2G2NA

Crystal structure of e.coli transthyretin-related protein with bound zn
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
NILSVHILNQQTGKPAADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTGDYRVVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHYHVPLLLSQYGYSTYRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin-like protein
publication title The transthyretin-related protein: structural investigation of a novel protein family
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 25
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 2g2nA00
2ROYA 4FI6A 3DJRA 5L4MA 4I87A 5E4OA 4IKKA 4PWKA 3TCTA 2H1XA 1KGJA 1ICTA 3IMTA 4FI8A 1GKOA 1BZEA 4TQHA 4PWIA 1FHNA 1TZ8A 3P3SA 1TFPA 5AL0A 3BT0A 4TLKA 3IMUA 5EZPA 1SN2A 5FW8A 1DVSA 4ABVA 2B77A 4PWHA 3CN2A 4PWFA 5CLXA 1BZDA 4MRCA 4N86A 3IWUA 3KGSA 5AKVA 3DK0A 2G2PA 5AKSA 1DVZA 3Q1EA 1SN5A 3DJSA 1U21A 3I9AA 1G1OA 1ZD6A 4AC4A 4DEWA 5IHHA 1THCA 1TTBA 5CM1A 5CLZA 1ETA1 4I89A 5L4IA 3FC8A 4TLUA 2B15A 3CFTA 4PWEA 2H4EA 3P3UA 3NEOA 4MASA 3GRGA 2B14A 3DK2A 3IMVA 3NEEA 4Y9GA 4AC2A 4DETA 5AKTA 3FCBA 1BZ8A 4ABUA 2QGBA 3ESNA 3OZLA 2FBRA 3IPBA 5AYTA 5DEJA 3IWVA 2QELA 4TNFA 1GKEA 4ABQA 1E5AA 4TQPA 3GPSA 4IK7A 4IK6A 4KY2A 4TNGA 2QGDA 4IKLA 4IIZA 1DVQA 3QVAA 4L1TA 1ZCRA 5FO2A 2H0FA 1TTAA 3D7PA 4D7BA 1TLMA 3I9IA 4YDMA 4ABWA 1KGIA 3DGDA 3GS4A 3U2JA 4IKJA 3HJ0A 4ANKA 2H6UA 3GLZA 4HIQA 5JIMA 1SOKA 2IGLA 1TYRA 3DIDA 3IMRA 1BMZA 3CN3A 4PMFA 4QXVA 4WNSA 2H0EA 3CFMA 1DVYA 3CFQA 3D2TA 4L1SA 4PVLA 4YDNA 4HJUA 5FW6A 2G2NA 2H0JA 2G3ZA 2GABA 2F8IA 3CXFA 4DESA 2G4GA 5HJGA 1OO2A 3DO4A 4DERA 4DEUA 1TTCA 2F7IA 3KGUA 4Y9EA 3OZKA 2GPZA 1SN0A 1TT6A 2QGCA 3KGTA 4PWGA 4ACTA 5K1JA 1THAA 3SSGA 1FH2A 5E4AA 4TLTA 1ETB1 3IPEA 3CN1A 5L4JA 4QYAA 3I9PA 5CR1A 2ROXA 3A4DA 3CBRA 2PABA 1IIKA 4TNEA 3TFBA 4HISA 4PVMA 3IMSA 3GRBA 4FI7A 2G5UA 1TSHA 2B16A 1RLBA 4TQ8A 1SOQA 3CFNA 3CN0A 4HJSA 4WO0A 2QGEA 5TTRA 5JIDA 1E4HA 3CN4A 2G9KA 4Y9BA 4N85A 4TLSA 4TL4A 4Y9CA 4QRFA 4WNJA 5AL8A 4TKWA 5E23A 4TQIA 2FLMA 2G3XA 3W3BA 1X7SA 3IMWA 5JIQA 3P3TA 4N87A 3BSZA 3ESPA 3M1OA 5EN3A 4MRBA 1F41A 1IE4A 3ESOA 4Q14A 5A6IA 4TM9A 4PVNA 3NG5A 3NESA 2WQAA 2QPFA 1QABA 3GS0A 1Y1DA 5BOJA 3U2IA 1X7TA 1Z7JA 2B9AA 4I85A 3B56A 1TTRA 4PWJA 1F86A 5L4FA 1DVTA 4IKIA 5K1NA 1DVUA 4HJTA 3GS7A 5CLYA 2TRHA 2G4EA 3NEXA 5CNHA 5FW7A 2NOYA 1IIIA 4PMEA 1DVXA 2TRYA 4PM1A 5CN3A 3DJZA 3A4EA 4TL5A 5DWPA 3DJTA 1BM7A 1QWHA 3P3RA 1IJNA 3A4FA 4Y9FA 1E3FA
chains in the Genus database with same CATH superfamily
5B1CA 1TDQA 4ZUUB 2ED9A 2YUZA 3EOYG 3GSXB 3JQOB 3T0AA 4YLCA 5I2IB 2WSKA 3VXQA 5BPPA 5FLVA 3DRQB 1L7TL 4HBQA 3ZKXB 1AGEA 4Q0XL 4F7CB 2P3YA 3PWLA 4R7NB 1TQWA 1XGPB 3MXWL 3NZHH 4QHUB 3SOBL 3VO0A 4Q58C 4S1QL 3IKCA 3ARFD 3L8QA 1YC7A 1HHGB 1UD2A 2PR4L 3RDTD 3P69A 4BIKA 1EHNA 2E9BA 1DQJA 4G5ZH 4YJZL 2GEEA 4KK6C 4YUEL 4ZPVB 3QUMB 2LABA 1T7WA 3B2DC 2ERJB 1J1PH 4GQ9L 5I76B 4XC1H 3S88L 4H8UA 2OYKA 4PS4H 4FNQA 2ICEB 3OZLA 3RA7H 2DS4A 1NUDA 5GRXG 3TZVD 1Z9PA 2ZJSH 1J12A 2GUYA 4Y5VB 1CF1A 1WDAA 3M8OL 3VFPB 1R34A 5T1LA 3HMWL 1EGJA 3KW7A 4YHIA 2WLIA 2ZOKB 4L4TE 2X4TB 3O6MH 4C4UA 3FQXA 1BQUA 1AR2A 4WW1A 3P2BA 5AYUL 2BRQA 3D39D 4IDJH 2O5ZL 4ZFOL 1JF6A 2PWHA 2LVCA 4KK9C 4UT9H 2QVMA 2GC7C 1UJTA 1CC3A 2J8UB 3QFJA 1TZOA 3IDYC 4IU2A 4KMQA 2QADD 3GXUB 3Q48A 3IM1A 3PQYB 4DO6A 3LIZH 4YFLF 2G4GA 1N6QL 1WEJH 3DO4A 1Z66A 4DKEH 3GMLA 1G0DA 4BGDA 2A6KA 2WZ5A 5E03A 3EO0A 3QHTC 5JW4N 2V7HB 3REWA 5D93B 3TCLA 4D9QD 4XMLH 4PVBA 5IF0B 2WJ5A 8FABB 1PZBA 5FEBA 1C7SA 2NX5A 3BT2L 1EZLA 3EGSB 4Z7WE 3D4GA 3ALWA 3LOWA 1RFDL 1DLFH 4BKLA 2CU9A 4WV1C 3C75A 3LS4H 5D96B 1PSKL 3FN0H 4JN2A 2YUWA 1ULVA 3BPCB 3ARFA 2Z8RA 5EU7C 1MI5D 2GJ6B 2ZUYA 4G59C 5IHWA 4X80H 5LXGL 1X9LA 5F3BB 1FBIH 3FB7A 1XTMA 3NJIA 1D2OA 1P84J 4NC1E 4PP1D 1UXWA 4W9HC 3U48A 1NSNH 4JM2B 5GGVH 5EOCL 1QTYT 2Z7WA 3BHBA 4BEIA 5IW6B 2EC9T 1QTPA 1M42A 1UZ6E 3TZVA 5F6HI 4QEGA 1JGIA 3A6CL 5IBUB 4PJ7E 4FFYH 1X5XA 2FO4A 1EAOA 3K71A 1MHEA 1TJGL 3MXVL 4KWUA 1MFEH 1IC5L 3ILPA 4JRYB 3KNBB 4GP4B 4K3EH 1FLTX 3D39A 3HJEA 5D7JB 5DHVA 5LQBH 1GVIA 4UZGA 5LAXB 1DE4B 4BJLA 5I23A 1GGUA 1BFOB 5I8EA 2ADJA 4CVXA 5EFIB 4YSQA 2DJSA 3S3CB 3SBWA 3FCGA 1D5IL 3KYNA 3VRIB 2UZIH 2I9TA 1AO7D 1W0WB 5F3HB 1ZHNB 1RERA 2Z65C 3D2UA 3T4AB 4AOFA 1SXZA 2RJMA 3TV3L 2BSTA 2K4AA 4U6TA 5ID1B 1NL0H 1QLEH 2Q7NA 4MMYB 1RZPA 2XZZA 5EF1A 1B3IA 3PWVA 2VN3A 2QVFB 3E8VA 3QUHA 5ERWA 4A6YH 4X5PA 3BXNA 2R1YA 5AYTA 2XA8L 1UATA 5JIPA 1CL7I 1NCIA 2YGOA 3BAXA 5D1QD 1O7DE 3B8SA 4K7FA 3RIFK 4EI0A 1WCBB 1E3XA 1OWWA 3ARGB 4MXQD 1TQVA 2X0VA 4U6HA 5AVSB 1LK2B 4WVRA 3VG0H 5HDLA 2OXGA 3H7BA 2DB8A 3ZKNC 3V9FA 2P8LB 3NZ8B 3G6DL 3SGKA 2PPFA 3ZTDC 1BOYA 4PHZA 2ZWLT 2WD0A 5E8OA 1QBMH 4Y1AD 4RAVB 2X38A 4CU7A 4PG2C 5AW7B 3WFZA 4QRRD 4PGBB 3C5JA 2F7PA 2WNXA 4H40A 4J4PC 2XWRA 5DVKA 3EJRA 5B7EA 3QUYB 1IIKA 3I74A 2V9QA 4P9HC 5D5MA 4KPHH 1RI8A 4BELD 2ZAIA 2Y7SA 3U1QA 3UTPE 5DGRA 4C56A 3QEUA 5FYLD 4UUJA 4Y9CA 1QSFD 4YHZL 3NJMA 2N1KA 4N1CA 4TN9A 2ADGB 3ILDA 3KD4A 1HSBA 2DWDA 2WYIA 4AT6B 3UZQB 1D6EB 4HK3J 2VDRL 3N0AA 1MG3C 2DM3A 3TO4C 1UFUA 4DKDC 1JGLL 2AJUH 4PJ9C 3FCSA 2W07A 4Z3JA 4N0UA 3GKZA 4UAOB 1KULA 1OZUA 1X5AA 2ZX7A 1YNKH 2H32B 2G60L 2GC4C 4Y4FC 4ZOCA 5KS9F 1W6LA 5FC9A 3MNZA 4HHAA 2E7HA 2XQYG 3KPOB 1IZKA 4V1DD 1R3JB 3O0RL 6FABL 4NSKB 1V55B 3NCMA 5L2JA 4UZSA 3OM3B 1PYWA 3QR1A 4UAHA 3EYFB 3HC4H 2CIKB 3Q6GL 3NDZE 5SWSA 3MQIA 5HI5C 2YKLL 4PY7A 5KSAD 5MEOA 1CIUA 1HWWA 3D51A 3AQXA 1RIVL 3M1BB 2CDEA 3SCMB 3FHEA 3WYRA 4OZIE 3UYPB 1ES0A 3DX8B 3WTSA 4FQIL 4PRHA 1E6JH 1P7KB 5ETUA 2J3SA 5D7IF 5DHYB 4W9LC 3MPCA 5DQDL 1UEMA 5DUML 2FHFA 4K3DH 5FV2A 3IMVA 2IWEA 3GO1L 5TDPA 2WXKA 5JHBA 1KDJA 1GKEA 1KIRA 3TLRA 1E5AA 3WS3B 2AQNA 4OJCA 1R5VA 2YN5A 3I50H 4I3SH 3WMPA 3DJ9A 4ZFZA 3W38A 2EDEA 4Y16B 1JXFA 2H47C 4H8WH 4LASL 5EU6B 3WFEL 2CMRH 1IGTA 5F0PB 2NNRA 1GR7A 1IEBA 3TA3C 3CSGA 5JQHC 4FAAB 3FTZA 2EZ0D 3JZ7A 4JO1L 2VXQL 3UH8A 1DVYA 1T83A 3Q8AA 1I1RA 2DWSA 2F8IA 4QXGL 3HKZA 1OM3L 1F90L 2FIRT 2QGCA 3O11B 2YXMA 1R75A 1RSFA 3MKKA 4OIIH 5MP6H 3VXOA 2AK4D 2PP8A 3WIAA 4HKZB 4WAFA 1E27B 1IM9B 2F53B 1IQDB 4ODTH 4RSYA 2VW6A 4V1DA 2JB6A 3OXSA 4ADIA 4CILA 5JHDD 1IFHL 2K6ZA 4LHUD 4NLHA 4A39A 3OKNB 2B8OT 5I1HL 5KYWB 2WNKA 1X9UA 1AQMA 4Q4EA 4G6AD 4E68A 1MCEA 5EF2A 2Y0SA 4PPTA 3GD1C 3TVMD 5CGMA 2QMJA 3ES6B 5IG7B 1JVLA 1K5WA 3L5XL 1KELH 3AS1A 1FDLL 3HE6D 3ZSSA 5I0DA 1A8ZA 5DDHA 4YSCA 4AMXA 5FYJU 2E56A 3N3EA 4KKRA 4NO3B 5HHNA 4N87A 3ILEA 3SE4C 4LPCA 2AITA 5C9JB 5FYLL 3MFGB 5DVPA 1DQLH 2VDLL 1U8HA 1UOVA 4UM8A 1FJ1A 4KO9A 1T80A 1LGVA 2W91A 2UWEA 3SKNB 1HXMA 5C08B 3H4FA 4QF1B 3VRJB 2W95A 1DVFD 2AQ1A 2IXQB 4GW4A 1ZTMA 3WN5A 1H15B 5E8NB 1FL6A 2AEQH 5GSVA 2LU3A 2ZSVB 1MCBA 2ZNXA 3HTLX 1E4WH 4ORZC 4Y7OC 1TFPA 3FO9B 1VFAA 2IAMB 4LCWE 3ULVH 4OLXL 2VSDA 4LGRB 4L3CA 5BQ7A 1VEMA 4ORGB 3CVHB 4OD2B 4I0PA 1TQBB 4JPWH 3IWUA 5BZZA 3O6LL 1EBAA 3DV6B 3PWPE 2YMOA 4JGNA 3GTVA 2AK4A 4ZFQA 2GI0A 3LKSB 1ROCA 2GSGB 2VN4A 1QWNA 2CD0A 4IGBC 3D0VB 3GFUA 4L8CB 2VQ1A 2P5WD 3ATDA 3FC8A 5I1EL 3GSWA 4G7QB 3RRQA 4ZX4A 3SDDA 3ARPA 1J05B 2C3VB 3AXLB 2VM4A 1BZ9A 3NJJA 2VJ8A 4JG9A 4H7VA 5AVUB 1RK1A 2WQXA 5CEZH 2H5UA 4CADB 1RK0B 1CK0L 2YK1L 2EE3A 1LEIA 3EF4A 1TO4A 3RU8H 4OB5L 1BBDH 1NIEA 2WKGA 1RHHA 3MGTB 3X17A 3NSFA 2VLKD 5FGBC 4Q9BA 3KPLB 1ZPUA 1RIHL 4Z0BH 3VW3L 5AW5B 1QEWB 4JFXA 1RCYA 2E0PA 4NWUH 3AADB 1I9EA 3QQ9D 4WI6A 1BFSA 4XNBA 5AUMA 4B3EA 4XPTL 4Y4KD 1MCIA 4ZMNA 1WITA 2HRLA 3CZFA 4EJ1C 2WB7A 1LP9A 5L8JB 4ZMOA 4MJ6B 5D70L 4FMFA 5IOPB 3DGGA 3KYKH 5JQIB 2IV8A 3ZQ9A 4FN0A 5IWLC 3ZLQC 2P24B 4FQXB 4C57C 3MLWL 2BCKB 1VFMA 3B6SA 4AYSA 1ID2A 4EPSA 1DQMH 2ZXBA 4RFOH 5A2AA 2BOBA 3DTDA 1XCQA 3DUSA 4JVPA 2EADA 1T1XB 3UTTB 4LOUD 1T2QH 5BO1L 4Z7OF 2XZQL 3LPFA 5F9AC 4MD5B 4WHYG 1LEGB 4AE0A 1JNHA 3UTOA 1XVSA 4YHML 4JFFE 2RCSL 4NFDA 4WGWB 1AXSA 3MYJB 2VITA 3DI2B 2PPCA 3H2QA 1CDBA 1G5AA 1SJEA 1B9KA 4HCRL 1WSST 3O8XA 5EORH 4JJ5B 2XPGB 4MA8H 3NCYP 3LEYL 5EIIB 5IMKA 5HP5A 2EVHA 2EDMA 1J8HE 4AQZA 4X0NA 4I13B 3B1TA 4YZWA 3RNKA 3V6OE 4GI9A 2UY6B 2CO7A 1WAPA 2ADFL 1A7OH 5KN5A 2J7LA 3ZR6A 4CDHA 4J3OH 5EBMA 4NUJA 1IGIH 2Y24A 3FQRA 3MR9A 2EXYD 4MNGA 4N86A 4Y4KA 2G2RA 5KJRH 3RY5A 1I53A 4L0YA 4MJ5B 4UOQA 4OD3H 1R24B 4KKLC 4ZO9A 5FGCE 2VLMD 4PJXA 3MA7A 2QQKL 1UA6L 3CSYB 4NFBA 3GMPA 5EBLB 1NCAL 5CHNA 1C08B 2AJYL 2WTRA 1OQXA 2IH9A 3HVNA 3HLAA 4LBAA 1EAPB 4MBRA 4YHKH 1BD2A 4FL4C 4KKQA 3V4UH 4G6KL 1F97A 1QRNB 2BHFA 2Y2WA 1A7QL 3IPBA 1W72L 3AREB 5HHXL 5IVXA 4P2AA 4F58L 3DXAE 3NZSA 4XE5B 1A7PH 2E76C 4TTDD 4KDVA 5K9OA 3KXFD 1XF3B 3M88A 1ACXA 2DQTH 2MOGA 2X1OA 4W9JC 3RKDD 3GSNB 3HJ0A 3ZHFA 1BGXL 2XXCB 2D3JA 4M7LL 2PP7A 3BZEB 1JK9A 4GNKB 4N2GA 5HHQB 3IAQA 5I30H 3V0HA 4OQTA 5DEFB 3SJVD 4KAQL 3I6LD 3IJYB 3SB3A 4XH2B 1GGYA 1OO2A 2Y5EA 3KJ6L 1EAQA 3KW8A 3UMNA 4H26B 3WO4B 5IJVA 3LPOA 3G5VA 5ESAA 4JMXA 3VDAA 3BP6B 5TJWK 4BFIA 3GMNA 1G0XA 4IOIB 4F8LA 5E1AA 3DSFL 1I9IL 4KKCD 1SUHA 4P3CL 1PJ9A 1I3GL 4ZMTA 5M95B 3FT4B 3I2CL 4Z7QF 4AUYA 3SDAA 2DQJL 2NY3D 5JMRA 3OQ3B 3V5HA 3W0WB 4G8GA 4XNUL 2FQDA 4HWBH 5DJ2B 4GBXA 1AI1L 3NOIA 4B9CA 4JPIB 3EOBA 1KLGA 5JO5A 4AH2A 3UBXA 3P1VA 3PRZA 5GISH 4OM0H 1BVNP 4WNQA 3TBBA 1MF2H 1NFDE 2F7OA 1AGFA 2PR9A 3CMOL 3F5WB 3K6NA 4FYTA 4CGTA 4AVJA 5JQ6H 3KVPA 5IV2A 2OSXA 4GSXA 3N42F 3WNOA 5EO9A 1JZ2A 4YDKH 4XN8A 4APQD 2P5EB 4I85A 3MJ8B 1XMWA 1NAMA 3C87A 4Q56A 1XTLA 4DT2A 3WS6A 3PP4H 4FGMA 4DP5X 3GB7B 4HU8A 5FM4A 5E8PB 3ECBB 2WWMC 3FQNB 4RCAA 4TVPH 4WUUB 1MDAA 3K8MA 4KTYA 4OQTL 3UFIA 1OSEA 5EZIL 1A3RH 5H37H 2AQ3A 5DD1H 5KVEH 1ND0A 5LAPA 2EEFA 1KBWA 4XMPH 1S7XB 1JG9A 4CKQA 3O3AA 3P4OB 3RWHB 1RLWA 1I7UB 1TCRA 1KDIA 3LD8C 4PJCF 3SPHA 1BOGA 1C5BL 1BQHA 2WWNA 2R1WA 3PGDB 2E6QA 3QXUA 1QQDB 1NEPA 5HYIA 1S9VB 4A7UA 5CUSH 2CIIB 1DDHA 3VMOA 3L2MA 4FNTA 4XAKD 5ICXB 4HIHB 5H2BA 4AQ8A 5F89A 5I74B 2EO9A 4LVNC 4QHLA 3G5YB 3V0JA 5BS0E 5AZ2H 3U6XA 4ZMAT 1AGDA 3P4NA 3L3KB 2UXVA 3CFTA 4HV8A 1HI6A 1LLAA 1WFUA 1IGFH 5FYJE 1RVFL 3LN5A 4XNAA 3DK2A 1TSRA 3L3JA 4ZI8A 1L0YA 3OPUA 2QSCL 3N40F 3FRPB 4WF7A 3I85A 1U8IA 1CLYL 1VFUA 3FNKA 4JY6B 5HDWA 4BUGA 1YMMA 2VJ0A 1T1ZA 4RAUB 4DVBB 5DYOA 3I3EA 4IK7A 4YE4L 2HJKA 5BOPA 3TGXA 3JWNE 4HFUL 4EQ3A 2HTKC 3H9HB 4O2FA 3NJVA 3TBCA 2PPEA 1NAML 4LLMB 4BSVA 1ZJAA 3F62A 5DURD 4ANKA 4KJQC 4OGYL 5BJTA 5FECA 3ZL1A 1KGWA 4MS6A 1TYRA 2WIIA 3RURA 3GJEA 4APQA 4OLVH 2CNZA 4TSAH 5T33L 2FJGB 4G1MB 3OV6A 4IEFB 1DL7L 2XN9E 4CUCA 1ZEAH 2UXFA 3BUBA 4YHLL 4WO4A 2DQCH 5CAYB 2VM3A 4N2EA 2DYPB 4AEHL 2GFBA 1EEQA 4FULA 1I8AA 5EZOL 3N55A 1XGUB 4NKDB 4XCCL 4PRIE 4J23A 3SYAA 2YPLE 1Y6NR 4DZ8A 4OIFA 3EG9B 4KHTH 2G9KA 1FFPA 2HKFH 4M43L 4TVUA 3ZE2E 4BSWA 1JGEA 1W91A 2NPLX 1T20B 4WEMB 3KG5A 4I1RA 4JFYA 4ZUTB 4X9FA 1KT2B 4LLUB 3RIAK 5KYYA 2GIXA 4Z6AT 3VQ1C 3CK0L 1RZKH 5HDOA 3LNGA 1WD8A 2WXHA 3WKMH 3WU1A 3QI9D 5JXAH 3BGMA 4BCXA 3INUH 4Q14A 4GS7B 5EOQH 3IJ9A 4ERSH 5GGTA 5SWZE 2YAQA 1W8NA 1HOCB 3AU0A 3SO5A 3DUUA 1GXEA 2ZPKH 4KVCH 4BA8A 3I6GB 4DGWC 4HLJA 2UX6A 2WNGA 43C9A 5CZVL 2Z4QB 1OAZL 1QBLL 1TEYA 1E6OH 4O2EA 4YO0A 3O4LE 3R0NA 1P7BA 4L3ED 4HWEH 3BRFA 1NUFA 2FQEA 4PH8A 4IKKA 1FH5L 3DVNA 3PJSB 4G80B 4X7TA 3WEOA 1BZEA 3SPGA 3CUPB 1XIWC 4J3WA 3UXFA 1IQWH 1NMAH 4NI3A 1BJ8A 5HVHB 3VMNA 2OTPA 1X5JA 1M05B 3BSGA 4G9FE 2FHCA 3GRWH 4OF5A 1YYCA 1RK7A 4PWFA 5I6MA 5J3HD 3QHFH 3DV4A 5EEXA 3VI4F 1UH3A 1KPVA 5LWYH 3I9GL 1PAMA 5D6DC 4ETQB 1KN2H 3GSVA 2EYTA 4Q52A 1K2DB 5KBNC 1JFHA 5J13B 4EKXA 1R3LB 2N0MA 3EO1A 4JFDB 4JRXD 4PWEA 3WUZA 1CDYA 4UBDD 2YD6A 3E0GA 2EDJA 1LO0L 2BERA 5E99H 4OD1L 4HJGA 1AKPA 3KPMB 4HJEA 1A02N 3OL2A 1OP3K 3HAEB 5SV4A 2Z7YA 3D3VE 4DPBX 4XO4A 5GGTL 2ZG2A 2DICA 1NEUA 5FOBA 3O45A 3CFBB 3BMWA 3QI9A 2BS9A 2RBLA 1JF1A 1JPEA 3LKNA 4PAZA 1MRFH 1ZANH 2F19L 5GS0H 3P4MA 5DJCB 4CDGC 4E42A 5EUOE 2VRKA 2V17L 4N5EC 1FIGL 1PIFA 4L05A 3HZMA 3AABA 1GW6A 4M3HA 3UG5A 2A0LD 3D30A 4Q74A 4S2SB 4TNVK 1IBDA 3QZPA 2G3NA 2PWEA 1FVCA 2PYFA 5FCUL 2C5DC 5CJXA 4U1JB 4I1NB 1HJBC 1RZJL 4OV6F 1AR1B 3PGCA 2DLFL 3OGCB 4ZOAA 4JE0A 3VTMA 5D2LE 2VR8A 2JF1A 2ICWB 1IKNA 4IU3B 2B16A 4L4TD 3O9WD 5J6SA 2YRLA 1AAJA 1OAUL 3WSQL 5TTRA 1JRHL 2EEBA 3BI9X 1A4CA 4QRPB 5AVVB 4GUPA 3JUYA 1TUPA 2JJSA 3FCUB 2YQ3A 3NABL 4PJAB 1YEGL 3NH7H 3NTCH 1RJYA 1ZLVK 1AIZA 2NW2A 4LPUA 3LYRA 4U1LB 1E9PA 5FGSA 5CEXA 3ET9F 2KDGA 1X7SA 3L13A 1PLGL 5C0EA 2Q76A 2J2ZA 2CAKA 3ESOA 4GSQA 5E9DA 2EDWA 1HKLH 3MX0A 3GKWH 4HU2A 1EHLH 1OGAE 3EJZC 1AGBA 5T3XH 1KWGA 1QKZH 3C5SB 1CYXA 2FB4L 2RB8A 3KLLA 3QDGE 3MMEB 3FF8A 2UXGA 4M02A 2NYYC 1WUNT 4MAYC 4OCYL 5D4JA 3QXAA 1Z3GL 3STZB 4LSUL 2R69A 1RPKA 4BFGA 5IB5B 1AXTL 3KDPB 2F5BL 3VG9B 2F74B 5GGSB 3QAZC 3GWJA 1IEAA 1PZ5A 3T6QC 2XTJC 3ARDB 3OLDA 4FQLH 2ZUSA 4AJYV 2NNAA 3MJ7A 5I8KL 5LCVH 3SHSA 4JDTH 1QFWH 5EBWB 3KZ8A 1CUOA 4JFWA 1KEML 4Y2DD 3LKRA 1XL4A 4XRCB 1GAFL 3LQZA 5E94B 5A3ID 4L9LA 4KVNH 3PNWB 2VDMH 3WO3B 1GY1A 4JCLA 3NEOA 2Q8BH 4XO8A 1A6AB 4Y9GA 4L4TA 4X4ZA 5FO8B 5DRWB 3QXTA 4UILH 2Y25A 3BPNC 1RAMA 2XRAL 2R39A 4NENA 1QO3B 1YECH 4O58L 4XCNA 1PZ3A 4RX4A 1BM3L 2ZXEB 5E2VH 2UVFA 2XG5B 5DLMH 1T7XA 1H6UA 3MBEC 2VDNH 2HFGL 3CLFH 2V9TA 4D0BB 3UERA 4UTBA 1GHFL 3RNQA 2OL3A 4X5XB 2O4EA 3L4ZA 4I3GA 4R7XA 2AMUA 1JNLL 2A9CA 4NT6B 3CXFA 4GKZA 5C0CA 1QNZL 2F1EA 1N2RB 5EZLB 2F7IA 1CT8B 1LK3H 1XF5B 2JK5B 1CDCA 2R69L 2ZUVA 2ODHA 2VERA 4N20A 3SYPA 1LE9B 2DQEH 2X70B 4G43A 2DY2A 4N24A 3OZ9L 5B3NA 3NJHA 2OJZL 4YBQC 3BAEH 1ZLSL 1EFXD 5DD6B 3H3PL 2LU5A 1PFCA 5C0JB 1WGVA 2PABA 2CO6A 3E3QC 2R8SL 1SHWA 5I66A 1SOQA 1U58B 3K6SB 1U36A 3S3JA 1QSEA 4JPVH 1GPOL 1R3HB 3RUGE 4Z76A 1E28B 1IV8A 5F7EH 2CWRA 5HGHA 3O2WH 3HE7C 3OPZL 1G9MH 1NGPL 4P2OD 5CBAA 1AZCA 2DEXX 4AV0A 3DLQR 4P49A 4YHYC 2P5PA 4Y2DA 3ZT5A 4OCXH 3ZSTA 4POZD 4RVBA 2XWBB 2QPFA 2YUXA 4IOFD 4UQDA 1ZV5A 5HHOE 1C1EH 4L9DA 2YGNA 2NUTB 3GXFA 1RZFL 4BUHA 4TTGA 4F9LC 1TU2A 1I1AD 4HK0A 3LRSB 2NOYA 4NJAH 5CSZA 5HGDA 5CGYD 3TCXA 2WZAA 1EXGA 3DOHA 2WMPB 5HBBA 2XG4A 4TQEL 4FI6A 3UTPD 1KV3A 3FQ4A 4JHAH 4ZUVB 2R2CA 3OAZK 4ZW6A 1DUYA 2JKTM 1CD0A 3HHSA 3EZ8A 4M61B 5FGRA 1MW1A 5GGRB 2HH0L 1YY8B 4KV5E 4EXKA 4DP9X 3QDJE 1ZT1B 5DJYB 1SN2A 3T3ME 5ID0B 4ZOEA 5JHAA 1MFDH 1OAYH 2CUAA 3WOVA 4HIJB 1AHMA 1I9JL 1L0XA 1MW2A 1QFHA 2B4CH 5BRZE 3KPRA 2FX8L 3C60A 2R29H 3I02A 4ZTOH 3EADA 3WFBH 3QNXA 4CVZB 1OTUC 4DOHE 4LCVA 4ZMWA 3D25B 2W60B 1YEFH 2OMXA 3MLTA 5CEYB 3MNVB 3QDMB 1MJ7H 3II1A 4DWHA 4EI5D 1S5IH 2GCYA 4DIXA 2EO1A 3MO1B 4M6OH 4FDWA 1BPVA 3H42L 3ASOB 1FFOB 2ZXQA 1NDGA 1Q94A 4RIRA 3D9AH 4MA1B 1GGBL 3DROA 3IN2A 4IK6A 4ZSOE 5C6TH 3TTYA 4U7KA 3HNVL 4P2OA 4JN1L 1TTAA 2IDSA 4DGVL 4IKJA 4QXTA 2AVFA 4X6DA 3FMGL 3DPBA 3QIUB 4NCC2 3H9ZA 1MFUA 1KJ2H 4MD0A 3KWWB 2D31B 1NGQL 3V5KB 1U8QA 4Z7NF 2ZTBA 3FU5A 1SEBB 3BZFB 4LSTH 2A73A 1L9TA 4K4KA 1AD9A 5F6IB 4Y9EA 2GPZA 1SHSA 5HVWA 4EI6B 5HI3C 3PREA 5BO0D 1BAFL 3FQYA 5I1KL 3RBSA 3D5OF 3NIFE 2X10A 4U1NB 2Q7AA 3OGOE 5DJAA 4EUPA 4Z5RB 3E7JA 3SPVB 1T0MA 3OMNB 5A6LA 4JVWA 3QJRB 1MSPA 5H4YA 2QEJA 1GRWA 2D0FA 3FFCA 3QUXB 3ABZA 4WW2A 4JQVA 2OR9H 4WDIB 1KNOB 2A6JB 2X1WL 4W9GC 3WJLC 1LM8V 1AS8A 1IGYB 2R0WL 3N1GC 1QFWI 3RB5A 3L2LA 3IJSA 4GI6A 3KL5A 4ANUA 4ELMA 3KLKA 4OZHE 3E1F1 3RILA 4NUPA 3QORD 3ARSA 3FUMA 1P4IH 1HE7A 3ZDZB 1J18A 3BDXA 3NACH 4ATTA 2A2QT 1ZAGA 4YZFE 2EIZA 1J87A 1G7HA 3PXLA 3U2IA 2JCCB 5DC9B 1MFAH 4C54A 1N5AB 3BO8A 2WUBL 2LQRA 4U49A 3GBLA 4FQQA 2VWEE 4NUMA 1T5WB 3VWKB 4AXWA 2BY0A 3IFOB 1TF4A 4MSWA 4C58B 4PMEA 1U3HA 4UT7L 2TRYA 3F7VA 4DF9A 4PJ8B 2CLVB 3A4EA 3DJTA 5CJBA 4LCCC 3KL3A 4F2EA 5HI4C 3MLSL 2LE9A 3U4EA 3D07A 4HKXA 4PJDF 1DBJL 2M26A 3BP4B 4OZIA 4NB7A 3HUJF 4KK5C 4GFTB 3BIAX 3BPLB 4FTVE 5D1ZB 1NCBH 4CBPA 4HC1H 1I1YA 2CR3A 3SOBH 3EYOA 1TTUA 4OZFH 4NAMA 4LMQE 3OX8B 2MHAA 4RFEB 4UM9A 3UPRB 3CFEA 2YHGA 2VXSL 4HGWB 2AABL 4AC4A 1AQDA 2CM6A 2X3BA 4KBPA 4YUEH 3U0WL 4YIQB 3WEMA 2RIKA 2C1OB 1DANU 1XD0A 4XMTA 3VDCA 2IPUG 3S88H 4YHOH 3KCPB 5E4EC 4PJFB 4PTUB 1NLBH 4ZQKA 3RVXC 2NY5C 3M8OH 4POYA 3HMWH 5HTSA 1ECYA 4JY5L 3VGHA 3CPLB 1H9DA 4LCWD 4HSQA 4LSSL 2CUHA 3QORA 2PCXA 1E2ZA 3R06B 5AYUH 4YSDA 4ZQTA 4EDXA 3TFKC 5HYJE 4G9DA 3PWPD 4NZDA 5IQ9A 4NN7C 4Z95H 5DZNA 3STLB 3JV4A 4XNQB 1JYWA 1QTSA 3D48R 4ALAL 1ZGLM 3L3GB 3RX7A 1LO2L 1RZ7L 3OR7A 4B7LA 4UOZA 3L6FB 5AAWA 2OMNA 3I9PA 1JPSL 4LEXH 3IJ7A 4NIKB 3VXSB 2B1HH 3FRPG 1JNJA 1RFDH 3P11H 1ADWA 4ATWA 2GBTA 3GK8L 4UIMB 5I6XB 4LPYA 4X4ME 1KBGL 1I9RH 4ZAKA 4XR8C 5DVLA 1X5ZA 2VAJA 2HTLC 1BX2A 1F4WH 6CGTA 5MENE 5F8QC 4GO9A 2VZUA 4R26H 1FNAA 1QASA 1Q72H 3OKMB 5F7UA 3T04D 3O4OC 2R4SL 5LXGH 1CBVL 1AHKA 2FEJA 4Y4HC 2HWZL 2AFNA 1HK6A 1X9RA 3I75B 4FEMA 3PL6B 3OG6B 1LQSR 4G6FD 1EGJH 3BEWA 4KTGA 2FQFA 1B88A 2N01B 1U92B 3FXIC 4F3FB 2IQ9H 1GOGA 3SQBB 3S5YA 2OYMA 1RY7B 4B0MM 3A6CH 4XWOD 3DRTB 3WNNA 1Z9MA 3CU1A 2AP2A 1Y7VA 2Q8AH 1T22B 3V52L 2A9NL 4ZMQA 4LCWA 1NC4A 3MGAA 3MXVH 2IDCA 3HB3B 1HSAA 1U3NA 3EH3B 1D9KB 3WDHA 4HS6B 5FKPA 4KJWC 2E9WA 4K73A 4M8QB 4NC2B 1T89A 4MQXD 2AV1A 2E27L 3QWRD 5JOEA 2XN1A 4KTDL 5J7CC 1D5IH 3GMOB 4KRLB 4HIEA 1G9NC 2OTWA 3FH5A 1WP6A 3NSJA 3VGBA 2O6PA 5DA4A 1L9NA 1TJMA 1XZWA 3QP3A 5ANHA 3KLHC 5LDUA 2AMGA 2VZSA 3IETA 1MW0A 2W88A 4OZ4B 3TV3H 4FA8A 4TUOB 4Q97A 1XGTA 2YD3A 3RQ3A 1NBYB 2WXNA 1EJFA 2O6FA 5F72S 1YUKB 4YL4A 5G4NA 2X6BA 3WDIA 4Z7VE 2C3XA 4GXVL 4ZXBA 1QATA 2Q5BA 2ZCLL 2IG2L 4M48L 1JZ4A 3P2DA 1BDYA 3F84A 3KBPA 3LRGA 4RBPH 1J8HD 1UKQA 2L8AA 1XDTT 4PJEF 4NC0B 4XXDB 1ZE3C 5CD5C 1IARB 4LPVA 4LVHC 2HLFC 2K7QA 2B5IB 2C3GA 5EB9A 3R0MA 2X2UA 2DJ4A 4YEFA 1MY5A 3C5XA 1GZHA 3H6AA 5BW7C 3RVVD 3X14A 3AM8C 3O6FA 2IIJA 8PAZA 3GIVA 3B5HA 3NPSC 4LF3B 4AK2A 4XE0A 4Y8DC 2AJ3B 1GGCL 4H2AA 4UU9B 5SX4H 2NXZD 1AJ7L 1EHXA 5KBPA 3G6DH 2G3ZA 2BMKA 1H6EA 2PO6A 3EJCA 4DESA 5D8JH 2DMKA 3ULUH 5DHVH 3DOSB 4P5TB 1MN4A 4DQOL 2BSRB 2FH6A 2L7QA 3ZKXC 1ETB1 1QI3A 4N2KA 2P7TB 1MAMH 4P4KD 1F4XL 2B59A 1I7ZA 5FO7A 2XQYA 3DXAD 4GSRA 4HXAH 3KYOA 1I75A 1N6UA 3QWRA 2A83A 5GZOC 2HKAA 3T2NL 4XNYL 4ICWA 3C8KA 3P2TA 5EZJB 2MWCA 2ERJC 3BKML 3ZHLA 4KUCD 5HPMA 2OMZA 3JBG7 1QLRA 5TH2B 2ICEC 1CD8A 3IMWA 3WFHA 1QHQA 5CWSB 5INCA 5IB1B 1XF2B 4Y5VC 2XWZA 2JH2A 5IEHA 1AANA 1UACL 4DN4L 3W81A 3NAAH 2ADIA 1HAUA 5HD8D 2WP3O 4K3JL 1FCGA 1EO8L 5CLYA 2VLJB 2WC7A 3TBWA 3MBXH 5KVGE 1NIFA 1OCZB 4FQ1H 2P47B 4GLRH 5GIRA 1J8RA 2J4WH 1EX0A 3CVBA 4WWKB 4YXKH 3EJYC 5JR1L 4JVUA 4KK8D 2OA9A 4E5XG 4APXA 5HY9B 1CFQA 3LPGA 5TF1L 1T4KB 2VH5L 4P2CG 1F58H 4YVUA 4FMKA 2D7TL 5D93C 3L3IA 3QG6B 1M56B 3TWYA 1S7QA 1AZNA 3FTUA 2DLEA 1DBML 2V2WA 1RIVH 2F9BT 4JO8A 5FA4A 1NJ9A 5DQ9B 3AWGA 3U2SB 1SQMA 4JUTA 1NDTA 2IBZY 3BQUB 3QCUH 2X3CA 3FDWA 4P5RA 4PRPB 4XP4L 2HG5B 3KYMB 4ZTEA 4DK6A 4P4KA 3UC0L 2NQ3A 4NOBA 4Y5YB 5I8CB 3LNHA 2VXVL 1U2CA 1FFRA 8CGTA 3FQUA 3A47A 3GO1H 2BOCA 3MNWA 4KH2A 4CC4A 5LUMA 1I8IA 2VDOH 1WWBX 4PLKD 3MTXA 3VI3B 4G71B 4ODHH 3DMMB 3JWOH 4MAUL 4A7TA 4JM2C 1DR9A 1N64H 4B96A 3OJDB 1P5VB 4D0CA 3PDOA 4UQEA 1NFIA 2C9SA 4X8XA 1ZSHA 2F58H 3ZGIA 3HG3A 4JO1H 2OJ1A 1E5YA 2BVPA 3GSOB 2PNDA 1EEUA 3IBEA 4FNSA 3G08A 4QXGH 2VDMB 1XCTB 1SVZA 5BS0D 2A6IB 5D7KE 4MX7B 4RNRB 3N6YA 4X0KB 5D7JC 4M5ZL 2Q87A 3O2DL 3RWEB 4IYKA 5E5MA 5FYJD 3MRBA 1SDYA 3GBML 1CE6A 1Z9NA 4XZUB 1YN6A 2ZXCA 2AI0H 1KYFA 3GSUB 1LWJA 3QEHA 4N0RA 5I1HH 4WHDA 4ZO7A 1GGIH 5E6SB 3WDJA 4JRWA 3T4AC 4B9JA 2VDNB 2Q6WB 3T09A 3V6ZA 3W9DB 5C0BA 5E9AA 4NP9A 2NY1D 5HYSG 1NFDA 1J1OH 3CN4A 3L5XH 4GSDH 1E2VA 5E1HB 3V0FA 4P4RA 3SDCC 2GK0A 3AVEA 3HR5A 1YQ2A 4MYPA 5F1NB 1AC0A 4AGMA 3DHMA 2X4QB 1FG2B 5F21B 4IRSD 5IHUL 4NZFA 4G8FB 1IGJA 4P23D 3GGWA 2W9EH 1S46A 3T0EB 3QR0A 2XN9D 3ARZA 4LSRH 4GKSB 1EEYB 1Y1DA 3SDXA 1JPGA 4NQEA 4E9VA 2Z8WC 2VR6A 3PYCA 4HJTA 5DMGC 1FNGA 1S9KC 4YXHL 1H19A 4X9HA 4Z7WF 3FQWA 2IF7A 4L4VD 2EC8A 5JOFB 4LO9A 5AB0A 5IGXL 3B9KD 4PRID 4XCEB 1A6TB 2YPLD 3BD4A 5F2FA 2ROYA 2COVD 4WI2A 5SX4I 2C9XA 2QHRL 1AG0A 2XJLA 2YBRA 1VADA 5DS8A 3SGEI 2Y1ZA 5ANMA 4HDIA 2HLEB 3VCLB 4N8CL 1AZVA 1P7QD 3C6LA 4HUUB 1FFNB 1FAKT 1RUAL 5EO0B 2N56A 4UYQA 2ZUXA 5BS0A 1S7UB 4Z7UE 2VAAA 3O6LH 3QUYC 4PYHA 3UDWC 2K45A 2W65B 2VDQH 3QDHA 2OCCB 5AOLA 5SWZD 5A2CA 2AANA 1OAQH 5C8JB 2BS8A 2VKXA 1M7IB 3ME0A 5FHBH 3KS0J 5DC0A 2ZXWB 1OGSA 1NGZA 3NN8B 4WRLA 4G8IB 4PJ7F 5HGBB 4F7EB 1N5YL 2JKWA 4XN9A 4KXBA 3O4LD 4K5LA 4DETA 1FZKA 2FHBA 3GBNL 4GRWH 1LHZA 1MPAL 2FBRA 3IAPA 4R0LA 3E6HB 1PLAA 3H9SE 2QELA 5BVJB 3F3HA 1A0QL 4HIIB 4X2UA 4NP4H 3QIWB 1P5UA 1CICA 4HS8H 4YR6A 1H9VA 5AB2A 1HXYA 1F45A 2MFNA 4L1TA 4ZW8A 5I15L 4JREB 4G9FD 4MNQA 4R97B 1DTUA 2XN9A 3RE0A 3WFDH 3NGBB 3RZCA 1FNHA 5DRXA 4ACPA 3PHQB 2ITCA 1UM5L 4QD2E 4FKHA 5F6HJ 3RGVB 7PAZA 2OW7A 3LKOA 2PYEA 1NUNB 3HG0A 2OX5A 4L4VA 2A5UA 5DFWH 4X98B 4MDJB 3UJTH 2HVJB 1OAKL 2XWXA 4BFNA 1HL4A 1JPTL 3QUZB 1FN4B 3EJSA 4PRIA 5D70H 1OTTD 4NGHL 4KK6D 4X50A 1MJUL 3BW9A 4FLHA 3CFKA 4OFPA 2B7DT 3I6SA 1N3NB 3MFFA 3SCMC 3S37X 1ED3B 4A37A 5LO7A 1E4KC 4M7KH 3D3VD 4OSUL 3TX4A 5FYJL 3GRBA 3MLWH 1XCXA 3OWRA 1P7QA 1TSHA 4MCZA 3MOQA 4XO5A 2DJMA 4XXWC 3TH3T 4PIRF 2J21A 1TPXB 4Z8FL 3MV8E 2IALA 1LO3H 3K2UL 1NPNA 5SWZA 1A4KB 4GEJA 4LESA 4E9SA 5GRUH 2F61A 1S9XA 3LQAC 1A3ZA 4BE6A 1MWOA 4N0FA 2BXZA 5KBLA 4Y16C 1DSWA 3FSZA 1DVUA 4DNLA 2IV9A 5DZJA 3B3IB 2WVSA 1LE5B 4PI2A 3BN3B 3QPXH 5F7DA 1FRGH 1JS4A 4NBZB 3OXRA 3L3DA 3L9RA 2LLGA 4PS7A 4OUUB 5G5DA 2GEQA 5TGBA 1G7PB 2R7EA 4P59L 5J6GB 3DPDA 4G9FA 3U6XS 2NTSP 5C7XH 2BVTA 5ADOH 2VISB 3MLRL 4F7CA 3G6JE 4R7NA 4ZRGA 3T0WA 4QHUA 2ZUQB 4B95C 1MHPL 1TJHH 4HOMA 1PKQB 1V27A 2V33A 4A38A 1ZA3B 2H3NA 3IN0A 4JLRB 1MQKH 5ILTH 3KGSA 3MLUH 1E90A 4UQCA 4Z7OB 4ISVA 3V4LA 1UA6H 1OGAD 2XTJE 3QUMA 1NCDL 4DN3H 1DUZA 1IJ9A 5I6OA 2X4UA 2JWYA 3K2IA 3OF6D 3HPJA 4ZYKB 5L4IA 3WLBB 2XXMB 3NFPB 1MCOL 3EFFA 4HWZB 3QDGD 2O93L 2VDKL 1SUJA 3F85A 4G6KH 3G3LA 3FOMA 3D3VA 4M03A 2PW1B 2YPKA 2FIKA 1A7QH 3QC6X 1BWMA 3VFPA 4HETA 1WCQA 3GIZL 1EERB 1JXGA 4KROB 3UJIH 1FYTB 4JZOA 3SE3C 3U36B 3FT2B 3VYPA 4B27A 1AS6A 4BH7A 4MD4A 2MCPL 4EZJA 5I1AB 3QZNA 1SXCA 2Q1EA 4HIQA 4M7LH 5KW9L 2QPSA 4BINA 2XV6B 4S1RL 5CJ8A 5CMAB 4F80A 1SF3A 4OZIF 3IMRA 2DBLH 1A6ZB 2Y3NA 3FCTA 1QLFA 4KAQH 3FO0L 2D3LA 2DI8A 3POCA 5I1LA 2DW5A 3W2DL 1OD9A 1AY1H 4OF3A 4ACTA 4R3SA 1ASOA 4R96A 1G1CA 3CFJB 5D2LA 4IJ3B 4M1CC 5I73C 3OLIA 4P3CH 2JELH 3V10A 2WN2A 1A14L 2O72A 5ITFA 1CXIA 2NMSA 4JY4A 3A6BL 2VUYA 3BLPX 4TV3A 4D9LL 4PY8I 3C2AL 5ICZA 4ZFOB 1S9YA 5FO9B 2HFFB 2WLZA 4P2RB 1DN0A 1R0AL 2BRRL 4OI8A 3E3QE 4TKWA 1IGML 1D5RA 2WLLA 4FG6C 2JIXD 5F3BA 2PUQT 3MV11 5EIVA 1OGAA 3VXQB 3N04A 2NRDA 1AP2A 3TYGL 1AGEB 1UXSA 3OF6A 5DZAA 4BFFA 1WT5C 2N1TE 4PIBA 5IW6A 3PWLB 4HK3N 3QDGA 4NQDA 3NCXA 1K9TA 2X1PA 1R3KA 3ZKND 2EDRA 35C8L 4MXWL 4NQQA 2CG9X 2ZCHH 2F54E 5KANI 3ZE1B 1M3IA 4JKNA 3F6JA 4OQTH 3TN0A 5E56A 5EZIH 1WBZA 4JRYA 3KNBA 4GXUN 1RD6A 2AJSL 2BVYA 4LLWA 1OAXL 1J0ZA 4J4PD 4KOBA 1DE4A 1P4LA 2DQHL 1BFOA 1GKOA 4LCIH 1TZ8A 2NT1A 4N2HA 2F0CA 3E9UA 5EZPA 3EH4B 5T1LB 4YHIB 2WLIB 5IBLC 1VRSA 2MKLC 5AD0A 2KT6A 1QD0A 3FQXB 3M86A 1A1OA 4WW1B 4FQXC 1QRKA 3OMIB 5HHOD 4ZZKA 1D3CA 2VRQA 5ID1A 1IC4H 2WK2A 4PUBL 2P28B 4N8PA 2VMFA 3TO4D 2VC2H 4IU2B 2EKSB 4PJ9D 1RVFH 4M7LT 5IEKA 3PUUA 3WV0A 1I82A 3GMLB 1CLYH 1MG2C 2A6KB 4QY8A 3VU2A 1RU9L 1TJIH 4Y4FD 3REWB 5IM7B 4XTRC 3TCLB 1OKEA 2EYSA 1N0LA 3ARGA 1ZMYA 4TNGA 2Z6FA 2NX5B 3V0GA 4HFUH 4ADGA 3B7RL 4DKFL 1KCLA 1LK2A 2H0FA 2JIXA 3QDJD 4BKLB 1CFMA 4PJHF 4DP1X 3T4YA 3S37L 3FRUB 5T8IA 2A77L 2O5YL 5I1CL 2P8LA 5CR8A 5HI5D 3KYAA 2C4FT 4JN2B 4R84A 3UMTA 5BRZD 3ARFB 3MRGA 3IMBA 3IDNB 3NSCA 3RDTB 3K2MC 2BDNH 2K70A 1KPUA 3QCVH 5E4AA 4PGBA 1TENA 3FB7B 4QYAA 2YAMA 1P4UA 2AGJH 4H8QA 1A8JH 2R59A 4CSSA 1UXWB 1BWWA 1J9TA 3RUGA 1DDTA 3I3BA 3BHBB 3GXIA 4B53A 1FPTL 4HKBB 4XCCH 1HEZA 5IIEA 3TZVB 5E8EB 3S96B 4BK5C 4RGOL 4KX8A 1CLOH 4PYGA 3FHQA 4M43H 4HUMB 4I5BA 2FO4B 3IGLA 1MHEB 2ADGA 1FHGA 3ILPB 1KUMA 5HHOA 4AT6A 3UZQA 3D39B 5DHVB 5JIQA 3AREC 1A64A 4M62L 2PCFA 3L95B 5I8EB 4Z9KB 2RQ8A 3TA3D 3TO4A 4AITA 4GRLC 2ADJB 4X5WA 3OB0H 1QZ1A 2QADB 5E1IA 4JMNA 2BWDA 1U8LA 2BNRE 3KYNB 3QQ4B 3LS5H 2B9AA 1Z6JT 4HJ0C 1XZ0A 4YDIH 5CZVH 2WOYA 1QBLH 2BSTB 2YMXH 3KPOA 3NZUA 4H1LG 3CGTA 4BFKA 4N2MA 1R3JA 1KLFA 4HUXA 4PV9A 4WY7H 1QI4A 4FFZA 1ICTA 4WEEA 3UAFA 2Z31A 3WO4C 3PWVB 2Q20A 3BXNB 2R1YB 4CC1A 3M46A 2X4PB 3QUGA 4KMTH 2VDRB 4BUQA 5GGSY 3ASNB 1F42A 1CURA 1S7WB 1XWVA 4FQHB 1E5BA 2EDYA 3I9GH 1P7KA 4P9HL 3WFCL 2N4IA 4N2AA 1J0IA 4U6HB 4J3VA 3TYFB 7FABL 5ICYA 3KEDA 3SIKA 1E4JA 4L1BA 3ZYZA 3EYUH 3CD4A 4GAGL 5JPNC 1CXEA 3H7BB 4AIOA 2BJML 1LO0H 3AGVA 3QIBA 1NLDL 2ZP8A 4ZSOA 3ZDYF 1M4KA 4TULL 5E8OB 2NT0A 5FA3A 1Q38A 3MNDA 2WGXA 2VLLB 1S8DB 4OD1H 3WS3A 4H88H 1QOKA 2QL1A 1EDHA 4Z7AA 2MIZA 4BZ1A 5GZNC 5L6YL 3ESUF 5GGTH 3AY4C 5E24E 1SOXA 3Q8FA 3MUJA 4FTVD 2V4LA 5D5MB 4FHKA 4YAQA 3CVIH 3FTWA 3D33A 1WS7A 4O4YH 2F7QA 3SZ6A 1RUMH 5FS5A 5CCKL 5H35A 3EYSL 4UUJB 5C0RH 4FFZL 2ITDA 3AUVA 1XMEB 3A6OA 2BOLA 2XQ0A 1OK0A 4GUOA 1HSBB 2DWDB 1E27A 2F53A 2DDQL 3U4KA 3TF7C 1MZZA 4KZDL 1RZJH 5KYWA 4XODA 3T3PB 2W07B 1WAEA 4N0UB 5IKCA 2VMDA 3EDKA 5I6LA 2EO7A 2Z0BA 4U1SB 4MHHG 4UOJA 3T2LA 5A7EA 5I74C 1OAUH 4KFMA 2H8PA 5D1QB 2IFFH 3L3HA 3OKKB 3V2AR 5T3ZH 3NABH 5AOZA 1YEGH 4P8QA 5HYJD 1UXMA 1J5OL 1ZOXA 4ONHB 2WZ6A 4N1HB 1FLRH 2QHLA 4NN6B 2J56A 1SJXA 4FCHA 2ZE0A 5DI8A 3JVGC 1ZLWH 1MNNA 4BZ1L 4AZUA 4PY7B 4W70A 5MEOB 3GI8H 4IMKA 5HYEA 2CDEB 2G30A 1ES0B 3GSQB 1RULH 5ITBL 4NHUA 2FB4H 1JXJA 3QYCA 4PRHB 4EN3C 5ETUB 3FONA 4BA0A 5B1KA 3QQDA 3UTSE 4BFEA 3AAZA 4QRRB 3ULUF 2CO3A 5FCSH 4TYUA 2WHVA 1NGYA 3VFMA 1Z3GH 4F91B 1OCWH 2BP8B 5MEND 1NGXA 2BSCA 3NP3A 5DMIL 3FO9A 4GXUM 1AXTH 2IAMA 5TDPB 1T6VN 1O6VA 2GUOA 3NIGE 3QWNA 3TEXA 2E8ZA 2VT0A 3BUPA 1KIRB 3FTVA 1WWCA 3IMUA 2VQTA 1R5VB 4P46A 4G7VL 1UA3A 1NICA 1I85C 2VDLB 4ZFZB 1YNTA 1ZDQA 5CJQL 5I8KH 3RPKA 2HXAA 1IGTB 2K78A 5DJDA 4OI7A 1IEBB 1L6PA 3VX1A 4L8CA 5CILL 4WI4A 4WGVB 1PAZA 2RD0A 2YQGA 3B4NA 4MZ2A 4R8WH 1YNLH 3HS0B 5TFSL 1FGNH 4HOWA 3NYKA 2XWEA 4AGPA 1SGKA 4PEEA 1BVNT 4DVRL 1KCUH 3VXOB 5AW2B 4MVBC 2XRAH 2CR6A 3NUKA 5TK4A 4XPFL 4OGXH 3JYBA 5HYJA 4V1DB 1BM3H 2JB6B 1INQA 3G9AB 3AWFA 3IRPX 1XO8A 2OCJA 4HH9B 3SGJC 1HTYA 4EIBA 3KPLA 4JO3H 3Q5TA 3U0TA 5JHLA 4PMFA 4HX1B 1BG9A 5KSAB 1A22B 5E2WH 2Y7OA 2EDDA 2V5RA 3FSWA 4XP5H 3HC3H 3IPFA 5CD3A 5DDHB 2R69H 2ZX6A 3VD0A 5C6PB 2EICA 1E4XL 1ORSA 3OZ9H 4EE2A 4LMQI 4KKLD 4X4MA 2OJZH 4LNRB 2P44B 1R6VA 2FVNA 3H3PH 5AYQA 2W38A 1YYLH 3X1GA 4YDLB 1U8HB 1B3JA 4KOCA 2Z35A 4IKNA 4YNYA 3TNMB 1Q1JH 1FJ1B 1W9XA 2APSA 3ASWA 3CCHA 1QHPA 4P5SA 4UM8B 5C0IB 2WBJA 3CN0A 2UWEB 1GPOH 1HXMB 4DO4A 2E7CA 3BIKB 4N5UA 1SEQL 2DQGH 4TPRH 2ENPA 3MREB 2DWYA 3MLYH 2BVOB 4F7MA 3WN5B 1KXQA 3BZ4A 1FL6B 5GSVB 4MD5A 5KVDL 2HMIC 3K6FA 5HVGB 1LEGA 2CBTA 3HI1A 1BV8A 4KO7A 4L3CB 4LLAA 1KZYA 3OLEA 4HEPG 1RZFH 1OARL 4AYID 2AK4B 4UTBH 3TIDA 4P5KA 2OL3H 4ZNCD 4N6RB 1NAKH 3MRQA 5E0FA 4DGYL 3AY2A 5JHLL 2C9UA 4KDWA 3D0AA 2CA4A 2VQ1B 3MBWA 5CP3A 5JHDB 1PG7H 2JKIS 3NCJL 4D8PA 1KCBA 1DYZA 2BSDA 1TQUA 1ZTXE 3QXDA 2LR4A 4PP2A 2IANA 4W4NA 3SDDB 3ZMNA 5C2BH 4JFUA 3TPUB 3ZE2F 1AD0A 2IEPA 1VZIA 2YOAA 3GNML 1FGVL 1BZ9B 2HH0H 2J8UE 3VFOA 5ADPL 1RK1B 2PWFA 4YXLH 4UDTA 1DCLA 1LEIB 4J2QA 1WAAA 3HE6B 2MCMA 5I19L 2RALA 1OP9A 1RHHB 1AR1C 1I9JH 4Z7VA 3EAKA 2WM0A 9CGTA 2FX8H 3J8F7 2XZCH 2CPCA 4ES9A 1EAPA 3W39A 1HHHA 3DX7A 4JFXB 3NIDB 4R90H 3FT9A 4W1TA 3RWCB 4K2UH 4QJ5B 4LSQH 1X3DA 4L2YA 2WWKO 5AUMB 3CZFB 4ABQA 1UT2A 1LP9B 5HHVL 1GGBH 5AVXB 1U4EA 4XP9H 3RTQC 3D06A 2GJ6E 3BVTA 3DGGB 4JN1H 3GSNA 1G4RA 4YH6A 3DGCR 1KC5L 3BZEA 2AXGA 3RI5F 3FFDA 3B6SB 3OJMB 2DWXA 5F1KC 3IJYA 4YSPA 5I6NA 2CJUL 3Q44A 1NGQH 1OHZA 4QAWA 1URLA 1Y6MR 3LX9A 2BOBB 2IGFL 3U4BL 1XCQB 2D7OA 1A4AA 3DUSB 2UZXA 3KGUA 5KYNA 5LVEA 3MRLA 1BAFH 5I1KH 3UGUA 4OH2A 3VG9C 1BEYL 4I0KA 1JNHB 2R2BA 3BE1H 2Y5QA 1AXSB 3HN3A 1JE6A 2Q86A 3FT4A 4TNEA 5JYLA 3ARDC 1J5DA 5JA9A 1INDH 3HBZA 2KYIA 3CQPA 3W0WA 1SJEB 2XZAL 2QPEB 3CTTA 1HAWA 4B9ZA 3NJGA 1VSCA 5IMKB 3ARBA 4ZW3A 4GRWF 5DRNA 3RYMA 3V5DB 5D71L 2V5SA 4NO0A 5EIQA 2J73A 3RNKB 2HTKD 3F5WA 3EUUA 1CI5A 2CO7B 2W5PA 4KJQD 4YHPB 2FWLB 4FXGC 4HSCX 4HWUA 4WCYL 5EUOF 5D7KD 3WJJC 5CINL 1K6QH 3ULVC 5EBMB 3MJ8A 4NUJB 1X7TA 2WTPA 4A1RA 5DGQA 1YEKL 2AXFA 3FQRB 3MR9B 4ZMPA 4Y4KB 5LGHL 1AH1A 2G2RB 2EH8H 1KOAA 3GB7A 3ECBA 4WUUA 5JORA 5KTEH 4FE9A 3MA7B 2DLTA 3GMPB 1IJNA 5D2LF 4AEFA 3KWTA 1WGOA 2L7UA 1QR4A 3RWHA 1DBJH 1XSKA 1U3JA 4PGCA 1KXVC 4ZMLA 3PGDA 3CLWA 5IVXB 2YLKA 3BT0A 1A5FL 3TIEA 4KZEH 2EDFA 2XXFA 3C6SA 5DD0H 4EUPH 5ICXA 2ZYRA 5K9OB 1LXMA 4AE1A 4S1SL 2CE6A 1P9MC 1DVZA 2CJSA 1T03H 4RRPG 1GS8A 3GZKA 4H0LC 1JHLL 4XBMA 5DWUH 4HS3B 4QO1A 1JD7A 1I8LA 3RVUD 3FRPA 3H2WA 3DTUB 2KLRA 5IJVB 4IRJC 3W5NA 2EDKA 4RAUA 5ESAB 2F15A 4DVBA 4BFIB 1HQ4A 1UCTA 3QHZH 3P9LA 3PHSA 1NKRA 3NVQA 3IRZA 3H9HA 5J4MA 4IQHA 4LLMA 3APNA 3SE8H 3V4VL 3ZX1A 5C09A 1D7FA 2B1AH 3GS4A 1TITA 2IPTL 4OJDH 1BQSA 4X8JA 5F9DC 1F6AA 3V7MA 1JF5A 4HLZG 3L9YA 5KYUA 1TETH 2XV0A 2EXTA 4QXUL 3V5HB 4EXPX 5A2IH 3VFGH 1BHGA 1KLGB 5JO5B 4OTXL 4AH2B 1G87A 3S9DB 5PAZA 4ALAH 5HJGA 4MDRA 4AKOA 3PF2A 3UBXB 1HC1A 5IFAH 4WNQB 2ZKHL 2FNBA 4PWGA 3SOTA 3WENA 1AGFB 4YWGH 2V37A 1P2CA 4TLTA 5EHFA 4BDVA 3PE9A 4WTXA 1JV5A 4J7RA 1JZFA 1H3WM 3A5VA 3BD3A 5IV2B 5EO9B 2V5YA 5D6CA 3H9SD 5IQ7L 3QWQB 3GK8H 2CK0L 1NAMB 5TQ0L 1ZK5A 2P48B 4F2MB 3QH3A 3HFMH 4CNIA 1C5CL 1T20A 4ZUTA 4M5YL 3GQFA 3N5AA 1K4DA 4DP6X 1O9ZA 5LG1A 1CB4A 3P0GB 1ND0B 1CBVH 4JFHD 4KHXH 4UV7H 1QA9A 5AAMC 3T0BA 3TT3L 5T1DL 5JPMA 3AG4B 1TCRB 3J27A 1QBAA 1BOGB 4NM8L 1BQHB 2EINB 2R1WB 2WQSA 3FW6A 1DDHB 4J3OC 1EJOH 2EDQA 4PG9A 4JQIH 3OWEA 1T3FB 2EJ1A 2AC0A 3WELA 4N5ED 5H2BB 2HN7A 5F89B 2ATPB 3GI9L 4FADA 4QHLB 2QQQA 3QIUC 1KBPA 4K15A 1KJ3H 1F4YL 1AGDB 1ZS2A 3P4NB 5EU6E 3FTGA 3OMAB 4HV8B 4G80A 3PJSA 1JYNA 3CUPA 3RUGF 3MLVL 2YIHA 5F6IC 4Z7UA 1C5DA 3K91A 2NY3B 3MV8D 4XMKH 3EGXA 1U8IB 1KJMA 2WXLA 5I28A 1T1ZB 2RMNA 5C0AE 3JSSA 5DYOB 4WI3A 3EJJX 1U33A 2HJKB 4U1HA 4NKMA 2IPKA 3ZUCA 2X28A 2FJUB 4O2FB 4BSVB 2YAPA 3QUXC 3FB8B 2HT3D 5ABAA 2FLRT 2JJWA 3TBVA 5AAPA 5BJTB 6PAZA 5FECB 2HKHH 3F12A 4U3SA 4BFBD 4JFDA 2X6AA 3GJEB 1KENL 4WJG3 4APQB 1JWUB 2ZCLH 3MRMA 2IG2H 1X6NA 4JUSA 3ZKMD 5KBDA 1S3KL 2ZUUA 3K2KA 2FECL 1MFCH 3EJZD 4AQEA 1AIFA 4WO4B 3GZPA 1FL3A 1Z3RA 4BSJA 3NRPA 4XMVA 1FZJA 5LB1A 1S7SA 2NYYD 3O3DA 4KV5F 1NMCB 3S2CA 1F8TL 5AB1A 3ENEA 3VWKC 4JKPH 1GGCH 1N68A 4IHBA 1YAZA 2YAEA 3UL4A 4PJ8C 4YSTA 1FSKB 4DZ8B 5F9WB 2WQWA 3CFMA 1FFPB 5FW6A 3L4TA 4BSWB 3PJLA 2VXUL 4L4JA 2XTJD 2Z4TA 3TIDB 4JFYB 4JZNA 3IFNL 5KYYB 4M7ZC 2I60H 5C08E 1U8KA 4S2SA 1THAA 4BH8A 3BGMB 3ULAB 3VXNB 3S2AA 5D1ZC 1ZIAA 4LIQL 3O0LA 5AOIA 3PGFL 1IUZA 3L16A 3L4XA 2E6PA 4Q89A 2WQUA 4C4KO 3II2A 4WU7A 4E5XA 3DUUB 1W8EA 3MV8A 4LEOB 2Y36H 3B37A 3X3GL 5IB2B 2IQAA 2FSDA 3F64A 3BVWA 1RUPL 3T2NH 2FX9L 4XNYH 43C9B 4O2EB 4XN5A 3FQ1A 4YO0B 4X6EB 4L0ZA 4U1LA 3BKMH 4DKAA 4E9QA 3R1GH 2UVEA 2OZ4L 4MMXB 2BVQA 3FULA 3DVNB 2J1YA 4L8SB 1S5HA 4X7TB 4Q8BA 1CXKA 1OF2A 3BSZA 5AOJA 2EEXA 2AS5M 2J8OA 1UACH 3QE5A 3VU1A 5L4FA 3DYPA 1YEEL 3DV4B 3NIFF 3ZTEA 2ZWNA 25C8H 1KPVB 4U6XB 1VKXB 3MMEA 1QMUA 5ISZA 1K4CA 3GSVB 2EYTB 4XVUC 3VVWA 4NO5A 4HHGA 4RMRA 4YBQD 5JR1H 2WXRA 4AKPA 3STZA 3EO1B 4NKIL 1A9EA 5JIIA 4OLZL 3WN6A 2VOTA 5IB5A 2NDFA 5TF1H 3QZLA 5FYKE 1T7ZA 2CDFA 3G5ZA 2CUMA 3ML8A 2F74A 3H1ZA 4GIOA 4OZHF 4PTTA 4HJGB 1N4XH 2GIYA 4G42B 4N9GB 1L5GA 1DBMH 3F7KA 4KQ4L 4G6ML 4CVWA 4L5FE 1OSPL 3HE7D 1GYVA 2FWOA 4YZFF 5FOBB 3O45B 1Q9KA 3WUWG 3HI6L 3QI9B 5AVQB 4OFDA 5IK3A 3LKNB 5JXED 2H9GB 3D4ZA 3DI3B 3P4MB 4U7SA 2F54D 2WN3A 1IZJA 4IIQA 4OI9A 4OR1A 3SE9H 1R47A 4MASA 4E42B 5AENA 3QT2A 4LDOB 3UAJC 3HZMB 3BP5A 3PL6C 1L9RA 2FJFA 4MAUH 5I5RA 5HYSA 1FVCB 1IFRA 1QAWA 2PYFB 3QQXA 2XG5A 3D18B 3UTTE 3PG2A 1JZGA 3RY4A 4D0BA 4N2BA 3ZQXA 3AQZA 4XP1H 4BBWA 4X5XA 2X7LA 4YPGA 1Q0YL 5FUCC 3S36H 5JLZB 4JJHA 4CA4A 3BKJH 4NT6A 2QDVA 5C1MB 1HKFA 2OMBA 4DGIH 4GUPB 5AW3B 5SV3A 2GABA 3HB3C 2NZ9C 1CT8A 4ZS7L 1D9KC 1RJYB 2NW2B 4NS0A 5CEXB 1E9PB 5MEPA 1RZKC 2CKBL 4M5SA 1MLBA 2N7AA 2V3FA 5IVZA 5C0EB 2DAVA 2XTLA 2J2ZB 5FDWA 3BYYA 1HZKA 4JRXB 3L1FA 3M6DA 3MX0B 4A55A 1I7TB 3UABA 2PTVA 4LQ1A 3U0PA 1BEXA 5BMFH 1LVEA 1DQDH 3U7YL 3GC3A 1R3HA 2WSPA 3D34A 3H85A 1KB5L 3VX0A 3HE7A 1JZ6A 5LNGA 2FLMA 3QXAB 4R4ND 1NCGA 5DEZA 3W3BA 3QJZA 3W82A 3E2HB 2WNWA 5JXEA 2XFGB 4FQPA 4B9IA 1ZRUA 2YRBA 1VEOA 1NBZA 1IEAB 1PZ5B 4F8OA 1QRNE 2JTYA 4WI5A 5K1NA 1JNNL 2AEWA 4OCWL 3UYRL 3F01A 3LRSA 3BEVA 4MS8C 2NNAB 3MJ7B 4PFEA 2PWDA 2DMHA 5HI3D 3LKRB 5EO1A 5IGXH 4GMTH 1Q8MA 3LQZB 4W6WB 3MCYA 5DEGB 2VR3A 3C5ZC 4D2NA 2DEYX 4KRPD 5I16A 1E0OB 2AW2A 4L4TB 4P5TC 1XCWA 4N8CH 2ICES 1ZT1A 4XI5D 5DJYA 3IE4A 1VA9A 4M4PA 1P6WA 5ID0A 4XCNB 5IFJA 4PQXA 5J0BA 5MEQA 3WNMA 4HAGA 5GSRB 1TNMA 4XAWL 3MZGB 2BNRD 4LHJB 3GUFA 1L4IA 2H6OA 4FQJH 3EBGA 3RNQB 5KZCD 2OL3B 3LXUX 4RBPK 2O5XH 5GS0C 3UROR 1QNIA 5CEYA 3MNVA 4UI2A 2E4TA 4XPHH 5BUGA 1UJ3A 4GKZB 3NPZB 2VXTH 3VSUA 1WICA 3GBNH 4Q2ZA 1MPAH 3FS9A 4RWYL 5CJOL 3KGRA 4G43B 1A0QH 4LHUG 3SGDI 3T0VA 2FBJH 2H2SC 2YA0A 1NBVL 4MKMA 2ZAHA 4QOKE 1SHXA 2DMCA 4FA7B 1HESA 1BVKA 2CO6B 2DD8L 2P45B 2BW5A 2NR6C 3MRKA 5I66B 5CFAA 4YS4A 1JSYA 2IO5A 4KK5D 3ETTA 1QSEB 2P5EE 3C8DA 3MZTA 3AMKA 4Z76B 3PNRB 3BZFA 2YD1A 4PGDA 5HGHB 2PPDA 4EI6A 2NQDA 2ENJA 5CBAB 3KVQA 4AYDC 3B7TA 2V2XB 4Y2DB 2XKSA 2VNCA 4U1NA 4MCNA 3VI4E 4U0QB 4Z5RA 1IBGH 4OKVA 3WI9A 2EUZA 2NW3B 3TJEL 4PJ6A 4PJ7B 5IREA 1G6RA 2CUIA 3FZUC 3QFGA 5IROD 4HISA 4OSUH 4WDIA 5ALCH 4KUZL 1KNOA 4OFIA 3BQUC 3EBIA 5E2JA 1TU2B 5FYJH 4W9DC 4HLEA 4HK0B 1Y18A 2VR7A 5CSZB 5HGDB 3RVXD 1IGYA 4CN1A 2C9VA 2XG4B 3ULSA 3LJ3A 2BNRA 3S35X 3VXUE 2MJWA 3HHSB 4U0RB 5C0FA 3RVWC 3TFKD 4JG0L 4ONFL 4E0RA 2JCCA 3DMMC 1VCAA 3Q2CA 4UTCA 3IFOA 1NOAA 1AS7A 2TRHA 3WXWH 1W6WA 5D2NE 2E5EA 4KO5A 5GRZA 5LXVA 1S7VA 1H3UA 3KPRB 4X99B 3C60B 3I02B 2ZSWB 4WHYH 3QNXB 4AVKA 2PLTA 1KFAL 2OMXB 3MLTB 3DX4A 2WZPA 4XN1A 2GCYB 5TE7L 2J44A 1RIUH 1MY7A 1SXBA 4RIRB 4H8VA 1Q94B 1OB0A 2HTLD 1G9NH 2XV2A 3AXHA 3UZEC 3DROB 3OX8A 4RFEA 4ABVA 5IW1B 2YPVH 4HGWA 2EIJB 2J57A 3CDYA 4WK2B 5EU5A 5IJCC 4P2OB 4PJ5E 4HUWA 3BAYA 4XOBA 2P43B 1FC1A 4F37K 3W9EA 3Q8CA 4QXTB 4Y4HD 2ZOOA 5E5RB 3I9AA 1NFKA 1C12A 3DPBB 1MCOH 3ZOAA 3QB7C 4NRYA 1FF5A 4X6CF 4LLDA 3UTSD 5IROA 1U8QB 5LBSL 2B14A 1CF8H 2A73B 2WKOA 3AT8A 3EJTA 1AD9B 1I1AB 5ABZA 5IMOA 4LRNH 3T0EC 1GJIA 4HWNA 3IFLL 2VTFA 2VW4A 3RX9A 4FFVC 4NQUA 2E8YA 5T5FA 5DTFA 3R06A 3A23A 1T0MB 1INEL 2NNXA 2VLRA 3A21A 2GB2A 5C3LD 3FFCB 3QEGL 4WW2B 5KW9H 2HCZX 4KJWD 4MJIA 1S9WB 2BM3A 2GY5A 3FO0H 1SQ2N 4L8DA 2I7OA 3D2TA 3VWJD 5I0XA 3IS1X 4L3AA 3W2DH 5IQMA 2LU4A 3HI5L 3IJSB 4HCFA 4PRDB 3SDYL 2JKNA 1FNSL 3B83A 1QP1A 1PD6A 3UZVA 4ELMB 3D87B 1MCJA 1G9MC 2KZBA 3MRIA 4G7SB 1O5DT 1NCWL 4TSCL 5FV1L 2DQIH 3KLHD 2LW3A 2FCBA 2HLAB 3GSRA 3VXSA 2R1XA 3RIFF 1SZNA 1OB1A 1OXYA 5FK9A 1PPIA 1G7HB 2N59A 4XXCA 2ALWA 4K8RH 3V0VA 4KU1A 3BO8B 4Y19A 2HFEA 4FQQB 3JT2A 4I7ZC 2MQ0A 3HG1E 3DDGA 4KQ3L 4MB5A 4FI7A 2Q7YA 5EU4B 3C2AH 3ZKQD 4AXWB 5KSBE 3ARXA 3KBEA 3LH2L 1U3HB 3QUMH 3F7VB 4WSJA 1H3PL 4P9ML 4NXSA 4QT5A 2HLFD 2BRRH 4NM4L 3QPQC 3VYOA 1DO6A 5DJ0A 2BNQE 3U4EB 5LHDA 2PCPA 2FK9A 4Y4HA 3F8UB 3LH8A 3LN4A 2EIKB 4OZIB 1R5WA 2NY5L 4G1EA 4MRBA 1IE4A 3QIWC 4OZGE 4B97A 1I1YB 3AACA 4N25A 2Y9RT 5BVPL 4R4FH 4JE4B 1F00I 4MXWH 4JREC 4QJ3B 3CXDH 4CMHB 4XCFL 5JW5A 4KDTA 3K6IA 4JFEE 4NWTL 4OVUA 3RI5K 3SQOH 1AQDB 2NNCA 3NGBC 1HFUA 1VGEH 3QO1A 2AJSH 4LHQB 4GAJH 3ZRCC 1OAXH 2OSYA 4GINA 2DQHH 3CX2A 4PHXA 1KIPB 2RFXB 1J9CT 4A2FA 4ZQKB 3EFDL 3QUZC 5ABDE 1U8OA 3VWJA 4AJ0A 3Q43A 3ZL2A 2CHDA 3RB7A 2CR0A 2OK0H 4S0HA 1BZOA 3QORB 4FKEA 1QYGL 3AQDA 5JUEH 2J1XA 4K9EH 4EDXB 4HGMA 4O5LL 5IQ9B 1TPXC 3WNLA 1EIBA 2XFXA 3JV4B 4YX2H 4IRZA 5JTWA 4MZIA 4JKKA 4XXDA 5EU3B 4LRIA 5BZWA 3CDGB 4QRPE 3OR7B 1ZKAA 3EOTH 3DYMA 3NRQA 3FAWA 3D12B 4Q9RH 1IC7H 1J0YA 4ILDA 3EJYD 5LGKA 5BW7A 1MCPL 4Y0GA 3MLXL 4LF3A 4UMGA 3BKCL 3DGDA 2AJ3A 2WXOA 4OT1L 4UU9A 3T77A 3S37H 4Z7UF 1TMCB 2MRYA 4ZAKB 5I1CH 1HIML 4ZD3H 2VMCA 3ZRFC 5IJBC 4LL9A 1OQOA 1BX2B 2WUCL 2F1AA 4FZ8L 1KCVL 1R46A 3TV8A 1OLZA 1KBVA 4GT7A 2NY6D 1DFBH 5E08L 1CDUA 1UGNA 2CRMA 5CU5A 3MCKA 3HPLA 5CBEA 2LOEA 2VCOA 2Y06L 1FAIL 2ZUQC 3QRFM 3ZU8A 4H1LA 3EH1A 1VAHA 5L9DL 2WQ8A 2YWZA 1FPTH 2MOVA 3ZZSA 2DL2A 1P4BH 2QQLL 2Z9TA 4UQ2A 2D3NA 4K23H 4RDBA 5BRQA 4FP8L 5B4MC 4NDMA 5JIDA 4PB0H 1R5IA 2FR4B 4LCWB 1NC4B 4OM1L 2NY7L 3L1OH 2M2DA 4JM2D 1HSAB 4DO5A 1ACYL 3RZWA 3MJ9A 5LLIC 5CWSA 5FKPB 4Z78A 1UM4L 2X4OA 3ESPA 3EDJA 1IAIL 2IWGA 4KROC 5B1JA 4DEPC 4HPYL 2A9DA 1Q9OA 1KGCE 3SD2A 4YBLB 4HIEB 2OTWB 4KJPD 3TPKA 1AHWA 3INOA 1N12A 2AEPL 3GEFA 2OI9C 3PHOB 3IETB 5E8DL 3ULVE 4WWKA 1IRAY 1XGTB 5DK0A 2HJLB 4LFHG 5KYXA 2GHWB 1T4KA 4ZXBB 3MV9E 1Q0XL 5CU9A 1VGKA 1JZ7A 3FJTA 1IAKB 4XPAL 1T0NA 1MXDA 4XPBH 2R27A 3QG6A 1PTZA 4HBCL 4HMDA 1SVBA 1ZHBA 5KUKA 4IJ3C 4M1GL 1W15A 4HG4K 3SDCD 2X40A 3U2SA 3CHRA 1G9EA 3VACA 4L23A 4PRPA 4AW7A 1YA5A 4JHWH 4FA6A 5CEZE 4F15B 4G6FB 4Y5YA 4GAGH 5DLLA 4KQ0A 3S0PA 2B20A 1QVOA 4RGNE 2W80C 2IWKA 4YL9A 3ZZ1A 1NLDH 5KS9A 2BMKB 4TULH 1HYRC 2YAFA 4NJ9H 3MJ9L 4LLQA 5CKAA 3LZFL 3ESNA 5DMGD 3CIAA 1PZCA 5E6YA 5AVRB 3QFDA 4FXKA 2I07A 4NEHB 2AJXL 4MA7H 1OD7A 3OJDA 2B59B 1FP5A 3G6JF 1I7ZB 2CXGA 1DEDA 2ZG3A 5FO7B 1E8ZA 5IR1B 3KYOB 3UYOD 1ZTXL 4E9TA 4NO2A 1G5GA 2A83B 4M6MH 3GSOA 3SKMA 4KKPA 4GG6E 4K7PX 4ODUA 5CCKH 3FUNA 1XX9C 1Z2KA 2A6IA 3HUJE 3C8KB 5IB3A 4X0KA 1SDAB 1WPCA 3VJ6A 5HPMB 3QUYD 4LP5A 5D7IA 1YZZA 3E1ZA 3LHAA 2OMZB 4D0DA 1QLRB 1U9KA 1CE1L 2X88A 1JAEA 2DDQH 2XKUA 3P9MA 4L37A 5INCB 3WFHB 3WAJA 3JTTA 5CCHE 2CALA 5IEHB 3WY2A 4KZDH 1G9HA 3HA0A 3OTTA 3TJHD 4F5CE 1SYVA 2ADIB 3GHEL 4GMSL 4XN7A 2DV6A 5HHPB 1QSZA 5C3IA 5EEWA 2AERT 3HC2A 4M4RA 5JW3H 3D0LA 5GIRB 4X8CA 1DJXA 4WHCA 2AK1L 1IM3D 3D05A 1J5OH 4UNUA 3UO1H 4APXB 1CFQB 1ZWIA 3IJ8A 4AQ1B 5EDXA 5GS1A 1VEPA 3L3OC 2J43A 3PU7A 2NXZB 1XQ4A 2EIMB 3W11C 3KWUA 4BZ1H 3L3IB 3F2LA 4Q9QH 3K7UA 4ZPTB 3H8NA 2V2WB 5JOPE 3ARWA 1VB9A 1J9SA 5FA4B 1KCSL 3CLEL 2EDOA 2G4EA 2GY7B 4PCYA 1RSYA 5AFAA 5JOFA 2H6PB 3QYNA 2QSTA 3A4AA 4UMSA 1RJZB 4AG4H 1BG1A 5T1KD 1E50A 2VRAA 4L1LA 4P4KB 2XY1A 3KEHA 4F2FA 1T21A 3DXAB 3U30B 3NFNA 3IDIA 3ARFC 3WIFB 2W0PA 3FB5A 3JYCA 3VCLA 3SCMD 3FTYA 3QUKA 1OOWA 3FQUB 2GTWB 1NCHA 4BXVA 3LXBA 2BOCB 3MNWB 3FT1A 1I8IB 2I7SA 2X4RB 3SYQA 3ZIMA 4X5LA 4PWHA 5LDSA 2W65A 1BZDA 1HNYA 1BZQK 2IC2A 4D0CB 1XV8A 2Z1PA 3TZVC 3N41B 1NFIB 1ZD6A 3P0YH 5F96L 1A6VL 3NN8A 1V8HA 2BVPB 1WBXA 4GW1A 3IF1A 1B2WL 5TFSH 1CG9A 3JV5A 3G08B 4PY8J 5FDYA 3VXME 1TQSA 1H6TA 2DMBA 3OR6B 2E7LA 4HT1H 5EU6D 2CRZA 1TZHA 4I2XA 1MIEH 4MTMA 3MRFA 5HDQH 4XPFH 3MRBB 1IM3A 4G8AC 2XN2A 1CE6B 4RAHA 5FAAA 2W9DL 3SBWC 3MV7A 4WK0B 3RJOA 4M93B 1YN6B 2K9UA 5C0AD 2BY1A 4GKOA 2J6EL 5TF0A 3V6ZB 5C0BB 1XXDC 3QG7L 1NFDB 4CGUB 2WCGA 3K1DA 3RGVA 4NFCA 2GK0B 1OE1A 3EBAA 1DZBA 4KXCA 1E4XH 2Z1KA 4HEPA 4W6XB 5T1KA 2DM7A 1DSYA 1BXUA 4O00A 3DTXA 3SDXB 2ATKA 1JPGB 5K39B 1K85A 4NZUL 5FM5O 32C2A 1EBPA 1FNGB 1FQ9C 1M1XA 1QW8A 2APXA 2HA1A 5ALBL 3KR3L 3VXRE 5AB9A 1PDKA 4XVJH 1NA8A 2KH2B 2WP3T 4ONGH 4PJEE 4XB8A 1N59A 3CZGA 1LD9A 3SGKC 3SPIA 2O6DA 1NM4A 4OY9A 3OB0K 3TURA 2ZXGA 5KVDH 5C97A 2FEEI 2YBRB 5CZXC 5LNEA 1VADB 1BLIA 5DS8B 1WRFA 4TVPE 4AL8L 4HDIB 5T5NF 3C6LB 5C08D 5KVEE 1KTKE 5IT2L 5DJXB 1Z7JA 3HC0A 2QKIA 4PJFE 5BS0B 4BD4A 2VAAB 2OTUA 2BIIA 3ECWA 5A2JH 1KIQA 4N68A 4HIXL 5JHLH 3WHXA 4OUUA 2CCVA 1AZRA 3EJUA 4YEEA 3ME0B 5J6GA 2YFNA 4LLYA 4UB0L 3VGFA 4RMSA 1NGZB 4LP8A 4M1CD 4BGLA 1UOWA 3QZBA 1KN4L 3Q2VA 1NCCL 3W37A 1J0KA 3IXTA 1FZKB 3ZL4H 3MJGX 2NY1B 1PKQA 3P30L 5E6IA 3T0DA 2QVTA 5MI0B 5BV7L 4JLRA 2VMEA 4YR6B 1T0OA 2A9ML 5I19H 1HXYB 3JWOC 4M6AA 4WWID 1QFOA 3RWIA 1NZRA 2GJZA 3PAYA 2PTTA 4XNXL 2BSSA 4IRSB 3LZOA 4MXVE 4MNQB 4P23B 4WQOA 1L9PA 5DHMC 2Y7NA 3TESA 1SMDA 2XN9B 1G84A 3BFWA 2OULB 5DRXB 2ZCZA 4TLUA 2ITCB 4K7PL 2IH8A 1PD0A 1I1CA 1H0DB 5HDBF 3LKOB 1WFOA 4RRPM 4Y2NA 2OX5B 4L4VB 1ZVNA 2RA1A 3HRPA 3V8OA 3HNSL 4HG4J 1MCHA 1TVBB 2FX7L 3GZOA 3B9KB 3FT2A 4PRIB 5FYKD 1MAKA 3U36A 4YMPA 4KY2A 1WA0X 5I1AA 4KNUA 3BW9B 3CFKB 1OSYA 3U79A 3MFFB 3ZE2B 2PKDA 1AACA 1KYDA 2GHZA 4HZ1A 5CMAA 1P7QB 1OSZA 4LEEA 1PX4A 4MCZB 5IB4B 4AVHA 4QXVA 2CJUH 5CP3H 4L1SA 4JHBA 2IGFH 3PV7A 2VDKB 5IBLD 2IALB 3T2QA 3KMDA 4DEUA 5FUCE 1UC6A 5SWZB 1DJYA 4FQXD 3MUHL 4A2HA 4LQFL 1UXLA 5CIPA 1S9XB 3VQLA 1PLCA 3JWDL 2EABA 4HPOH 5M7QA 5C07E 1F4HA 4N0FB 2JB5L 1YEHH 4M7JL 1CR9L 4GSUA 5ACLA 4A04A 2XZAH 3IMSA 2GTZB 3GYRA 1EXHA 1ETJA 4EMZA 3UTTD 3BN9C 3PXHA 5JZ7C 1EMTL 5F7DB 5FO9A 2HFFA 2XIDA 1ADQH 4DUXA 3OXRB 4XTRD 1F3JA 3L3DB 3L9RB 4XVOA 5G5DB 5D71H 3WTTA 1T83C 4PJBE 5TGBB 2R7EB 1ZLWK 3SKJL 3X12A 4MMZA 4G9FB 1GSKA 2I9LA 1OM9A 4MYWB 4AM0A 1LWRA 3KHOA 1JCVA 1GCYA 5CINH 2XJKA 1U8MA 4RRPA 5AW0B 2H3NB 1YEKH 1USZA 2XVKA 3OMZA 5LGHH 4TSBH 1WLHA 3GSNH 3N44B 4OGAC 2D03H 4UTAH 1JDDA 5CGTA 2QV2A 4ISVB 4B41A 4ZNEA 3MRRA 3QW9A 1DUZB 2X4UB 3QZWB 5B21A 4N0CC 3HPJB 4JG1L 3RIAF 3EFFB 4XVSH 1OVZA 3FOMB 2X2HA 3D3VB 2YPKB 1KTBA 2FIKB 3ZW3A 3AGWA 4KZEL 4CU6A 3IU4H 1FC2D 4JZOB 1BW8A 1ROWA 2BPBA 5B38B 3Q1SL 4LL1A 4YDLC 3U9WA 4MD4B 4BH7B 3L9BA 1U41A 5AKVA 3NDYE 4DAGH 1QRND 5EUOB 3KPSE 1V05A 3ARED 3GHBH 4G3YL 4BHUI 2BK8A 1ZLEA 2EKSA 3FCTB 1QLFB 3IDYB 4GRLD 2AXWA 4IHOA 4NZRL 4EAE