2G2NA

Crystal structure of e.coli transthyretin-related protein with bound zn
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
b'NILSVHILNQQTGKPAADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTGDYRVVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHYHVPLLLSQYGYSTYRGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin-like protein
publication title The transthyretin-related protein: structural investigation of a novel protein family
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 25
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2g2nA00
5E4AA 3P3RA 3CN4A 1BZDA 4QYAA 4QXVA 4PWJA 3CBRA 2G3ZA 5FO2A 3DK2A 3P3TA 2B16A 4PVLA 4ABQA 2G2NA 5JIMA 3IMTA 5HJGA 4HISA 1FH2A 2H4EA 2B15A 4DEWA 1TZ8A 1BZEA 2G3XA 2G4EA 3GS7A 5K1JA 3DJRA 1BZ8A 3IWUA 3TFBA 2G2PA 4PWFA 3CFTA 4DERA 1TTAA 1DVTA 1ICTA 1DVZA 3CXFA 4I87A 4PMEA 4YDNA 1DVQA 4TNGA 2FLMA 3FCBA 1DVUA 4TQPA 5AKTA 3P3UA 5CNHA 5IHHA 4FI6A 1THCA 4HJSA 4WNSA 5L4IA 1KGJA 3D2TA 4TL4A 4PVNA 5JIQA 4PVMA 2QPFA 4MRBA 2G5UA 4L1TA 1DVYA 3A4EA 3GLZA 4ACTA 4TQHA 3IMVA 2B77A 4DEUA 4DETA 3IMUA 3GRBA 1Z7JA 4MASA 4IIZA 1TYRA 3DIDA 4N86A 1SOQA 1SN0A 2FBRA 3DGDA 3DK0A 3P3SA 4QRFA 3W3BA 3A4FA 5FW7A 3A4DA 3NEXA 4FI7A 2IGLA 4FI8A 3ESOA 1IJNA 5AL8A 5CR1A 3CN3A 4MRCA 4TLKA 3NEOA 3BSZA 1U21A 3GRGA 5E4OA 5DEJA 4Y9FA 5K1NA 2H0JA 4IK7A 5L4FA 5L4JA 2H0FA 3IMWA 1BM7A 3GPSA 1E4HA 4I85A 3CFQA 4Y9BA 3NEEA 5JIDA 2QGDA 2NOYA 5DWPA 1ETA1 1OO2A 3IPEA 2F8IA 2TRHA 3HJ0A 1G1OA 4IKLA 3IMSA 1IIIA 3GS0A 3Q1EA 4TNFA 1SOKA 4TL5A 5TTRA 2GABA 4I89A 4DESA 2ROXA 4TM9A 1X7SA 1TSHA 4Y9EA 3KGSA 4Y9CA 1ZD6A 2GPZA 4TLUA 4PWHA 4PWGA 2QGBA 4TQ8A 2TRYA 3OZKA 5E23A 4KY2A 1TTBA 1ETB1 1F86A 3ESNA 1E5AA 1SN5A 4N85A 5EN3A 3U2JA 1X7TA 4AC4A 1BMZA 3IWVA 5AYTA 5FW6A 5CLYA 1QABA 2QELA 4PWIA 1THAA 1TLMA 2QGCA 2H6UA 2PABA 5CLXA 4ABWA 1TT6A 3IPBA 3KGUA 1ZCRA 5AKVA 3QVAA 4N87A 5BOJA 4TLSA 1DVXA 3CN0A 1DVSA 2G9KA 1Y1DA 1KGIA 1F41A 2H0EA 3BT0A 3FC8A 1FHNA 3D7PA 3I9IA 4IKKA 4L1SA 4TQIA 2F7IA 3KGTA 5L4MA 1E3FA 4ABVA 3NESA 2QGEA 4PM1A 4Q14A 4PWEA 4ABUA 4D7BA 5CN3A 1TFPA 2B9AA 3CFMA 5CLZA 1QWHA 3NG5A 5A6IA 3DJTA 3I9PA 4PWKA 3IMRA 4HJTA 4TKWA 5FW8A 1GKOA 3CN2A 5AL0A 3DJSA 5EZPA 2H1XA 4AC2A 3CFNA 3B56A 3CN1A 4PMFA 4YDMA 4HJUA 3TCTA 2WQAA 4TLTA 3GS4A 4TNEA 4IKIA 1RLBA 4ANKA 2ROYA 1GKEA 3OZLA 4WO0A 4WNJA 1IIKA 1TTCA 2B14A 2G4GA 3DO4A 1SN2A 3M1OA 1TTRA 3ESPA 4Y9GA 4HIQA 5CM1A 3U2IA 4IK6A 3I9AA 5AKSA 4IKJA 1IE4A 3SSGA 3DJZA
chains in the Genus database with same CATH superfamily
1NGPL 2OZ4L 1T1ZA 2IG2H 2ZUWA 1J86A 4YE4L 3CU1A 3NAAH 4GSXA 4I9WE 1J1OH 3D2UA 3KPMB 3T2NL 4HUVB 4IGBC 3BH8B 3DYOA 1IM3A 2R23B 3HUJF 3UIZA 4C55A 1KPRB 4ZTPH 1YAZA 4XMUA 2E7CA 4MD0A 4Z7AA 1YZZA 4L8DB 5DQJA 4LKCA 5I19H 4NQUA 1TZGL 1T22A 4YHZH 4H8WL 1CZ8L 4KUCF 2E6JA 3ZMRA 2XWZA 4KI5F 4TVPD 5JIQA 4JPWH 5C0JB 4AEHL 4HKZB 5FYJD 4TVPH 2YLKA 2G60L 3T0BA 4NM8H 3VI3F 3PWJB 3PXJA 1MLCB 1GW6A 3CFEB 4BZ1H 4UOW0 4Z7VB 4MAYA 4TSAL 1MFBL 4JQVC 3HPLB 5I5IA 2NY7H 3CVBA 3QQ3A 2FHFA 3V9FA 1J0IA 4J8RA 3CMGA 3L5JA 1QSZA 2P1YA 4HLJA 3DHJA 2BNUA 5DUBB 3L3DA 3B9AA 3IMWA 4PBDA 2FQEA 2Q10A 2B0SH 1RZKC 1ASOA 1NKOA 4PBXA 2YRBA 1TCMA 1U93B 3EH5B 5AVVB 4Z5RA 1AZBA 3ZQWA 3ZO9A 1FYHB 4YVUA 3ETSA 1U58B 2CGRH 2EC8A 4LASH 1A6ZB 2V17L 1CGVA 2P48B 3DURB 5T8IA 3SYAA 4NQVA 4S2SA 3X13A 1DLFL 3FTGA 3SKJL 1VFUA 5JIIA 2AJZA 4PRHB 1U92A 3RUGB 1FNHA 2X42A 3ZZSA 4AX3A 1ZGLB 3K4ZA 3G6JF 4E9LA 4L8SB 5BO1L 4ES8A 5KVEH 2G9HA 2MIZA 3GSVB 5I1LA 2ICWJ 3ATBA 1SMOA 3X14A 1OARL 2CBOA 5JOFA 3J2PA 2G9KA 2ZUQB 4OLYH 2KQNA 3SDYL 4YSTA 5GGVY 4IKKA 1IC7L 3FFCA 1D2OA 3BFWA 4ZTOH 5CBEA 1OY3B 2EECA 4MJJA 3HFMH 1UH2A 1AD9B 5HP5A 1N0LA 1ZANL 3HLAA 5I0YA 3U46B 3SJVD 3CFNA 3QUYD 1G9MC 3QI9B 4PMFA 4C4KT 3KBHE 4P2QE 1TNMA 4D9QD 3GS4A 3JWNG 4K7PY 5GS2H 5HYJA 1M6OB 1KTDA 3RL1A 4TUOA 5ITBH 3H3PH 1Q4NX 3LAFA 2FTAA 4Q9QH 2W60B 1A4AA 3VXSD 4JRYE 2DAVA 3QPXL 2VDNH 2E7DA 2W88A 3NFNA 4IKJA 3AROA 4P2OB 1GZQA 3L17A 3ZMNA 2PNDA 4MLIA 1PFOA 3MV7D 1OT1A 1ITCA 2XQ0A 3O4OB 5FYJU 3VXUA 1A1MB 4WTZG 2AJVH 5FYKE 1LP9E 3KYNA 2A74C 3NCYP 3V8CA 2EVFA 3UX9B 5CCKH 3VXSB 2NX5A 4OGZA 4GAYB 4NP9A 4XNYL 8FABA 1DQML 5E5UB 4WV1C 5ISZE 1XIWD 3RNQB 4F9LA 4R8WL 3MV7B 1SPDA 1UWXK 2WBWB 3CSYA 2CPCA 1DUZA 1JI1A 2NY2D 3GNML 3EYFA 2BW5A 1AKJA 3HAEG 3PJSB 4H1LH 5D1ZI 4HWBH 1NEPA 3VXQA 2ERJB 3AVEA 3CGTA 1QBMH 2P5PA 4OF7A 4F58H 4OQ1A 1AE6H 2GJ6E 1LDPH 4LIQE 3V0EA 4MMXB 2NY2B 4PG9A 2ITCB 5HI3C 1RZGA 2Q2LA 1PZDA 2WGNB 2C1OA 4MCYA 1FFNB 1AC6A 1ANUA 2XPGB 3AZUA 4DO6A 2ZP0T 4G8EB 4L8CB 3OKLA 1EHLH 1CFQB 4MNQE 4WFGE 3UFIA 2DWEB 1HCYA 1YECH 3NEEA 3UGUA 1K8IB 1AQHA 1L0PA 1ZS8A 2VZ1A 4A55A 4HJ1A 2Q8AH 4HS3B 3C5SB 2MOQA 4HEME 1WH0A 2YD5A 3JTTB 3TFKC 5AW7B 4NO2A 4W4OA 1DLHB 2I26N 2N59A 4NZRH 5C07B 2IC2A 2BCKB 3F12A 3PJNA 2XQBH 3UBXA 2ZKMX 4PV9A 1I1AC 2NW2A 4BD4A 3OKEB 1ACXA 2NNRA 3ULVE 2P8MA 4MNHB 4F8OA 4H25B 3GMMA 4X5PA 3UABA 3BGFB 2Q3ZA 4YHKH 1J87A 3A67H 5HGBA 4GRMB 3P11H 7CGTA 3DBXB 4RQQA 3JWNC 3WU1A 1MVYA 4W6WB 3TT1H 3UDWC 4IDLA 1KIRA 1RIHH 1VF5C 3LJ3A 2GY7B 3EO0B 5G4OA 4GSDL 4NQCE 4OLVH 4ZSOA 2UZXB 3HVDA 3MKKA 3TVMD 4AK2A 2JXMB 3D25B 5F97E 3OWRA 3D0VA 4W9EC 2Y69B 4XNZB 1JGEB 4HIHA 1V54B 2O5ZH 4R4FL 4C59B 1H9DA 4OCYL 1NCDH 3OGOE 4MMYB 1EBPA 1E90A 3II3A 5JZ7D 2KMWA 2V8MA 5EEXA 2YGQA 1E8ZA 4N8CH 3ULUH 4EI5A 4BZYA 2VLMD 3TVMB 2K6YA 1GGCH 4FA7B 1J48A 1K4DA 1V8HA 2Z31C 4PVLA 1FUNA 4I0PC 1OCOB 4RSVA 5EUOA 4TOYH 1HE8A 2DWDA 3JSSA 3L5WB 5C0BE 2IQ9H 3KL3A 3AY2A 5D8JH 4AUJA 3HBQA 2VN3A 2D03L 3IXTA 4M7LH 2VLLA 1IAKA 1YJDL 4JR9L 5SWQA 3V4PH 2ZUTA 3QJFA 5IV2B 1AZUA 3R1GH 2EIBA 1YEFH 3PL6D 4NLHA 4NHUA 4M7KH 2QPFA 5T1KB 1TEFA 3D0LB 1OHZA 3VFPA 4UOQA 3TTSA 4WEEA 3MLRL 2QQKL 4ZZFA 2OV0A 3KH3A 5T1JA 2KLTA 3FW6A 5EC1B 1OGAA 4HU8A 4KXZI 4AXWB 4RFEA 5B22A 4K8RD 2VSCA 2NUTA 4OZFB 5G5DB 3UJIH 2P5WE 4AG4L 3PL6B 3TA4D 4FI8A 4K8RH 4LBEA 4YHNB 3QIBB 4KMLB 1NCBH 1Z32X 3QWOB 4H8PA 4QMEA 3ZR5A 3BVDB 5IZ7A 2BDNH 3VYOA 5DEGA 5J6HB 1RJCA 2YPVL 5D7HA 5D72H 1MW1A 4ZPVA 3QIWD 2DD8H 1PSKL 2QSCH 1A5FH 4J3TA 4XP5H 3QFJB 3GLDA 3N40P 2CIKA 2CLRA 1ND0A 2CRYA 2EC9T 2QLVB 3K72A 4IBZA 2OMXA 1VEPA 3ET9F 1B2WH 2Y7LA 2D3VA 4E9RA 4RMRA 5I76B 5EN3A 5DJZB 2OA9A 1U8IA 4OIIH 1RK7A 2YQBA 4FC3E 4LCUA 5MEND 3IN2A 3UTTA 2FBJH 3MREA 1JP5A 1X4YA 3V7AG 2WB1A 3FU7B 1QFWM 1RKRA 1E27A 3CFJA 2XTJB 2HLAA 4R2GC 2WXMA 1N6UA 4ZMOA 5DZ9A 2B1HH 4UF7C 1A14L 1KFGA 2YSSA 3MLYL 2LLNA 4HXBL 4RISH 1PW3A 3HHSA 2BVUA 2D0GA 4MKMA 3PGFH 3QZPA 4PRAB 5DMIL 5IW1B 5GRWA 4GG6F 3KPOA 5IW6B 3QDMD 1CE1L 4M00A 4LPVA 3LNDA 5AB1A 2HPTA 1TO5A 5BCAA 1ETJA 1S7WA 4LOVA 5JHDD 1DFBH 4XBGA 5CWSB 4R4BB 1OT2A 2YQGA 2VABA 3VGEA 1FZMA 2ZOTA 1LMIA 1FGVL 2EIMB 1CICA 2XZQL 3VH8A 3HZMA 1CBVL 1PYWA 4M8QA 4JANB 3OLDA 3T2PA 3SKOB 4MMZA 5F7LB 1ZIAA 3C2SA 3P9MB 1E2ZA 5T3XE 4FXGB 3WLWC 3U0WH 5T3ZD 2M1KA 3EUUA 3PWNA 1N0XH 2O1AA 3MLUL 1I9RH 2FHBA 4GRWF 4XXCA 4HJ0C 1ROWA 3OR6A 4OJDH 5IB1A 1UT1A 1HQ4B 4NQEA 3IFLH 1DVTA 1BHGA 5BNXD 1BLNA 3UYRL 3HS0B 3DMMC 2AQ3A 1JWSA 4KNUA 4PUBH 2Q76A 4S1QH 3S3BB 3SCMD 1JSYA 4FLHA 3WGVB 4NQSA 1VPOH 3BISA 2H7WA 4LF3B 1GZPB 2H45A 1TYEB 5ENWB 2L04A 2P80D 4MCZA 5E2VL 1KGYE 5I1GL 3AG4B 2B3RA 3A4EA 3DVNB 3S2AA 4JFSA 4O58H 1MI5E 3OLGA 3N9GH 3QQ4A 4X4XA 4PYGA 1TZAA 3BUIA 2EEAA 2XFXB 3VFSB 4YEFA 2DICA 3KPPB 2BXYA 2DQHL 5E95B 4GQ9L 3SBWA 4AGNA 4YDIH 1DO6A 1CGSL 2UWEB 3P30H 4PGCA 4RFOL 4UQ9A 3ASWA 5H35B 5L8JB 2HT2D 3MA7B 1LXMA 1A3LL 4CMMB 2E7LA 3QP3A 4EN3D 2E9GA 3GK8H 1WG3A 1JCVA 1AGDB 3NIFF 1XF4A 5D1XC 4ENZA 1IAIH 3FMGL 3SKMB 1WZKA 3ERXA 3W9EA 1KWGA 2VCOA 2P26A 3MU3A 3B1UA 1INDL 4LVEA 2B5IB 5E6RB 3EG9A 1BEYH 1EV2E 1MCPH 4JFEA 3P2TA 3S48A 1PAZA 4PRBB 3REVB 3U25A 4TUKH 4F57H 2DQFB 3FSZA 4EN3B 1UT9A 3D33A 2KZBA 2R8SH 5TDOA 1V55B 4KKPA 4ISVB 3QXAA 4U3HA 1I1YB 1PZBA 1LJMA 4C83A 4PQXA 1CFBA 2H2SC 5GZNA 1INQB 1ZPUA 4R96B 5SV4A 4X4YB 3I9PA 2G0KA 4XMTA 3FULA 4JG0H 4FQXC 4QPEA 4Z7NF 3ES6A 5JHLL 5I0XA 3CSBA 5CJOL 5D1QD 1NKRA 4WUUD 2R0LL 3BP6B 2IGTA 1JFQL 2J4WL 4NWUH 5DEFA 3EOAA 1AC0A 2ZWNA 4IGBB 2JB5H 3TN0A 4Z0BH 3MBXH 2BZDA 4N2EA 4JDVB 1NFDA 4I1NB 4HWZA 5GS0C 4F9PA 3BT2H 1BLIA 3I9AA 5DHYA 4G7QB 3IJYA 4WUUB 2NSQA 3UIYA 2CMRL 1CK0L 3H7BA 1IGIL 5FUOL 2YGPA 1IBGH 1ZLUK 3QWRA 4A2MA 1YYLL 2B15A 3KEHA 3RGVC 2JTYA 5D7LA 4M4RA 4OLWH 1ZLWK 1R5IB 4W9FC 3GO1H 4AEIH 2AMGA 1U4FA 5DHXB 1I8LC 1BFOB 1P4BL 3MGOA 2E8ZA 4R7XA 4WWID 5CGBA 3SDXF 2ZSVB 1Q1JH 3C8DA 3BX7C 1NMBL 2AQSA 1X7QA 4U6HA 2Y7QB 3KD4A 3ZN6A 3ECBA 1ET5A 2GSGB 2OMZA 4XAKE 1JGUH 4NRZA 3PV6A 4YVNA 5HHPB 4H26B 2ZG1A 4PV1C 4YXHL 2CRZA 3FT1A 3ETTA 2VZOA 3FCTA 1J7VR 4WW2C 5J5EA 3ZKQD 2NY1D 4BE6A 5TK2A 2YPVA 2YIHA 3FU8A 1G4MA 1JF6A 1OQOA 2BZCA 4OZHE 5TF0A 4WTQA 5KS9F 1E5CA 4YO0B 2BIOA 5DD5L 2JSFA 4L3ED 2OXHB 4XNQB 3ZZQA 4WFED 2V9RA 5E4OA 5TQ2L 3G04A 1QSFD 1T1YB 1MDAA 4ZNEE 3OXRB 1KLFA 1UH4A 2NY1B 3IU4L 3K3QA 3IJSB 4JKWA 4L37A 2MPAL 3V6FB 4ODSH 3MLVL 4B5ZA 1A65A 1R9FA 1SOKA 2UZIL 4N0FA 4JFFD 2ROXA 4NJ9L 4NZTL 3TPKA 3F6IA 1UA3A 1AJ7L 1QEWA 4ALAC 1OQXA 1RHHB 3KVDD 3BUDA 4OM0L 4AJ0A 1LE9B 2O61B 5LBVA 1KN4H 2AK4D 1L9MA 3VRJA 4H8UA 1ZHKA 3DV4A 5FAAA 5T5FL 3KH4A 1QRNA 1GYWA 4FJ6A 2EXTA 2Z91A 4P46A 5EO1A 3TO4C 1HHIA 1DJXA 5JYLA 5BOZG 3VUAA 3A5VA 5I8EB 5FKPA 4PWKA 3QC5X 3VMOA 3DSNA 1YEWA 2R29L 5GIRA 2Y7OA 4LCCA 3UTSB 4YDMA 3BUQA 2K45A 4NNYB 3FSAA 3HN3A 3ROOB 3TCLA 2H3XC 1BVLA 1CIDA 2C9SA 1JZ7A 5DD3L 2EEXA 2A74B 3TWCH 3KJ4C 4LSQH 2D3JA 1UD6A 3F58L 5GHWH 1UXMA 3QO1A 3AG3B 3BO8B 2X0VA 1UURA 3CZUB 1RZIA 3NJNA 4WV1B 1ZEAH 2FEDD 1CG9A 4X4KA 2J2ZB 3CDZA 4XBMA 4RBPH 3BZ4A 2EP6A 2FQGA 5FV2A 4IU3A 2A6DA 2BMKB 1QLFB 3BUYA 4XP4H 5E9AA 3WS3A 3VXRB 4N8UA 2A7BA 4C8XA 1K8DB 2IH1A 3FB6A 3AW5A 1KEMH 1A4KA 4K15A 3PWPD 5MERA 1S9KC 1M71A 2LAGB 4PMEA 2YZ1A 4F8TA 1U8CB 3IFOB 4I48B 4LLVB 5KJ7E 4HUWB 4G42A 1E8XA 1SBBA 4LAQH 4UCFA 3EJUA 4JQXC 3QHZL 4PRPE 1UWYA 2QSVA 4N0RA 3ISRA 1LWRA 2JJSC 1C5BH 2R0KL 3BP5A 3EFOB 3IGAB 4HKXB 1A0QL 3OKMB 2VDQB 5DDHB 3V0WL 4NUPA 5SWZA 2V5RA 1VLXA 1FRGH 3T8MA 1RERA 5JW4R 3L4UA 4KKLD 3R4RA 4XGZB 2C26A 3Q6FB 3QH3B 3S34H 4AM0Q 3RWIB 4MJ5A 1SUJA 1CLYH 3GC3A 3HZVA 3NABH 4HBCH 4WKZB 4N20A 4XPBL 3VXNB 2UY7B 2YJLA 5KANG 1RVFL 5DGQA 1OO2A 3EYQD 3VGDA 3GEFA 4JRFA 4LLMB 4X6CB 4Y1AE 1TETH 2O6EA 1UM4L 4QDGA 4PREA 4A04A 4N5EC 4EUPG 5MEQA 3ZRCC 1YEIL 4MDJB 2QHLA 2D7PA 2OTWA 1KJMA 4O02B 4G6AD 3DETC 5ID0A 3BKCL 4Q8BA 4PWGA 4ACPA 1TTBA 1CLOL 4XOCA 5CZVH 2VB5A 2AJSH 5B39A 2XXGA 5AUMB 3TEYA 1CGWA 3CV5A 1KWKA 1WAPA 3CJJA 4GW4B 3BYTA 3MRGB 1F3DH 2EYSB 2Y36L 3QORA 5DJYB 2WTOA 4PTUB 4KTYA 3MLXL 3P77B 1N5YL 1NIAA 4WW1B 3ZKND 4XX5A 5K93A 3EYUL 3NH7L 4PJDE 5DTFA 3NCJL 3S36X 4OY9A 5AWNH 3DGGB 3LMJH 5KSBE 2DYSB 3U9WA 1MFVA 1M56B 1ED3B 3MBEA 1YMHA 1IEAB 1W9XA 1VFAB 3C87A 2VMFA 2Z31B 2EDQA 4IRJC 3CC5B 3ZXAC 2ZCZA 4I0PB 2IGFL 2DZEA 1NC2D 4ZFOB 5BW7A 4J6IA 2O5NA 5FXCH 3HAEB 4X9BA 2KKQA 1P7QB 2VMCA 1B4JL 2F54A 4GG8A 2X7LB 3WXVL 2FVNA 4G6KH 1QLEH 4JFDE 2XBZA 4PJ5E 3B1TA 4OBRA 5I1HH 5JPMA 2XG5A 2AKRA 4KOBA 1BX2A 4G9FD 4ODWA 3T3MB 3BPNC 2P49B 3UJJH 4NUJA 1OPGL 5IFAH 3OAUL 3WN5B 1NC2B 1F42A 5I8OH 1BD2E 4XN9A 5L2KD 3OKDA 1QBAA 1GIGH 4JG1H 3I9GH 4Y19E 5DWUH 3ZRFC 5IHBA 3BGMA 2PXYD 1LEIB 5CXPA 4FFYH 4B9YA 4KHXL 4G9FB 4JMXA 1GS8A 5LWYL 3PU7A 4NAQA 4UNTA 1UKQA 1SLWA 2H6PB 2LE9A 4D3CL 2VDKL 3Q2WA 3N1FC 3GJFH 2NT0A 1IKNA 2NLJA 4GI9A 5L2KB 1MCLA 1HWHB 3BEWA 1SY6H 1CFNB 3GLZA 4GAJL 1DQDH 3GM8A 1JZEA 3QDHA 5HJ3B 1NGZA 3JV6A 4YL4A 4Y5VA 3KPRE 1MAMH 4WGWB 4EQ3A 4XP9L 1JWMA 1NDGB 2DQCL 4IOIB 5C7XL 3WMQA 3CLEH 4YFLI 5D2LB 4JPQA 1NQBA 2WB7A 3MN8A 1NAKH 3HI5H 1XTMA 4GAFB 1P84K 3L3IA 1AP2A 2VSKB 1F0LA 4BQ8A 2KPNA 2I60L 2RFXA 4UV4L 1SOSA 1GC1C 1U8LB 2BH0A 2CG9X 2QQLH 1XFPA 2I24N 4R26H 4JDZA 1J8KA 3FQXA 1I1CA 4R2GB 4N3UA 5C0IB 4GMSL 1VFOA 1UKTA 5T5FA 3TBTA 1E6OH 2DKUA 3KWTA 1XSKA 1M2OA 1XXFC 3PG2A 2I07A 5TF1H 4YHLH 1QKZL 4HK3N 4Z7UA 3CBKB 3I84A 5C0EA 4H4NA 3RIAK 3RU8L 5FUZH 2VLJA 1MHEA 2ZYRA 2F7IA 3ISYA 1LO4H 4P2AA 2HJKB 1I9EA 4N1CA 2A6JB 4OFIA 4WDIB 3FUIA 5CHNB 2L7EA 5FW8A 5INDA 5ESQB 4WWOA 3CHRA 1UZGA 2OMTA 2WZ6A 3GSUB 5CMAB 4A7VA 3WS6A 1Z9NA 1A6TB 4QRPE 2WNWA 2N7AA 2OP4L 1D5BB 2EDFA 1EIBA 2JK5A 4XH2A 3NSCA 3M46A 3NUKA 4DN4H 1KSRA 1H6UA 4ZMVA 2ITDB 1CD1A 2GIYA 2V3FA 3HW7A 4Z7WB 3DMMB 1KYUA 3RNKA 5IMMA 4BFOA 1XCQB 3BLBA 1FAIH 1XH3B 4OD3L 2G3ZA 4UT6L 3ZTJH 4CSTA 3BE1L 1BAFH 5KBKA 3KXFB 3C6SB 3V0IA 5DJAB 3T8VA 1LK2A 1KCUL 3AACA 3MX0B 3VYPA 5EBMA 5BRZA 1I3RA 4N5UA 4NWTH 4KJQD 3MRIB 4ZW7A 2HWZL 1MCIA 5A2KH 2IO5A 3FDWA 4K3HA 1OE1A 1MIEL 1N10A 3MR9A 3SBRA 1IGTB 4HJSA 3WFCL 4NNXA 5EB9A 4WTWA 1H3XA 1T4KA 3CFUA 3S36H 4NT6A 5ID1B 2BHZA 4AYGA 3BP7A 1QX1A 2Y4SA 2WN3A 2E75C 2MKLC 3SQBB 4XHJD 4WZ9A 1MWAB 3A22A 3OLIA 1EFXD 3WFDH 4QY8B 4XT1C 2HA1A 3BRDA 1FNAA 4AVKA 2P8LB 2FWOA 1BWMA 3KBEA 1SOQA 2PW2A 3T0VA 4XPGL 2YPLE 1EZUA 3PDGA 1IC5L 1UJTA 4ZO6A 2RALA 5JDSB 1AH1A 4YDJB 1TYJA 1P5UA 5D1XB 4ADIA 5JXEC 4J5VA 3WEAA 2NR6D 1F4XL 1RFDL 4MJ6B 2JKLA 4XTRC 3RFZC 5C0CA 2MQGA 5B1AB 4K3JH 5LG1A 1EUTA 5DVPA 3VQLA 5IVXB 4X9IA 3POCA 1HHKB 5CLWA 2IPTL 5C86A 2X88A 3NIGF 5DF0A 3OR7A 1A9BA 4ZW6A 4FFZL 4I89A 5F8QC 5CILH 4HZLB 2FB4H 4IJ3C 2YD7A 5EOCJ 1BVZA 1PCSA 4QRRA 3WTTA 2IADB 5IROC 4E41D 5EU6E 5IBTL 4RGND 2VXTL 2WUCH 4QTHA 2IANE 2AQ1A 4XNAA 1Q94B 2I25N 4OCLC 3QVAA 5E1AB 1DL7H 3FYIB 3ZPDA 2ZXDA 5E9NA 3MNWA 3TV8A 3ZGHA 5LVEA 2VH5L 3T1WA 3T0DA 1YEJL 1ILSA 1GPOL 4E41B 3EYOA 4KPHL 4LOEA 5DK0B 2ZONA 2KQMA 5EG6C 5FF6B 2A4ZA 3VD7A 4KK8D 4MKTA 2JKSA 4KZEL 2GK0B 5JHMA 1MRCH 1HU8A 2F0CA 4G9DB 3R7RA 3W11C 3S4SG 1XHHA 4G3YH 2A6IA 1TCRB 2VXQA 5HDBF 1OSPL 2WVTA 3CFKB 1NAML 4F2ME 2W0KA 4G8IB 2XACC 4UMGA 3RGVB 2QFPA 4N6RA 1FE8L 4C47A 2GUOB 4WEBL 4CNIB 4M61B 2VDRH 1KBGL 4FQLL 4ZS6D 5D93C 5AB9A 1J05A 4M7ZC 1G1KA 4PWJA 2NTFB 2X9XA 3D18A 4J23A 2EXSA 3DJRA 1Z9MA 4Z3IA 1DQJB 5JXAL 3KGRA 6PAZA 2ARJB 1IBHA 5CLTA 3RKDD 4AQ1A 4I1RA 1MFCH 5IR1A 3SY0B 5IKCA 1ZA3B 3GBML 1DVQA 2BVTA 1UXWB 4GUPA 4LLDA 2QTEA 5GGSB 3MJ8B 1SJEB 3VD4A 4ZFQA 2XN9B 3H54A 5E4IA 1J12A 2YBRA 4YO0A 3QCTH 3PWUA 1ACCA 4LOUC 2UXTA 1L9NA 1ZDQA 2OMWB 4OCWL 1JRHI 4PP2B 3U36B 4XNDA 4FABL 3BZFA 4Q9RH 2EINB 2OJEB 5FO8B 4RAUB 4M7JH 3ME0B 1DZBA 4JM2C 1S7RB 1I8AA 2VQTA 3O81A 1F1AA 2M26A 1WBZA 3O2WH 5ERWA 3CLFH 5DYOB 5KVMC 1MCHA 5HHQA 1CFVH 4N8VG 4MJIB 1EHXA 3NZHH 5EBGA 5E08L 1H5BA 3NZSA 4CVXA 2ICES 2Z93B 2BNQA 4GBXD 3TJEH 4GKLA 4GP8B 4JCLA 4ELMA 4WI0A 2Y5TA 1IC4H 1KIPA 1ZJAA 1S7UA 3EHBC 4MAUH 3EDFA 5F1NA 4JRXA 1DP0A 3H85A 4HUXB 2VDPL 5B3JF 3QZMA 4HQQH 3TO4B 3S35L 5B7EA 1LTXA 4ZMNA 3T0ED 4NM4H 4BH8B 3ZE2E 4L8BA 3G6AA 3TIDB 4E9SA 1NTDA 1NH6A 1RK0B 1SEQL 2ITFA 3B8SA 2L0DA 1TLMA 3VWJD 2OMVB 1QRKA 1SYSA 2QLYA 2ZXCA 3QUKA 3T0WA 2D8KA 3RDTC 3WJLA 1HIML 2F6AA 1L6XA 1B4LA 3WG7B 5HHOB 1VGEH 3ULUC 1Z9PA 1BZ9B 2CD0A 3GZPA 3KJ4B 3U6RB 4NNYA 4J3OF 5MP6L 4FQPA 2FNWA 3OAZH 4N2AA 3VXMA 4ERSH 3VWJB 2I85A 4GRLC 3PGCB 4OI8A 3L3JA 3NJFA 1IBYA 1IM9B 5FA4B 1JVKA 5F7YC 3L3KA 4UM8A 5KYWA 2NCMA 5F1IA 2RCSH 4FQ1H 2DMCA 4UT6A 1TQTA 2Q20A 4F7TB 5DMGD 2HVKA 2FR4A 1RUKH 3TCXA 4OJEH 4PJHB 4DCQA 1T66D 43CAA 1M05A 2KT6A 3QEUB 5I8KL 4YBQC 3FOLB 5EEZA 2X3CA 1N5AB 3JV4B 3T08A 3MACL 1UM5L 3MJ7A 2JI3A 2JKTM 4RAVB 3FQRB 1X9LA 4YDKL 2IF7A 5JIMA 5GSVA 1GJIA 3HI6H 1VZHA 1BBJB 3P0GB 3BKJH 5F7EH 2A6KA 3VXOB 1JZFA 3T65A 4TTGA 4TTDC 3N44B 2UZPA 1F8TL 3FU9A 2X2HA 2W5PA 4P23C 5HGHA 1HYSC 2FLMA 1DJHA 3FCBA 5JORA 1S9VB 1BM3L 3LNIA 4NQXB 3TURA 3FJTA 5J4MA 5D2NE 1CPUA 3TL5A 3DO7A 1AFVL 3Q1SH 3ECVA 1F6LL 1R3HA 4I9WD 3S8WA 5HYSG 2DEWX 2X4QA 4NNPH 4PGJA 3MRFB 1Q72H 2XY2A 4JG5A 3ZDXF 3C6LC 3N42B 3QUGA 4A7TA 1E6JH 2VC2L 4CBPA 3CDCA 2WY3B 3VXTB 2ZUXA 1I1AA 4N2KA 2DIBA 1FO0A 5CEYA 3GI8H 1ZIBA 1FZOB 4PI2A 4UM9A 4OGXL 4OZ4A 3SE4A 2G5BA 3U4AA 2J8UB 3LXCA 4K9EH 4K3EH 4LE8A 2QR0B 32C2A 1ZS2A 4PJIA 5F89B 2K0RA 2Z3FA 5MEOA 3IGFA 3RGBA 3QZNA 4JZJC 4NJAH 1NFDF 4QXGH 1NMAL 1X9UA 1AGFB 3CVHH 1YEDA 1SZNA 2YRZA 2ZOKB 4J6RL 2DMGA 3GIVB 4CKVX 3D69A 2F18A 4JO1L 1FZKB 3GTNA 2OYLA 5C08E 3QUML 4W9JC 3B34A 3SKNA 5HVFB 1KB5B 4GQRA 5A16B 3IWVA 2NQ3A 1UASA 2W59A 5CS7A 2EXYC 1B0RA 5FCUH 1JL8A 1JV5B 5E2WH 1VFMA 3IETB 2VDMB 3FONB 4GRWH 2QV4A 3MXWL 3F7KA 3DTXA 3E8VA 2DMBA 2WO4A 4IRJB 5J12B 1IGJA 3L1GA 1OZTG 3LEVL 5EFIA 2F08A 4XX1E 3RZWA 4LNVA 3CBJB 3VFRA 4P4KA 1KNOA 4YIQB 2WCSA 5FB8A 1FBIL 5F9DC 4Z76B 4NO3A 4KMQA 3FTVA 1XGPA 1MFEH 1BAWA 5M95B 4PJFE 2V9TA 4YR6B 3BPNB 1B88A 3GIZH 3ARBD 3QUZD 4Q56A 3QCVL 4F7PA 1QNZL 4OF0A 2YA1A 3P4LA 5T1LD 4LCWE 4QI3A 4PJEA 2DV6A 4IK6A 3ZHDA 3ARGD 3PGDB 1IAOB 1PEZA 5D5MA 2GI7A 4M03A 4MCMA 2R4RL 3HB3C 4KZDH 3QUZB 4HKBB 3O6LH 1L9TA 2VDOB 1T04A 3CIQA 4XOBA 2GEQA 3B2VH 4P2QD 5E9DD 5G2NA 5T1LB 4DH2A 5JUEH 1TZOA 2FSEA 3N3EA 5J57B 4X7CC 4MSWA 1RMFL 4D9LL 4KV5E 3L08A 4JRYD 3SE6A 3AGWA 3BW9B 5E2UH 2BPBA 1DBMH 1YEEL 4MGXA 5E1HB 4BZ2A 4OFQA 1MUJB 4OKVA 4G6ML 5E9DB 1Y6MR 1RJYA 1F4YL 4EUPB 5LGHL 5F7UA 5EIVA 3O8XD 5BJTB 3RVWC 4BCXA 5FYKD 3NQIA 3EOTL 5C8JA 3GYRA 4JRYB 3QG6A 1Z9SA 3S5ZA 2AFNA 4NDMB 4P2YA 3LN5A 3UAEA 2EVIA 2GHZA 1I8IA 5ISZD 2A0LC 3D34A 4YSUA 3MZGB 4XCYB 1O6TA 3RIFK 2LU5A 2EDOA 5HGGS 1WFTA 5IJVB 3FT9A 1LP9B 1A2YA 1U8LA 1YNTA 2JCCA 5B7FA 3P69A 4XZ4A 3GMNB 3VFOB 1QFWH 1MQKL 1QVOA 3IDXH 1QUNA 5DURB 2NY5H 4NUQA 1KF9B 4GAGL 4X0KB 1E4XH 1M42A 3NJGA 2PPAA 4POZC 5D7IB 4A66A 3O0RH 4TMPA 4HOWA 2DQIL 3C08H 4HC1H 3MBWA 4LCYA 2WUBH 3V0DA 5SWSA 2BS9A 4QRTB 3SPIA 4OSUH 5IP4A 4MNQD 4WFGD 5LCVA 3OV6A 1HXKA 3HE6D 4MQTB 1JCKA 5HD8D 1U42A 3QZBA 4PJ8C 4UQ3A 4Q7DA 5K39A 1OAKL 2XZCL 4N9GA 4CGUB 3AWFA 3L13A 1GYUA 2BP0B 2OL3H 3KYOB 5EU7E 1FNSH 4ODTL 4FZ8L 4OZGE 5AZ2H 1S5HA 4U1JA 4LZKA 3SHSA 4BBWA 4ZX4A 3BQUA 2CJUL 3BPOC 4LL4A 4RFNC 1EAOA 5D71L 4Z78B 5E51A 1J5OH 3MNZB 1DBKL 3ULVD 2OQJA 5JQHC 4LLAA 1IC1A 1HHHB 1QA9A 1WZ1L 3ZE0F 1HJBC 5HHMD 2QBWA 1BXAA 1MW0A 5LUMA 5IJKC 1BSIA 4ANKA 2PYEA 4JO4H 2E47A 1QYGL 1NEZG 3FK3A 3VG0L 1IVLA 4OM1L 1M2VA 3GBEA 5LQBL 1TENA 2GIMA 3NOIA 5KYUA 4ODUA 4OIAA 2GJRA 3FAXA 1FF5A 3TP4A 2VRKA 1NC4B 1MFNA 2LQRA 4PRIE 5HHMB 4L1DA 4NQCD 4ABQA 4JUSA 4TSBH 4I3RH 4XB3A 5IBUG 5FYKU 5CEXA 3K2KA 5GGUA 1A1OA 4PJGA 1LE5B 3DDGA 1X5IA 2AEPL 4JHWH 1RPUA 2QQNH 2DTSA 1UWEH 5DVLA 4PGDB 2VW6A 3S96B 3EYVB 3FU0A 1Z9OA 1NANH 3ETBF 5F0PB 5CEZL 1G7HA 4KKBC 1XF3B 2FLBT 3SBPA 4EKJA 3T3PF 4LLYB 5E2JA 3DO3A 2HKHL 3V6OA 1TVBA 3DVGA 1NPNA 5D9SB 4HIEA 5EU4A 5ANME 3U9PL 1AQKH 3S3PA 3RFZB 3IAPA 5FM5O 3L4WA 1DCEA 4DJMA 1U8NA 3DARA 5C0BD 3KJ6L 1ZLSH 1ZLVK 2HFFB 1S8DA 5D6DA 5F9JB 3SE9L 3AT0A 2F7OA 3UZEC 1P0SE 1HHKA 2NYYC 2Y24A 3CUPB 2J6EH 4IJ3B 1RZQA 3QT2A 4IK7A 4ZS7H 2PR4H 1U41A 4RMWA 5L4JA 2PWEA 3K2UH 1GJUA 5C0BB 3CQPA 5EIIG 5EORH 3GUTA 1LGVA 1X5JA 1IGFH 3P40A 3I3EA 2XHNA 3QUMA 2JLPA 5DD6B 3B9KC 2RQEA 2XIIA 5KSVA 3F5WB 5DUPH 3K8LA 3RWGA 1NCTA 1L9QA 2ZCHL 4D0BB 2P5WD 2VWEC 3QJQB 4FQXA 2P5EB 5AD0A 4AH2B 3BVNA 4M6ML 3IJ8A 3QDGA 4TNVF 1QI5A 3BUBA 3EDDA 1VADB 4XRCB 5AW4B 1SDYA 1G9HA 4UTAL 4CL7A 4K94H 5C70A 3SOBH 3VJ6B 2ZT9C 3CK0L 2J72A 1KC5H 3PQYA 1G94A 3ASNB 4KTDL 1QPPA 4PU2A 3E6HB 1T6VN 3KAAA 1FLRH 2D4FA 4NUGL 1N8OE 2H26A 3B7SA 1CTMA 3EH2A 2E4TA 4YHPB 3FO0L 1JYVA 1PD1A 4Y2LA 5FDYA 5LBSL 1NICA 1HEHC 1M1XB 4KH2A 2R69H 3FQTA 1E65A 2YUZA 1PLGL 1T21A 2WCGA 3CFBA 3S5YA 1KXTB 3A6BL 2VDLH 3HI1A 3BCFA 3M86A 5ADPH 3TNNA 5AZEH 1OHQA 2EADA 1SGKA 1JN6A 3Q2VA 4M7ZB 3U7AA 3OPZH 1JGDB 4TNEA 2JNZA 2VSMB 1XCXA 3WFEL 3ULSB 2NY6C 3PP3K 3PLYA 4A2FA 3U2SB 4RZKA 3T5WA 4ZODA 3FOMB 2NY3D 4LOUD 1TZIB 1OW0C 3EYSH 4TSCH 3TIEB 4HUCA 4EIUA 4QXVA 4EIGB 1U8HA 5E70A 4WW2A 4DWHA 2CSPA 2ADJA 4V1DA 1QLRB 4J4PD 4HV8A 3QFDA 1LNUB 1NPJA 4JQIL 1AI1L 3WLBB 5MI0C 3H0TA 3UG5A 1PKQA 4PCTA 1NBZB 3AMKA 3O2VL 4JM2B 5DJXA 1MNNA 1N4XH 2OR9L 4JRLA 2Q86A 3Q05A 4NAJA 4K73A 3HCVB 4DKFH 3PPSA 5T3XH 1Z1WA 1W0VB 1TEGA 4YNYB 2J1XA 3NP4A 1HH9B 4FKKA 3NVQA 1WWAX 4JFXA 1TITA 3M17B 4L4VE 3GJEB 2DQJL 3TNMB 4OGYL 4RLDA 2IMNA 4KUZH 4LLWB 4N2NA 3T0AA 4AMKH 3OJVC 1UJ3C 4KY1L 1Z5YD 3ALWA 1UZ8B 4KQ3H 2KS0A 1OTTD 1DJWA 3APMA 3KW7A 3VO0A 1KTJA 3EHBB 2AXGA 1YEKL 1JXJA 1U21A 5FDWB 3RDTD 4CUCA 4PY7B 5FC9A 1JK8A 1JV2B 3ULAB 2ADFH 4OV5A 2OAAA 1S9YA 2WP3O 4KX9A 3NIDB 4DAGL 5IQMA 1L4IA 2WYTA 2VLKA 1CE6B 4MA8H 5D7SH 2K7QA 2E7MA 3IRZA 1IQDA 3DRTA 5DGRA 1MI5D 2DYPA 3HC3L 2HTLC 4F37K 5FWQA 1SBSL 3PHOB 2B2XH 1AY1H 4QOKB 3RDTB 2J44A 4Y9CA 5E03A 2FGWH 3WNLA 4X8GA 4ZNCD 4PJCE 4IMLA 3D3VE 4YFDB 4AIZA 1C5DB 3LKQA 3TEWA 2HVJB 3EFFA 1MLBB 3VVWA 1E7UA 1D9KA 4LESA 5E8DH 1L5GA 4HMCA 1S9XB 3FTZA 3SDDC 1E28A 1R24B 2XQYA 1MPAH 3VGBA 4NQTA 3ZU8A 1OCWH 1QO3B 4N2LA 3NCMA 3ARDD 2TAAA 4MHHI 4PJBE 3VXPB 3QPQC 3V5KA 2V2WA 1NCCH 2CE6A 2JKRM 4HCRH 2Z65C 1I3GL 3QEQE 4DOHE 3ZR6A 3DJTA 3W0WE 2OTUB 2MCPH 1LO3L 1OCZB 4WFFE 1R34A 3DJSA 5DMKB 3N04A 1JWUA 3CDGB 3TEXA 4B97A 1M9SA 1LLAA 5DQ9A 3V8OA 3AXIA 1KT2B 5IVZB 3N0AA 3AREA 5FYJL 2R2BB 1KCVL 4KK6C 4XNXH 1T20B 2IFGA 4G11A 1HL5A 3WNMA 5DVMA 1W2KT 3A47A 3EGSB 3O9WC 3U4BL 4P23B 3QDJE 4AL8H 5A7EA 5E4AA 3L1OH 5GGTH 3WIFB 3UERA 3CBRA 1FDLH 4RA3A 4Y16C 5IQLA 3WKML 1WBYA 5IB2B 3ECWA 1HSBB 1JZDC 5GJTH 5JQ6H 1MRFH 4QNPE 2B0SL 3FHQA 1DN2A 2AJXL 2Z4TA 3JWOH 3FSOA 2AABL 2AK1L 3TO2A 1OAQL 2WLLA 5AOZA 1MH5A 4X5XA 1HN1A 3OHXC 3O41A 3RPKA 3VFMB 2RGSA 4KTEL 5JPNC 1G5AA 4PHZA 4FRWA 4K5MA 1QW9A 3SPCA 3OG4B 1RU9H 1A6VL 3RAJL 1DBAH 1DYZA 1N64H 1MJJA 4LARH 5HDQH 4QHMB 2VN5A 3I50L 2YZ8A 4PY8J 4JZJB 3P3SA 4OFPA 2FJFB 4FTVE 1YEHH 3TV3H 3D9AL 4LEOA 3HE7D 2AEWA 4XN1A 3MRPB 3FQUB 3HC0B 4F7MB 3KE0A 3EO9L 4P3CH 4A2DA 4BUQA 2FO1A 2DI7A 3ESMA 4HWNA 4XAKD 5B38A 3MRMB 2DBJA 2EEBA 2DIJA 2CWRA 5TJWK 2BVOA 2OX5A 3UJTL 1V7NL 3HE7B 2AANA 2COQA 2DKMA 4WI2A 1AQDB 4IKLA 5ILTL 5B8CC 2H2PD 3CWGA 3OSVA 2R1YA 3FT2A 4ZD3L 3P4OA 4LVNC 3RTQC 3EGDB 5E99H 4CKQA 2IVFC 3UC0L 5C0GA 3RL2B 2EKSB 4GOSA 4DUVA 1R0AH 4KI5C 5EUKB 5TPWH 2WXRA 4G2AA 3EBAA 3EGXB 4KKNA 5FGBC 1CGYA 2EIDA 2X2JA 5GJSL 3UTQB 1WWCA 4NRXB 3C8KB 2AJVL 1IRAY 1U3JA 2HFEB 1LVEA 4RVBA 4EXKA 1HQRB 2J43A 5FR3A 5JLZB 5J56B 5F7MC 2ICWB 1OSZA 1WFJA 5F9AC 2D31B 4CADA 3VGFA 5HHVH 1WSST 3T4AC 4I4WA 3WIIH 3US1A 4NFCA 5EBLA 1BF2A 1ZLDA 4Z3JA 1LEKA 5E24E 4OZIA 4F7EB 2R1WB 4E0RB 4X9FA 3QQNA 5JIPA 1A4JA 3T4YA 5CBAA 1S7VB 5F7DB 5ICYB 4XCFH 1Q0YL 3L4CA 5CZRA 3U1SL 4F58L 1DQTA 1WFNA 3HZKA 4BINA 5GRUL 4XVUD 1LDPL 4A7GA 2ZWYA 5KG9A 4JZNB 4Y8AA 2E5EA 5HYSB 1J8SA 3LCYA 1G6RH 2XKUA 1NBCA 2D7QA 4KAQH 3IU3B 3IK2A 2NUPB 3RBSA 3P3TA 1XB8A 1Q9OA 4ELMF 1WC7B 4U0RC 3KLLA 4FKEA 1FA4A 1WZAA 5IHZA 1ZT4A 3D5OF 1NGPH 2OZ4H 2DI8A 4QRQB 4CDHA 5LJYH 4YE4H 4ZPTB 3LS5L 3B5GA 3T2NH 1SF5A 1U0QA 4ILDA 1I82A 1LO0L 4OFYD 2ZXBA 1DZ0A 2NTSP 3MYJB 5BZDB 3WV0A 2A9NH 5I66B 5L4IA 1AGCB 4M43H 2ZKHL 2X4PB 4KH9A 1TJGL 4G72B 3SDAD 3DXAA 1ZVSB 4I1PA 1TZGH 4LPCA 4W6XB 4QHUB 4H8WH 3O2DL 4I2XB 1CZ8H 2X3BA 4MXVE 2H1PL 3MZTA 4Y4FC 2VM3A 3MRJB 4IW4C 3BAYA 4AEHH 4ANUA 5DVKA 3RVVC 4FP8L 4JFPA 2G60H 1KFAL 5CUSL 3LDBC 4S1SL 2FCBA 1XV8A 4JKMA 4LPUA 3OXSB 3RWDA 1G7QB 4MX7B 1SFDA 5DK3A 2F19L 5FKAA 1BM7A 2CR3A 4PRPD 1N8ZA 2PWFA 3Q8CA 5HJBA 2FGZA 2NOYA 3NGBC 3VWKA 3OKOB 3B5TA 3JVGA 1ESOA 5DHMC 5KOVC 2VITB 3CZLA 5GS1C 2HN7A 2Z64C 4JAMA 4PJAE 4E42B 1F11B 3FU6A 3FUJA 1QI4A 1UB5A 4KJYA 4YZWA 5TDNB 3SPJA 1LD9B 4P3DA 4N22A 3ZL1A 5I6MA 3WY1A 2GPZA 1GH7A 5DJ8A 1E9QB 4CJ0A 4U2YA 1J0YA 4CC0A 4WQOA 2V5MA 3IFNL 4Q6IC 3PHAA 1D5ZB 4UUJB 3RWCB 2ESVD 3BPOB 2V17H 3HKFA 2VIRA 3QFGA 4PBVC 1YQ2A 2BOBA 3KMDA 1DLFH 3C5ZD 3LPWA 1F90L 3MRKA 3SKJH 1KTRL 4JVWA 4PLKD 1KTKE 5L8KB 2R56L 1FN4B 1GHFL 4YK4C 3TTYA 5BO1H 1UTDA 5ESAA 4AKOA 3BSZL 4YS4A 2ESVB 3NG5A 4N0UE 1GGTA 4KGLA 4C54A 1EZVX 4BZ1A 1OARH 4X8JA 3SDYH 2H1XA 4AV4A 3KLAB 1IC7H 4M7KL 2KZ1B 4OD2A 1LWHA 4OCSL 4PRNB 1T1WB 3SQOL 1W72B 4I77L 4U31A 5F7FA 5GS3A 1ZANH 1AHKA 3WHXA 5HVHB 4Q0XH 4K71B 4G1EA 3H9HB 4RMBA 2WXLA 2XWBB 4D8PB 2ZQKA 2I9TA 3OX8A 3B7UX 2ZCKL 4NKOB 5HYQB 3NA9L 1E7VA 4AYEC 2FJSA 5JW4N 3D85B 2FECL 5F9OL 1NJ9A 1YPZB 3QPXH 4L3CA 4ZUVA 3PY9A 2G4EA 3F64A 1XGTA 5EMYA 5ICXB 2X2UA 1AO7A 4XVJL 5KSBB 4XOAA 5JXEA 3X11B 2CLZB 2XZZA 4XP5L 2BVPB 4YDVA 4XC3L 3AQZA 4JFDD 4PJ5D 4E36A 4L5FL 3S0PA 4OFVA 1VACA 1T1XB 2YAHA 1DQMH 1NLDL 4XNYH 1NGQL 2P44B 1L6PA 3S8GB 2A83A 1Q1PA 2EE6A 3GDBA 4RCAA 2CO6B 2YGNA 4FG2A 2DQUL 4QIRA 3UAAA 4R8WH 4AGOA 1BD2D 2X4NA 2WLIA 4FTDA 1DDTA 3GNMH 3HNVL 4Y19D 4J28A 5F6HI 3VM7A 1D5MA 4PJ5B 2WNKA 5JOPE 5IROA 3WJJC 2B1HL 4X6EB 5AALA 3VI4A 1GOGA 5F3HB 1NWPA 3DHUA 1T0OA 3ALXA 3QUYA 1TNNA 4R7DB 5C09A 1KPUB 4MJ4A 3SJVA 1HL9A 1M4KA 1L9RA 4OI7A 3T1FB 1KXVC 3C60D 1N2RA 2XY1A 5BQ7A 1AHWA 2OKMA 4NZDA 3TZVC 5IUSA 2DIAA 4TF4A 3KPRD 1K2DB 4Y1TA 2WVVB 1NLBL 3KVPA 4QHKI 5EUOE 3WUWG 3LKOA 3C60B 1Q0XL 4C56E 2E4FA 1P5VA 3RWEB 3T04D 3UTZA 1D6VH 4YLQT 1X5MA 3H9SA 1WT5C 3LV3A 1VB9A 4LVOC 2FT8A 4FQHA 2JIXB 5T3ZL 1XIWA 3FO1A 1T0NB 3Q3GA 3EH3B 1BXVA 1G7JA 2P24A 3FC8A 2VRAA 3N41F 1MN4A 4H1LA 4HWBA 2APSA 1L3NA 4J3BA 2NY6B 4N8PA 5A2CA 4CA4A 5IBUB 2NSMA 4I8DA 4G43B 5AEAA 2YAMA 4E9TA 5AL0A 1FZJB 4B5EA 4NSKB 5KVGL 4N1EA 1RUQL 4NUMA 1TZIA 1JNHB 3AU1B 4QXWA 4BCYA 1JXFA 2W07B 2X4RB 4F93B 3N43F 2WXPA 1JXKA 4GSDH 3OZLA 1NCGA 5I1DA 1MXDA 4MA1C 4KZ0A 1YNTF 4HJGB 3SGEH 5E6YA 2B7DT 4WSKA 2FX9H 4R4FH 4JHAL 5MI0B 2VZVA 4Y2DA 1HL4A 3K5RA 1L7IL 3D39B 3P4NA 4YSSA 1HXYB 2AJ3B 1ECYA 1HT6A 3US0A 2OSWA 4H5SA 5G55A 1Y18B 4ZOAA 3GWJA 2MPVA 4F5CE 1K4CB 1UCBH 4R5XA 2ZX9A 4HHAB 2F7QA 2EYTA 5EIIB 2EIZB 2YUXA 3S98A 4CRPA 1E0OB 3DUUA 2PCPA 2ZF9A 1RP8A 1SEBB 4M6NL 3DX9A 2D03H 1BOGA 2OMYB 3O6FC 1YJDH 1UZ6E 4YBLB 4JR9H 4HX1B 1KN2L 4UQ2B 3B83A 5A43C 1ETZB 2YC1B 1HC1A 2Q7YA 1E5YA 2VISA 4WGKA 4NBYB 3WNKA 2WBJD 4GW5B 1DVFC 2QQKH 3QEGL 2Q3XA 5TE6L 4JY5L 4EKXA 1QR1A 5AOJA 3RWFB 3E3QE 1GS6X 3VDAA 1A6UL 2BSSB 2EE0A 5E8PA 4G6JL 4AG4H 1AZNA 1EEUA 3S4SA 2K8QA 5L88L 5BMFL 1EAPA 2WBJB 3HOGA 4PH8A 2Z35B 3QNZA 3SDDB 1ZT7B 3D6GA 4U3SA 3EDJA 3RWJB 3Q1EA 4N2MA 5ICZA 5KSAC 4GRLA 2W65B 5E94A 4R3SA 4Z3GA 5C92A 1J9CT 2YPLD 2CO7A 3CVDA 2X2IA 4G8FA 2HRGA 1PSKH 5IB4B 4PRDB 1ETB1 2ETWA 1NBYB 1E5AA 4MA3B 1YN7B 5GGQL 1KCWA 1NOAA 3U30C 1BMZA 4XO4A 2B3IA 1F18A 5AYTA 1XCTB 2PO6C 3HMXL 1W8OA 3ALPA 2XWJA 3KPTA 4PJGF 1HHJA 4YHIA 1QPKA 2C9PA 3FHEA 2Z34A 1ZDSA 2YD6A 3V4PA 1PTZA 2BM3A 4Z0XB 3JZYA 4HLZG 1NKGA 2Z9TA 5KANI 5HYEA 1AXSA 2IXQB 2QVKA 3HPJA 4ABVA 2GG1A 3X1NA 5KJ4A 4JUTA 1DQQB 4BK5C 4TUJA 3O9WB 1A14H 2W0LA 3MLYH 3P0VL 4HXBH 5EU6D 3WN6A 4ZFGL 1IGYB 4Y16B 2IAND 2QADD 3O3UN 5IK3B 1JZ4A 2FSDA 5DMIH 4Z6AT 2C3VA 2PYFA 1CE1H 3RP1A 5FHAL 1UQSA 3F7VA 4X6DA 3PAZA 4GW1A 2BINA 4DGUA 5AKSA 1CFTA 1CDBA 1IILE 3RPIA 2DM2A 2QZQA 2XA3A 1FGVH 5DHVB 4Z7QF 1VEOA 2IANB 2QADB 2V37A 2XZQH 4YAQA 3OHXB 3QIWA 1Z3GL 4OCRL 1CBVH 4ZFZB 3K74B 4OTXL 3C6LA 5LGKA 1FL3A 2J3SA 1IBZA 2Q7AA 3ZE1E 1R3LB 1NDMA 4FXKA 5GGVL 1G9NL 5BO0D 1EEZB 2DMHA 2ZICA 2QFRA 4NQDE 4PJAF 4PW4A 4UTCA 2X53A 1T5WA 4NN5C 4HS6A 3MLUH 3TEUA 1CD8A 4ZMXA 3ESUF 3W1ZA 3GSOA 5HY9B 5MENA 2BS71 4CVZA 3UYRH 1CGUA 2DPKA 3NCCB 4PJ9C 2ED7A 3FCSA 5I8CA 3MLTA 4K7PL 4JZOB 4F2MB 3LKNA 2NY5C 5INCB 2G3MA 4G7YH 2ZG2A 3ZLQC 3IAGC 4FXTA 4GKNA 2GW5A 4MZIA 3PWLA 2PP7A 1JPGA 4GXFA 2ZYIA 5I1GH 5B8CB 3R0NA 2NNCA 2XETA 3HUJB 3QDMA 5DZLA 4MRCA 5IHLB 3RTQB 1OXYA 4PJ7A 5JHDA 3SDCD 5BOPA 2WW8A 4N2FA 2I9LA 2WSDA 3N1GC 2DQHH 2JF1A 4LHUG 4XNBA 3SE3C 3L3GA 1GGUA 4GQ9H 1T2JA 3QQ9C 3FNKA 3KYMB 3WTYA 3FBKA 3P2BA 1CGSH 1KLGB 3HG3A 3HS9A 1X5HA 4XPTL 5D1ZC 4G5ZL 3VI3B 4RFOH 4ZFFB 3D87B 4I18C 3SDCB 1EX0A 4JHZA 4EJ1C 3GF8A 1A3LH 3TF7C 2ZTBA 4L3AA 2O6CA 4JFOB 1U8JA 5CLYA 1WCBA 1JPST 3FMGH 2M2DA 2EZ0C 4JO3L 1J11A 3SCMA 4Z7VE 4HUUB 1INDH 3TF4A 2DQTL 4J3WA 1G9EA 2Y0SA 5A2JH 4HH8A 4JPKL 3BXNA 2P80A 5DMYA 1IX2A 5AVYB 4N25A 3O3AA 2LR4A 1TJHL 1ECZA 2NPLX 4AT6B 4RZCA 2D2CC 2VDQL 4M6OL 3REWA 4AM0B 4BGDA 2V7HB 4JJHA 5F8RC 1KPVA 4U0RB 5E5MA 1PKOA 1UXSA 2X87A 3HG1D 5C6PB 5JHLH 3G6JB 4HMDA 4XOEA 5CJOH 2R0LH 4FNSA 2EIJB 1AKPA 1JFQH 4YHML 3E38A 5FK9B 2J4WH 4OLEA 4YGVA 4A63A 4PRHE 2DMKA 2FZ3B 4WNQA 2WVSA 3RUGE 2AXJA 4OCMC 3MCLL 1I8MA 5EU5B 3KPLB 4DP5X 3BD3A 3PCYA 1GGIL 5F70A 3HG1B 2IAAC 4QF1B 5D7JC 1BQUA 1OVZA 35C8L 1AXTL 2YWZA 4O02L 2CMRH 1CK0H 1ES0B 5FUOH 3QUXD 1D5XA 5E00A 4CILA 1PZ3A 4Y4FB 1YYLH 1A7OL 3ARXA 1PVHA 1YN6A 4NHCH 3UBFA 3FZUC 4LRNH 3VB9A 9PCYA 3IB4A 3ZJAA 2ZCLH 1P4BH 3CDYA 2SEBB 2AJSL 5EF2A 2FH8A 1FAKT 1NMBH 4PGEA 3AM8C 1OSEA 3H42L 4OKDA 4DTGL 3NGBB 3DX8A 4HPHA 4XZUB 5C3TA 2WQXA 4YXHH 1MVFA 1HH6A 4IBLT 3LN9A 4PV8A 1BMGA 2YD1A 4G70B 4ZAKC 4K94C 5D1QA 5FUCC 1J9QA 4UQCA 3GSNB 4XB7A 4PJ8A 2IAMD 4X7TB 5FA3A 5KBNC 2HLFC 3DNKA 4Q6IB 4WJ5B 3GI9L 4GS7C 5DD5H 4ZFOL 3JUZA 3VXSE 4R4NC 4I5BB 1KELL 2OPCA 5F7BA 5TQ2H 4KKCD 3KCPA 4Y5XC 3V4VB 5IJBC 3IU4H 4XN7A 1TVHA 1N59B 4D8OA 4XNUL 1DO5A 4RGMB 4PWHA 2F5AL 2MPAH 2WBKA 2C3WA 3F7PC 4YK4B 1PNCA 4XODA 5J6GA 4KFMA 5IJKA 4QXTA 5LNEA 2UZIH 4F7CA 4NJ9H 3ZT7A 3F62A 5DS1A 2YRLA 4NZTH 4M1GL 3KGUA 2YD4A 1AJ7H 5J1AB 4JFYB 5DFAA 1LMKA 3AXLA 4OM0H 5GSRB 2X4OA 2YAQA 3KLAA 4QHLA 3P9LA 2C9VA 1Z0MA 5A6IA 2OK0L 2JJUA 2CDFA 4H88L 4WGVB 1OGPA 5T5FH 1HKFA 5C08D 5CD3A 4XPFL 1QWUA 4AUYA 1XF5A 3O3EB 5C9KA 1UZ6F 1SXSA 4W6YB 3T6XA 3L4ZA 1PD6A 4IKIA 5IFJA 1KG0B 5IMLA 1W16A 1SXBA 3RZCD 4L3EA 2R29H 3ZDZB 1UWGH 1MAML 3US9A 3D4YA 3ARSA 4ZXBD 43C9A 4DP9X 1QSFA 5CIPB 5C07E 3BN9D 3VE0B 5DD3H 4FADA 3QB7C 1Y0LA 3F58H 3OJDA 4PR5A 4LNRA 2NYKA 3IMTA 1HNYA 4Z3HA 5IBLD 2XTLA 2G3XA 1BZEA 4NKMA 4P5MA 5KUKA 4XO3A 2NDGA 4JFFA 4PTTB 1AACA 3UZEA 1E43A 2ATKB 3CQQA 3CXFA 2ZX8A 3DV6B 3FFDB 2WMPA 1T03L 4LCWD 1C1EH 1HKLL 1QSED 1XGRB 3TZVD 4PJFB 2AK4A 5DO2D 4IKNA 1DQKA 2A38A 1PDKA 3FUHA 3B9KA 4DFIA 4XVTL 4ACTA 2Z7UA 3VW3L 5HGDB 4LCWB 3G9VA 3L4VA 1QSEB 1TQCC 3HN5A 3QHZH 4MAYC 3J27A 1ZHBB 1MHCB 3TZVB 3WJMA 1E5UI 3LRLA 1R5VB 1NFIA 4B9GA 1U33A 3BKML 2RHEA 3GPEA 2LW3A 3NJHA 5LN8A 4UQEA 3GSWB 2R0KH 4AKPA 2BIHA 1NCUA 4OZIF 2H1LM 1LILA 4M3HA 7FABL 1IEBA 3V0WH 3NCXA 2HT4D 3OAYH 3LD8C 3OKNB 5IREA 3VD3A 4A7GF 2PWDA 5A2LH 5JO5A 4LVOB 3EAKA 5DRWB 1XEUA 1NEZA 4JPIB 3VD9A 4XPBH 1KJ3L 1RVFH 1B9KA 4LDLB 4R7NB 5BS0B 3I6GA 1UM4H 2VAJA 3LNFA 4O2CA 2YOCA 1QFPA 3LTVA 3RX5A 1EO7A 2R27A 1WIPA 5GZOD 2YEZB 3BKCH 3PWPA 4A7SA 1BAFL 3IE9A 3U6XS 3IPBA 3G5YA 3MUY1 1CLOH 4FEMA 2R7EB 1CJYA 4QCIB 5F0LB 4ZMQA 2DN7A 2NDFA 1HTYA 5EZOL 4D0DA 2GAZB 3JTSB 1M7DB 1WICA 3FU3A 4HK3J 4MD4B 3STZA 3UBXG 4BDVA 1FL6A 1KXHA 1WTLA 2NNXA 1R75A 4JPVL 4XP1H 4AL8C 4DP6X 3SO3C 1X5ZA 4R6UA 1S7TA 3MLXH 1N5YH 5IGXL 4QHNA 3CXHK 2NZ9C 3EYUH 4IU2B 3NH7H 3QR1A 4HSQA 3VD0A 3NCJH 4TLTA 5A1AA 1OAZL 1A4CA 2IDUA 1CC3A 1RLBA 2VE6B 4YSDA 1NCJA 3FB7B 3JWOC 3QFJE 1HINL 1KJVB 4CMHC 3LB6C 5IB5A 3IXAA 2Y2TA 4MDRA 1ZTXL 1SN2A 3JV5A 3QQDA 1I7RA 4M5ZL 4NENA 1UT2A 4S1DC 3CH1A 4N0YL 1NOLA 2IGFH 1ZHNA 2WXKA 4IEFA 5I28A 1CYWA 3TBCA 3VDCA 3Q7JA 4L5FE 3VVVA 1HCZA 2CGZA 5HJGA 1B4JH 3WXVH 1UJ3A 1AD0A 3LX9A 5DJ0B 2H0PA 2CHNA 3TFBA 2XTJE 1GXEA 4XPHL 3O6FB 4OZGB 5EPMB 4YH6A 3H1ZA 2J73A 3CHOA 1ONQB 1OPGH 1PQZB 3OAUH 3AY4A 5IF0A 2WLKA 4JHUA 2AVGA 4WU5B 8PAZA 3PHQB 4Z7UE 3W9DA 3QJTB 1DVFB 3P73B 4PRID 3W39B 2XPZA 4KHXH 5SX5K 5LWYH 5CSBA 1R3JB 3W5MA 1X5YA 4D3CH 5KEZA 4NCC1 4NZ8A 2VDKH 4BFFA 4Z95L 3F7RA 3PP3H 4LEEA 3NMEA 3GSQA 4GRWB 1FQ9C 1PFCA 1URZA 5GS0L 1SF3A 4GAJH 5T1MB 5KSAB 1N3NB 1HI6A 4KK9C 3L5XL 3RA7L 4QRSA 3HRZA 2GSIB 1OE2A 5H4YA 4XN5A 1JTPA 1BVKA 1F6AA 3MMEA 4XP9H 3VCLB 3KWVA 5C7ZA 2DQCH 4P05A 4Q58C 1HILB 3U30B 3U9UB 5C7XH 2DQGL 1L7TL 1I4FA 4OUUB 2PO6B 5E1GA 1FIEA 4N68A 3U7YL 1Y6NR 3UPRA 3X12A 3QJXA 4ETYA 2V2TB 2I60H 2Y1YA 3G5VA 2XA8L 1D7BA 1A22B 3H56A 3OZKA 3NZ8B 2OS7A 3QZOA 4UV4H 2EXWD 4WLCA 1ACZA 2Q5BA 1FJ1B 4RNRA 2XLLA 5HHXL 5ANMB 4QGTA 4IOFC 1JPFB 1UB6B 3OZ9L 4EVNB 4GMSH 4KMTL 4DVBB 2AV1B 1QTYT 2PXYA 4ADJA 3TONA 4JFQB 1KCSL 3WO4C 3DIFA 4N87A 2YEVB 1W0WB 1TO4A 1HSAA 3STBA 1KXQE 3GJFA 4NC1E 3B3IB 5I2IB 2DH3A 2MFNA 2ZG3A 4TQIA 2UYLA 1IAII 3CSTA 1E3FA 3MROB 1MFCL 2C7FA 3PAVA 4LT7A 4OGAD 3TBWA 4DHLA 2L3BA 3HHMA 4FQQB 1LO2L 2UWEE 4P2RB 1NFKA 1FC2D 2H47C 1G0YR 3RU8H 1P6FA 4DZBB 1U95A 4AKQA 5BZXA 1R3IL 4AI7A 3VU1A 3OKKB 3LKSA 1OP4A 1NOFA 1AGBB 1I7TB 3OHXA 4HIXL 5EDXA 2WWKT 1FFOB 4U1MA 3VI4F 2WN2A 5JPNA 1Y7VA 1PG7W 3APDA 3BVXA 1F2XK 3QEHB 3QDAA 4NN5B 4ALAL 3A0OA 2OP4H 4CC4A 2ZWZA 1HWGB 4XO9A 5C2BL 4ODBD 4H8WC 2G2NA 1KYAA 4K9JA 2F7PA 4PJ9B 1JUFA 4JM0A 4QRRE 5C0ND 3QULA 4Z7NB 5DSCA 3VTTA 4OD3H 3KW8A 1KUMA 1JF1A 4UZSA 4Q9CA 3BE1H 3PAYA 2JKJA 1F5WA 2GC7C 3TJHD 1KCUH 4TYUA 3CE1A 5TE7L 4BQBA 2UV3A 3GHPA 4MS8C 4XMWA 4ZRGA 4YX2L 1ZA6B 3EOYG 4Q2ZA 4HK0A 2HWZH 1IFHL 2DI9A 2BOCB 5D1ZD 3QZWG 2QL1A 4HSCX 3S35X 3WFCH 5BZWB 1OF0A 3MGTB 2WLHA 3ZHNA 1KCRL 3LRSB 2ZOWA 3FF8A 4GP4B 4GY4A 5EOTB 4J3OG 4FLRA 3EJZD 3L3OA 1D6EB 2VLRA 2WZ5A 4ZYKA 5CSZA 5CR1A 5D1ZB 3LHAA 3LEXA 1AMXA 3WBDA 4G8GA 5ETUB 4ZK8A 3SDXB 4XPGH 3F7YA 4A39A 1IC5H 1ZT1A 3H2WA 4L4VD 4O2EB 1JVLA 1KDJA 1ZHLB 2GTZB 3DA0A 1F4XH 1GYAA 1RFDH 1YYCA 4TL5A 2MHAA 2GABA 3T4AA 1HEJC 4KDWA 1VCAA 2VXSL 2MH4A 2YQ3A 3VQMA 2DS4A 2FJGA 3O0LA 2IPTH 5E8OB 3UOAB 3VD5A 2CBTA 4UIMA 5KS9B 3F84A 3LPFA 1TQSA 1ZVNA 4FFZH 3ZDYE 1KMGA 3QARA 2FYVA 1JD9A 3RVTD 1QNIA 4HZ1A 3K2IA 2CDEB 3VX0A 4HD9A 1R19A 3ARFD 3ZL2A 5IMOB 1CWVA 3NK3A 2NXZD 3BT0A 3GMQA 4LPXA 5C0DB 1EPFA 5IBTH 3MV9D 2VXTH 4AVHA 1R3KA 3TU6A 2X4SA 1JHTB 1AHMA 4XHQA 1FGNL 2XSKA 3ABMB 5AW0B 3D3VD 3BZDA 1NL0L 1EFXA 2VH5H 3G6JA 1YEJH 3ZGIA 5C9JA 4XPAL 3ARFB 1G7PA 1GPOH 3TBYB 2OMUB 4K7FB 2QVIA 1NCHA 4KPHH 3C6EA 3FT4B 3MV9B 3TBSB 3ZW3A 4WI5A 4QO1B 4KZEH 4G71B 4WFEE 5D7JB 3MV8A 5JIKA 4BFGA 3B2UC 5I6KA 4MMZC 1DE4A 4U49A 2NR6A 4ORGB 3IJEA 3WHE1 4IRSC 1OSPH 3C5JA 3QEQD 1NAMH 2H32H 3W0WD 3L4TA 2C7UB 4WFFD 3MOAH 4Y7MA 4MD5A 1FE8H 5IMKA 4WEBH 4XXCC 4MA7H 4PJBB 1KBGH 2ENPA 4FQLH 1YAIA 4L0PB 3ABZA 5EN2A 3WEXA 3IDNB 2Z0UA 3L81A 1IGCL 3F65A 1DVZA 3AS3A 4U2ZA 2CZNA 5AVSB 3BIKA 4U1SB 3FS9A 1KB5L 2X1QA 4LHUB 4WUKH 2VMJA 3QBTB 3CCHB 5ESVA 5JXAH 2R9HD 4LFHG 3PUCA 4MZRA 1JFHA 1MFDL 3Q6GL 2BS8A 3GBMH 2VDML 4ZAKB 5GS1A 3UTSE 4X6BB 1QATA 3W37A 2XICA 1YYML 3WKYA 5IUCA 3MTRA 5HPOA 1PU0A 2PPEA 4WRLA 4ZOBA 5DFWH 4OI9A 2Q8BL 4GS7B 4GQPH 5FCUL 1WV7T 5H37H 2GCYA 5DYFA 3T77A 4PJXA 1JPEA 4O4YL 4TULL 3VFUA 5DZPA 1P7KA 1IJNA 1Q38A 3SBWC 4OCWH 4FABH 2H0JA 1K5NA 1ZSDA 2O30A 2CIIA 3NRPA 1BW8A 1OAUL 2IJ0C 3D30A 2VDLB 2AV7B 2HUHA 2VR9A 3GMRA 2JB6B 3VXRE 4G8AC 4KKAC 1MFEL 5EOQL 4A6YB 1TLKA 5CCGE 2D9CA 2E7LC 3JYBA 4BQ9A 3CZSA 2VW4A 3MO1B 4FFVC 1DEDA 2HFGL 2GQHA 2KI6A 3FPYA 1BJ1J 4FTVD 1X7SA 5DA4A 4LL9A 5GGRA 1BMWA 3FB5A 4KX8A 2VDOL 3PABB 5H2BB 3ZO0A 3QO0A 1TZHA 4LKXB 5KVFL 4QHKJ 4YLCA 3IS1X 3G08A 3WMPA 1K3ZA 3QR0A 5EBWA 1CQYA 2HB0A 2VDPH 4EIZC 3S35H 2ICEC 3V9CA 4IHOB 1EWHA 2W81C 3DX7B 2DL2A 3L3HB 1XD1A 4KROD 4IS6A 1FHNA 3BH9B 5HDWA 1SEQH 4Y5YA 4Z7IA 4MWFB 4U1KB 4FHJA 3VFVA 1IL1B 1IM3D 4F33B 2EDBA 4MYPA 3LPGA 1HIMH 2CBQA 2NXYD 4AQAA 2A4EA 4EPSA 4ZO7A 2Z8WC 1T1ZB 1OF2A 4FLSA 3KL0A 4KROB 4X6CE 3MRQA 5MP6H 3D2UB 2IPUG 4HW6A 5DK2A 2O72A 4N8VA 3IVKA 1J0HA 3GMOA 2BVQA 2X9ZA 1BVNT 3UCRA 2DLFL 1IM3B 5DFVC 3WAJA 4TNWK 4NO5A 4MD0B 4Q9BA 1O9WA 5FYKL 4LSVL 2VR4A 4U6TA 1XGZA 2V7NA 5DQJB 4F9PC 4LKCB 2QEJA 4Z77A 1EXGA 3JWNE 2F1EA 1AG0A 5ECJE 2EIKB 3DRQA 3GXNA 1T22B 1OWWA 4GBXA 3UMNA 3DV6A 3KLHD 2VQUA 2Y7NA 2BSRA 1YJDC 4RX4D 1BECA 5I8KH 1VEMA 3H6AA 1ZAGA 1BQ5A 3MACH 1UM5H 3PXLA 2ZXEB 3V79C 1RV6X 3QXWA 3C2AH 4YDKH 1C08A 3QXDA 1T2XA 1UOWA 2DWSA 1BZQK 2EILB 4MAYB 4YZFF 4FA6A 4JY6A 4LPYA 5I73C 3T0EA 1VKXA 1XBDA 3QQ3B 1KGCE 1U3YA 4LIQL 4J8RB 4YN3A 5JNYA 2ZKXA 1VGKA 2WWMC 4UT9L 1F8TH 3LQZA 2BNUB 3L3DB 3WEOA 4B9IA 2QQQA 2C8NA 1Z0NA 1BM3H 3QHFL 3O6KL 4HOMA 2OW7A 2YAEA 4F3FA 1AFVH 4P5TD 5ICUA 4DP8X 3QIUC 2WKGA 1TQBC 1RJZA 3X1EA 1Z9LA 4Z3FA 4Z5RB 4BUGA 2AGJL 2CDGA 4XI5C 1HZHL 4PW9A 4GYBA 3FYEB 2AQNA 3K0YA 1YA5A 3IJHA 4F8LA 4D94A 3T3ME 2A73A 3L2LA 2BWIA 2UXFA 1BQKA 3GTTA 1AR1D 4NQVB 4S2SB 3X13B 3B9EA 3FTGB 4ZUSA 2BXZA 2AJZB 1U92B 4NC0B 5F21B 1ETA1 1L9OA 2I5YL 1DJIA 4GUOA 4HLEA 2WTRA 1QG3A 4OGXH 2ZOUA 2G9HB 5A2BA 3BC9A 5I1LB 3ULVL 2VR7A 3X14B 1J5IA 5JOFB 1OB0A 4JKPH 4QWWD 3BESR 3WUZA 2HJFA 1WA1X 3KLSA 3FFCB 1RUAL 4HPYL 5L2KE 3CPUA 5CBEB 4WHCA 3SO3B 2LVEA 5M94B 4XVSL 1NMAH 1S78C 1EDHA 1N0LB 3HLAB 3QC6X 3QQXA 4J6RH 5CLXA 4JO1H 1QP1A 3CHPA 3LOWA 4PBWD 4X9GA 3V5HA 5HYJB 1KTDB 3RL1B 4TUOB 1OSYA 4P46C 3CSGA 4XMZA 4CMHB 5FPIA 5I82A 5B39G 5D2LE 5GRXG 3JT2A 5ACZA 4JFUA 3AUVA 1TQVA 3MXWH 3NFNB 2NNFA 1Q9WA 3LEVH 1XWVA 2WCPA 5EEYA 1GZQB 2WZ0A 2E86A 3K71A 3KLQA 3VXUB 2YFOA 2V2XA 3KYNB 4HGMA 2JCCE 4QTIL 1AKJD 1W15A 4EEEA 2NX5B 4Y4HD 8FABB 3JXAA 4GG6A 4EF3A 4NO0A 2KH2B 1CT8A 3QCVH 3CN4A 3W81A 1QNZH 2J8HA 3CSYB 1DUZB 1S5IL 4PIRF 1OTUD 2J6EL 4M1DL 3EYFB 3V2AR 4XMPL 1AKJB 1YEGH 3B2MA 3CVHA 1E4WL 4YPGA 5KYNA 2Y5QA 1FH5L 1BZ8A 2PWHA 6CGTA 3P3YA 1BEXA 2R4RH 5DFTA 5E6ID 1CLCA 1DFXA 1XGUA 1JD7A 3KPSA 1JPTH 3LZOA 3LRKA 2ZAHA 4J12A 3WUWA 2WQ8A 4PG9B 1UACL 1B0IA 1RZGB 2C1OB 4MCYB 1AMYA 2CPUA 3QWNA 1RMFH 4UMSA 5E0QA 4NKQB 2MCG1 1WK0A 4D9LH 1X5XA 1QQDA 2YXWA 1EJ8A 2FX7L 3LZRA 5CCHE 4OT1L 3OKLB 4BK4A 4HG4J 4EZJA 3FBQA 2OCFD 3B6SA 3OJ2C 5HI4D 4G6MH 3IKKA 1F4YH 1ZS8B 5LGHH 2LVCA 3A4DA 4DGYL 4Z7WE 1AZCA 3EOTH 2FEJA 3B9VA 5AZUA 3APFA 3CHSA 4NO2B 1P4UA 3GB7A 2PYEE 4L05A 4OVVA 1KYFA 4UQDA 3F12B 3KXFE 3ARBA 4FF9A 3RVXC 3HFFA 3OLEA 3UBXB 1OV8A 4FLOA 4GKOA 4PV9B 2NW2B 3V4LA 1JBJA 2Y72A 5FGCE 5AZEL 1KTBA 2P8MB 1X44A 4L9LA 3GMMB 1RJLA 3ARGA 2WXJA 4B0MB 5LGJA 4P48A 3WO4B 5A2FA 5JOPD 1MQKH 1AXIB 5HGBB 5E0FA 2I7SA 4RQQB 4GAGH 3E1ZA 1RD6A 1QHOA 3ATAA 1KIRB 3JWDC 5KVDE 1DUYA 4P2QA 1B3IA 4JM4L 4L1HA 1ZXQA 4EI5D 4ZSOB 1KYOJ 4NI3A 2ILLA 1KEGL 4XO8A 4DK6A 3D0VB 4N1HB 4XVOA 3CG8A 1H19A 1HE7A 4HIHB 5CJQL 3FN3A 4BSVA 2EVHA 3V7AE 4WHTA 2O26U 1W8EA 3AC0A 5D1XE 3B2XA 4APQC 4C56D 1OAJA 4A38A 3GTVA 1OAKH 3O8XA 4EI5B 2XZCH 3RVUC 2ADGA 2P8PA 2BY0A 5EZPA 4G80A 4ODTH 4FZ8H 5IVXE 1S7QA 1K4DB 3EXJA 2X6BA 3SYQA 5EUOB 5ISZA 2CJUH 3FO2A 2DWDB 4M1CD 5D71H 1DJGA 1IIKA 2X40A 1DBKH 2FJHA 2VUOA 3DKHA 3BAWA 4L29A 4KHTL 4WSJA 1S9WA 1WZ1H 5AG8A 1XZ0A 1OGAD 2YRPA 5JPMC 3IXTB 2MEJB 3SSGA 4N2OA 2VLLB 1IAKB 2MOGA 4KDTA 5KAQF 1QYGH 3VG0H 3H2QA 5SWQB 4OM1H 3QJFB 5LQBH 1MJ8L 4NYLA 2GJ6A 5DJDA 3PV7A 4NHUB 3VFPB 1EZLA 4HC1A 1CXIA 4MA8L 1ZA6A 1CUOA 2HP4A 1OGAB 2ZYSA 4UAOB 5IOKA 4E41E 4IBYA 4RFEB 5HDBB 3QJOA 4XAWL 2K1MA 2AP2A 2NUTB 2W0FA 4ZOEA 4MNQA 5D96C 2XN2A 4LBEB 2AEPH 1IKNC 4BKSC 3HE6A 1UFGA 4LEXL 4DGIL 1KIQA 2OL3A 3Q5TA 4PLOB 4F8NA 5DEGB 5JHAA 2XXMB 4EQ2A 4RRPM 3IT8D 4HEMA 1ADQL 4MAZA 5CEZH 4UQBA 4I18A 1G7LA 3DPBA 3EO1A 4NXSA 4ZPVB 2GSMB 3X3GL 3BP4A 2HKHH 1XBRA 4Y4KC 4U1NA 3W38A 2PF6A 3U9PH 1IMHC 2QKIA 1ITBB 1M7XA 1ND0B 2CIKB 2CLRB 2XV0A 4WU7A 3K72B 5L2JA 1NCCL 5E08H 1RUML 2OMXB 3KJ6H 2VSDA 3SE9H 3ARYA 3C75A 4FQ2L 1OEZW 2WLNA 1U8IB 4X50A 4LCUB 4QGYA 5AB0A 3UTTB 3UG3A 3MREB 2YD8A 3DOSA 4KVPA 3BPLC 5JR1L 1E27B 3CFJB 2HLAB 1FV1A 1CVRA 1RZJL 5J13B 1KTLA 2BSTA 4E9VA 3IFPA 1HDMA 2YSSB 4NQCA 4PB0L 1OTSD 2XN9E 4WO4D 5JOEA 1H3GA 1CICD 2WWOA 4HAGA 3HHSB 2XX0A 4KI1A 5EA0L 1GJWA 2ZCHH 3KPOB 3B43A 2X6AA 1HHGA 5AW6B 4M6MH 3VD2A 1F4AA 2C4XA 1S7WB 4UDTA 4L23A 4UTAH 4TLSA 1DVXA 2H9GA 3PIQA 4XBGB 3CN0A 3AB0C 4BJLA 1WYJA 1Y1DA 2VABB 1FZMB 2ADIA 4C58B 3CK0H 1CICB 2AQRA 3FQNA 1X4XA 4KTDH 4U1IA 3VH8B 3HZMB 1PYWB 4M8QB 5CLZA 4HUNB 4NUGH 3G7TA 2BSED 1U3HD 4MMZB 1SNRA 2OCCB 4HD5A 4MJIE 4XCEA 3FO0H 1XXDC 3LZFL 1T83A 5LBSH 4BUHA 3D50A 1O7DC 5IY5B 4HGWA 3TCTA 1BFVL 3PWNB 1EEQA 4GMTL 1PLGH 3J7HA 1MQ8A 4J3OD 2J6EA 3OR6B 3A6BH 5EZLA 5IB1B 2CM5A 3OGCA 4NQEB 4FOMA 3G5ZA 5IEKA 2GJZA 1BLNB 1MCDA 1H15A 1JMXA 1JWSB 2YA0A 3CSPA 2Q76B 3L9RA 3V5DA 3WFEH 5ANHA 3BWAA 4NQSB 3QPKA 2GEEA 2EO7A 2XX1A 3MGAA 1CLZL 4B95C 5LKNA 1SMAA 5EWIL 4BA0A 1QZNA 4ANVA 4MCZB 2MQ3A 1JE6A 1EXUA 2BRRH 2P5WA 5A6MA 3EJYD 5HHOE 4AYID 3QQ4B 4X4XB 4BQ6A 4MXQD 2EE2A 2KZWA 5CZXD 3V95A 4YDZA 2BVYA 4FG0A 4JQIH 1AI1H 2B20A 2J56A 3P9WB 3DUSA 4RGOL 4Y5XA 1R1CA 1KY7A 1M7IA 3IDIA 3O2VH 4PGCB 5HVWA 2R69A 1WIOA 3KDPB 2OR9H 1H6FA 3MNDA 4MFHA 1MCJA 3S8FB 3FH8A 1WITA 5KTEL 2XCMC 2DEYX 4XCCL 3WNIA 2F61A 4O00A 2DQJH 2ZSWA 4U1HA 1XF4B 1CTNA 3RDJA 2IWFA 3SKUD 3KM1A 3QNXA 3ZE1B 3W9EB 3MO1A 3RGHA 4KY1H 5HHVL 5GRZA 4LDEB 5FOBA 1SDDA 3WIAA 4Q52A 1V7ML 3M7OA 5GZND 3EG9B 3ROLA 4DZ8A 2ZNWA 1J9RA 1GOFA 3H4HA 3L2NA 1YEKH 4JFEB 4MB4A 3L45A 5EO9A 5ECGA 5TDOB 4DAGH 3GUFA 2ICEB 3EDEA 4WENB 1TSHA 1KLUA 2X1PA 3QXAB 5IOPA 2IH3A 4RMQA 3ZDXB 1S7XA 4M8VA 4U6XA 4C83B 5DS8A 3FB8A 3HC3H 2Y6SD 3TN0D 3D0AA 1SBSH 1JYNA 4J4PA 4LOFA 1PGRB 1BQLL 2X12A 2WOBA 1U6AL 2IPKA 2F15A 3ES6B 1T6BX 3IDGA 4K4KA 3MOBL 1XGQA 5A7BA 1EHKB 4EDWH 4IIQA 5DEFB 1A9VA 3EOAB 3GT6A 3TN0B 5F1SA 3HNTL 2X4UA 1V05A 1NFDB 4HWZB 4ZQTA 3UZVA 2J8UE 5DHYB 1IBDA 3SO5A 3TOPA 2A9NL 3N1PC 3UGXA 3IJYB 4M43L 3H7BB 2HYMA 4HIPA 2CHXA 1IJ9A 4XMLL 3QYNA 3GMPA 3V0VA 1U8OA 3R0MA 5BRPA 1I3GH 3R7QA 4XXWA 1J8RA 3BUTA 2D4DA 4XMVA 3BAXA 1LO3H 2HX8A 3WXWH 1JGVL 1SHWA 3GHBL 4M4RB 1CU4L 5D7LB 1WD8A 3L8QA 4KK5D 3U2IA 4CSSA 4ENED 1YY9D 3VSQA 3T2LA 2CJTA 3MGOB 4BXSV 1OM3H 3KHOA 2WXFA 5FYJH 2P42B 1I3UA 1X7QB 2XG4A 4U6HB 1KCVH 3ECBB 2OMZB 5D4QA 3UAJD 3UPAA 1MI5A 2C4FT 1QMUA 4NRZB 1T5XA 4YOKA 3PV6B 3FRPA 3U4BH 1E2WA 1OWRM 2EDTA 1SMDA 2WQWA 3WKMH 3FCTB 4L1LA 4AQ1C 3WEMA 3BFOA 1C5CL 5KN5A 4OCXL 5AYUL 3D48R 4ZX5A