA 5CZVH 2OMUA 3B9KB 4XPFH 4OCWL 4PRID 3QK0A 4GEIA 1RZKH 1AKJB 2CM5A 3QUML 1YEIH 4NKDA 1GGBH 1MEXL 4FFYH 3A6CH 2P24A 3EJYC 1B6UA 4JRXB 4P5MB 1HZLA 3P54A 5JIDA 3L95B 4PH8A 1DVUA 4KY1H 5T1KD 5E8PB 3ZRCC 4MB3A 3BRFA 3SJVA 4ICXA 1G7IB 3NTCL 5EIIA 5HHMB 4UOJA 1T1YB 3Q3GB 4XNQB 5H8DA 5HGDB 3VD4A 2DJUA 4QDGA 1IC5L 3AW5A 3LAFA 2DN7A 4JKPL 3DO7A 2J1KA 3MJWA 3GMNA 3WS3A 5GRZA 4OV5B 4L3AA 4HALA 1NEPA 4FQQB 1NJ9B 2WLNA 1EBPA 1NOFA 3T8XA 3E9UA 1UG9A 2WWKO 3MMEA 4K3EH 1I8AA 5EZLB 4HS6B 4DGYH 5GRXG 5KSBB 2CG9X 1AGDB 1NEZB 4KZEL 1JF5A 3FO2A 3EH4B 4WUKH 3MFFB 5JZ7C 3WHXA 3GSQB 5D8JL 2HFEB 1QBLL 1OVZA 4Y16B 3DNKA 3ULUE 5K5YA 1G5GA 4FF9A 4UOQA 4AMKH 1KWKA 3AJ7A 3IYLW 4QMEA 2OP4H 3QFJD 4NPKA 5B39G 3W3BA 4JFXB 1SYVB 2ED7A 1AP2B 4U6TA 4MDIB 1QQDA 2SEBB 3TZVB 4I2XA 3T6VA 5H2BB 1DBJH 2DQTH 1WBZB 3BPNC 3GPEA 1PKQB 3F7VA 4HT1L 1BJ1J 1GKEA 3GO1H 2H2PC 2DYSB 1YHPA 2VMJA 3HNTL 5JPMB 4ODHH 3QJUB 1AZRA 4P2RD 4CMHB 1XEUA 2RCSH 3P3TA 4QLRA 4XWOD 4HYTB 3LQZA 1LEKA 3MNVB 1KBBA 3UH8A 5C0AE 3GDCA 3DX3A 1QEWB 1E9OB 3OKYA 4G9FE 3GRGA 3HE6D 2RMNA 1OLLA 3EFFB 3QUKB 3J27A 5D1QE 5D5MA 1CE1L 4DJMA 4XNZC 3QIUA 1ILUA 4PRPA 4GUCA 4MA1B 4TQIA 2XWRA 3ESUF 2M26A 4L8BB 3VD3A 1P1ZA 3DETC 1U9KA 5D1XB 3VGAB 5ALCH 4P59H 1ES0B 3GSVA 1EMTL 2AW2A 2DQUL 3QE5A 3BVWA 4L4TD 4AZ8B 4WF7A 5J8OA 3VD2A 2JCCE 3LD8B 2GSMB 5CP3A 1NFAA 3ILQC 1KYUA 3U36A 5DFWH 2FUQA 3Q1SL 5EBGA 4P5MA 1I7ZB 2OW6A 4YPGA 5E9NA 1OSPL 3CBJB 3RVWD 3RWCB 2FL5B 3NJIA 5IBUB 4WWKA 2BSCA 3VXUD 1FUNA 5IB2A 4HCIA 1E27A 4WHYH 5EUOF 2JJSA 1CD9B 1HHIA 1IGYA 1PD1A 1OL0A 1NGWB 1Q1JL 2VLME 1KZYA 1J0JA 3UPCA 2BOCA 1NCTA 3II1A 4ZNEE 3LXAA 3TASA 4LK4A 1MFDH 2FJHA 4P2YA 3WJJA 1UB6B 2DV6A 3K71A 1T7WA 3MRHB 2G3NA 4JDZB 2WXGA 4XN7A 4QHMB 5FA3A 4AYID 2H32A 2IC2A 2APXA 1O6SA 5LAPA 4LCCC 5E5LA 4UIKL 4XPBH 4DTGH 3OVUB 2ATKA 3BQUC 2AJ3B 1AXSB 1I1FB 1NANI 3WNPA 5I17A 1B4JL 3JWNC 4PJXA 4JKMA 4UQ3A 5EEWA 1CG9A 2H32H 4Y19B 4N0YH 4N0RA 1ZY9A 4HCRL 4I3GA 3O6FD 4PRNA 2QMJA 1RU9H 3CN1A 2Y0SA 3K3QA 2KHAA 1KELH 2P47B 3MKKA 1BEYL 1DUYB 3IXTB 3MJ9A 5GS0D 1QUNB 4PHZA 3TBSB 3LRHA 2VDRL 4NKMA 5C0ND 2VGLM 3W11D 5I30L 2WK2A 2F8VA 2O6PA 4KMTH 4QF1A 3ZKQD 3I85A 3APFA 3BQUD 1SVBA 1C8PA 2C9QA 4NN6B 3MRKA 5GJTH 3CNKA 3D0VB 3DX9B 3T2OA 4UTCA 4LU5H 3BOVA 3L3OA 3RVXC 2WINA 4YAQA 4I18C 4W9IC 5EHFA 2IQAA 5GGVY 1K5NA 3CH1B 2WBWB 4XH2B 2YK1H 3CUPA 4MCNA 1AR1B 4R97C 5T8IA 2AJSL 3CZJA 1PCXA 2JWYA 4PP1C 1N59B 1C8QA 1LVEA 4YDZA 1NC2B 4HVBA 2FSDA 2ESVE 4Z7WE 1XF3B 5D7EA 5FYJD 2BNQB 4U1KB 3D39A 3LB6C 1VPOL 5KVFE 3T8XB 1T5WA 4G7VH 1QI4A 3FRPA 2IJ0C 3TX4A 4JDTH 4FMFA 2NZ9D 4NGHL 4U6XA 4DP5X 3S3DB 2Z0UA 2VL4A 4JFEE 5B21A 4X8JA 3ZE2F 3MRLA 2DQHH 4GIAA 2ERJC 2WVVA 3C2AH 4Y4KA 3ESVF 5DZJA 5T5NG 5DJ2B 4L0YA 3KE0A 3UAJD 2C9RA 5DZVA 2MH4A 2ZCKL 5HJBA 5KYWB 4DP0X 1WCBB 3OHXB 3S3CB 5CLWA 3WFHB 4AYEC 3UJJL 5CKGA 2DLFL 3RI5F 4ZOBA 1H3XA 2IG2L 3OGCA 3D39B 2KZ1B 2VN4A 1JHLH 4ZOCA 3NN8A 4RAVA 5GGUB 2DJMA 4L3CB 4OLUH 1KGCD 3RWGB 4GKSA 4WFGD 3QRLA 5FUZH 1U8QA 1CXEA 2VR8A 3B7UX 2Z91A 4NCC2 1YN6A 1INEL 5AVXB 3SKOB 5GGSB 4NRZA 2N01B 3FUMA 1FL5B 5DFVC 3ZQ9A 4UTAH 2ZOKB 1IGFL 1AXIB 4KY2A 5E94B 2ICWA 3QXVA 4NCDA 4GB9A 3S5YA 5GZNA 1NLBH 4LBEA 5C2BL 1UOVA 2XNAB 3NCMA 4KKAD 4JHZA 2AJUL 1T4KB 3PABB 3WNIA 4GP8B 1A6AB 2BCKB 4UT6A 4V1DD 1BZEA 1VGKA 1GZQA 4LHUA 5GSVB 3OXRB 4OZGE 4LIQH 4G9DB 1PY9A 1FN4B 1I1AB 5CEZH 4NUGH 3DOSB 2BVOB 1SM3L 1MFVA 1JMXA 3MRFA 4EUPB 2JKRM 4NSKA 4RWHA 1MIEH 3SKOA 5C0GA 4XMXA 5D70H 3CK0L 5JQHC 4JFFD 3TV3H 2APVA 2KLSA 3GRBA 1RULL 1JZHA 1MI5E 4BE5A 2YA0A 4FXTA 5IQMA 1QRNA 4U1LB 1NGWA 1BECA 1COBA 1P5UB 2BH0A 3UCRA 3WUWB 3OZLA 2DI9A 3FAWA 1J7VR 3GMOA 3IAQA 1IEAA 1U3YA 1KV7A 2Q7NA 3OWEA 3C87A 3FTWA 3QDJA 4YBLC 3UMNA 3ZDYF 2PW2A 1IL1A 4DZ8B 1EDYA 3ARED 1LJMA 1A66A 5HPMB 4YVUA 1K4DB 2C7FA 2G5BB 2K8MA 2NY7H 4J3BA 5FCUL 2YZ8A 4IMLA 2O61A 2N0MA 4ODVL 1CDCA 4U1NA 3T4YA 4UQAA 3CN2A 4YX2H 5F3HB 2CXKA 2VUYA 5HXMA 2IALA 2IPUK 4MLIA 3WLBA 3QRBA 1KZQA 4R96A 4QOKA 2KZKA 1QFHA 2PYEB 4WHTA 1YVLA 4H8WL 5BS0E 4FQ2H 5TK4A 1AHWA 3IDXH 2P44B 2EIZB 4QWWD 2JKTM 3MLVL 1I4FB 5E4OA 1H3GA 5SV4A 2I07A 1NC4A 4JCWA 2OJEA 1RVFL 3L5HA 3TTYA 4E42A 3U1PA 5BVPL 2HKHH 4NBXB 4MJ2A 3AITA 3S8GB 3B3IB 5JPMC 5GS1C 1ROCA 3VO0A 1RIUL 4MZIA 2EVIA 2A83B 3W82A 3J7HA 4KV5E 4YZFE 5DU7A 3V4UH 3Q0HA 2FQFA 2N7SA 2IH9A 1LM8V 5CCHE 1IAIM 2DMBA 4BQ9A 2PO6D 5ITBH 3FW6A 3PXJA 2WBKA 3FO1A 3BGFC 1KTKE 1WE5A 5ACZA 4UAHA 5JOEA 4XMWA 4MMZC 3VRLE 2DQCL 1L0PA 3FSVA 4LSSH 4PU2A 3PHAA 1UD2A 3ZYOA 1A3QA 4RFEA 4G6AC 3SB3A 1Q1JH 2DWXA 1JWMB 3PWLB 3ZRFC 3WTSA 3W56A 3EOYG 1QFWM 3HMXL 3UTTE 3BRDA 3VXOB 1E2VA 3EJYD 5FM5O 1SEQH 2FD6L 4RMWA 1ZV9A 2JJTC 3OR7B 3VRJB 1OAYL 1OF2B 1LK2A 1ZK5A 4EPSA 3ERXA 2WUBH 2FQEA 4AMWA 2OTUA 3FO2B 4Y2DD 5DEGB 4PRPE 2H3KA 3I3EA 3NEXA 5DMYA 5I1KL 2WQXA 1UENA 2COVD 1GGCL 4O5LL 4X5RA 3EJCA 3RQ3A 1TJIH 2DWYA 3AG3B 4RFEB 1ZHLB 4FQPA 1T0NB 3SDYH 2J4WL 1DJWA 2GBAA 2Y1AA 2MNJB 3FUFA 5ES4B 1R4XA 2ZOOA 4XBEH 4AXWB 1Z32X 2N4IA 3O6LL 2Z35A 3P4OA 4R26H 5F7FA 4JJOA 3AVEA 2PYEE 3O4LD 3EGSB 4B27A 3QI9D 3BQVA 2ISDA 4PCSA 1XT5A 2BNRB 2WZAA 3GYRA 4GRLD 5ANMA 5J89A 5ID0A 4Q4EA 1VCBC 2X6CA 3TJEH 1UM4L 4HUUB 5HGBA 3B9AA 4A04A 2UY6B 1JTTA 3E9TA 4LLWB 4N1EA 5ANME 3FCTB 5T5NF 3O6ML 3SYAA 2FYYB 2R0ZH 3GRWA 4PJ5D 5H94B 1CD1B 3GO1L 5CJXC 1NGZB 4XMKH 4XVJL 4Z95L 5CCJA 2IH3B 5JXAH 4LVNC 4Y2NA 1TJIL 5SWSE 3VFUA 5CBEB 1EHNA 4X42A 4A67A 1BQUA 2GW5A 4WDIA 4OCXL 4QRSA 4Y5XB 5E8NB 3X3GL 4HBQA 2XYCA 1KC5H 2OS7A 1D9KB 2V9QA 2D73A 2PLTA 3GHBL 3INUH 3WIFA 3VXQA 5B8CB 1BIIA 1XGPB 4XVUD 3B83A 1PZ2A 5E9DD 4AUUA 2OX5A 1A1NA 5E8DH 4FADA 2FECI 1NDMA 2W07B 3GXIA 3LIZL 5GS3A 3HMXH 4A7QA 4XVTH 1NINA 1W72B 4Q9CA 4KVCH 3ZMNA 4ZUSA 4U1LA 3T6QC 1GS8A 4G70B 3SO3B 3CZFB 2ZAGA 4JRFA 3TTSA 3KYOB 5CO1A 1CD1A 5T1DH 5I8CB 4NHCL 1JVLA 3ZZSA 4HH8A 4O2FA 4ZFZB 1JV5B 3RGVA 5CP3H 1WICA 2VR7A 3QQDA 2K9FB 1URLA 5D6DC 1TVHB 4OZ4B 1U8PB 2BZDA 1K4DA 4NQSB 5H2BA 3JWOH 3LKRA 3DMMB 2RIKA 4UT7L 3P4MB 1X3DA 4X5PA 1NFDF 3ARDD 4YGVB 1FBIH 1W80A 1IE5A 3SN6N 2AFNA 4YQXH 2ITCA 1TQSA 4P5RA 3MROA 3O6LH 2FB4L 1UKQA 2QDVA 4NPJA 1T0MB 4G8EB 4TUJA 1FV1B 4UAOB 2WO3B 3FQNA 4C57C 5DD1H 4OLUL 4GG8A 4UQ2A 4DOHB 5CD5D 4ZUWA 2AJVL 1U8PA 2CO7A 2VR5A 5C97A 5GS0H 1MQ8A 4QTHA 3VMNA 3TESA 3UP6A 3VG0L 2CUHA 2KI6A 3BDBA 3TT1L 3IXTA 4LASL 5I1JL 4DGVH 3HC0A 3MGTB 4A2LA 3IJ8A 2ZUSA 4U1IA 1DL7H 1F02I 5BMFH 7PCYA 1GIGL 2ZCKH 2EVFA 1YECH 1B9KA 3UYPB 4XO9A 4CKQA 4LLMB 5IESL 2DL9A 4LQFL 3QJSB 1FL6A 4QHKJ 4MNQE 4GW1B 5BQ7B 2UXVA 3ALWA 3NIFB 1HYRC 3EYSL 1X5KA 3C5XA 1A6ZB 3LZQA 1Z9SB 1JNLL 2AQRA 2DQCH 3HZMB 3RWCA 4ZOAA 1FNSH 1RLWA 2UZYA 4ABUA 1T22A 4TNGA 4HD5A 4Y5XA 3PFUA 3TN0C 3VXNB 3MGAA 1WJ3A 5F7EL 3BT2L 2VTFA 1J0YA 4YDJA 2NDFA 3KCWA 5I1HH 2DM2A 2OPCA 4N85A 1IGYB 2NRDA 2NY2B 3T3ME 3HMWL 5KBDA 4NUGL 1XCQB 1H0DB 2E8YA 5I8KH 5TGBA 5IUCA 1T6WA 4DFIA 3NK4A 3O3DA 1IFRA 4XPAH 5C09E 1JAEA 2LVEA 2N3JA 3RWJA 1I1YB 4P4KA 3CSBA 4HQQL 4KQ4L 1BFOA 3ZW3A 1SZNA 3PAZA 4X5LA 2XVKA 3U2JA 3MJ9L 1HINH 2O5ZL 3MLSL 4EKJA 1EZLA 1YY8A 2ZIDA 3QEUA 2CJ3A 1ZVYA 4KXBA 3L2LA 5TDOB 2L7UA 2CKBH 4KI5C 3DVNA 5AL8A 1T03L 2BSSB 2ZSVA 4K55A 2O72A 2F53A 4KJYA 2ODIA 2ZP8A 3CTTA 5IVXF 2DLEA 3OJDA 3QDGD 5D1XA 4Q9RH 2C4XA 3CFEB 3QNZA 2A6KB 5SWZA 1G7JB 2VWEC 1FQ9C 4FQHA 4DOHE 4X0KA 5E2JA 4FEMA 3PNWB 1J88A 4JZJA 4AG4H 1OO2A 3DRTA 4CILA 4RFNB 2EE6A 1MG2C 3ARDC 3GHPA 4KI5D 1SYVA 1L0XA 3MRNA 1IU1A 4X98A 5F1NB 2BIQA 4ALAC 6FABL 2QDWA 2P5EE 2P45B 3RX5A 4Y5YB 3V6OA 5BVJB 4OF6A 4OSUL 3CK0H 4QXVA 4BFJA 5EU7E 5B4MD 1AGCA 3IWVA 4F57L 1AY1H 2Q7AA 2X2HA 1O7DC 1IBFA 3V6OE 3FPYA 4IU3A 4APQB 2ZYSA 4BFGA 3MRHA 1BZQK 1ZXQA 4QOKE 4U3XA 2WLHA 4YDVB 5FHBH 5ISZA 4B0MM 3GXMA 3Q3GA 3QGVA 5HJDA 2XA8H 4ZUSB 3SGKA 3SJVB 1CG9B 4Y19A 4GO9A 3OV6A 4DKDC 3DKHA 3GHEL 3NSXA 1JBJA 4E0RA 1I75A 1E5BA 2MPAH 4AKOA 3AREA 5I2IB 3LNFA 3DROA 3P0YH 4WHCA 4AGPA 2PN5A 2F9BT 3LZPA 2VXVH 4K23H 5B39A 3FQWA 2P5ED 4NQSA 3RWEB 1KCSL 2XKSA 1BHGA 5C7XH 1RUML 3SDXF 5I28A 2VDOB 3CX2A 4N0FB 1QG3A 3C75A 4OI9A 3QRGH 4M7LT 4YLCA 1J10A 1I1CA 1OIOA 2Z91B 3WJLC 4PV9A 1JXJA 3UROR 1N10A 4K3JL 4R7LA 2I26N 1VRSA 4W9FC 2VLRE 5SX4I 3JT2A 1OCWH 2HT2C 2X6VA 3T4YB 4MYPA 2X4RA 5ICZA 1JZ2A 3AM8A 1JPFA 5BNXD 4CDHA 3TO4B 4IIQB 1EJ8A 2H45A 2VT0A 3FQWB 3FRUB 4P4KD 3RWEA 4V2BA 2X4QA 4IDJH 2IAMB 4ZX5A 4X6DF 2YUVA 4JRYA 3ML8A 2E9IA 1JGLH 2DIJA 4GPVA 1UZ8B 4W6WB 4PP2A 3MJ9H 2R4SL 1F6FB 4N2LA 5DS8A 4G6FB 4WWPA 4K7PY 5TQ0L 3GSWA 3NCBB 3HJ0A 3HE7B 2B3RA 2BC4A 1ZIBA 1USZA 4G7VL 3KBPA 3D8MA 1R24A 3E0GA 1Z9SA 3TNNB 1J5OH 1Z9MA 3V7AE 4ELKA 1I7RA 1RJYB 4HGWA 4MS8C 4JM2A 1S46A 3P77A 3W9DA 4OLVH 5T5FL 4FRWA 2JK5B 3N9GL 3MOQA 4U6YB 2OI9B 3U30B 5LXGL 1FZKB 4LVNB 3RKPA 5EC1B 1NUGA 4UYPA 3RVUD 4XVSH 2Z1KA 5D2LF 4JO5A 3VXOA 3W57A 3DI2B 4TSAH 4ODUB 4X80L 3BDXA 5DA4A 3TA3A 3ARXA 4GXVH 1IBDA 3IBOA 1GZPB 1L9PA 5BW7A 4Y5VB 1IAOB 3EF4A 3CGTA 4XCFL 1IAKB 4U0RC 4Y19D 5HYSB 1V3MA 5JTWA 4M3HA 4KQ3H 2EQDA 4MAUH 3N42B 5ADOL 4TS6A 1KXTA 3QWQB 3HBPA 5F97E 1FCCA 2HP4A 4HCRA 4WKZA 4NXSA 2E59A 2FCBA 1T66D 1I8KB 1HHIB 1T4KA 2FBJL 2A9MH 2IFFH 1C5BH 1QEXA 1TZ8A 1Z9OA 1ETZB 4JEGB 3CFCH 3Q6GL 3UYRL 1AZVA 3EADA 3R18A 4U6VL 4XAWL 1A9BA 1WT5A 5JMOC 3L3IA 1UJ3C 3R8BB 5L6YH 2OL3L 3JWDH 3PWNB 1KTBA 4ZPVA 4JZJB 3LEXB 4OGYL 3VXMA 1DYZA 1T5XB 5A1AA 1CFMA 3BUBA 1RIHL 3KM2A 5E8EB 3MLYH 3OHXA 1SQMA 4R83A 4JREC 4B9FA 4LVOB 4PJAE 2IQ9L 3B8YA 4DIXA 1TT6A 3DTUB 5GZOC 1OSEA 1D5MA 1BG1A 3T0EE 1KBWA 1TJGH 2VDMH 4AEHL 2JV6A 3L8QA 4N9GA 3WIHL 2DQTL 1Z6JT 5FYKH 3BQUA 1BBJB 2ZKYA 2B77A 2V7NA 1C7TA 2WO4A 4RMBA 2GJ6B 4WWOA 3GS4A 2XWDA 1X4ZA 2BZCA 2IAMA 4JFDA 4L2LA 3N1FC 4P2QE 1QKZH 1TETL 3X12A 2QZ5A 2J6EA 4J2XA 1UWXK 4BCXA 3VD0A 3PE9A 3QDJB 1A5FH 3VYOA 4DK3A 5E9DE 4AH2A 2VISB 3KXFB 2V8MA 5BRPA 9PCYA 4L3EA 1OW0C 5EO0B 4CU8A 3DGDA 4G43B 1NGYA 3FOMB 5JW3H 3WLBB 2D3NA 2HRHA 1Q9WA 2GKIA 5TDNB 2YFOA 4NQED 5C0EA 1CUOA 1CURA 1UD6A 2EYSB 3QXUA 1NLBL 4PS4H 5BXFA 1SOKA 1FPTH 4FXLA 3T3PF 1RPUA 4JQXC 3CDZA 1J1OL 2GCYB 3S8WA 3VFVA 2XN9E 3BP5A 3BO8A 2HPTA 3GLEA 3X1NA 3JWNG 3OF6A 1VLXA 1TVBA 2ZXDA 2G9HB 4O02H 5IHZA 1CDBA 1OT2A 3Q6FA 4J23A 3SPGA 2OZ4L 1MHCA 1B6DA 1IGJA 4KJQD 3V0DA 3BZ4A 3GEFA 4D0DA 1ICTA 1BD2E 1KTDB 2PTTA 3DDFA 4QRUA 5GGQH 3C6LA 4B5ZA 4WW2F 3MRFB 4A7TA 1WIUA 1EFXD 2QELA 3SE9H 2ORBH 4UTBA 5B3JE 3KNBA 1JGVH 5F44A 1NMAH 4JE4B 2D3VA 4K7PX 3LKQB 1U6AL 4X6CF 5A2IH 4HXAH 1LO4H 1NCDH 1O0VA 2AV7A 4PWHA 1R5WA 2OSLB 5D7JD 5C09A 2G9HA 1JUFB 2IV8A 4M61B 4PUBH 5ADOH 1TJHH 4NWTL 4PTUB 3QIUD 4PRPD 2X05A 5CGYD 1KXVC 5IFJB 1XMEB 3NSFA 4XAKE 1BYPA 3U6RA 2OYMA 3UZVA 4ANWA 2W5PA 2UWEF 3CFQA 4LVHB 3DURB 4P2QB 4Z77B 5HVWA 4KKZA 3RVTD 3CQQA 2WUBL 4OR1A 3BHBA 4P2OB 2NLJA 4I8DA 3WN5A 4RNRA 3RKDC 5JXEA 2O93L 3BW9B 5GZOD 3UTTD 2EKSB 2OMWB 2IANB 5FGSA 1DQQB 3KBEA 2P46B 1EHAA 3ISWA 4CC4A 4W1TA 2RQEA 4FFZH 4MDRA 3C5ZD 1OGAE 4F92B 4HG4K 3BSGA 4NIKB 1TMQA 5DMKA 3TH2T 1TQBC 1BD2A 3VXNA 2GTQA 5I1GL 1H6FA 2VXSL 3CDYA 4KKLC 1QNZH 1TEYA 1VZGA 3PAVA 5IK3A 1NUFA 1OGAA 3EO1A 3K4AA 4X6CE 1CDIA 4XP9L 4A2DA 3W11C 1Q8MA 2R83A 4HUUA 5HGBB 4YHPA 3KYKH 4PEEA 1RJCA 1IC7L 3RDTC 3CHQA 5IBUG 4ONHA 1N4XH 4Z0XA 4RMVA 5DRWB 1WS7A 1MWAL 3QEQB 5FW7A 2AJVH 2ENSA 5FO8B 5GS0L 4FHJA 4HU2A 1F1AA 1I9RL 1I53A 2HB0A 1PZ5B 4W70A 2WZ0A 2HCZX 5C0BA 3NIDB 5I26A 2FSEA 3IMWA 4Y4HC 1TCMA 4OD1L 4JN1L 4U1GC 3LSOB 1LEGA 2J8UF 4Z7UA 4JM0A 1SJXA 3DJSA 4MBRA 4ZD3H 4N2IA 2MOGA 4J7RA 1PNDA 3EIFA 3K8KA 2GABA 3MFGB 3ULVF 3MA7A 4XBMA 3MODH 1BMWA 2J8UE 4K3JH 3W0WA 3LKSA 5E51A 1F97A 3II3A 1HCFX 2IPTL 4N6QA 1DFBH 4Z7QE 4I7ZC 4BZ1L 5HVHC 5KYXA 4D3CL 4PJ5A 1OSYA 4OB5L 2MOQA 3FO9A 3O2DL 5GISL 4BIKA 5I76B 4A7UA 1OD7A 3FXIC 3QNFA 1NAMA 3OSVA 5JO5A 1X5XA 5L4FA 3O3AB 4LBEB 3BUPA 4I1NB 4NQVB 4NRYA 5C8JB 2V2WA 4JO3H 4BFBD 2MJWA 3CHOA 3B4NA 5J5EA 3BZFB 5HHNB 3WXVL 1KNOB 4XCYA 2EDTA 1X9LA 2P43B 1WZ1H 3VDCA 3APCA 4E41D 3KPMA 3A4AA 3QI9A 1B90A 4AJWA 5ABZA 4KQ0A 4JHWL 3FKUS 2WOBA 4G9DA 4O2FB 1VJSA 2HFTA 2XWJB 2QQNH 3VXRD 5ICYA 1MFCL 2FWUA 4LB8A 5BZZA 4GXFA 3IFOB 3C5SA 3QEHB 3CJJA 4NO2A 2R4RL 2UXTA 4CA4A 2P26A 4BWTA 1I7TB 1X5IA 1QFWL 4YDIH 3GSQA 2QHRH 3SE6A 4EVNA 2JCCF 3WO4B 3BKML 4XMLL 3NPSB 4H5SB 3QUGA 4V1DE 1YUKB 1T5KA 5F0MB 4C56D 1WISA 3VI4F 3CLEH 1SVZA 1A4CA 1V7ML 4D8PA 1Q9KB 5FECB 4JLRB 2WXHA 3IDIA 2VABA 3BUYA 2FT6A 2RTTA 1R1CA 1RJLB 1FI8C 4ZFFB 2R1XA 4WDIB 2PR4H 2NY0D 2OMUB 3EDEA 5ACMA 4NO0D 3BWZA 2BWQA 4DNLA 4P06A 4JKKA 2WZ6A 5I1EL 6TAAA 3P9WB 1WGVA 2GK2A 2CGRL 3RZCB 2OK0L 1WFIA 3WFCH 1H5BA 3WGVB 2CPUA 5TK2A 4MKMA 2IQ9H 4RDQF 2O6FA 5E4EB 2VN6A 3BE1L 3ESOA 3I3DA 4K3HA 4X9BA 5DQ9A 5B7EA 5T3ZD 5AW9B 5DD3H 3VI3E 3GK8L 4LRIC 4RQQB 1BWWA 4WFGE 5HYFA 2NXZC 5INCA 4AIZB 4ZUUB 3VD5A 2XWXA 3THML 1PD6A 3UO1L 4HXBH 2RALA 2QVMA 1QSFD 2UY7B 3N85H 4LOFA 1JTPA 5FIEA 1S9YA 5F6IB 3S88H 3Q6GH 4JZOB 2MCMA 2K8QA 3K1KC 5C09B 1IX2A 4AVKA 3VUAA 2Z35B 3C2SA 3P4OB 4HPYL 1EAPA 1RZIA 3BVTA 3MRPA 1ES0A 3BP7A 4FQLH 3LN5B 2CA4A 3L17A 1NCHA 1AQMA 2Y2YA 3TBTB 4IYKA 1BFVH 5HHQA 1QBLH 1SF5A 5KVEL 4I0KA 5F1KC 5DWUH 2B5IB 2ID5A 3SE3A 3RNKB 5KVMC 3TFKC 2RACA 3QHTC 3NJLA 2X28A 2ZXAA 3LH9A 3TCTA 2WYZA 1MNNA 2P9RA 3HC3H 3QJZA 5JPNB 5E99L 2Y7QA 3KPRE 1LL1A 4N25A 1LMKA 3LQAC 4Y1TA 3WY1A 5I1CH 1NCAH 2ESVD 2WMPA 4S0SD 4PJDA 3HLAB 1T1ZB 2CBOA 4LSPL 3QPXL 1Q1PA 1QZ1A 2WCSA 3KPRA 3NPSC 2XBTA 4FI7A 3V4PH 3T8VA 2X4OA 4OLVL 2YS4A 1FZOA 3HPJA 4CVZB 1UVQB 2EIDA 1BQRA 4QHLA 3NG5A 3O3EA 3SCMC 3K2MC 3GTVA 3TBTA 3ZR6A 5AVTB 2BFGA 1KFAH 5FF6B 1ADQL 4G1MB 1A14H 2AEQH 3EDFA 5LNDA 1HH6B 3MLZL 5F89A 1KLFA 5E5UB 1W72A 1G7LA 1KYOK 1WDAA 4X6BB 4BQ6A 3G6AA 2Y7QB 3AQDA 2DD8H 3FCSB 1CFSA 2GY7B 4FFZA 3O2WH 4YZFF 4QT5B 3RHWK 2Z7WA 4G6FD 4KGJA 2X4QB 4WW1B 3NCJH 3MMEB 3UTSD 1U8HA 2VUKA 4CGUB 3LX9A 3GI9L 3DYPA 1J5DA 4FQQA 5C08E 4ZYKA 3SDDD 4I5BA 3QUYA 2EO1A 5C6PB 4NKIL 1KBPA 2WTRA 2G4EA 4JE0A 4D0CA 5GGTL 5D2NC 2YEVB 5K59E 4M7LL 5D7KD 3L3HB 1J1XH 3DOIA 3B6SA 3NJMA 2VE6A 3MCKB 1WCQA 4ZMZA 1F4WL 4A2EA 2GITA 3C6EA 5GRJH 5FYKD 4DK5A 4ZUUA 3C8HA 1B4RA 5JHMA 3CLFL 3DX6A 1AFVH 1YJDC 1OAZH 4TULH 2R69H 4WFFE 4OIIH 1PIFA 2ENQA 5A2AA 5JIKA 4KRNA 1G6RH 3HRZB 3NFSL 3QG7H 2C7UB 4G71B 4HJ0C 3VXUE 3B9KA 1F8TH 3LS5L 5HHOA 2EE2A 2R27A 2EDWA 4JKWA 1GSMA 1NBYB 3V0JA 3S2CA 2FJFB 3P30H 2F61A 3TFBA 3FULA 2R0LL 4OJFL 2R4RH 4FMVA 1NGQL 4X8JB 3VSTA 4FYQA 4M00A 3BUIA 4H26B 4N0FA 3L5XL 3IF1A 3OKEA 5I1DB 2IADB 3DUUA 3FC8A 4HJTA 4TVUA 3VSQA 3ROLA 4I9XA 4GUOA 3H6JA 1CFNB 3VWJA 4G72B 1A6ZA 4N0CD 3QZBA 2LLLA 3KPPA 2JKXA 1MLCA 3IJEB 4WSKA 2OMYB 3B9KC 3UO1H 1C5CL 3V52L 4H25A 1BA9A 3D85B 1URZA 4ZXBD 1KTRL 2KUTA 3OKMB 5GIRA 5T3ZL 1E4HA 3WUWA 2NR6D 3CXHK 2FJGA 4G9FD 2J5LB 3MZTA 4NT6A 3ZHFA 4LCIL 5C0AD 1UACL 5B1CA 3SJVE 4LDCA 3WHXB 1S9VB 3H6AA 5DCCA 2GUOB 1GW6A 4Z7VB 4WEBH 1AGDA 3WFCL 4PS8A 5DO2C 1FA4A 1R3LB 3BT0A 4QF1B 1U4FA 3D6GA 3PHQB 5T1MA 2EVJA 2K3HA 3CC1A 3F2LA 2VKXA 3S37L 1RUMH 4FL4B 1NOLA 3UG4A 4YSAA 2R51A 3N1GC 1RFDH 4KV5F 1DVFD 2C9AA 3OKNB 3QJHB 3VWKD 3BVNB 3E2HB 4LLQB 2ICEA 1M7XA 2ZSVB 5EC1A 3MRQA 4GKNA 1QW8A 4U31A 5GRUH 2R2CA 1ACYH 1AGBB 1RH8A 4E9RA 3O2DA 4HZAA 2TAAA 1IC7H 3LN4B 4CDGC 4G8FB 5F2FA 2IPKA 1AGFB 2JF1A 2IIJA 3L3KA 5GGVL 4E9LA 4RVBA 1EIBA 1T2QH 5GGTA 2JKLA 1TZIA 3MLXH 1BBDH 2WJ5A 5DJ2A 5EN3A 4ZNEA 2B5IC 3ASWA 5BZDB 4Y4KD 3F58H 3BPCB 3FAXA 4K3EL 1UXWB 1OF0A 3N1PC 2IANA 2FWLB 2J1ZA 2JQAA 3NACH 4JO1H 4RGNE 5GGUA 4HEPA 3MV7B 1BJ1H 4D2NA 4LPVA 3ZUCA 5KWYC 1JI1A 2QSCL 2XWTA 4G9FA 1D6EA 3WEMA 1JDDA 1IL1B 1FVEA 3O9WC 3BWAA 1GS6X 3NTCH 2WVUA 1A9BB 3O3DB 5AW6B 1PSKH 3GGWA 4NBZB 3VTMA 4FGMA 2FR4B 2FIKA 3B2XA 1D3CA 3UPAA 4M7LH 2AEPL 3ILPB 3SE3C 2QKIC 4PRIE 4GIOA 1TZIB 1MCJA 5AYTA 4LCWD 4RMQA 1YEIL 5E5RB 5DC2A 2ZOLA 3CPLA 5C0CE 3RWIB 5FO2A 1ZHLA 1GW0A 4WCYH 3S98A 3D25A 5A7BA 5B39B 4LVEA 1FORL 4N2GA 4PIBA 2XQYK 1U91A 3ARFA 3DTDA 5JUEL 4LHUB 2IO5A 3RDTD 1MWAB 2ATPB 2K70A 4LSRL 5LBVA 3WGUB 4PTUA 5C70A 3GC3A 4PJIA 3RP1A 5GGSY 5MENB 1CLZH 1G1KA 3BYYA 4QY8B 4A2FA 1YEGH 1Z7JA 3B9VA 3H3PH 1MHEB 1UM5H 1A65A 1E5UI 4OF3A 4CNIA 4O02L 1JYWA 4FHBD 1IM3A 1BWMA 4JPIA 3DECA 1FBIL 3V6ZA 5F96H 4NM4L 1A7PH 3VYPA 4YJZL 2FUTA 1A4JA 1DSFL 1MDAA 3V5KA 4GP4B 1P9MA 1WFUA 3CPLB 1RHHB 1HHGA 4LCUA 5I66B 4NRYB 4QRRE 3TBYA 1X5YA 3DVGB 2CLVA 4ODSH 2K3TA 1PYWA 4R4BA 2VM9A 5E4EC 4HGKC 3RJOA 5DS8B 3BESR 5C3LD 3CXHJ 2OAAA 1YEHH 3TCXA 5MENA 2D7NA 4OY9A 4QJ3B 4WNQA 4QJ4B 2WVSA 1EX0A 3HB3D 5CIPB 3RPKA 3EH2A 3UJTH 2AEOA 4J3SA 5F7MC 3APDA 2FVNA 1TQWA 4XNXH 4FS0A 4LIQL 2A77L 2XV0A 5KTEH 2DYRB 4WU5B 1U8NB 1OGAB 3ZSTA 5DUMH 1F2XK 4EKXA 4M4RA 2UVEA 4QD2E 2HRGA 4A39A 1M1SA 2ZX5A 1Z3RA 3AS2A 3SGKC 3MLWH 5C0BB 2EUXA 5EU6B 2FR4A 2KDYA 2XI9A 4WGVB 2X1PA 4OLWH 5KVGE 2NY0B 3AACA 3RGHA 4XWGH 5KEZA 4WFHD 1QSED 3FTUA 2H0FA 4CC4C 4E42B 2DMHA 2WKOA 3AXLA 5BJTA 4MA3B 1IEBA 5IB5A 2KBGA 5SWSB 1E4XI 3X1EA 1JZIA 5EO9B 2CCVA 4NN7B 4N2CA 1L7IH 5HGHA 2X4RB 3I75B 4PJXF 5ICZB 3SDAD 2OK0H 1TLMA 2JKNA 2F7QA 3KWXA 3H4HA 4IS6A 5BZWA 3UC0H 4MBOA 4LCCB 5KUKA 2WSPA 1M05A 1G4RA 4PD4K 5FDYA 5KYNA 4MA8H 4C4KO 3S3BB 4X6EA 3QI9B 2R15A 4GKLA 1E2ZA 4R4ND 3WY4A 2IGFL 2K7PA 4HWBH 4ZSOB 3AT9A 1HHHA 3PWJB 3LRMA 4NNPL 4E41A 3DRQB </