2G2QA

The crystal structure of g4, the poxviral disulfide oxidoreductase essential for cytoplasmic disulfide bond formation
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
115
Chain Sequence
MKNVLIIFGKPYCSICENVSDAVEELKSEYDILHVDILSFFLKDGDSSMRGTLIGNFAAHLSNYIVSIFKYNPQTKQMAFVDINKSLDFTKTDKSLVNLEILKSEIEKATYGVWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin-2
publication title The structure of G4, the poxvirus disulfide oxidoreductase essential for virus maturation and infectivity.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Oxidoreductase
total genus 28
structure length 115
sequence length 120
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05768 DUF836 Glutaredoxin-like domain (DUF836)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2g2qA01
2X8GA 2R5GA 2NBSA 2PMTA 3WGEA 2I81A 4O5RA 4IN0A 3GH9A 4MPGA 3NZNA 2CVKA 5F8BA 1PMTA 5ECNB 3I69A 6GSWA 5A4UA 4TR1A 1GSYA 5F0GA 4HS1A 2L4QA 3N5OA 1QQ2A 2YJHA 3PGTA 2VM2A 1SD8A 5KN1A 1XW6A 1BYEA 3ME8A 2CX4A 4RUVA 1Q4JA 4TOPA 4BWSA 1LJRA 1GTIA 1ERTA 3HDCA 4KB3A 1TJDA 3TRPA 4POMA 7GSSA 4HQSA 2CZ3A 1Z6NA 1TRWA 1EP8A 1EGRA 3CYNA 5JWRB 5D9TA 2B5XA 5CNWA 2AHEA 3FY7A 3VI7A 4K0GA 4MJAA 1S3DA 2HZEB 2VL2C 1T4ZA 3QAWA 1JLWA 3F8UA 1ERWA 1JZDA 1K3YA 2CAQA 4PUFC 1O73A 4ILFA 2JADA 2LTKA 3LXTA 1V40A 1R5PA 2LV3A 5CYYA 3KH9A 4MZCA 4OFMA 1JZWA 4MDCA 2A2RA 6GSVA 5ABRA 3EINA 3VI5A 4MH2A 3TOUA 2EC4A 3ZFLA 3ZMLA 1M2DA 1PQNA 1FOVA 1ZYQB 3WT1A 4Q5RA 4MF5A 4JU5A 2MBSA 1X9MB 3HVSA 4XS4B 1VGLA 2P0GA 2AV4A 3SWLA 22GSA 4GSSA 5G5FA 5ID2A 5G30A 2WGRA 2K18A 2PVQA 3GV1A 4IJ3A 1EOGA 4FO5A 4MJCA 2WRTA 2WS2A 2FLSA 1X9WB 1A8LA 1A8YA 3KMNA 3FZ4A 2VL3A 3P7XA 4KSMA 3HKRA 3DIEA 3TKSE 2L5LA 1RQMA 3MDKA 5D9XA 3C1RA 3TKQA 1YQ1A 2LSTA 2A2SA 3CXGA 2H74A 2VLVA 1WIKA 3DYRA 1M2AA 4ZBAA 3J7Yk 4QL7A 3FW2A 5G2ZA 5J5NA 1PSQA 1Z7RA 2WJUA 1FVJA 3GKNA 3QMXA 4GSNA 4ML6A 1MDJA 3WGXA 1WPIA 1V9WA 1SJIA 4CW9A 3D22A 1S3CA 1K0BA 4K0NA 2GTUA 2HRFA 5DCHA 1AAZA 1NHOA 4GXZA 2YWOA 2FHEA 1OC8A 1IYHA 5HR0A 3EURA 4LL4B 1V2AA 3C8EA 3US3A 5COHA 4JBBA 1ST9A 5ECLB 4HQZA 4KA0A 1VRSD 2MMOA 3L9VA 3QCPA 4RI6A 5FWGA 1FG4A 1GLPA 3HY2A 1TK0B 1QGVA 3TJJA 4BVYA 2V41A 1TRUA 1B9XC 1EEMA 2FGXA 3FR3A 2GT6A 3HJMA 1WP0A 1GWCA 2GVPA 1T7PB 1K0AA 4EDZA 4IELA 4X0XA 2L6CA 4RQXA 3FK8A 4N11A 5E4WA 3QFAC 1WWJA 4AGSA 2X8CA 1GNEA 4MP4A 3W8SA 3CRTA 4MMMA 5JCGA 5F07A 5FT3A 4N30A 2D2ZA 2VCQA 2IWTA 3LWAA 5H5RA 1XVQA 4TW5A 4J2FA 5C00A 2PUKC 5J9CA 5DALA 3VLNA 1Z9HA 2LNSA 3IA1A 4K7IA 4L8EA 1IYIA 4WBJA 2H0IA 3W6GA 2VO4A 2IFQA 2KP2A 1HNCA 1EWXA 4MCUA 3EMXA 2F9SA 1XXUA 5EVOA 3ZLPA 4D73A 2GSSA 5HFKA 1M2BA 4I8BA 1F9MA 4OFNA 1Z3EA 4PNGA 3F6DA 3E0UA 4EF0A 2PBJA 1DUGA 3GHAA 4GQFA 1SD9A 2XPDA 3ZZXA 2FUG2 4OWYA 4GRFA 2H1AA 4I97A 4V1Ag 2OKAA 5ECHB 4Q5FA 3LEFA 3FZ5A 2AJQB 4Z7XA 2XC2A 5DQSA 1OVNA 1K3LA 1A24A 1M99A 2OE1A 1UN2A 3EC3A 2ES7A 1G0TA 4PGTA 4ACSA 5ID2B 1UVZA 5D9VA 4IBPA 3DWVA 2H0HA 3IOSA 2AYTA 2P5QA 3LYPA 1OC9A 3NIVA 1TU7A 3PINA 5CRGA 2L57A 1MEKA 4L0WA 2F8FA 5ELAA 2G0FA 3QAGA 3RBTA 4ULXA 2QC7A 3KXOA 4GSTA 4EVMA 1TI3A 4GLTA 4HUAA 1TDIA 3QFBC 4L0UA 5H5SA 4G19A 3ERFA 1O6JA 4Q5NA 3U6VA 3H1NA 3F4RA 2EIQA 2C0EA 2HE3A 1FAAA 2H72A 2VD1A 4ISDA 3RPNA 3H8QA 4NV2A 4RI7A 1O85A 3MSZA 2NPBA 3DXBA 1MD3A 5B6MA 4FYUA 2DMMA 2VCTA 2YWMA 1SYRA 2N5AA 1YKCA 3VURA 2DC5A 2PPTA 5IOWA 2FD3A 4HZ4A 5GZZB 1YDKA 4EC0A 1WOUA 1PRXA 3FZ9A 2IMEA 3HYPA 3DKSA 1G6WA 4MZBA 4K9ZA 4N0ZA 3VWUA 3HA9A 2ZNMA 5G5EA 2JACA 1XPVA 1A23A 2I3YA 2H6YA 2I1UA 1FB0A 3IK7A 3HJOA 1SK1A 1T3BA 2YP6A 3LORA 3ZL5A 2L4CA 4TRXA 5IOXA 2O87A 1PL2A 1XOAA 2XBQA 3GYKA 5B8BA 5ECMB 1VF1A 1PX6A 2B1KA 3KZQA 3PR8A 1GUMA 5CRWA 4KDXA 5DALB 1PA3A 4K6XA 3TKPA 4IVFA 3DGQA 2LQQA 2IFQB 2CQ9A 3KTBA 2JSZA 2RM6A 3UAPA 2TRCP 3TJKA 2DIZA 3TUEA 2N5FA 2H19A 5EPFA 4PQHA 2RUEA 1W4VA 4HZ2A 1WJKA 1BAYA 2XPEA 3QAVA 2O85A 3RHCA 4D73B 4N0VA 1OKTA 4KE3A 4MABA 2F3MA 1YF0A 1GTAA 5AIXA 1Q98A 2VUPA 3IAM2 1WMJA 1F3AA 2IMFA 2YV7A 4J56E 2WFCA 3BCKA 1I5GA 2C3QA 2GQLA 2VL9A 1A0FA 1ON4A 14GSA 2H8LA 1WE0A 3ZREA 5IMAA 4XHMA 1O81A 3H4KA 4ZXGA 1J08A 3BOAA 2XBIA 1BQ7A 3HCZA 2HI7A 3EU4A 1XFLA 5ECSA 5HFIA 3KP8A 2C80A 5DQYA 1OC9B 3FHKA 4KNDA 2PWJA 3TOTA 3CTFA 2V6KA 4DSQA 4K7OA 3F9UA 2GZYA 2C4JA 3P2AA 2ZUPA 5H5QA 2FCHA 3ISOA 1HQOA 1PKWA 4HEA2 5GAND 5D93A 4NMUA 3IBHA 1XW5A 1NM3A 4MJEA 20GSA 2JSYA 4JEDA 2R6KA 1EZKA 2IJYA 1QFNA 1VF3A 3UJ1A 2VOCA 4JR6A 1KTEA 1J9BA 2K6VA 3E9JB 2O89A 3MNGA 5A4VA 1DE1A 2B7JA 4KCAA 4KW6A 3FR6A 3M1GA 4OFTA 2FNOA 1SKRB 2BTOT 1U87A 3F0IA 2V6OA 1TKDB 1NSWA 4ZL9A 5GAPD 5G31A 4FIWA 3D5JA 4LLRA 3LGCA 5EY6A 4L5LA 1ZYEA 2C8UA 1LU4A 2VM1A 3HZ8A 2GDRA 3TDGA 3S9FA 1DE2A 1XWGA 2YANA 2R37A 2GQKA 2B3SA 2IPAA 5ELGA 4AJ7A 1M9AA 3CSHA 1EV9A 1K0NA 4N10A 1B48A 2IMIA 4H86A 2RIIA 5J4UA 4FYBA 1M9BA 1MD4A 1X5DA 3QD9A 4PXOA 5AN1A 1SU9A 4WEYA 4WR4A 1TXXA 3RHBA 4F03A 4XRAA 2ZCTA 11GSA 1M7TA 4I2TA 4IW9A 2RLIA 4TKYA 1MTCA 3APSA 3IPZA 3KMOA 5ENUA 2K8VA 4YAVA 1U6TA 3ZFBA 3WGDA 2MBTA 2Z9SA 2B7KA 3BCIA 4K1FA 3IRAA 2B5YA 4KDUA 2DSAA 2DIYA 3HD5A 2PGTA 1GTBA 4ZL8A 2F51A 4NWYA 1O8XA 5B8AA 4KSOA 1N2AA 2FY6A 1JFUA 3GL5A 1GSSA 2YJ7A 2CAIA 1ZMAA 3FKFA 4HU9A 2WDUA 2E2MA 2M80A 3A5WA 2FA4A 1H75A 4F9ZA 1TOFA 2IN3A 2MZCA 2ON7A 5EL8A 2F8AA 5KN3A 4PQ1A 4OCFA 2IL3A 4WETA 4TR1B 3WT2A 3TKSA 4ZIJA 2L5OA 3IK9A 2YZUA 3UIWA 2O7KA 5IMCA 2HRNA 6GSYA 2ALBA 3FZAA 1YKAA 4TXVA 1ACVA 4QQ7A 4NHWA 2CA8A 2LKUA 2YOIA 5GSSA 2CVBA 2RUFA 3A2WA 2LS5A 3ZVJA 4GWRA 1TU8A 19GSA 3GUSA 3WYWA 1TP9A 2OE3A 3UMAA 2I9HA 4ECJA 1EP7A 3QPMA 3VPQA 1THXA 3FRCA 3M0FA 1RW1A 1BX9A 2H71A 1UA5A 1HD2A 3CMIA 3J7Yb 1T4YA 4F2IA 2KOKA 2L6DA 3GSSA 2LRTA 3APOA 2IMKA 3KIJA 5CAXA 4POBA 1XCCA 1V98A 3DD3A 4DVCA 3BD2A 2LRCA 2DJ1A 2MMNA 1JHBA 2L59A 3M8NA 1R7HA 1T00A 3IXRA 3D0ZA 4OMVA 2LJRA 2H1DA 4L5OA 1XIYA 2H0GA 4ID0A 2MMAA 3KTLA 1TI1A 4IP6A 3KP9A 1T8EB 2JZRA 4X43A 3IR4A 1XWKA 1XWBA 1NW2A 3LSZA 4DSSA 1H4OA 2LRNA 3TRXA 5D73A 6GSXA 4I6XA 1R5AA 3MWHA 1ERVA 1Z6MA 1E6BA 4TR4A 1PKZA 1B4PA 4LMWA 2YWNA 3Q18A 2J23A 1AIUA 4G9HA 1J0FA 1AXDA 1SL2B 3GFKA 4KAEA 3FR9A 2VCXA 2YWIA 5AIVA 2C0DA 1X9SB 4HJ2A 1XZOA 2WULA 3Q6OA 3VWVA 2V1MA 2N5BA 3IC4A 3ZRDA 5D9WA 2NTOA 1OKDA 4ZILA 2R4VA 4CHSA 5CRHA 5IMZA 1WRYA 1SENA 2AUVA 3G7JA 3Q19A 10GSA 2GT5A 1HNAA 5J3RA 2FWGA 1SK2A 1M0UA 4EKZA 1B8XA 2CT6A 3KH7A 1QMVA 1OE8A 5CO3A 5HR3A 2DLXA 2H6ZA 1YZXA 3ERWA 1BEDA 5HR1A 2GZZA 1U3AA 4IHUA 3OR5A 4TR0A 5IQYA 2FWFA 3UBKA 4ZB6A 3EE2A 1AQXA 4IKHA 3GMFA 2C3NA 3RDWA 2P5RA 1EEJA 1G6YA 2C1YA 4MZWA 4E8EA 3L9SA 1FO5A 2P31A 1E2YA 1SL0B 1SKWB 2CZ2A 1GSEA 4JZQA 3HZ4A 4GTUA 1O7UA 4ECBA 4NPBA 3GRXA 2HNLA 2G2QA 3KD0A 4G10A 4OD7A 4WR5A 4ZBDA 2YN1A 4MF7A 1CQGA 3VWXA 4O92A 2GLRA 4K7NA 4MLYA 13GSA 1Z5YE 5GSTA 1R4WA 4EXJA 2VD0A 3GL3A 1F37A 5CREA 4BA7A 2EIRA 3RAZA 9GSSA 4Q5QA 3VWWA 1W89A 3LG6A 1NHYA 3O3TA 2DMLA 2C0FA 5ECRB 3QOUA 4TN8A 2HFDA 4ZBBA 2DJ2A 3D4MA 4YQMA 1A2MA 1XBSA 3F3QA 4OO5A 1SL1B 3F4SA 5IMDA 3A2XA 5DJMA 3GNJA 3UARA 1ZZYA 1X0RA 3DEXA 2H01A 2VCWA 2WZ9A 3GKMA 3U5RE 1N8JA 4PQIA 4KX4A 1PX7A 3RPPA 2V32A 4P3YB 3GURA 2GZPA 4WXTA 1FVKA 3L4NA 1AQWA 1OYJA 4YH2A 4HJMA 3ME7A 1V57A 4JR4A 4ECIA 3G7YA 5A5KA 3F3RA 2YPMA 1VF4A 1B9YC 1YY7A 2DJKA 4MJBA 1G7OA 4POLA 1ERUA 3H93A 1TTZA 3M9KA 2REMA 5AISA 3KJYA 4HOJA 1QK8A 4TXOA 1TRVA 4OCEA 2GSRA 1GNWA 2WB9A 2X8HA 4DSSB 2E0QA 4V2LA 3D4TA 4WF4A 2H6XA 2HZFA 4XS1A 2JZSA 2BMXA 3E3EA 5J41A 3NOFA 4WKWA 2YZHA 1YEPA 2VAFA 3LQ7A 5ECOB 4F0CA 4BVXA 4ZB9A 3M3MA 4PX1A 1QXHA 2PVOC 4MPFA 2XHFA 2VIMA 3I9V2 5IMVA 1GUHA 5G1LA 2KP1A 1AQVA 3BJ5A 1V58A 1XWCA 4X1UA 3KM6A 4BPYA 3CSIA 3ZTLA 1OE7A 5IO0A 3GN3A 5B6NA 4ECCA 4IJIA 2RM5A 1DBYA 1U3IA 3GIXA 4HI7A 5JWOB 4K8MA 2JZTA 3F4TA 2GGTA 3G7IA 2M72A 5KEJA 5D96A 4JRRA 3AY8A 3MAKA 3IDVA 4EE0A 2YNXA 3W8JA 1SYXA 3BBYA 1Z7PA 4NHZA 1JZRA 4LL1B 5CRDA 2AB6A 3EMPA 3ED3A 1FW1A 4HU7A 3IAS2 5E59A 3I6AA 5IPHA 4NV5A 1K0DA 1Y6EA 16GSA 1A0RP 3DRNA 3HXSA 2PU9C 3TJGA 3G9BA 3M9JA 2MYGA 3EWLA 1ZOFA 2A4VA 3TKSC 3IV4A 3IHQA 3TCOA 4KDYA 5JWQB 1XW9A 2ON5A 2X64A 4F0BA 1XWAA 4TVEA 5ECPB 3O6TA 2R3XA 2YCDA 2QGVA 2GS3A 3KEBA 2HT9A 1B4QA 2LJKA 4ML1A 3LYKA 4O7HA 5DAKA 2H73A 5LD0A 1KBNA 1F3BA 1OC3A 5LCZA 4IQAA 5KN2A 4IP1A 2QSIA 3ZVJD 1GP1A 4XCSA 5FHIA 3QR6A 5B7CA 3R2QA 2FWEA 3DVXA 2VLTA 2GSQA 3D21A 4DEJA 1ABAA 3EU3A 1PGTA 2O8VB 2OACA 2H70A 3GKKA 4LMVA 1JLVA 3ZMKA 2KUCA 1YJ6A 4V2NA 3GX0A 2H1BA 2VL2A 4RQRA 3IE3A 2H30A 2H76A 2IIYA 3ERGA 1GUKA 3Q74A 2I4AA 4EL1A 3GH6A 1GSFA 3P8WA 4KCEA 1BJXA 3TGZA 3UVTA 5D8IA 2LUSA 2K9FA 2VCZA 5AGYA 3ZIJA 3SBCA 4IGJA 1F2EA 1ZL9A 4EDYA 3GTUA 2OA7A 4EO3A 2LNTA 3F6FA 4IS0A 2KHPA 1O8WA 4GF0A 4XTSA 3C71A 1T1VA 3D6IA 4TXOB 3L78A 4CDOA 3C7MA 5DJLA 2HYXA 2OBKA 3L0HA 2H66A 4J57E 5DBQA 2TRXA 3HVXA 1AUCA 5IPGA 4OO4A 2B1LA 2LEGA 3L9UA 1I9DA 1EV4A 3CRUA 3C73A 1K0OA 1G7EA 1GL8A 1EGOA 1GTUA 1PN9A 1MDKA 3LXZA 4O32A 3O76A 4QL9A 2DJ3A 2OJLA 1FB6A 4HDEA 1YEXA 1Y25A 2PN8A 4MH3A 5A4WA 3CTGA 3TRQA 4GQCA 1USBA 1SKSB 3A2VA 3UL3A 5C04A 2B6MA 2IMDA 1AW9A 1ZCPA 1X5EA 1BG5A 2KLXA 1QUWA 3GKXA 1CQHA 4NAXA 3TKRA 3EYTA 3HHVA 2E2GA 4FYCA 4XRDA 18GSA 1THOA 1TRSA 1URMA 1GRXA 3DMLA 1HYUA 1ML6A 5ECIB 3GSTA 3A3TA 2FA8A 1SK0A 3LFLA 2VLUA 3GA4A 4AF2A 2DJJA 2OBIA 1KEBA 5JCWA 2YV9A 3TJFA 1TW9A 4F82A 1S3AA 4XIHA 3CBUA 1AC1A 2V2GA 1XOBA 8GSSA 3DVWA 3F63A 3UBLA 2OE0A 1F6MC 2OADA 1GSUA 4KH7A 1SJZA 4KUNA 3TB2A 5HQPA 5IO2A 1ZGNA 2NVLA 5INYA 1SJ6A 4GCIA 1GSQA 2PERA 5J9BA 1C72A 6GSSA 3VK9A 2FWHA 3FEUA 3P90A 4NXIA 1OAZA 3I43A 2LJAA 1XVWA 2M46A 3KCMA 3LJRA 1KNGA 3EVIA 4I2UA 5DAKB 4POKA 5DVBA 5IMFA 4WBRD 4I5QA 2C3TA 5L71A 1K0MA 2X99A 1GLQA 1TK5B 5G1KA 4PURA 4ZL7A 4LA1A 4AJ8A 3ZIVA 3ZITA 2R2JA 2C0GA 3C1SA 4PUAA 1YF1A 2HZEA 5F06A 5ECQB 2AAWA 4IQ1A 1K3OA 4PNFA 5LNKe 2HSHA 3FYGA 5CP1A 3WD6A 2MMZA 1RK4A 4G2EA 2BJXA 4JE1A 4BWQA 4BL7A 2JL4A 3HJPA 1GULA 2VCVA 3CSJA 1GH2A 2QKEA 2WCIA 3VFIA 1VF2A 3PH9A 3TJBA 3UEMA 1TK8B 2CVDA 3N9JA 4ZB8A 4YQUA 2CV4A 3ZYWA 1K0CA 4V1Ap 3H79A 2NDOA 5ECKB 3GTUB 3UVHA 1DSBA 4YAPA 4DSRA 4XS4A 4EUYA 2H1GA 3K8NA 2JU5A 4MA9A 4FH8A 3HVVA 4YQVA 3QDNA 5DDLA 4K2DA 1UC7A 1GSDA 1LBKA 1FHEA 5F05A 2EIOA 2HSYA 17GSA 4MF6A 3VPTA 2DBCA 3GX8A 5DCGA 2HLSA 1MDIA 1R26A 5HR2A 12GSA 5JCUA 2CX3A 2TIRA 5HFGA 5IM9A 5KN0A 5IIZA 1ILOA 2GSTA 2B5EA 1PD21 2GQMA 1A2JA 2K8SA 4XS6A 3JCML 3V1WA 4TR3A 2H75A 4KGIA 1U88A 6GSUA 4WF5A 1PL1A 4AJ6A 2E7PA 1EOHA 2DJ0A 3KGKA 1HNBA 1JZOA 4E8HA 3APQA 4V2MA 1A2LA 2LQOA 2HXKA 2J9HA 6GSTA 1X5CA 3UOMA 4MK3A
chains in the Genus database with same CATH superfamily
2X8GA 2R5GA 2NBSA 2PMTA 3WGEA 2I81A 4O5RA 4IN0A 3GH9A 4MPGA 3NZNA 2CVKA 5F8BA 1PMTA 5ECNB 3I69A 6GSWA 5A4UA 4TR1A 1GSYA 5F0GA 4HS1A 2L4QA 3N5OA 1QQ2A 2YJHA 3PGTA 2VM2A 1SD8A 5KN1A 1XW6A 1BYEA 3ME8A 2CX4A 4RUVA 1Q4JA 4TOPA 4BWSA 1LJRA 1GTIA 1ERTA 3HDCA 3LW9A 4KB3A 1TJDA 3TRPA 4POMA 7GSSA 4HQSA 2CZ3A 1Z6NA 1TRWA 1EP8A 1EGRA 3CYNA 5JWRB 5D9TA 2B5XA 5CNWA 2AHEA 3FY7A 3VI7A 4K0GA 4MJAA 1S3DA 2HZEB 2VL2C 1T4ZA 3QAWA 1JLWA 3F8UA 1ERWA 1JZDA 1K3YA 2CAQA 4PUFC 1O73A 4ILFA 2JADA 4BL7B 2LTKA 3LXTA 1V40A 1R5PA 2LV3A 5CYYA 3KH9A 4MZCA 4OFMA 1JZWA 4MDCA 2A2RA 2R0CA 6GSVA 5ABRA 3EINA 3VI5A 4MH2A 3TOUA 2EC4A 3ZFLA 3ZMLA 1M2DA 1PQNA 1FOVA 1ZYQB 2A4HA 4Q5RA 3WT1A 4MF5A 4JU5A 2MBSA 1X9MB 3HVSA 4XS4B 1VGLA 2P0GA 2AV4A 3SWLA 22GSA 4GSSA 5G5FA 5ID2A 5G30A 2WGRA 2K18A 2PVQA 3GV1A 4IJ3A 1EOGA 4FO5A 4MJCA 2WRTA 2WS2A 2FLSA 1X9WB 1A8LA 1A8YA 3KMNA 3FZ4A 2VL3A 3P7XA 4KSMA 3HKRA 3DIEA 3TKSE 2L5LA 1RQMA 3MDKA 5D9XA 3C1RA 3TKQA 1YQ1A 2LSTA 2A2SA 3CXGA 2H74A 2VLVA 1WIKA 3DYRA 1M2AA 4ZBAA 3J7Yk 4QL7A 3FW2A 2QA1A 5G2ZA 5J5NA 1PSQA 4Z2TA 1Z7RA 2WJUA 1FVJA 3GKNA 3QMXA 4GSNA 4ML6A 1MDJA 3WGXA 1WPIA 1V9WA 1SJIA 4CW9A 3D22A 1S3CA 1K0BA 4K0NA 2GTUA 2HRFA 5DCHA 1AAZA 1NHOA 4GXZA 2YWOA 2FHEA 1OC8A 1IYHA 5HR0A 3EURA 4LL4B 1V2AA 3C8EA 3US3A 5COHA 4JBBA 1ST9A 5ECLB 4HQZA 4KA0A 1VRSD 2MMOA 3L9VA 3QCPA 4RI6A 5FWGA 1FG4A 1GLPA 2X4AA 3HY2A 1TK0B 1QGVA 3TJJA 4BVYA 2V41A 1TRUA 1B9XC 1EEMA 2FGXA 3FR3A 2GT6A 3HJMA 1WP0A 1GWCA 2GVPA 1T7PB 1K0AA 4EDZA 4IELA 4X0XA 2L6CA 4RQXA 3FK8A 4N11A 5BMUA 5E4WA 3QFAC 1WWJA 4AGSA 2X8CA 1GNEA 4MP4A 4YKGA 3W8SA 3CRTA 4MMMA 5JCGA 5F07A 5FT3A 4N30A 2D2ZA 2VCQA 2IWTA 3LWAA 5H5RA 1XVQA 4TW5A 4J2FA 5C00A 2PUKC 5J9CA 5DALA 3VLNA 1Z9HA 2LNSA 3IA1A 4K7IA 4L8EA 1IYIA 4WBJA 2H0IA 3W6GA 2VO4A 2IFQA 2KP2A 1HNCA 1EWXA 4MCUA 3EMXA 2F9SA 1XXUA 5EVOA 3ZLPA 4D73A 2GSSA 4HSCX 5HFKA 1M2BA 4I8BA 1F9MA 4OFNA 1Z3EA 4PNGA 3F6DA 3E0UA 4EF0A 2PBJA 1DUGA 3GHAA 4GQFA 1SD9A 2XPDA 3ZZXA 2FUG2 4OWYA 4GRFA 2H1AA 4I97A 4V1Ag 2OKAA 5ECHB 4Q5FA 3LEFA 3FZ5A 2AJQB 4Z7XA 2XC2A 5DQSA 4Z2RA 1M3IA 1OVNA 1K3LA 1A24A 1M99A 2OE1A 1UN2A 3EC3A 2ES7A 1G0TA 4PGTA 4ACSA 5ID2B 1UVZA 5D9VA 4IBPA 3DWVA 2H0HA 3IOSA 2AYTA 2P5QA 3LYPA 1OC9A 3NIVA 1TU7A 3PINA 5CRGA 2L57A 1MEKA 4L0WA 2F8FA 5ELAA 2G0FA 3QAGA 3RBTA 4ULXA 2QC7A 1ZYNA 3KXOA 4GSTA 4EVMA 1TI3A 4GLTA 4HUAA 1TDIA 3QFBC 4L0UA 5H5SA 4K5RA 4G19A 3ERFA 1O6JA 4Q5NA 3U6VA 3H1NA 3F4RA 2EIQA 2C0EA 4K5SA 2HE3A 1FAAA 2H72A 2VD1A 4ISDA 3RPNA 3H8QA 4NV2A 4RI7A 1O85A 3MSZA 2NPBA 3DXBA 1MD3A 5B6MA 4FYUA 2DMMA 2VCTA 2YWMA 1SYRA 2N5AA 1YKCA 3VURA 4K2XA 2DC5A 2PPTA 5IOWA 2FD3A 4HZ4A 5GZZB 4BVYB 1YDKA 4EC0A 1WOUA 1PRXA 2X49A 3FZ9A 2IMEA 3HYPA 3DKSA 1G6WA 4MZBA 4K9ZA 4N0ZA 3VWUA 3HA9A 2ZNMA 5G5EA 2JACA 1XPVA 1A23A 2I3YA 2H6YA 2I1UA 1FB0A 3IK7A 3HJOA 1SK1A 1T3BA 2YP6A 3LORA 3ZL5A 2L4CA 4TRXA 5IOXA 2O87A 1PL2A 1XOAA 2XBQA 3GYKA 5B8BA 5ECMB 1VF1A 1PX6A 2B1KA 3KZQA 3PR8A 1GUMA 5CRWA 2R0GA 4KDXA 5DALB 1PA3A 4K6XA 3TKPA 4IVFA 3DGQA 4A5PA 2LQQA 2IFQB 2CQ9A 3KTBA 2JSZA 2RM6A 3UAPA 2TRCP 3TJKA 2DIZA 3TUEA 2N5FA 2H19A 5EPFA 4PQHA 2RUEA 1W4VA 4HZ2A 1WJKA 1BAYA 2XPEA 3QAVA 2O85A 3RHCA 4D73B 3IHGA 4N0VA 1OKTA 4KE3A 4MABA 2F3MA 1YF0A 1GTAA 5AIXA 1Q98A 2VUPA 3IAM2 1WMJA 1F3AA 2IMFA 2YV7A 4J56E 2WFCA 3BCKA 1I5GA 2C3QA 2GQLA 2VL9A 1A0FA 1ON4A 14GSA 2HRKA 2H8LA 1WE0A 3ZREA 5IMAA 4XHMA 1O81A 3H4KA 4ZXGA 1J08A 3BOAA 3IC8A 2XBIA 4PTSA 1BQ7A 3HCZA 2HI7A 3EU4A 1XFLA 5ECSA 5HFIA 3KP8A 2C80A 5DQYA 1OC9B 3FHKA 4KNDA 2PWJA 3TOTA 3CTFA 2V6KA 4DSQA 4K7OA 3F9UA 2GZYA 2C4JA 3P2AA 2ZUPA 5H5QA 2FCHA 3ISOA 1HQOA 1PKWA 4HEA2 5GAND 5D93A 4NMUA 3IBHA 1XW5A 1NM3A 4MJEA 20GSA 2JSYA 4JEDA 2R6KA 1EZKA 2IJYA 1QFNA 1VF3A 3UJ1A 2VOCA 4JR6A 1KTEA 1J9BA 2K6VA 3E9JB 2O89A 3MNGA 5A4VA 1DE1A 2B7JA 4KCAA 4KW6A 3FR6A 3M1GA 4OFTA 2FNOA 1SKRB 2BTOT 1U87A 3F0IA 2V6OA 1TKDB 1NSWA 4ZL9A 5GAPD 5G31A 4FIWA 3D5JA 4LLRA 3LGCA 3R3EA 5EY6A 4L5LA 1ZYEA 2C8UA 1LU4A 2VM1A 3HZ8A 2GDRA 3TDGA 3S9FA 4G0LA 1DE2A 1XWGA 4FQUA 2YANA 2R37A 2GQKA 2B3SA 2IPAA 5ELGA 4AJ7A 1M9AA 3CSHA 1EV9A 1K0NA 4N10A 1B48A 2IMIA 4H86A 2RIIA 5J4UA 4FYBA 1M9BA 1MD4A 1X5DA 3QD9A 4PXOA 4USSA 5AN1A 1SU9A 4WEYA 4WR4A 1TXXA 3RHBA 4F03A 4XRAA 2ZCTA 11GSA 1M7TA 4I2TA 4IW9A 2RLIA 4TKYA 1MTCA 3APSA 3IPZA 3KMOA 5ENUA 2K8VA 4YAVA 1U6TA 3ZFBA 3WGDA 2MBTA 4Z2UA 2Z9SA 2B7KA 3BCIA 4K1FA 3IRAA 2B5YA 4KDUA 2DSAA 2DIYA 2DKHA 3A5IA 2PGTA 3HD5A 1GTBA 4ZL8A 2F51A 4NWYA 1O8XA 5B8AA 4KSOA 1N2AA 2FY6A 1JFUA 3GL5A 1GSSA 2YJ7A 2CAIA 1ZMAA 3FKFA 4HU9A 2WDUA 2E2MA 2M80A 3A5WA 2FA4A 1H75A 4F9ZA 1TOFA 2IN3A 2MZCA 2ON7A 5EL8A 2F8AA 5KN3A 4PQ1A 2A2PA 4OCFA 4X4JA 2IL3A 4WETA 4TR1B 3WT2A 3TKSA 4ZIJA 2L5OA 3IK9A 2YZUA 3UIWA 2O7KA 5IMCA 2HRNA 6GSYA 2ALBA 3FZAA 1YKAA 4TXVA 1ACVA 4QQ7A 4NHWA 2CA8A 2LKUA 2YOIA 5GSSA 2CVBA 2RUFA 3A2WA 2LS5A 3ZVJA 4GWRA 1TU8A 19GSA 3GUSA 3WYWA 1TP9A 2OE3A 3UMAA 2I9HA 4ECJA 1EP7A 3QPMA 3VPQA 1THXA 3FRCA 3M0FA 1RW1A 1BX9A 2H71A 1UA5A 1HD2A 3CMIA 3J7Yb 4YKFA 1T4YA 4F2IA 2KOKA 2L6DA 3GSSA 2LRTA 3APOA 2IMKA 3KIJA 5CAXA 4POBA 1XCCA 1V98A 3DD3A 4DVCA 3BD2A 2LRCA 2DJ1A 2MMNA 1JHBA 2L59A 3M8NA 1R7HA 1T00A 3IXRA 3D0ZA 4OMVA 2LJRA 2H1DA 4L5OA 1XIYA 2H0GA 4ID0A 2MMAA 3KTLA 1TI1A 4IP6A 3KP9A 1T8EB 2JZRA 4X43A 3IR4A 1XWKA 1XWBA 1NW2A 3LSZA 4DSSA 1H4OA 2LRNA 3TRXA 5D73A 6GSXA 4I6XA 5KOXA 1R5AA 3MWHA 1ERVA 1Z6MA 1E6BA 4TR4A 1PKZA 1B4PA 4LMWA 2YWNA 3Q18A 2J23A 1AIUA 4G9HA 1J0FA 1AXDA 1SL2B 3GFKA 4KAEA 3FR9A 2VCXA 2YWIA 4KF9A 5AIVA 2C0DA 1X9SB 4HJ2A 1XZOA 2WULA 3Q6OA 3VWVA 2V1MA 2N5BA 3IC4A 3ZRDA 5D9WA 2NTOA 1OKDA 4ZILA 2R4VA 4CHSA 5CRHA 5IMZA 1WRYA 1SENA 3FMWA 2AUVA 3G7JA 3Q19A 10GSA 2GT5A 1HNAA 5J3RA 2FWGA 1SK2A 4EIPA 1M0UA 4EKZA 1PN0A 1B8XA 2CT6A 3KH7A 1QMVA 1OE8A 5CO3A 5HR3A 2DLXA 2H6ZA 1YZXA 3ERWA 1BEDA 5HR1A 2GZZA 1U3AA 4IHUA 3OR5A 4TR0A 5IQYA 2FWFA 3UBKA 4ZB6A 3EE2A 1AQXA 4IKHA 3GMFA 2C3NA 3RDWA 1FOHA 2P5RA 1EEJA 1G6YA 2C1YA 4MZWA 4EIQA 4E8EA 3L9SA 1FO5A 2P31A 1E2YA 1SL0B 1SKWB 2CZ2A 1GSEA 4JZQA 3HZ4A 4GTUA 1O7UA 4ECBA 4NPBA 3GRXA 2HNLA 2G2QA 3KD0A 4G10A 4OD7A 4WR5A 4ZBDA 2YN1A 4MF7A 1CQGA 3VWXA 4O92A 2GLRA 4K7NA 4MLYA 13GSA 1Z5YE 5GSTA 1R4WA 4EXJA 2VD0A 3GL3A 1F37A 5CREA 4BA7A 2EIRA 3RAZA 9GSSA 4Q5QA 3VWWA 1W89A 3LG6A 1NHYA 3O3TA 2DMLA 2C0FA 5ECRB 3QOUA 4TN8A 2HFDA 4ZBBA 2DJ2A 3D4MA 4YQMA 1A2MA 1XBSA 3F3QA 4OO5A 1SL1B 3F4SA 5IMDA 3A2XA 5DJMA 3GNJA 3UARA 1ZZYA 1X0RA 3DEXA 2H01A 2VCWA 2WZ9A 3GKMA 3U5RE 1N8JA 4PQIA 4KX4A 1PX7A 3RPPA 2V32A 4P3YB 3GURA 2GZPA 4WXTA 1FVKA 3L4NA 1AQWA 1OYJA 4YH2A 4HJMA 3ME7A 4O5UA 1V57A 4JR4A 4MNNA 4ECIA 3G7YA 5A5KA 3F3RA 2YPMA 1VF4A 1B9YC 1YY7A 2DJKA 4MJBA 1G7OA 4POLA 1ERUA 3H93A 1M3JA 1TTZA 3M9KA 2REMA 5AISA 3KJYA 4HOJA 1QK8A 4TXOA 1TRVA 4OCEA 2GSRA 1GNWA 2WB9A 4CY6A 2X8HA 4DSSB 2E0QA 4V2LA 3D4TA 2HSMA 4WF4A 2H6XA 2HZFA 4XS1A 2JZSA 2BMXA 3E3EA 5J41A 3NOFA 4WKWA 2YZHA 1YEPA 2VAFA 3LQ7A 5ECOB 4F0CA 4BVXA 4ZB9A 3M3MA 4PX1A 1QXHA 2PVOC 4MPFA 2XHFA 2VIMA 3I9V2 5IMVA 1GUHA 5G1LA 2KP1A 1AQVA 3BJ5A 1V58A 1XWCA 4X1UA 3KM6A 4BPYA 3CSIA 3ZTLA 1OE7A 5IO0A 3GN3A 5B6NA 4ECCA 4IJIA 2RM5A 1DBYA 1U3IA 3GIXA 4HI7A 5JWOB 2QA2A 4K8MA 2JZTA 3F4TA 2GGTA 3G7IA 2M72A 5KEJA 5D96A 4JRRA 3AY8A 3MAKA 1S3RA 3IDVA 4EE0A 2YNXA 3W8JA 1SYXA 3BBYA 1Z7PA 4NHZA 1JZRA 4LL1B 5CRDA 2AB6A 3EMPA 3ED3A 1FW1A 4HU7A 3IAS2 5E59A 3I6AA 5IPHA 4NV5A 1K0DA 1Y6EA 16GSA 1A0RP 3DRNA 3HXSA 2PU9C 3TJGA 3G9BA 3M9JA 2MYGA 3EWLA 1ZOFA 2A4VA 3TKSC 3IV4A 3IHQA 3TCOA 4KDYA 5JWQB 1XW9A 2ON5A 2X64A 4F0BA 1XWAA 4TVEA 5ECPB 4ICYA 3O6TA 2R3XA 2YCDA 2QGVA 1ZYPA 2GS3A 4G0IA 3KEBA 2HT9A 4G0KA 1B4QA 2LJKA 4ML1A 3LYKA 4O7HA 5DAKA 2H73A 5LD0A 1KBNA 1F3BA 1OC3A 5LCZA 4IQAA 5KN2A 4IP1A 2QSIA 3ZVJD 1GP1A 4XCSA 5FHIA 3QR6A 5B7CA 3R2QA 2FWEA 3DVXA 2VLTA 2GSQA 3D21A 4DEJA 1ABAA 3EU3A 1PGTA 2O8VB 2OACA 1XG8A 2H70A 3GKKA 4LMVA 1JLVA 3ZMKA 2KUCA 1YJ6A 4V2NA 3GX0A 2H1BA 2VL2A 4RQRA 3IE3A 2H30A 2H76A 2IIYA 3ERGA 1GUKA 3Q74A 2I4AA 4EL1A 3GH6A 1GSFA 3P8WA 4KCEA 1BJXA 3TGZA 3UVTA 5D8IA 2LUSA 2K9FA 2VCZA 5AGYA 3ZIJA 3SBCA 4IGJA 1F2EA 1ZL9A 4EDYA 3GTUA 2OA7A 4EO3A 2LNTA 3F6FA 4IS0A 2KHPA 1O8WA 4GF0A 4XTSA 3C71A 1T1VA 3D6IA 4TXOB 3L78A 4CDOA 3C7MA 5DJLA 2HYXA 2OBKA 1PFOA 3L0HA 2H66A 4J57E 5DBQA 3CQFA 2TRXA 3HVXA 1AUCA 5IPGA 4OO4A 2B1LA 2LEGA 3L9UA 1I9DA 1EV4A 3CRUA 3C73A 1K0OA 4BVXB 1G7EA 1GL8A 1EGOA 1GTUA 1PN9A 1MDKA 3LXZA 4O32A 3O76A 4QL9A 2DJ3A 2OJLA 1FB6A 4HDEA 1YEXA 1Y25A 2PN8A 4MH3A 5A4WA 3CTGA 3TRQA 4GQCA 1USBA 1SKSB 3A2VA 3UL3A 5C04A 2B6MA 2IMDA 1AW9A 1ZCPA 1X5EA 1BG5A 2KLXA 1QUWA 3GKXA 1CQHA 4NAXA 3TKRA 3EYTA 3HHVA 2E2GA 4FYCA 4XRDA 18GSA 1THOA 1TRSA 1URMA 1GRXA 3DMLA 1HYUA 1ML6A 5ECIB 3GSTA 3A3TA 2FA8A 1SK0A 3LFLA 2VLUA 3GA4A 4AF2A 2DJJA 2OBIA 1KEBA 5JCWA 2YV9A 3TJFA 1TW9A 4F82A 1S3AA 4XIHA 3CBUA 1AC1A 2V2GA 1XOBA 8GSSA 3DVWA 3F63A 3UBLA 2OE0A 1F6MC 2OADA 1GSUA 4KH7A 1SJZA 4KUNA 3TB2A 5HQPA 5IO2A 1ZGNA 2NVLA 5INYA 1SJ6A 4GCIA 1GSQA 2PERA 5J9BA 5KOWA 1C72A 6GSSA 3VK9A 2FWHA 3FEUA 3P90A 4NXIA 1OAZA 4BIKA 3I43A 2R0PA 2LJAA 1XVWA 2M46A 3KCMA 3LJRA 1KNGA 3EVIA 4I2UA 5DAKB 4POKA 5DVBA 5IMFA 4WBRD 4I5QA 2C3TA 5L71A 1K0MA 2X99A 1GLQA 1TK5B 5G1KA 4PURA 4ZL7A 4LA1A 4AJ8A 3ZIVA 3ZITA 2R2JA 3PPUA 2C0GA 3C1SA 4PUAA 1YF1A 2HZEA 5F06A 5ECQB 2AAWA 4IQ1A 1K3OA 4PNFA 5LNKe 2HSHA 3EPTA 3FYGA 5CP1A 3WD6A 4CY8A 2MMZA 1RK4A 4G2EA 2BJXA 3MIXA 4JE1A 4BWQA 4BL7A 2JL4A 3HJPA 1GULA 2VCVA 3CSJA 1GH2A 2QKEA 2WCIA 3VFIA 1VF2A 3PH9A 3TJBA 3UEMA 2HRAA 1TK8B 2CVDA 3N9JA 4ZB8A 4YQUA 2CV4A 3ZYWA 1K0CA 4V1Ap 3H79A 2NDOA 5ECKB 3GTUB 3UVHA 1DSBA 4YAPA 4DSRA 4XS4A 4EUYA 2H1GA 3K8NA 2DKIA 2JU5A 4MA9A 4FH8A 3HVVA 4YQVA 3QDNA 5DDLA 4K2DA 1UC7A 1GSDA 1LBKA 1FHEA 5F05A 2EIOA 2HSYA 17GSA 4MF6A 3VPTA 2DBCA 3GX8A 5DCGA 2HLSA 1MDIA 1R26A 5HR2A 12GSA 5JCUA 2CX3A 2TIRA 5HFGA 5IM9A 5KN0A 5IIZA 1ILOA 2GSTA 2B5EA 1PD21 2GQMA 1A2JA 2K8SA 3HVNA 3MYDA 4O5QA 4XS6A 3JCML 3V1WA 4TR3A 2H75A 4KGIA 1U88A 6GSUA 4WF5A 1PL1A 4AJ6A 2E7PA 1EOHA 2DJ0A 3KGKA 1HNBA 1JZOA 4E8HA 3APQA 4V2MA 1A2LA 2LQOA 5BRTA 2HXKA 2UZ8A 2J9HA 6GSTA 1X5CA 3UOMA 4MK3A
chains in the Genus database with same CATH topology
2X8GA 2R5GA 2NBSA 2PMTA 3WGEA 2I81A 4O5RA 4IN0A 3GH9A 4MPGA 3NZNA 2CVKA 5F8BA 1PMTA 5ECNB 3I69A 6GSWA 5A4UA 4TR1A 1GSYA 5F0GA 4HS1A 2L4QA 3N5OA 1QQ2A 2YJHA 3PGTA 2VM2A 1SD8A 5KN1A 1XW6A 1BYEA 3ME8A 2CX4A 4RUVA 1Q4JA 4TOPA 4BWSA 1LJRA 1GTIA 1ERTA 3HDCA 3LW9A 4KB3A 1TJDA 3TRPA 4POMA 7GSSA 4HQSA 2CZ3A 1Z6NA 1TRWA 1EP8A 1EGRA 3CYNA 5JWRB 5D9TA 2B5XA 5CNWA 2AHEA 3FY7A 3VI7A 4K0GA 4MJAA 1S3DA 2HZEB 2VL2C 1T4ZA 3QAWA 1JLWA 3F8UA 1ERWA 1JZDA 1K3YA 2CAQA 4PUFC 1O73A 4ILFA 2JADA 4BL7B 2LTKA 3LXTA 1V40A 1R5PA 2LV3A 5CYYA 3KH9A 4MZCA 4OFMA 1JZWA 4MDCA 2A2RA 2R0CA 6GSVA 5ABRA 3EINA 3VI5A 4MH2A 3TOUA 2EC4A 3ZFLA 3ZMLA 1M2DA 1PQNA 1FOVA 1ZYQB 2A4HA 4Q5RA 3WT1A 4MF5A 4JU5A 2MBSA 1X9MB 3HVSA 4XS4B 1VGLA 2P0GA 2AV4A 3SWLA 22GSA 4GSSA 5G5FA 5ID2A 5G30A 2WGRA 2K18A 2PVQA 3GV1A 4IJ3A 1EOGA 4FO5A 4MJCA 2WRTA 2WS2A 2FLSA 1X9WB 1A8LA 1A8YA 3KMNA 3FZ4A 2VL3A 3P7XA 4KSMA 3HKRA 3DIEA 3TKSE 2L5LA 1RQMA 3MDKA 5D9XA 3C1RA 3TKQA 1YQ1A 2LSTA 2A2SA 3CXGA 2H74A 2VLVA 1WIKA 3DYRA 1M2AA 4ZBAA 3J7Yk 4QL7A 3FW2A 2QA1A 5G2ZA 5J5NA 1PSQA 4Z2TA 1Z7RA 2WJUA 1FVJA 3GKNA 3QMXA 4GSNA 4ML6A 1MDJA 3WGXA 1WPIA 1V9WA 1SJIA 4CW9A 3D22A 1S3CA 1K0BA 4K0NA 2GTUA 2HRFA 5DCHA 1AAZA 1NHOA 4GXZA 2YWOA 2FHEA 1OC8A 1IYHA 5HR0A 3EURA 4LL4B 1V2AA 3C8EA 3US3A 5COHA 4JBBA 1ST9A 5ECLB 4HQZA 4KA0A 1VRSD 2MMOA 3L9VA 3QCPA 4RI6A 5FWGA 1FG4A 1GLPA 2X4AA 3HY2A 1TK0B 1QGVA 3TJJA 4BVYA 2V41A 1TRUA 1B9XC 1EEMA 2FGXA 3FR3A 2GT6A 3HJMA 1WP0A 1GWCA 2GVPA 1T7PB 1K0AA 4EDZA 4IELA 4X0XA 2L6CA 4RQXA 3FK8A 4N11A 5BMUA 5E4WA 3QFAC 1WWJA 4AGSA 2X8CA 1GNEA 4MP4A 4YKGA 3W8SA 3CRTA 4MMMA 5JCGA 5F07A 5FT3A 4N30A 2D2ZA 2VCQA 2IWTA 3LWAA 5H5RA 1XVQA 4TW5A 4J2FA 5C00A 2PUKC 5J9CA 5DALA 3VLNA 1Z9HA 2LNSA 3IA1A 4K7IA 4L8EA 1IYIA 4WBJA 2H0IA 3W6GA 2VO4A 2IFQA 2KP2A 1HNCA 1EWXA 4MCUA 3EMXA 2F9SA 1XXUA 5EVOA 3ZLPA 4D73A 2GSSA 5HFKA 1M2BA 4I8BA 1F9MA 4OFNA 1Z3EA 4PNGA 3F6DA 3E0UA 4EF0A 2PBJA 1DUGA 3GHAA 4GQFA 1SD9A 2XPDA 3ZZXA 2FUG2 4OWYA 4GRFA 2H1AA 4I97A 4V1Ag 2OKAA 5ECHB 4Q5FA 3LEFA 3FZ5A 2AJQB 4Z7XA 2XC2A 5DQSA 4Z2RA 1OVNA 1K3LA 1A24A 1M99A 2OE1A 1UN2A 3EC3A 2ES7A 1G0TA 4PGTA 4ACSA 5ID2B 1UVZA 5D9VA 4IBPA 3DWVA 2H0HA 3IOSA 2AYTA 2P5QA 3LYPA 1OC9A 3NIVA 1TU7A 3PINA 5CRGA 2L57A 1MEKA 4L0WA 2F8FA 5ELAA 2G0FA 3QAGA 3RBTA 4ULXA 2QC7A 1ZYNA 3KXOA 4GSTA 4EVMA 1TI3A 4GLTA 4HUAA 1TDIA 3QFBC 4L0UA 5H5SA 4K5RA 4G19A 3ERFA 1O6JA 4Q5NA 3U6VA 3H1NA 3F4RA 2EIQA 2C0EA 4K5SA 2HE3A 1FAAA 2H72A 2VD1A 4ISDA 3RPNA 3H8QA 4NV2A 4RI7A 1O85A 3MSZA 2NPBA 3DXBA 1MD3A 5B6MA 4FYUA 2DMMA 2VCTA 2YWMA 1SYRA 2N5AA 1YKCA 3VURA 4K2XA 2DC5A 2PPTA 5IOWA 2FD3A 4HZ4A 5GZZB 4BVYB 1YDKA 4EC0A 1WOUA 1PRXA 2X49A 3FZ9A 2IMEA 3HYPA 3DKSA 1G6WA 4MZBA 4K9ZA 4N0ZA 3VWUA 3HA9A 2ZNMA 5G5EA 2JACA 1XPVA 1A23A 2I3YA 2H6YA 2I1UA 1FB0A 3IK7A 3HJOA 1SK1A 1T3BA 2YP6A 3LORA 3ZL5A 2L4CA 4TRXA 5IOXA 2O87A 1PL2A 1XOAA 2XBQA 3GYKA 5B8BA 5ECMB 1VF1A 1PX6A 2B1KA 3KZQA 3PR8A 1GUMA 5CRWA 2R0GA 4KDXA 5DALB 1PA3A 4K6XA 3TKPA 4IVFA 3DGQA 4A5PA 2LQQA 2IFQB 2CQ9A 3KTBA 2JSZA 2RM6A 3UAPA 2TRCP 3TJKA 2DIZA 3TUEA 2N5FA 2H19A 5EPFA 4PQHA 2RUEA 1W4VA 4HZ2A 1WJKA 1BAYA 2XPEA 3QAVA 2O85A 3RHCA 4D73B 3IHGA 4N0VA 1OKTA 4KE3A 4MABA 2F3MA 1YF0A 1GTAA 5AIXA 1Q98A 2VUPA 3IAM2 1WMJA 1F3AA 2IMFA 2YV7A 4J56E 2WFCA 3BCKA 1I5GA 2C3QA 2GQLA 2VL9A 1A0FA 1ON4A 14GSA 2HRKA 2H8LA 1WE0A 3ZREA 5IMAA 4XHMA 1O81A 3H4KA 4ZXGA 1J08A 3BOAA 3IC8A 2XBIA 4PTSA 1BQ7A 3HCZA 2HI7A 3EU4A 1XFLA 5ECSA 5HFIA 3KP8A 2C80A 5DQYA 1OC9B 3FHKA 4KNDA 2PWJA 3TOTA 3CTFA 2V6KA 4DSQA 4K7OA 3F9UA 2GZYA 2C4JA 3P2AA 2ZUPA 5H5QA 2FCHA 3ISOA 1HQOA 1PKWA 4HEA2 5GAND 5D93A 4NMUA 3IBHA 1XW5A 1NM3A 4MJEA 20GSA 2JSYA 4JEDA 2R6KA 1EZKA 2IJYA 1QFNA 1VF3A 3UJ1A 2VOCA 4JR6A 1KTEA 1J9BA 2K6VA 3E9JB 2O89A 3MNGA 5A4VA 1DE1A 2B7JA 4KCAA 4KW6A 3FR6A 3M1GA 4OFTA 2FNOA 1SKRB 2BTOT 1U87A 3F0IA 2V6OA 1TKDB 1NSWA 4ZL9A 5GAPD 5G31A 4FIWA 3D5JA 4LLRA 3LGCA 3R3EA 5EY6A 4L5LA 1ZYEA 2C8UA 1LU4A 2VM1A 3HZ8A 2GDRA 3TDGA 3S9FA 4G0LA 1DE2A 1XWGA 4FQUA 2YANA 2R37A 2GQKA 2B3SA 2IPAA 5ELGA 4AJ7A 1M9AA 3CSHA 1EV9A 1K0NA 4N10A 1B48A 2IMIA 4H86A 2RIIA 5J4UA 4FYBA 1M9BA 1MD4A 1X5DA 3QD9A 4PXOA 4USSA 5AN1A 1SU9A 4WEYA 4WR4A 1TXXA 3RHBA 4F03A 4XRAA 2ZCTA 11GSA 1M7TA 4I2TA 4IW9A 2RLIA 4TKYA 1MTCA 3APSA 3IPZA 3KMOA 5ENUA 2K8VA 4YAVA 1U6TA 3ZFBA 3WGDA 2MBTA 4Z2UA 2Z9SA 2B7KA 3BCIA 4K1FA 3IRAA 2B5YA 4KDUA 2DSAA 2DIYA 2DKHA 3A5IA 2PGTA 3HD5A 1GTBA 4ZL8A 2F51A 4NWYA 1O8XA 5B8AA 4KSOA 1N2AA 2FY6A 1JFUA 3GL5A 1GSSA 2YJ7A 2CAIA 1ZMAA 3FKFA 4HU9A 2WDUA 2E2MA 2M80A 3A5WA 2FA4A 1H75A 4F9ZA 1TOFA 2IN3A 2MZCA 2ON7A 5EL8A 2F8AA 5KN3A 4PQ1A 2A2PA 4OCFA 4X4JA 2IL3A 4WETA 4TR1B 3WT2A 3TKSA 4ZIJA 2L5OA 3IK9A 2YZUA 3UIWA 2O7KA 5IMCA 2HRNA 6GSYA 2ALBA 3FZAA 1YKAA 4TXVA 1ACVA 4QQ7A 4NHWA 2CA8A 2LKUA 2YOIA 5GSSA 2CVBA 2RUFA 3A2WA 2LS5A 3ZVJA 4GWRA 1TU8A 19GSA 3GUSA 3WYWA 1TP9A 2OE3A 3UMAA 2I9HA 4ECJA 1EP7A 3QPMA 3VPQA 1THXA 3FRCA 3M0FA 1RW1A 1BX9A 2H71A 1UA5A 1HD2A 3CMIA 3J7Yb 4YKFA 1T4YA 4F2IA 2KOKA 2L6DA 3GSSA 2LRTA 3APOA 2IMKA 3KIJA 5CAXA 4POBA 1XCCA 1V98A 3DD3A 4DVCA 3BD2A 2LRCA 2DJ1A 2MMNA 1JHBA 2L59A 3M8NA 1R7HA 1T00A 3IXRA 3D0ZA 4OMVA 2LJRA 2H1DA 4L5OA 1XIYA 2H0GA 4ID0A 2MMAA 3KTLA 1TI1A 4IP6A 3KP9A 1T8EB 2JZRA 4X43A 3IR4A 1XWKA 1XWBA 1NW2A 3LSZA 4DSSA 1H4OA 2LRNA 3TRXA 5D73A 6GSXA 4I6XA 5KOXA 1R5AA 3MWHA 1ERVA 1Z6MA 1E6BA 4TR4A 1PKZA 1B4PA 4LMWA 2YWNA 3Q18A 2J23A 1AIUA 4G9HA 1J0FA 1AXDA 1SL2B 3GFKA 4KAEA 3FR9A 2VCXA 2YWIA 4KF9A 5AIVA 2C0DA 1X9SB 4HJ2A 1XZOA 2WULA 3Q6OA 3VWVA 2V1MA 2N5BA 3IC4A 3ZRDA 5D9WA 2NTOA 1OKDA 4ZILA 2R4VA 4CHSA 5CRHA 5IMZA 1WRYA 1SENA 3FMWA 2AUVA 3G7JA 3Q19A 10GSA 2GT5A 1HNAA 5J3RA 2FWGA 1SK2A 4EIPA 1M0UA 4EKZA 1PN0A 1B8XA 2CT6A 3KH7A 1QMVA 1OE8A 5CO3A 5HR3A 2DLXA 2H6ZA 1YZXA 3ERWA 1BEDA 5HR1A 2GZZA 1U3AA 4IHUA 3OR5A 4TR0A 5IQYA 2FWFA 3UBKA 4ZB6A 3EE2A 1AQXA 4IKHA 3GMFA 2C3NA 3RDWA 1FOHA 2P5RA 1EEJA 1G6YA 2C1YA 4MZWA 4EIQA 4E8EA 3L9SA 1FO5A 2P31A 1E2YA 1SL0B 1SKWB 2CZ2A 1GSEA 4JZQA 3HZ4A 4GTUA 1O7UA 4ECBA 4NPBA 3GRXA 2HNLA 2G2QA 3KD0A 4G10A 4OD7A 4WR5A 4ZBDA 2YN1A 4MF7A 1CQGA 3VWXA 4O92A 2GLRA 4K7NA 4MLYA 13GSA 1Z5YE 5GSTA 1R4WA 4EXJA 2VD0A 3GL3A 1F37A 5CREA 4BA7A 2EIRA 3RAZA 9GSSA 4Q5QA 3VWWA 1W89A 3LG6A 1NHYA 3O3TA 2DMLA 2C0FA 5ECRB 3QOUA 4TN8A 2HFDA 4ZBBA 2DJ2A 3D4MA 4YQMA 1A2MA 1XBSA 3F3QA 4OO5A 1SL1B 3F4SA 5IMDA 3A2XA 5DJMA 3GNJA 3UARA 1ZZYA 1X0RA 3DEXA 2H01A 2VCWA 2WZ9A 3GKMA 3U5RE 1N8JA 4PQIA 4KX4A 1PX7A 3RPPA 2V32A 4P3YB 3GURA 2GZPA 4WXTA 1FVKA 3L4NA 1AQWA 1OYJA 4YH2A 4HJMA 3ME7A 4O5UA 1V57A 4JR4A 4MNNA 4ECIA 3G7YA 5A5KA 3F3RA 2YPMA 1VF4A 1B9YC 1YY7A 2DJKA 4MJBA 1G7OA 4POLA 1ERUA 3H93A 1TTZA 3M9KA 2REMA 5AISA 3KJYA 4HOJA 1QK8A 4TXOA 1TRVA 4OCEA 2GSRA 1GNWA 2WB9A 4CY6A 2X8HA 4DSSB 2E0QA 4V2LA 3D4TA 2HSMA 4WF4A 2H6XA 2HZFA 4XS1A 2JZSA 2BMXA 3E3EA 5J41A 3NOFA 4WKWA 2YZHA 1YEPA 2VAFA 3LQ7A 5ECOB 4F0CA 4BVXA 4ZB9A 3M3MA 4PX1A 1QXHA 2PVOC 4MPFA 2XHFA 2VIMA 3I9V2 5IMVA 1GUHA 5G1LA 2KP1A 1AQVA 3BJ5A 1V58A 1XWCA 4X1UA 3KM6A 4BPYA 3CSIA 3ZTLA 1OE7A 5IO0A 3GN3A 5B6NA 4ECCA 4IJIA 2RM5A 1DBYA 1U3IA 3GIXA 4HI7A 5JWOB 2QA2A 4K8MA 2JZTA 3F4TA 2GGTA 3G7IA 2M72A 5KEJA 5D96A 4JRRA 3AY8A 3MAKA 3IDVA 4EE0A 2YNXA 3W8JA 1SYXA 3BBYA 1Z7PA 4NHZA 1JZRA 4LL1B 5CRDA 2AB6A 3EMPA 3ED3A 1FW1A 4HU7A 3IAS2 5E59A 3I6AA 5IPHA 4NV5A 1K0DA 1Y6EA 16GSA 1A0RP 3DRNA 3HXSA 2PU9C 3TJGA 3G9BA 3M9JA 2MYGA 3EWLA 1ZOFA 2A4VA 3TKSC 3IV4A 3IHQA 3TCOA 4KDYA 5JWQB 1XW9A 2ON5A 2X64A 4F0BA 1XWAA 4TVEA 5ECPB 4ICYA 3O6TA 2R3XA 2YCDA 2QGVA 1ZYPA 2GS3A 4G0IA 3KEBA 2HT9A 4G0KA 1B4QA 2LJKA 4ML1A 3LYKA 4O7HA 5DAKA 2H73A 5LD0A 1KBNA 1F3BA 1OC3A 5LCZA 4IQAA 5KN2A 4IP1A 2QSIA 3ZVJD 1GP1A 4XCSA 5FHIA 3QR6A 5B7CA 3R2QA 2FWEA 3DVXA 2VLTA 2GSQA 3D21A 4DEJA 1ABAA 3EU3A 1PGTA 2O8VB 2OACA 2H70A 3GKKA 4LMVA 1JLVA 3ZMKA 2KUCA 1YJ6A 4V2NA 3GX0A 2H1BA 2VL2A 4RQRA 3IE3A 2H30A 2H76A 2IIYA 3ERGA 1GUKA 3Q74A 2I4AA 4EL1A 3GH6A 1GSFA 3P8WA 4KCEA 1BJXA 3TGZA 3UVTA 5D8IA 2LUSA 2K9FA 2VCZA 5AGYA 3ZIJA 3SBCA 4IGJA 1F2EA 1ZL9A 4EDYA 3GTUA 2OA7A 4EO3A 2LNTA 3F6FA 4IS0A 2KHPA 1O8WA 4GF0A 4XTSA 3C71A 1T1VA 3D6IA 4TXOB 3L78A 4CDOA 3C7MA 5DJLA 2HYXA 2OBKA 3L0HA 2H66A 4J57E 5DBQA 2TRXA 3HVXA 1AUCA 5IPGA 4OO4A 2B1LA 2LEGA 3L9UA 1I9DA 1EV4A 3CRUA 3C73A 1K0OA 4BVXB 1G7EA 1GL8A 1EGOA 1GTUA 1PN9A 1MDKA 3LXZA 4O32A 3O76A 4QL9A 2DJ3A 2OJLA 1FB6A 4HDEA 1YEXA 1Y25A 2PN8A 4MH3A 5A4WA 3CTGA 3TRQA 4GQCA 1USBA 1SKSB 3A2VA 3UL3A 5C04A 2B6MA 2IMDA 1AW9A 1ZCPA 1X5EA 1BG5A 2KLXA 1QUWA 3GKXA 1CQHA 4NAXA 3TKRA 3EYTA 3HHVA 2E2GA 4FYCA 4XRDA 18GSA 1THOA 1TRSA 1URMA 1GRXA 3DMLA 1HYUA 1ML6A 5ECIB 3GSTA 3A3TA 2FA8A 1SK0A 3LFLA 2VLUA 3GA4A 4AF2A 2DJJA 2OBIA 1KEBA 5JCWA 2YV9A 3TJFA 1TW9A 4F82A 1S3AA 4XIHA 3CBUA 1AC1A 2V2GA 1XOBA 8GSSA 3DVWA 3F63A 3UBLA 2OE0A 1F6MC 2OADA 1GSUA 4KH7A 1SJZA 4KUNA 3TB2A 5HQPA 5IO2A 1ZGNA 2NVLA 5INYA 1SJ6A 4GCIA 1GSQA 2PERA 5J9BA 5KOWA 1C72A 6GSSA 3VK9A 2FWHA 3FEUA 3P90A 4NXIA 1OAZA 3I43A 2R0PA 2LJAA 1XVWA 2M46A 3KCMA 3LJRA 1KNGA 3EVIA 4I2UA 5DAKB 4POKA 5DVBA 5IMFA 4WBRD 4I5QA 2C3TA 5L71A 1K0MA 2X99A 1GLQA 1TK5B 5G1KA 4PURA 4ZL7A 4LA1A 4AJ8A 3ZIVA 3ZITA 2R2JA 3PPUA 2C0GA 3C1SA 4PUAA 1YF1A 2HZEA 5F06A 5ECQB 2AAWA 4IQ1A 1K3OA 4PNFA 5LNKe 2HSHA 3EPTA 3FYGA 5CP1A 3WD6A 4CY8A 2MMZA 1RK4A 4G2EA 2BJXA 3MIXA 4JE1A 4BWQA 4BL7A 2JL4A 3HJPA 1GULA 2VCVA 3CSJA 1GH2A 2QKEA 2WCIA 3VFIA 1VF2A 3PH9A 3TJBA 3UEMA 2HRAA 1TK8B 2CVDA 3N9JA 4ZB8A 4YQUA 2CV4A 3ZYWA 1K0CA 4V1Ap 3H79A 2NDOA 5ECKB 3GTUB 3UVHA 1DSBA 4YAPA 4DSRA 4XS4A 4EUYA 2H1GA 3K8NA 2DKIA 2JU5A 4MA9A 4FH8A 3HVVA 4YQVA 3QDNA 5DDLA 4K2DA 1UC7A 1GSDA 1LBKA 1FHEA 5F05A 2EIOA 2HSYA 17GSA 4MF6A 3VPTA 2DBCA 3GX8A 5DCGA 2HLSA 1MDIA 1R26A 5HR2A 12GSA 5JCUA 2CX3A 2TIRA 5HFGA 5IM9A 5KN0A 5IIZA 1ILOA 2GSTA 2B5EA 1PD21 2GQMA 1A2JA 2K8SA 3MYDA 4O5QA 4XS6A 3JCML 3V1WA 4TR3A 2H75A 4KGIA 1U88A 6GSUA 4WF5A 1PL1A 4AJ6A 2E7PA 1EOHA 2DJ0A 3KGKA 1HNBA 1JZOA 4E8HA 3APQA 4V2MA 1A2LA 2LQOA 5BRTA 2HXKA 2UZ8A 2J9HA 6GSTA 1X5CA 3UOMA 4MK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X8G A;  2R5G A;  2NBS A;  2PMT A;  3WGE A;  2I81 A;  4O5R A;  4IN0 A;  3GH9 A;  4MPG A;  3NZN A;  2CVK A;  5F8B A;  1PMT A;  5ECN B;  3I69 A;  6GSW A;  5A4U A;  4TR1 A;  1GSY A;  5F0G A;  4HS1 A;  2L4Q A;  3N5O A;  1QQ2 A;  2YJH A;  3PGT A;  2VM2 A;  1SD8 A;  5KN1 A;  1XW6 A;  1BYE A;  3ME8 A;  2CX4 A;  4RUV A;  1Q4J A;  4TOP A;  4BWS A;  1LJR A;  1GTI A;  1ERT A;  3HDC A;  4KB3 A;  1TJD A;  3TRP A;  4POM A;  7GSS A;  4HQS A;  2CZ3 A;  1Z6N A;  1TRW A;  1EP8 A;  1EGR A;  3CYN A;  5JWR B;  5D9T A;  2B5X A;  5CNW A;  2AHE A;  3FY7 A;  3VI7 A;  4K0G A;  4MJA A;  1S3D A;  2HZE B;  2VL2 C;  1T4Z A;  3QAW A;  1JLW A;  3F8U A;  1ERW A;  1JZD A;  1K3Y A;  2CAQ A;  4PUF C;  1O73 A;  4ILF A;  2JAD A;  2LTK A;  3LXT A;  1V40 A;  1R5P A;  2LV3 A;  5CYY A;  3KH9 A;  4MZC A;  4OFM A;  1JZW A;  4MDC A;  2A2R A;  6GSV A;  5ABR A;  3EIN A;  3VI5 A;  4MH2 A;  3TOU A;  2EC4 A;  3ZFL A;  3ZML A;  1M2D A;  1PQN A;  1FOV A;  1ZYQ B;  3WT1 A;  4Q5R A;  4MF5 A;  4JU5 A;  2MBS A;  1X9M B;  3HVS A;  4XS4 B;  1VGL A;  2P0G A;  2AV4 A;  3SWL A;  22GS A;  4GSS A;  5G5F A;  5ID2 A;  5G30 A;  2WGR A;  2K18 A;  2PVQ A;  3GV1 A;  4IJ3 A;  1EOG A;  4FO5 A;  4MJC A;  2WRT A;  2WS2 A;  2FLS A;  1X9W B;  1A8L A;  1A8Y A;  3KMN A;  3FZ4 A;  2VL3 A;  3P7X A;  4KSM A;  3HKR A;  3DIE A;  3TKS E;  2L5L A;  1RQM A;  3MDK A;  5D9X A;  3C1R A;  3TKQ A;  1YQ1 A;  2LST A;  2A2S A;  3CXG A;  2H74 A;  2VLV A;  1WIK A;  3DYR A;  1M2A A;  4ZBA A;  3J7Y k;  4QL7 A;  3FW2 A;  5G2Z A;  5J5N A;  1PSQ A;  1Z7R A;  2WJU A;  1FVJ A;  3GKN A;  3QMX A;  4GSN A;  4ML6 A;  1MDJ A;  3WGX A;  1WPI A;  1V9W A;  1SJI A;  4CW9 A;  3D22 A;  1S3C A;  1K0B A;  4K0N A;  2GTU A;  2HRF A;  5DCH A;  1AAZ A;  1NHO A;  4GXZ A;  2YWO A;  2FHE A;  1OC8 A;  1IYH A;  5HR0 A;  3EUR A;  4LL4 B;  1V2A A;  3C8E A;  3US3 A;  5COH A;  4JBB A;  1ST9 A;  5ECL B;  4HQZ A;  4KA0 A;  1VRS D;  2MMO A;  3L9V A;  3QCP A;  4RI6 A;  5FWG A;  1FG4 A;  1GLP A;  3HY2 A;  1TK0 B;  1QGV A;  3TJJ A;  4BVY A;  2V41 A;  1TRU A;  1B9X C;  1EEM A;  2FGX A;  3FR3 A;  2GT6 A;  3HJM A;  1WP0 A;  1GWC A;  2GVP A;  1T7P B;  1K0A A;  4EDZ A;  4IEL A;  4X0X A;  2L6C A;  4RQX A;  3FK8 A;  4N11 A;  5E4W A;  3QFA C;  1WWJ A;  4AGS A;  2X8C A;  1GNE A;  4MP4 A;  3W8S A;  3CRT A;  4MMM A;  5JCG A;  5F07 A;  5FT3 A;  4N30 A;  2D2Z A;  2VCQ A;  2IWT A;  3LWA A;  5H5R A;  1XVQ A;  4TW5 A;  4J2F A;  5C00 A;  2PUK C;  5J9C A;  5DAL A;  3VLN A;  1Z9H A;  2LNS A;  3IA1 A;  4K7I A;  4L8E A;  1IYI A;  4WBJ A;  2H0I A;  3W6G A;  2VO4 A;  2IFQ A;  2KP2 A;  1HNC A;  1EWX A;  4MCU A;  3EMX A;  2F9S A;  1XXU A;  5EVO A;  3ZLP A;  4D73 A;  2GSS A;  5HFK A;  1M2B A;  4I8B A;  1F9M A;  4OFN A;  1Z3E A;  4PNG A;  3F6D A;  3E0U A;  4EF0 A;  2PBJ A;  1DUG A;  3GHA A;  4GQF A;  1SD9 A;  2XPD A;  3ZZX A;  2FUG 2;  4OWY A;  4GRF A;  2H1A A;  4I97 A;  4V1A g;  2OKA A;  5ECH B;  4Q5F A;  3LEF A;  3FZ5 A;  2AJQ B;  4Z7X A;  2XC2 A;  5DQS A;  1OVN A;  1K3L A;  1A24 A;  1M99 A;  2OE1 A;  1UN2 A;  3EC3 A;  2ES7 A;  1G0T A;  4PGT A;  4ACS A;  5ID2 B;  1UVZ A;  5D9V A;  4IBP A;  3DWV A;  2H0H A;  3IOS A;  2AYT A;  2P5Q A;  3LYP A;  1OC9 A;  3NIV A;  1TU7 A;  3PIN A;  5CRG A;  2L57 A;  1MEK A;  4L0W A;  2F8F A;  5ELA A;  2G0F A;  3QAG A;  3RBT A;  4ULX A;  2QC7 A;  3KXO A;  4GST A;  4EVM A;  1TI3 A;  4GLT A;  4HUA A;  1TDI A;  3QFB C;  4L0U A;  5H5S A;  4G19 A;  3ERF A;  1O6J A;  4Q5N A;  3U6V A;  3H1N A;  3F4R A;  2EIQ A;  2C0E A;  2HE3 A;  1FAA A;  2H72 A;  2VD1 A;  4ISD A;  3RPN A;  3H8Q A;  4NV2 A;  4RI7 A;  1O85 A;  3MSZ A;  2NPB A;  3DXB A;  1MD3 A;  5B6M A;  4FYU A;  2DMM A;  2VCT A;  2YWM A;  1SYR A;  2N5A A;  1YKC A;  3VUR A;  2DC5 A;  2PPT A;  5IOW A;  2FD3 A;  4HZ4 A;  5GZZ B;  1YDK A;  4EC0 A;  1WOU A;  1PRX A;  3FZ9 A;  2IME A;  3HYP A;  3DKS A;  1G6W A;  4MZB A;  4K9Z A;  4N0Z A;  3VWU A;  3HA9 A;  2ZNM A;  5G5E A;  2JAC A;  1XPV A;  1A23 A;  2I3Y A;  2H6Y A;  2I1U A;  1FB0 A;  3IK7 A;  3HJO A;  1SK1 A;  1T3B A;  2YP6 A;  3LOR A;  3ZL5 A;  2L4C A;  4TRX A;  5IOX A;  2O87 A;  1PL2 A;  1XOA A;  2XBQ A;  3GYK A;  5B8B A;  5ECM B;  1VF1 A;  1PX6 A;  2B1K A;  3KZQ A;  3PR8 A;  1GUM A;  5CRW A;  4KDX A;  5DAL B;  1PA3 A;  4K6X A;  3TKP A;  4IVF A;  3DGQ A;  2LQQ A;  2IFQ B;  2CQ9 A;  3KTB A;  2JSZ A;  2RM6 A;  3UAP A;  2TRC P;  3TJK A;  2DIZ A;  3TUE A;  2N5F A;  2H19 A;  5EPF A;  4PQH A;  2RUE A;  1W4V A;  4HZ2 A;  1WJK A;  1BAY A;  2XPE A;  3QAV A;  2O85 A;  3RHC A;  4D73 B;  4N0V A;  1OKT A;  4KE3 A;  4MAB A;  2F3M A;  1YF0 A;  1GTA A;  5AIX A;  1Q98 A;  2VUP A;  3IAM 2;  1WMJ A;  1F3A A;  2IMF A;  2YV7 A;  4J56 E;  2WFC A;  3BCK A;  1I5G A;  2C3Q A;  2GQL A;  2VL9 A;  1A0F A;  1ON4 A;  14GS A;  2H8L A;  1WE0 A;  3ZRE A;  5IMA A;  4XHM A;  1O81 A;  3H4K A;  4ZXG A;  1J08 A;  3BOA A;  2XBI A;  1BQ7 A;  3HCZ A;  2HI7 A;  3EU4 A;  1XFL A;  5ECS A;  5HFI A;  3KP8 A;  2C80 A;  5DQY A;  1OC9 B;  3FHK A;  4KND A;  2PWJ A;  3TOT A;  3CTF A;  2V6K A;  4DSQ A;  4K7O A;  3F9U A;  2GZY A;  2C4J A;  3P2A A;  2ZUP A;  5H5Q A;  2FCH A;  3ISO A;  1HQO A;  1PKW A;  4HEA 2;  5GAN D;  5D93 A;  4NMU A;  3IBH A;  1XW5 A;  1NM3 A;  4MJE A;  20GS A;  2JSY A;  4JED A;  2R6K A;  1EZK A;  2IJY A;  1QFN A;  1VF3 A;  3UJ1 A;  2VOC A;  4JR6 A;  1KTE A;  1J9B A;  2K6V A;  3E9J B;  2O89 A;  3MNG A;  5A4V A;  1DE1 A;  2B7J A;  4KCA A;  4KW6 A;  3FR6 A;  3M1G A;  4OFT A;  2FNO A;  1SKR B;  2BTO T;  1U87 A;  3F0I A;  2V6O A;  1TKD B;  1NSW A;  4ZL9 A;  5GAP D;  5G31 A;  4FIW A;  3D5J A;  4LLR A;  3LGC A;  5EY6 A;  4L5L A;  1ZYE A;  2C8U A;  1LU4 A;  2VM1 A;  3HZ8 A;  2GDR A;  3TDG A;  3S9F A;  1DE2 A;  1XWG A;  2YAN A;  2R37 A;  2GQK A;  2B3S A;  2IPA A;  5ELG A;  4AJ7 A;  1M9A A;  3CSH A;  1EV9 A;  1K0N A;  4N10 A;  1B48 A;  2IMI A;  4H86 A;  2RII A;  5J4U A;  4FYB A;  1M9B A;  1MD4 A;  1X5D A;  3QD9 A;  4PXO A;  5AN1 A;  1SU9 A;  4WEY A;  4WR4 A;  1TXX A;  3RHB A;  4F03 A;  4XRA A;  2ZCT A;  11GS A;  1M7T A;  4I2T A;  4IW9 A;  2RLI A;  4TKY A;  1MTC A;  3APS A;  3IPZ A;  3KMO A;  5ENU A;  2K8V A;  4YAV A;  1U6T A;  3ZFB A;  3WGD A;  2MBT A;  2Z9S A;  2B7K A;  3BCI A;  4K1F A;  3IRA A;  2B5Y A;  4KDU A;  2DSA A;  2DIY A;  3HD5 A;  2PGT A;  1GTB A;  4ZL8 A;  2F51 A;  4NWY A;  1O8X A;  5B8A A;  4KSO A;  1N2A A;  2FY6 A;  1JFU A;  3GL5 A;  1GSS A;  2YJ7 A;  2CAI A;  1ZMA A;  3FKF A;  4HU9 A;  2WDU A;  2E2M A;  2M80 A;  3A5W A;  2FA4 A;  1H75 A;  4F9Z A;  1TOF A;  2IN3 A;  2MZC A;  2ON7 A;  5EL8 A;  2F8A A;  5KN3 A;  4PQ1 A;  4OCF A;  2IL3 A;  4WET A;  4TR1 B;  3WT2 A;  3TKS A;  4ZIJ A;  2L5O A;  3IK9 A;  2YZU A;  3UIW A;  2O7K A;  5IMC A;  2HRN A;  6GSY A;  2ALB A;  3FZA A;  1YKA A;  4TXV A;  1ACV A;  4QQ7 A;  4NHW A;  2CA8 A;  2LKU A;  2YOI A;  5GSS A;  2CVB A;  2RUF A;  3A2W A;  2LS5 A;  3ZVJ A;  4GWR A;  1TU8 A;  19GS A;  3GUS A;  3WYW A;  1TP9 A;  2OE3 A;  3UMA A;  2I9H A;  4ECJ A;  1EP7 A;  3QPM A;  3VPQ A;  1THX A;  3FRC A;  3M0F A;  1RW1 A;  1BX9 A;  2H71 A;  1UA5 A;  1HD2 A;  3CMI A;  3J7Y b;  1T4Y A;  4F2I A;  2KOK A;  2L6D A;  3GSS A;  2LRT A;  3APO A;  2IMK A;  3KIJ A;  5CAX A;  4POB A;  1XCC A;  1V98 A;  3DD3 A;  4DVC A;  3BD2 A;  2LRC A;  2DJ1 A;  2MMN A;  1JHB A;  2L59 A;  3M8N A;  1R7H A;  1T00 A;  3IXR A;  3D0Z A;  4OMV A;  2LJR A;  2H1D A;  4L5O A;  1XIY A;  2H0G A;  4ID0 A;  2MMA A;  3KTL A;  1TI1 A;  4IP6 A;  3KP9 A;  1T8E B;  2JZR A;  4X43 A;  3IR4 A;  1XWK A;  1XWB A;  1NW2 A;  3LSZ A;  4DSS A;  1H4O A;  2LRN A;  3TRX A;  5D73 A;  6GSX A;  4I6X A;  1R5A A;  3MWH A;  1ERV A;  1Z6M A;  1E6B A;  4TR4 A;  1PKZ A;  1B4P A;  4LMW A;  2YWN A;  3Q18 A;  2J23 A;  1AIU A;  4G9H A;  1J0F A;  1AXD A;  1SL2 B;  3GFK A;  4KAE A;  3FR9 A;  2VCX A;  2YWI A;  5AIV A;  2C0D A;  1X9S B;  4HJ2 A;  1XZO A;  2WUL A;  3Q6O A;  3VWV A;  2V1M A;  2N5B A;  3IC4 A;  3ZRD A;  5D9W A;  2NTO A;  1OKD A;  4ZIL A;  2R4V A;  4CHS A;  5CRH A;  5IMZ A;  1WRY A;  1SEN A;  2AUV A;  3G7J A;  3Q19 A;  10GS A;  2GT5 A;  1HNA A;  5J3R A;  2FWG A;  1SK2 A;  1M0U A;  4EKZ A;  1B8X A;  2CT6 A;  3KH7 A;  1QMV A;  1OE8 A;  5CO3 A;  5HR3 A;  2DLX A;  2H6Z A;  1YZX A;  3ERW A;  1BED A;  5HR1 A;  2GZZ A;  1U3A A;  4IHU A;  3OR5 A;  4TR0 A;  5IQY A;  2FWF A;  3UBK A;  4ZB6 A;  3EE2 A;  1AQX A;  4IKH A;  3GMF A;  2C3N A;  3RDW A;  2P5R A;  1EEJ A;  1G6Y A;  2C1Y A;  4MZW A;  4E8E A;  3L9S A;  1FO5 A;  2P31 A;  1E2Y A;  1SL0 B;  1SKW B;  2CZ2 A;  1GSE A;  4JZQ A;  3HZ4 A;  4GTU A;  1O7U A;  4ECB A;  4NPB A;  3GRX A;  2HNL A;  2G2Q A;  3KD0 A;  4G10 A;  4OD7 A;  4WR5 A;  4ZBD A;  2YN1 A;  4MF7 A;  1CQG A;  3VWX A;  4O92 A;  2GLR A;  4K7N A;  4MLY A;  13GS A;  1Z5Y E;  5GST A;  1R4W A;  4EXJ A;  2VD0 A;  3GL3 A;  1F37 A;  5CRE A;  4BA7 A;  2EIR A;  3RAZ A;  9GSS A;  4Q5Q A;  3VWW A;  1W89 A;  3LG6 A;  1NHY A;  3O3T A;  2DML A;  2C0F A;  5ECR B;  3QOU A;  4TN8 A;  2HFD A;  4ZBB A;  2DJ2 A;  3D4M A;  4YQM A;  1A2M A;  1XBS A;  3F3Q A;  4OO5 A;  1SL1 B;  3F4S A;  5IMD A;  3A2X A;  5DJM A;  3GNJ A;  3UAR A;  1ZZY A;  1X0R A;  3DEX A;  2H01 A;  2VCW A;  2WZ9 A;  3GKM A;  3U5R E;  1N8J A;  4PQI A;  4KX4 A;  1PX7 A;  3RPP A;  2V32 A;  4P3Y B;  3GUR A;  2GZP A;  4WXT A;  1FVK A;  3L4N A;  1AQW A;  1OYJ A;  4YH2 A;  4HJM A;  3ME7 A;  1V57 A;  4JR4 A;  4ECI A;  3G7Y A;  5A5K A;  3F3R A;  2YPM A;  1VF4 A;  1B9Y C;  1YY7 A;  2DJK A;  4MJB A;  1G7O A;  4POL A;  1ERU A;  3H93 A;  1TTZ A;  3M9K A;  2REM A;  5AIS A;  3KJY A;  4HOJ A;  1QK8 A;  4TXO A;  1TRV A;  4OCE A;  2GSR A;  1GNW A;  2WB9 A;  2X8H A;  4DSS B;  2E0Q A;  4V2L A;  3D4T A;  4WF4 A;  2H6X A;  2HZF A;  4XS1 A;  2JZS A;  2BMX A;  3E3E A;  5J41 A;  3NOF A;  4WKW A;  2YZH A;  1YEP A;  2VAF A;  3LQ7 A;  5ECO B;  4F0C A;  4BVX A;  4ZB9 A;  3M3M A;  4PX1 A;  1QXH A;  2PVO C;  4MPF A;  2XHF A;  2VIM A;  3I9V 2;  5IMV A;  1GUH A;  5G1L A;  2KP1 A;  1AQV A;  3BJ5 A;  1V58 A;  1XWC A;  4X1U A;  3KM6 A;  4BPY A;  3CSI A;  3ZTL A;  1OE7 A;  5IO0 A;  3GN3 A;  5B6N A;  4ECC A;  4IJI A;  2RM5 A;  1DBY A;  1U3I A;  3GIX A;  4HI7 A;  5JWO B;  4K8M A;  2JZT A;  3F4T A;  2GGT A;  3G7I A;  2M72 A;  5KEJ A;  5D96 A;  4JRR A;  3AY8 A;  3MAK A;  3IDV A;  4EE0 A;  2YNX A;  3W8J A;  1SYX A;  3BBY A;  1Z7P A;  4NHZ A;  1JZR A;  4LL1 B;  5CRD A;  2AB6 A;  3EMP A;  3ED3 A;  1FW1 A;  4HU7 A;  3IAS 2;  5E59 A;  3I6A A;  5IPH A;  4NV5 A;  1K0D A;  1Y6E A;  16GS A;  1A0R P;  3DRN A;  3HXS A;  2PU9 C;  3TJG A;  3G9B A;  3M9J A;  2MYG A;  3EWL A;  1ZOF A;  2A4V A;  3TKS C;  3IV4 A;  3IHQ A;  3TCO A;  4KDY A;  5JWQ B;  1XW9 A;  2ON5 A;  2X64 A;  4F0B A;  1XWA A;  4TVE A;  5ECP B;  3O6T A;  2R3X A;  2YCD A;  2QGV A;  2GS3 A;  3KEB A;  2HT9 A;  1B4Q A;  2LJK A;  4ML1 A;  3LYK A;  4O7H A;  5DAK A;  2H73 A;  5LD0 A;  1KBN A;  1F3B A;  1OC3 A;  5LCZ A;  4IQA A;  5KN2 A;  4IP1 A;  2QSI A;  3ZVJ D;  1GP1 A;  4XCS A;  5FHI A;  3QR6 A;  5B7C A;  3R2Q A;  2FWE A;  3DVX A;  2VLT A;  2GSQ A;  3D21 A;  4DEJ A;  1ABA A;  3EU3 A;  1PGT A;  2O8V B;  2OAC A;  2H70 A;  3GKK A;  4LMV A;  1JLV A;  3ZMK A;  2KUC A;  1YJ6 A;  4V2N A;  3GX0 A;  2H1B A;  2VL2 A;  4RQR A;  3IE3 A;  2H30 A;  2H76 A;  2IIY A;  3ERG A;  1GUK A;  3Q74 A;  2I4A A;  4EL1 A;  3GH6 A;  1GSF A;  3P8W A;  4KCE A;  1BJX A;  3TGZ A;  3UVT A;  5D8I A;  2LUS A;  2K9F A;  2VCZ A;  5AGY A;  3ZIJ A;  3SBC A;  4IGJ A;  1F2E A;  1ZL9 A;  4EDY A;  3GTU A;  2OA7 A;  4EO3 A;  2LNT A;  3F6F A;  4IS0 A;  2KHP A;  1O8W A;  4GF0 A;  4XTS A;  3C71 A;  1T1V A;  3D6I A;  4TXO B;  3L78 A;  4CDO A;  3C7M A;  5DJL A;  2HYX A;  2OBK A;  3L0H A;  2H66 A;  4J57 E;  5DBQ A;  2TRX A;  3HVX A;  1AUC A;  5IPG A;  4OO4 A;  2B1L A;  2LEG A;  3L9U A;  1I9D A;  1EV4 A;  3CRU A;  3C73 A;  1K0O A;  1G7E A;  1GL8 A;  1EGO A;  1GTU A;  1PN9 A;  1MDK A;  3LXZ A;  4O32 A;  3O76 A;  4QL9 A;  2DJ3 A;  2OJL A;  1FB6 A;  4HDE A;  1YEX A;  1Y25 A;  2PN8 A;  4MH3 A;  5A4W A;  3CTG A;  3TRQ A;  4GQC A;  1USB A;  1SKS B;  3A2V A;  3UL3 A;  5C04 A;  2B6M A;  2IMD A;  1AW9 A;  1ZCP A;  1X5E A;  1BG5 A;  2KLX A;  1QUW A;  3GKX A;  1CQH A;  4NAX A;  3TKR A;  3EYT A;  3HHV A;  2E2G A;  4FYC A;  4XRD A;  18GS A;  1THO A;  1TRS A;  1URM A;  1GRX A;  3DML A;  1HYU A;  1ML6 A;  5ECI B;  3GST A;  3A3T A;  2FA8 A;  1SK0 A;  3LFL A;  2VLU A;  3GA4 A;  4AF2 A;  2DJJ A;  2OBI A;  1KEB A;  5JCW A;  2YV9 A;  3TJF A;  1TW9 A;  4F82 A;  1S3A A;  4XIH A;  3CBU A;  1AC1 A;  2V2G A;  1XOB A;  8GSS A;  3DVW A;  3F63 A;  3UBL A;  2OE0 A;  1F6M C;  2OAD A;  1GSU A;  4KH7 A;  1SJZ A;  4KUN A;  3TB2 A;  5HQP A;  5IO2 A;  1ZGN A;  2NVL A;  5INY A;  1SJ6 A;  4GCI A;  1GSQ A;  2PER A;  5J9B A;  1C72 A;  6GSS A;  3VK9 A;  2FWH A;  3FEU A;  3P90 A;  4NXI A;  1OAZ A;  3I43 A;  2LJA A;  1XVW A;  2M46 A;  3KCM A;  3LJR A;  1KNG A;  3EVI A;  4I2U A;  5DAK B;  4POK A;  5DVB A;  5IMF A;  4WBR D;  4I5Q A;  2C3T A;  5L71 A;  1K0M A;  2X99 A;  1GLQ A;  1TK5 B;  5G1K A;  4PUR A;  4ZL7 A;  4LA1 A;  4AJ8 A;  3ZIV A;  3ZIT A;  2R2J A;  2C0G A;  3C1S A;  4PUA A;  1YF1 A;  2HZE A;  5F06 A;  5ECQ B;  2AAW A;  4IQ1 A;  1K3O A;  4PNF A;  5LNK e;  2HSH A;  3FYG A;  5CP1 A;  3WD6 A;  2MMZ A;  1RK4 A;  4G2E A;  2BJX A;  4JE1 A;  4BWQ A;  4BL7 A;  2JL4 A;  3HJP A;  1GUL A;  2VCV A;  3CSJ A;  1GH2 A;  2QKE A;  2WCI A;  3VFI A;  1VF2 A;  3PH9 A;  3TJB A;  3UEM A;  1TK8 B;  2CVD A;  3N9J A;  4ZB8 A;  4YQU A;  2CV4 A;  3ZYW A;  1K0C A;  4V1A p;  3H79 A;  2NDO A;  5ECK B;  3GTU B;  3UVH A;  1DSB A;  4YAP A;  4DSR A;  4XS4 A;  4EUY A;  2H1G A;  3K8N A;  2JU5 A;  4MA9 A;  4FH8 A;  3HVV A;  4YQV A;  3QDN A;  5DDL A;  4K2D A;  1UC7 A;  1GSD A;  1LBK A;  1FHE A;  5F05 A;  2EIO A;  2HSY A;  17GS A;  4MF6 A;  3VPT A;  2DBC A;  3GX8 A;  5DCG A;  2HLS A;  1MDI A;  1R26 A;  5HR2 A;  12GS A;  5JCU A;  2CX3 A;  2TIR A;  5HFG A;  5IM9 A;  5KN0 A;  5IIZ A;  1ILO A;  2GST A;  2B5E A;  1PD2 1;  2GQM A;  1A2J A;  2K8S A;  4XS6 A;  3JCM L;  3V1W A;  4TR3 A;  2H75 A;  4KGI A;  1U88 A;  6GSU A;  4WF5 A;  1PL1 A;  4AJ6 A;  2E7P A;  1EOH A;  2DJ0 A;  3KGK A;  1HNB A;  1JZO A;  4E8H A;  3APQ A;  4V2M A;  1A2L A;  2LQO A;  2HXK A;  2J9H A;  6GST A;  1X5C A;  3UOM A;  4MK3 A; 
#chains in the Genus database with same CATH topology
 2X8G A;  2R5G A;  2NBS A;  2PMT A;  3WGE A;  2I81 A;  4O5R A;  4IN0 A;  3GH9 A;  4MPG A;  3NZN A;  2CVK A;  5F8B A;  1PMT A;  5ECN B;  3I69 A;  6GSW A;  5A4U A;  4TR1 A;  1GSY A;  5F0G A;  4HS1 A;  2L4Q A;  3N5O A;  1QQ2 A;  2YJH A;  3PGT A;  2VM2 A;  1SD8 A;  5KN1 A;  1XW6 A;  1BYE A;  3ME8 A;  2CX4 A;  4RUV A;  1Q4J A;  4TOP A;  4BWS A;  1LJR A;  1GTI A;  1ERT A;  3HDC A;  3LW9 A;  4KB3 A;  1TJD A;  3TRP A;  4POM A;  7GSS A;  4HQS A;  2CZ3 A;  1Z6N A;  1TRW A;  1EP8 A;  1EGR A;  3CYN A;  5JWR B;  5D9T A;  2B5X A;  5CNW A;  2AHE A;  3FY7 A;  3VI7 A;  4K0G A;  4MJA A;  1S3D A;  2HZE B;  2VL2 C;  1T4Z A;  3QAW A;  1JLW A;  3F8U A;  1ERW A;  1JZD A;  1K3Y A;  2CAQ A;  4PUF C;  1O73 A;  4ILF A;  2JAD A;  4BL7 B;  2LTK A;  3LXT A;  1V40 A;  1R5P A;  2LV3 A;  5CYY A;  3KH9 A;  4MZC A;  4OFM A;  1JZW A;  4MDC A;  2A2R A;  2R0C A;  6GSV A;  5ABR A;  3EIN A;  3VI5 A;  4MH2 A;  3TOU A;  2EC4 A;  3ZFL A;  3ZML A;  1M2D A;  1PQN A;  1FOV A;  1ZYQ B;  2A4H A;  4Q5R A;  3WT1 A;  4MF5 A;  4JU5 A;  2MBS A;  1X9M B;  3HVS A;  4XS4 B;  1VGL A;  2P0G A;  2AV4 A;  3SWL A;  22GS A;  4GSS A;  5G5F A;  5ID2 A;  5G30 A;  2WGR A;  2K18 A;  2PVQ A;  3GV1 A;  4IJ3 A;  1EOG A;  4FO5 A;  4MJC A;  2WRT A;  2WS2 A;  2FLS A;  1X9W B;  1A8L A;  1A8Y A;  3KMN A;  3FZ4 A;  2VL3 A;  3P7X A;  4KSM A;  3HKR A;  3DIE A;  3TKS E;  2L5L A;  1RQM A;  3MDK A;  5D9X A;  3C1R A;  3TKQ A;  1YQ1 A;  2LST A;  2A2S A;  3CXG A;  2H74 A;  2VLV A;  1WIK A;  3DYR A;  1M2A A;  4ZBA A;  3J7Y k;  4QL7 A;  3FW2 A;  2QA1 A;  5G2Z A;  5J5N A;  1PSQ A;  4Z2T A;  1Z7R A;  2WJU A;  1FVJ A;  3GKN A;  3QMX A;  4GSN A;  4ML6 A;  1MDJ A;  3WGX A;  1WPI A;  1V9W A;  1SJI A;  4CW9 A;  3D22 A;  1S3C A;  1K0B A;  4K0N A;  2GTU A;  2HRF A;  5DCH A;  1AAZ A;  1NHO A;  4GXZ A;  2YWO A;  2FHE A;  1OC8 A;  1IYH A;  5HR0 A;  3EUR A;  4LL4 B;  1V2A A;  3C8E A;  3US3 A;  5COH A;  4JBB A;  1ST9 A;  5ECL B;  4HQZ A;  4KA0 A;  1VRS D;  2MMO A;  3L9V A;  3QCP A;  4RI6 A;  5FWG A;  1FG4 A;  1GLP A;  2X4A A;  3HY2 A;  1TK0 B;  1QGV A;  3TJJ A;  4BVY A;  2V41 A;  1TRU A;  1B9X C;  1EEM A;  2FGX A;  3FR3 A;  2GT6 A;  3HJM A;  1WP0 A;  1GWC A;  2GVP A;  1T7P B;  1K0A A;  4EDZ A;  4IEL A;  4X0X A;  2L6C A;  4RQX A;  3FK8 A;  4N11 A;  5BMU A;  5E4W A;  3QFA C;  1WWJ A;  4AGS A;  2X8C A;  1GNE A;  4MP4 A;  4YKG A;  3W8S A;  3CRT A;  4MMM A;  5JCG A;  5F07 A;  5FT3 A;  4N30 A;  2D2Z A;  2VCQ A;  2IWT A;  3LWA A;  5H5R A;  1XVQ A;  4TW5 A;  4J2F A;  5C00 A;  2PUK C;  5J9C A;  5DAL A;  3VLN A;  1Z9H A;  2LNS A;  3IA1 A;  4K7I A;  4L8E A;  1IYI A;  4WBJ A;  2H0I A;  3W6G A;  2VO4 A;  2IFQ A;  2KP2 A;  1HNC A;  1EWX A;  4MCU A;  3EMX A;  2F9S A;  1XXU A;  5EVO A;  3ZLP A;  4D73 A;  2GSS A;  4HSC X;  5HFK A;  1M2B A;  4I8B A;  1F9M A;  4OFN A;  1Z3E A;  4PNG A;  3F6D A;  3E0U A;  4EF0 A;  2PBJ A;  1DUG A;  3GHA A;  4GQF A;  1SD9 A;  2XPD A;  3ZZX A;  2FUG 2;  4OWY A;  4GRF A;  2H1A A;  4I97 A;  4V1A g;  2OKA A;  5ECH B;  4Q5F A;  3LEF A;  3FZ5 A;  2AJQ B;  4Z7X A;  2XC2 A;  5DQS A;  4Z2R A;  1M3I A;  1OVN A;  1K3L A;  1A24 A;  1M99 A;  2OE1 A;  1UN2 A;  3EC3 A;  2ES7 A;  1G0T A;  4PGT A;  4ACS A;  5ID2 B;  1UVZ A;  5D9V A;  4IBP A;  3DWV A;  2H0H A;  3IOS A;  2AYT A;  2P5Q A;  3LYP A;  1OC9 A;  3NIV A;  1TU7 A;  3PIN A;  5CRG A;  2L57 A;  1MEK A;  4L0W A;  2F8F A;  5ELA A;  2G0F A;  3QAG A;  3RBT A;  4ULX A;  2QC7 A;  1ZYN A;  3KXO A;  4GST A;  4EVM A;  1TI3 A;  4GLT A;  4HUA A;  1TDI A;  3QFB C;  4L0U A;  5H5S A;  4K5R A;  4G19 A;  3ERF A;  1O6J A;  4Q5N A;  3U6V A;  3H1N A;  3F4R A;  2EIQ A;  2C0E A;  4K5S A;  2HE3 A;  1FAA A;  2H72 A;  2VD1 A;  4ISD A;  3RPN A;  3H8Q A;  4NV2 A;  4RI7 A;  1O85 A;  3MSZ A;  2NPB A;  3DXB A;  1MD3 A;  5B6M A;  4FYU A;  2DMM A;  2VCT A;  2YWM A;  1SYR A;  2N5A A;  1YKC A;  3VUR A;  4K2X A;  2DC5 A;  2PPT A;  5IOW A;  2FD3 A;  4HZ4 A;  5GZZ B;  4BVY B;  1YDK A;  4EC0 A;  1WOU A;  1PRX A;  2X49 A;  3FZ9 A;  2IME A;  3HYP A;  3DKS A;  1G6W A;  4MZB A;  4K9Z A;  4N0Z A;  3VWU A;  3HA9 A;  2ZNM A;  5G5E A;  2JAC A;  1XPV A;  1A23 A;  2I3Y A;  2H6Y A;  2I1U A;  1FB0 A;  3IK7 A;  3HJO A;  1SK1 A;  1T3B A;  2YP6 A;  3LOR A;  3ZL5 A;  2L4C A;  4TRX A;  5IOX A;  2O87 A;  1PL2 A;  1XOA A;  2XBQ A;  3GYK A;  5B8B A;  5ECM B;  1VF1 A;  1PX6 A;  2B1K A;  3KZQ A;  3PR8 A;  1GUM A;  5CRW A;  2R0G A;  4KDX A;  5DAL B;  1PA3 A;  4K6X A;  3TKP A;  4IVF A;  3DGQ A;  4A5P A;  2LQQ A;  2IFQ B;  2CQ9 A;  3KTB A;  2JSZ A;  2RM6 A;  3UAP A;  2TRC P;  3TJK A;  2DIZ A;  3TUE A;  2N5F A;  2H19 A;  5EPF A;  4PQH A;  2RUE A;  1W4V A;  4HZ2 A;  1WJK A;  1BAY A;  2XPE A;  3QAV A;  2O85 A;  3RHC A;  4D73 B;  3IHG A;  4N0V A;  1OKT A;  4KE3 A;  4MAB A;  2F3M A;  1YF0 A;  1GTA A;  5AIX A;  1Q98 A;  2VUP A;  3IAM 2;  1WMJ A;  1F3A A;  2IMF A;  2YV7 A;  4J56 E;  2WFC A;  3BCK A;  1I5G A;  2C3Q A;  2GQL A;  2VL9 A;  1A0F A;  1ON4 A;  14GS A;  2HRK A;  2H8L A;  1WE0 A;  3ZRE A;  5IMA A;  4XHM A;  1O81 A;  3H4K A;  4ZXG A;  1J08 A;  3BOA A;  3IC8 A;  2XBI A;  4PTS A;  1BQ7 A;  3HCZ A;  2HI7 A;  3EU4 A;  1XFL A;  5ECS A;  5HFI A;  3KP8 A;  2C80 A;  5DQY A;  1OC9 B;  3FHK A;  4KND A;  2PWJ A;  3TOT A;  3CTF A;  2V6K A;  4DSQ A;  4K7O A;  3F9U A;  2GZY A;  2C4J A;  3P2A A;  2ZUP A;  5H5Q A;  2FCH A;  3ISO A;  1HQO A;  1PKW A;  4HEA 2;  5GAN D;  5D93 A;  4NMU A;  3IBH A;  1XW5 A;  1NM3 A;  4MJE A;  20GS A;  2JSY A;  4JED A;  2R6K A;  1EZK A;  2IJY A;  1QFN A;  1VF3 A;  3UJ1 A;  2VOC A;  4JR6 A;  1KTE A;  1J9B A;  2K6V A;  3E9J B;  2O89 A;  3MNG A;  5A4V A;  1DE1 A;  2B7J A;  4KCA A;  4KW6 A;  3FR6 A;  3M1G A;  4OFT A;  2FNO A;  1SKR B;  2BTO T;  1U87 A;  3F0I A;  2V6O A;  1TKD B;  1NSW A;  4ZL9 A;  5GAP D;  5G31 A;  4FIW A;  3D5J A;  4LLR A;  3LGC A;  3R3E A;  5EY6 A;  4L5L A;  1ZYE A;  2C8U A;  1LU4 A;  2VM1 A;  3HZ8 A;  2GDR A;  3TDG A;  3S9F A;  4G0L A;  1DE2 A;  1XWG A;  4FQU A;  2YAN A;  2R37 A;  2GQK A;  2B3S A;  2IPA A;  5ELG A;  4AJ7 A;  1M9A A;  3CSH A;  1EV9 A;  1K0N A;  4N10 A;  1B48 A;  2IMI A;  4H86 A;  2RII A;  5J4U A;  4FYB A;  1M9B A;  1MD4 A;  1X5D A;  3QD9 A;  4PXO A;  4USS A;  5AN1 A;  1SU9 A;  4WEY A;  4WR4 A;  1TXX A;  3RHB A;  4F03 A;  4XRA A;  2ZCT A;  11GS A;  1M7T A;  4I2T A;  4IW9 A;  2RLI A;  4TKY A;  1MTC A;  3APS A;  3IPZ A;  3KMO A;  5ENU A;  2K8V A;  4YAV A;  1U6T A;  3ZFB A;  3WGD A;  2MBT A;  4Z2U A;  2Z9S A;  2B7K A;  3BCI A;  4K1F A;  3IRA A;  2B5Y A;  4KDU A;  2DSA A;  2DIY A;  2DKH A;  3A5I A;  2PGT A;  3HD5 A;  1GTB A;  4ZL8 A;  2F51 A;  4NWY A;  1O8X A;  5B8A A;  4KSO A;  1N2A A;  2FY6 A;  1JFU A;  3GL5 A;  1GSS A;  2YJ7 A;  2CAI A;  1ZMA A;  3FKF A;  4HU9 A;  2WDU A;  2E2M A;  2M80 A;  3A5W A;  2FA4 A;  1H75 A;  4F9Z A;  1TOF A;  2IN3 A;  2MZC A;  2ON7 A;  5EL8 A;  2F8A A;  5KN3 A;  4PQ1 A;  2A2P A;  4OCF A;  4X4J A;  2IL3 A;  4WET A;  4TR1 B;  3WT2 A;  3TKS A;  4ZIJ A;  2L5O A;  3IK9 A;  2YZU A;  3UIW A;  2O7K A;  5IMC A;  2HRN A;  6GSY A;  2ALB A;  3FZA A;  1YKA A;  4TXV A;  1ACV A;  4QQ7 A;  4NHW A;  2CA8 A;  2LKU A;  2YOI A;  5GSS A;  2CVB A;  2RUF A;  3A2W A;  2LS5 A;  3ZVJ A;  4GWR A;  1TU8 A;  19GS A;  3GUS A;  3WYW A;  1TP9 A;  2OE3 A;  3UMA A;  2I9H A;  4ECJ A;  1EP7 A;  3QPM A;  3VPQ A;  1THX A;  3FRC A;  3M0F A;  1RW1 A;  1BX9 A;  2H71 A;  1UA5 A;  1HD2 A;  3CMI A;  3J7Y b;  4YKF A;  1T4Y A;  4F2I A;  2KOK A;  2L6D A;  3GSS A;  2LRT A;  3APO A;  2IMK A;  3KIJ A;  5CAX A;  4POB A;  1XCC A;  1V98 A;  3DD3 A;  4DVC A;  3BD2 A;  2LRC A;  2DJ1 A;  2MMN A;  1JHB A;  2L59 A;  3M8N A;  1R7H A;  1T00 A;  3IXR A;  3D0Z A;  4OMV A;  2LJR A;  2H1D A;  4L5O A;  1XIY A;  2H0G A;  4ID0 A;  2MMA A;  3KTL A;  1TI1 A;  4IP6 A;  3KP9 A;  1T8E B;  2JZR A;  4X43 A;  3IR4 A;  1XWK A;  1XWB A;  1NW2 A;  3LSZ A;  4DSS A;  1H4O A;  2LRN A;  3TRX A;  5D73 A;  6GSX A;  4I6X A;  5KOX A;  1R5A A;  3MWH A;  1ERV A;  1Z6M A;  1E6B A;  4TR4 A;  1PKZ A;  1B4P A;  4LMW A;  2YWN A;  3Q18 A;  2J23 A;  1AIU A;  4G9H A;  1J0F A;  1AXD A;  1SL2 B;  3GFK A;  4KAE A;  3FR9 A;  2VCX A;  2YWI A;  4KF9 A;  5AIV A;  2C0D A;  1X9S B;  4HJ2 A;  1XZO A;  2WUL A;  3Q6O A;  3VWV A;  2V1M A;  2N5B A;  3IC4 A;  3ZRD A;  5D9W A;  2NTO A;  1OKD A;  4ZIL A;  2R4V A;  4CHS A;  5CRH A;  5IMZ A;  1WRY A;  1SEN A;  3FMW A;  2AUV A;  3G7J A;  3Q19 A;  10GS A;  2GT5 A;  1HNA A;  5J3R A;  2FWG A;  1SK2 A;  4EIP A;  1M0U A;  4EKZ A;  1PN0 A;  1B8X A;  2CT6 A;  3KH7 A;  1QMV A;  1OE8 A;  5CO3 A;  5HR3 A;  2DLX A;  2H6Z A;  1YZX A;  3ERW A;  1BED A;  5HR1 A;  2GZZ A;  1U3A A;  4IHU A;  3OR5 A;  4TR0 A;  5IQY A;  2FWF A;  3UBK A;  4ZB6 A;  3EE2 A;  1AQX A;  4IKH A;  3GMF A;  2C3N A;  3RDW A;  1FOH A;  2P5R A;  1EEJ A;  1G6Y A;  2C1Y A;  4MZW A;  4EIQ A;  4E8E A;  3L9S A;  1FO5 A;  2P31 A;  1E2Y A;  1SL0 B;  1SKW B;  2CZ2 A;  1GSE A;  4JZQ A;  3HZ4 A;  4GTU A;  1O7U A;  4ECB A;  4NPB A;  3GRX A;  2HNL A;  2G2Q A;  3KD0 A;  4G10 A;  4OD7 A;  4WR5 A;  4ZBD A;  2YN1 A;  4MF7 A;  1CQG A;  3VWX A;  4O92 A;  2GLR A;  4K7N A;  4MLY A;  13GS A;  1Z5Y E;  5GST A;  1R4W A;  4EXJ A;  2VD0 A;  3GL3 A;  1F37 A;  5CRE A;  4BA7 A;  2EIR A;  3RAZ A;  9GSS A;  4Q5Q A;  3VWW A;  1W89 A;  3LG6 A;  1NHY A;  3O3T A;  2DML A;  2C0F A;  5ECR B;  3QOU A;  4TN8 A;  2HFD A;  4ZBB A;  2DJ2 A;  3D4M A;  4YQM A;  1A2M A;  1XBS A;  3F3Q A;  4OO5 A;  1SL1 B;  3F4S A;  5IMD A;  3A2X A;  5DJM A;  3GNJ A;  3UAR A;  1ZZY A;  1X0R A;  3DEX A;  2H01 A;  2VCW A;  2WZ9 A;  3GKM A;  3U5R E;  1N8J A;  4PQI A;  4KX4 A;  1PX7 A;  3RPP A;  2V32 A;  4P3Y B;  3GUR A;  2GZP A;  4WXT A;  1FVK A;  3L4N A;  1AQW A;  1OYJ A;  4YH2 A;  4HJM A;  3ME7 A;  4O5U A;  1V57 A;  4JR4 A;  4MNN A;  4ECI A;  3G7Y A;  5A5K A;  3F3R A;  2YPM A;  1VF4 A;  1B9Y C;  1YY7 A;  2DJK A;  4MJB A;  1G7O A;  4POL A;  1ERU A;  3H93 A;  1M3J A;  1TTZ A;  3M9K A;  2REM A;  5AIS A;  3KJY A;  4HOJ A;  1QK8 A;  4TXO A;  1TRV A;  4OCE A;  2GSR A;  1GNW A;  2WB9 A;  4CY6 A;  2X8H A;  4DSS B;  2E0Q A;  4V2L A;  3D4T A;  2HSM A;  4WF4 A;  2H6X A;  2HZF A;  4XS1 A;  2JZS A;  2BMX A;  3E3E A;  5J41 A;  3NOF A;  4WKW A;  2YZH A;  1YEP A;  2VAF A;  3LQ7 A;  5ECO B;  4F0C A;  4BVX A;  4ZB9 A;  3M3M A;  4PX1 A;  1QXH A;  2PVO C;  4MPF A;  2XHF A;  2VIM A;  3I9V 2;  5IMV A;  1GUH A;  5G1L A;  2KP1 A;  1AQV A;  3BJ5 A;  1V58 A;  1XWC A;  4X1U A;  3KM6 A;  4BPY A;  3CSI A;  3ZTL A;  1OE7 A;  5IO0 A;  3GN3 A;  5B6N A;  4ECC A;  4IJI A;  2RM5 A;  1DBY A;  1U3I A;  3GIX A;  4HI7 A;  5JWO B;  2QA2 A;  4K8M A;  2JZT A;  3F4T A;  2GGT A;  3G7I A;  2M72 A;  5KEJ A;  5D96 A;  4JRR A;  3AY8 A;  3MAK A;  1S3R A;  3IDV A;  4EE0 A;  2YNX A;  3W8J A;  1SYX A;  3BBY A;  1Z7P A;  4NHZ A;  1JZR A;  4LL1 B;  5CRD A;  2AB6 A;  3EMP A;  3ED3 A;  1FW1 A;  4HU7 A;  3IAS 2;  5E59 A;  3I6A A;  5IPH A;  4NV5 A;  1K0D A;  1Y6E A;  16GS A;  1A0R P;  3DRN A;  3HXS A;  2PU9 C;  3TJG A;  3G9B A;  3M9J A;  2MYG A;  3EWL A;  1ZOF A;  2A4V A;  3TKS C;  3IV4 A;  3IHQ A;  3TCO A;  4KDY A;  5JWQ B;  1XW9 A;  2ON5 A;  2X64 A;  4F0B A;  1XWA A;  4TVE A;  5ECP B;  4ICY A;  3O6T A;  2R3X A;  2YCD A;  2QGV A;  1ZYP A;  2GS3 A;  4G0I A;  3KEB A;  2HT9 A;  4G0K A;  1B4Q A;  2LJK A;  4ML1 A;  3LYK A;  4O7H A;  5DAK A;  2H73 A;  5LD0 A;  1KBN A;  1F3B A;  1OC3 A;  5LCZ A;  4IQA A;  5KN2 A;  4IP1 A;  2QSI A;  3ZVJ D;  1GP1 A;  4XCS A;  5FHI A;  3QR6 A;  5B7C A;  3R2Q A;  2FWE A;  3DVX A;  2VLT A;  2GSQ A;  3D21 A;  4DEJ A;  1ABA A;  3EU3 A;  1PGT A;  2O8V B;  2OAC A;  1XG8 A;  2H70 A;  3GKK A;  4LMV A;  1JLV A;  3ZMK A;  2KUC A;  1YJ6 A;  4V2N A;  3GX0 A;  2H1B A;  2VL2 A;  4RQR A;  3IE3 A;  2H30 A;  2H76 A;  2IIY A;  3ERG A;  1GUK A;  3Q74 A;  2I4A A;  4EL1 A;  3GH6 A;  1GSF A;  3P8W A;  4KCE A;  1BJX A;  3TGZ A;  3UVT A;  5D8I A;  2LUS A;  2K9F A;  2VCZ A;  5AGY A;  3ZIJ A;  3SBC A;  4IGJ A;  1F2E A;  1ZL9 A;  4EDY A;  3GTU A;  2OA7 A;  4EO3 A;  2LNT A;  3F6F A;  4IS0 A;  2KHP A;  1O8W A;  4GF0 A;  4XTS A;  3C71 A;  1T1V A;  3D6I A;  4TXO B;  3L78 A;  4CDO A;  3C7M A;  5DJL A;  2HYX A;  2OBK A;  1PFO A;  3L0H A;  2H66 A;  4J57 E;  5DBQ A;  3CQF A;  2TRX A;  3HVX A;  1AUC A;  5IPG A;  4OO4 A;  2B1L A;  2LEG A;  3L9U A;  1I9D A;  1EV4 A;  3CRU A;  3C73 A;  1K0O A;  4BVX B;  1G7E A;  1GL8 A;  1EGO A;  1GTU A;  1PN9 A;  1MDK A;  3LXZ A;  4O32 A;  3O76 A;  4QL9 A;  2DJ3 A;  2OJL A;  1FB6 A;  4HDE A;  1YEX A;  1Y25 A;  2PN8 A;  4MH3 A;  5A4W A;  3CTG A;  3TRQ A;  4GQC A;  1USB A;  1SKS B;  3A2V A;  3UL3 A;  5C04 A;  2B6M A;  2IMD A;  1AW9 A;  1ZCP A;  1X5E A;  1BG5 A;  2KLX A;  1QUW A;  3GKX A;  1CQH A;  4NAX A;  3TKR A;  3EYT A;  3HHV A;  2E2G A;  4FYC A;  4XRD A;  18GS A;  1THO A;  1TRS A;  1URM A;  1GRX A;  3DML A;  1HYU A;  1ML6 A;  5ECI B;  3GST A;  3A3T A;  2FA8 A;  1SK0 A;  3LFL A;  2VLU A;  3GA4 A;  4AF2 A;  2DJJ A;  2OBI A;  1KEB A;  5JCW A;  2YV9 A;  3TJF A;  1TW9 A;  4F82 A;  1S3A A;  4XIH A;  3CBU A;  1AC1 A;  2V2G A;  1XOB A;  8GSS A;  3DVW A;  3F63 A;  3UBL A;  2OE0 A;  1F6M C;  2OAD A;  1GSU A;  4KH7 A;  1SJZ A;  4KUN A;  3TB2 A;  5HQP A;  5IO2 A;  1ZGN A;  2NVL A;  5INY A;  1SJ6 A;  4GCI A;  1GSQ A;  2PER A;  5J9B A;  5KOW A;  1C72 A;  6GSS A;  3VK9 A;  2FWH A;  3FEU A;  3P90 A;  4NXI A;  1OAZ A;  4BIK A;  3I43 A;  2R0P A;  2LJA A;  1XVW A;  2M46 A;  3KCM A;  3LJR A;  1KNG A;  3EVI A;  4I2U A;  5DAK B;  4POK A;  5DVB A;  5IMF A;  4WBR D;  4I5Q A;  2C3T A;  5L71 A;  1K0M A;  2X99 A;  1GLQ A;  1TK5 B;  5G1K A;  4PUR A;  4ZL7 A;  4LA1 A;  4AJ8 A;  3ZIV A;  3ZIT A;  2R2J A;  3PPU A;  2C0G A;  3C1S A;  4PUA A;  1YF1 A;  2HZE A;  5F06 A;  5ECQ B;  2AAW A;  4IQ1 A;  1K3O A;  4PNF A;  5LNK e;  2HSH A;  3EPT A;  3FYG A;  5CP1 A;  3WD6 A;  4CY8 A;  2MMZ A;  1RK4 A;  4G2E A;  2BJX A;  3MIX A;  4JE1 A;  4BWQ A;  4BL7 A;  2JL4 A;  3HJP A;  1GUL A;  2VCV A;  3CSJ A;  1GH2 A;  2QKE A;  2WCI A;  3VFI A;  1VF2 A;  3PH9 A;  3TJB A;  3UEM A;  2HRA A;  1TK8 B;  2CVD A;  3N9J A;  4ZB8 A;  4YQU A;  2CV4 A;  3ZYW A;  1K0C A;  4V1A p;  3H79 A;  2NDO A;  5ECK B;  3GTU B;  3UVH A;  1DSB A;  4YAP A;  4DSR A;  4XS4 A;  4EUY A;  2H1G A;  3K8N A;  2DKI A;  2JU5 A;  4MA9 A;  4FH8 A;  3HVV A;  4YQV A;  3QDN A;  5DDL A;  4K2D A;  1UC7 A;  1GSD A;  1LBK A;  1FHE A;  5F05 A;  2EIO A;  2HSY A;  17GS A;  4MF6 A;  3VPT A;  2DBC A;  3GX8 A;  5DCG A;  2HLS A;  1MDI A;  1R26 A;  5HR2 A;  12GS A;  5JCU A;  2CX3 A;  2TIR A;  5HFG A;  5IM9 A;  5KN0 A;  5IIZ A;  1ILO A;  2GST A;  2B5E A;  1PD2 1;  2GQM A;  1A2J A;  2K8S A;  3HVN A;  3MYD A;  4O5Q A;  4XS6 A;  3JCM L;  3V1W A;  4TR3 A;  2H75 A;  4KGI A;  1U88 A;  6GSU A;  4WF5 A;  1PL1 A;  4AJ6 A;  2E7P A;  1EOH A;  2DJ0 A;  3KGK A;  1HNB A;  1JZO A;  4E8H A;  3APQ A;  4V2M A;  1A2L A;  2LQO A;  5BRT A;  2HXK A;  2UZ8 A;  2J9H A;  6GST A;  1X5C A;  3UOM A;  4MK3 A; 
#chains in the Genus database with same CATH homology
 2X8G A;  2R5G A;  2NBS A;  2PMT A;  3WGE A;  2I81 A;  4O5R A;  4IN0 A;  3GH9 A;  4MPG A;  3NZN A;  2CVK A;  5F8B A;  1PMT A;  5ECN B;  3I69 A;  6GSW A;  5A4U A;  4TR1 A;  1GSY A;  5F0G A;  4HS1 A;  2L4Q A;  3N5O A;  1QQ2 A;  2YJH A;  3PGT A;  2VM2 A;  1SD8 A;  5KN1 A;  1XW6 A;  1BYE A;  3ME8 A;  2CX4 A;  4RUV A;  1Q4J A;  4TOP A;  4BWS A;  1LJR A;  1GTI A;  1ERT A;  3HDC A;  3LW9 A;  4KB3 A;  1TJD A;  3TRP A;  4POM A;  7GSS A;  4HQS A;  2CZ3 A;  1Z6N A;  1TRW A;  1EP8 A;  1EGR A;  3CYN A;  5JWR B;  5D9T A;  2B5X A;  5CNW A;  2AHE A;  3FY7 A;  3VI7 A;  4K0G A;  4MJA A;  1S3D A;  2HZE B;  2VL2 C;  1T4Z A;  3QAW A;  1JLW A;  3F8U A;  1ERW A;  1JZD A;  1K3Y A;  2CAQ A;  4PUF C;  1O73 A;  4ILF A;  2JAD A;  4BL7 B;  2LTK A;  3LXT A;  1V40 A;  1R5P A;  2LV3 A;  5CYY A;  3KH9 A;  4MZC A;  4OFM A;  1JZW A;  4MDC A;  2A2R A;  2R0C A;  6GSV A;  5ABR A;  3EIN A;  3VI5 A;  4MH2 A;  3TOU A;  2EC4 A;  3ZFL A;  3ZML A;  1M2D A;  1PQN A;  1FOV A;  1ZYQ B;  2A4H A;  4Q5R A;  3WT1 A;  4MF5 A;  4JU5 A;  2MBS A;  1X9M B;  3HVS A;  4XS4 B;  1VGL A;  2P0G A;  2AV4 A;  3SWL A;  22GS A;  4GSS A;  5G5F A;  5ID2 A;  5G30 A;  2WGR A;  2K18 A;  2PVQ A;  3GV1 A;  4IJ3 A;  1EOG A;  4FO5 A;  4MJC A;  2WRT A;  2WS2 A;  2FLS A;  1X9W B;  1A8L A;  1A8Y A;  3KMN A;  3FZ4 A;  2VL3 A;  3P7X A;  4KSM A;  3HKR A;  3DIE A;  3TKS E;  2L5L A;  1RQM A;  3MDK A;  5D9X A;  3C1R A;  3TKQ A;  1YQ1 A;  2LST A;  2A2S A;  3CXG A;  2H74 A;  2VLV A;  1WIK A;  3DYR A;  1M2A A;  4ZBA A;  3J7Y k;  4QL7 A;  3FW2 A;  2QA1 A;  5G2Z A;  5J5N A;  1PSQ A;  4Z2T A;  1Z7R A;  2WJU A;  1FVJ A;  3GKN A;  3QMX A;  4GSN A;  4ML6 A;  1MDJ A;  3WGX A;  1WPI A;  1V9W A;  1SJI A;  4CW9 A;  3D22 A;  1S3C A;  1K0B A;  4K0N A;  2GTU A;  2HRF A;  5DCH A;  1AAZ A;  1NHO A;  4GXZ A;  2YWO A;  2FHE A;  1OC8 A;  1IYH A;  5HR0 A;  3EUR A;  4LL4 B;  1V2A A;  3C8E A;  3US3 A;  5COH A;  4JBB A;  1ST9 A;  5ECL B;  4HQZ A;  4KA0 A;  1VRS D;  2MMO A;  3L9V A;  3QCP A;  4RI6 A;  5FWG A;  1FG4 A;  1GLP A;  2X4A A;  3HY2 A;  1TK0 B;  1QGV A;  3TJJ A;  4BVY A;  2V41 A;  1TRU A;  1B9X C;  1EEM A;  2FGX A;  3FR3 A;  2GT6 A;  3HJM A;  1WP0 A;  1GWC A;  2GVP A;  1T7P B;  1K0A A;  4EDZ A;  4IEL A;  4X0X A;  2L6C A;  4RQX A;  3FK8 A;  4N11 A;  5BMU A;  5E4W A;  3QFA C;  1WWJ A;  4AGS A;  2X8C A;  1GNE A;  4MP4 A;  4YKG A;  3W8S A;  3CRT A;  4MMM A;  5JCG A;  5F07 A;  5FT3 A;  4N30 A;  2D2Z A;  2VCQ A;  2IWT A;  3LWA A;  5H5R A;  1XVQ A;  4TW5 A;  4J2F A;  5C00 A;  2PUK C;  5J9C A;  5DAL A;  3VLN A;  1Z9H A;  2LNS A;  3IA1 A;  4K7I A;  4L8E A;  1IYI A;  4WBJ A;  2H0I A;  3W6G A;  2VO4 A;  2IFQ A;  2KP2 A;  1HNC A;  1EWX A;  4MCU A;  3EMX A;  2F9S A;  1XXU A;  5EVO A;  3ZLP A;  4D73 A;  2GSS A;  5HFK A;  1M2B A;  4I8B A;  1F9M A;  4OFN A;  1Z3E A;  4PNG A;  3F6D A;  3E0U A;  4EF0 A;  2PBJ A;  1DUG A;  3GHA A;  4GQF A;  1SD9 A;  2XPD A;  3ZZX A;  2FUG 2;  4OWY A;  4GRF A;  2H1A A;  4I97 A;  4V1A g;  2OKA A;  5ECH B;  4Q5F A;  3LEF A;  3FZ5 A;  2AJQ B;  4Z7X A;  2XC2 A;  5DQS A;  4Z2R A;  1OVN A;  1K3L A;  1A24 A;  1M99 A;  2OE1 A;  1UN2 A;  3EC3 A;  2ES7 A;  1G0T A;  4PGT A;  4ACS A;  5ID2 B;  1UVZ A;  5D9V A;  4IBP A;  3DWV A;  2H0H A;  3IOS A;  2AYT A;  2P5Q A;  3LYP A;  1OC9 A;  3NIV A;  1TU7 A;  3PIN A;  5CRG A;  2L57 A;  1MEK A;  4L0W A;  2F8F A;  5ELA A;  2G0F A;  3QAG A;  3RBT A;  4ULX A;  2QC7 A;  1ZYN A;  3KXO A;  4GST A;  4EVM A;  1TI3 A;  4GLT A;  4HUA A;  1TDI A;  3QFB C;  4L0U A;  5H5S A;  4K5R A;  4G19 A;  3ERF A;  1O6J A;  4Q5N A;  3U6V A;  3H1N A;  3F4R A;  2EIQ A;  2C0E A;  4K5S A;  2HE3 A;  1FAA A;  2H72 A;  2VD1 A;  4ISD A;  3RPN A;  3H8Q A;  4NV2 A;  4RI7 A;  1O85 A;  3MSZ A;  2NPB A;  3DXB A;  1MD3 A;  5B6M A;  4FYU A;  2DMM A;  2VCT A;  2YWM A;  1SYR A;  2N5A A;  1YKC A;  3VUR A;  4K2X A;  2DC5 A;  2PPT A;  5IOW A;  2FD3 A;  4HZ4 A;  5GZZ B;  4BVY B;  1YDK A;  4EC0 A;  1WOU A;  1PRX A;  2X49 A;  3FZ9 A;  2IME A;  3HYP A;  3DKS A;  1G6W A;  4MZB A;  4K9Z A;  4N0Z A;  3VWU A;  3HA9 A;  2ZNM A;  5G5E A;  2JAC A;  1XPV A;  1A23 A;  2I3Y A;  2H6Y A;  2I1U A;  1FB0 A;  3IK7 A;  3HJO A;  1SK1 A;  1T3B A;  2YP6 A;  3LOR A;  3ZL5 A;  2L4C A;  4TRX A;  5IOX A;  2O87 A;  1PL2 A;  1XOA A;  2XBQ A;  3GYK A;  5B8B A;  5ECM B;  1VF1 A;  1PX6 A;  2B1K A;  3KZQ A;  3PR8 A;  1GUM A;  5CRW A;  2R0G A;  4KDX A;  5DAL B;  1PA3 A;  4K6X A;  3TKP A;  4IVF A;  3DGQ A;  4A5P A;  2LQQ A;  2IFQ B;  2CQ9 A;  3KTB A;  2JSZ A;  2RM6 A;  3UAP A;  2TRC P;  3TJK A;  2DIZ A;  3TUE A;  2N5F A;  2H19 A;  5EPF A;  4PQH A;  2RUE A;  1W4V A;  4HZ2 A;  1WJK A;  1BAY A;  2XPE A;  3QAV A;  2O85 A;  3RHC A;  4D73 B;  3IHG A;  4N0V A;  1OKT A;  4KE3 A;  4MAB A;  2F3M A;  1YF0 A;  1GTA A;  5AIX A;  1Q98 A;  2VUP A;  3IAM 2;  1WMJ A;  1F3A A;  2IMF A;  2YV7 A;  4J56 E;  2WFC A;  3BCK A;  1I5G A;  2C3Q A;  2GQL A;  2VL9 A;  1A0F A;  1ON4 A;  14GS A;  2HRK A;  2H8L A;  1WE0 A;  3ZRE A;  5IMA A;  4XHM A;  1O81 A;  3H4K A;  4ZXG A;  1J08 A;  3BOA A;  3IC8 A;  2XBI A;  4PTS A;  1BQ7 A;  3HCZ A;  2HI7 A;  3EU4 A;  1XFL A;  5ECS A;  5HFI A;  3KP8 A;  2C80 A;  5DQY A;  1OC9 B;  3FHK A;  4KND A;  2PWJ A;  3TOT A;  3CTF A;  2V6K A;  4DSQ A;  4K7O A;  3F9U A;  2GZY A;  2C4J A;  3P2A A;  2ZUP A;  5H5Q A;  2FCH A;  3ISO A;  1HQO A;  1PKW A;  4HEA 2;  5GAN D;  5D93 A;  4NMU A;  3IBH A;  1XW5 A;  1NM3 A;  4MJE A;  20GS A;  2JSY A;  4JED A;  2R6K A;  1EZK A;  2IJY A;  1QFN A;  1VF3 A;  3UJ1 A;  2VOC A;  4JR6 A;  1KTE A;  1J9B A;  2K6V A;  3E9J B;  2O89 A;  3MNG A;  5A4V A;  1DE1 A;  2B7J A;  4KCA A;  4KW6 A;  3FR6 A;  3M1G A;  4OFT A;  2FNO A;  1SKR B;  2BTO T;  1U87 A;  3F0I A;  2V6O A;  1TKD B;  1NSW A;  4ZL9 A;  5GAP D;  5G31 A;  4FIW A;  3D5J A;  4LLR A;  3LGC A;  3R3E A;  5EY6 A;  4L5L A;  1ZYE A;  2C8U A;  1LU4 A;  2VM1 A;  3HZ8 A;  2GDR A;  3TDG A;  3S9F A;  4G0L A;  1DE2 A;  1XWG A;  4FQU A;  2YAN A;  2R37 A;  2GQK A;  2B3S A;  2IPA A;  5ELG A;  4AJ7 A;  1M9A A;  3CSH A;  1EV9 A;  1K0N A;  4N10 A;  1B48 A;  2IMI A;  4H86 A;  2RII A;  5J4U A;  4FYB A;  1M9B A;  1MD4 A;  1X5D A;  3QD9 A;  4PXO A;  4USS A;  5AN1 A;  1SU9 A;  4WEY A;  4WR4 A;  1TXX A;  3RHB A;  4F03 A;  4XRA A;  2ZCT A;  11GS A;  1M7T A;  4I2T A;  4IW9 A;  2RLI A;  4TKY A;  1MTC A;  3APS A;  3IPZ A;  3KMO A;  5ENU A;  2K8V A;  4YAV A;  1U6T A;  3ZFB A;  3WGD A;  2MBT A;  4Z2U A;  2Z9S A;  2B7K A;  3BCI A;  4K1F A;  3IRA A;  2B5Y A;  4KDU A;  2DSA A;  2DIY A;  2DKH A;  3A5I A;  2PGT A;  3HD5 A;  1GTB A;  4ZL8 A;  2F51 A;  4NWY A;  1O8X A;  5B8A A;  4KSO A;  1N2A A;  2FY6 A;  1JFU A;  3GL5 A;  1GSS A;  2YJ7 A;  2CAI A;  1ZMA A;  3FKF A;  4HU9 A;  2WDU A;  2E2M A;  2M80 A;  3A5W A;  2FA4 A;  1H75 A;  4F9Z A;  1TOF A;  2IN3 A;  2MZC A;  2ON7 A;  5EL8 A;  2F8A A;  5KN3 A;  4PQ1 A;  2A2P A;  4OCF A;  4X4J A;  2IL3 A;  4WET A;  4TR1 B;  3WT2 A;  3TKS A;  4ZIJ A;  2L5O A;  3IK9 A;  2YZU A;  3UIW A;  2O7K A;  5IMC A;  2HRN A;  6GSY A;  2ALB A;  3FZA A;  1YKA A;  4TXV A;  1ACV A;  4QQ7 A;  4NHW A;  2CA8 A;  2LKU A;  2YOI A;  5GSS A;  2CVB A;  2RUF A;  3A2W A;  2LS5 A;  3ZVJ A;  4GWR A;  1TU8 A;  19GS A;  3GUS A;  3WYW A;  1TP9 A;  2OE3 A;  3UMA A;  2I9H A;  4ECJ A;  1EP7 A;  3QPM A;  3VPQ A;  1THX A;  3FRC A;  3M0F A;  1RW1 A;  1BX9 A;  2H71 A;  1UA5 A;  1HD2 A;  3CMI A;  3J7Y b;  4YKF A;  1T4Y A;  4F2I A;  2KOK A;  2L6D A;  3GSS A;  2LRT A;  3APO A;  2IMK A;  3KIJ A;  5CAX A;  4POB A;  1XCC A;  1V98 A;  3DD3 A;  4DVC A;  3BD2 A;  2LRC A;  2DJ1 A;  2MMN A;  1JHB A;  2L59 A;  3M8N A;  1R7H A;  1T00 A;  3IXR A;  3D0Z A;  4OMV A;  2LJR A;  2H1D A;  4L5O A;  1XIY A;  2H0G A;  4ID0 A;  2MMA A;  3KTL A;  1TI1 A;  4IP6 A;  3KP9 A;  1T8E B;  2JZR A;  4X43 A;  3IR4 A;  1XWK A;  1XWB A;  1NW2 A;  3LSZ A;  4DSS A;  1H4O A;  2LRN A;  3TRX A;  5D73 A;  6GSX A;  4I6X A;  5KOX A;  1R5A A;  3MWH A;  1ERV A;  1Z6M A;  1E6B A;  4TR4 A;  1PKZ A;  1B4P A;  4LMW A;  2YWN A;  3Q18 A;  2J23 A;  1AIU A;  4G9H A;  1J0F A;  1AXD A;  1SL2 B;  3GFK A;  4KAE A;  3FR9 A;  2VCX A;  2YWI A;  4KF9 A;  5AIV A;  2C0D A;  1X9S B;  4HJ2 A;  1XZO A;  2WUL A;  3Q6O A;  3VWV A;  2V1M A;  2N5B A;  3IC4 A;  3ZRD A;  5D9W A;  2NTO A;  1OKD A;  4ZIL A;  2R4V A;  4CHS A;  5CRH A;  5IMZ A;  1WRY A;  1SEN A;  3FMW A;  2AUV A;  3G7J A;  3Q19 A;  10GS A;  2GT5 A;  1HNA A;  5J3R A;  2FWG A;  1SK2 A;  4EIP A;  1M0U A;  4EKZ A;  1PN0 A;  1B8X A;  2CT6 A;  3KH7 A;  1QMV A;  1OE8 A;  5CO3 A;  5HR3 A;  2DLX A;  2H6Z A;  1YZX A;  3ERW A;  1BED A;  5HR1 A;  2GZZ A;  1U3A A;  4IHU A;  3OR5 A;  4TR0 A;  5IQY A;  2FWF A;  3UBK A;  4ZB6 A;  3EE2 A;  1AQX A;  4IKH A;  3GMF A;  2C3N A;  3RDW A;  1FOH A;  2P5R A;  1EEJ A;  1G6Y A;  2C1Y A;  4MZW A;  4EIQ A;  4E8E A;  3L9S A;  1FO5 A;  2P31 A;  1E2Y A;  1SL0 B;  1SKW B;  2CZ2 A;  1GSE A;  4JZQ A;  3HZ4 A;  4GTU A;  1O7U A;  4ECB A;  4NPB A;  3GRX A;  2HNL A;  2G2Q A;  3KD0 A;  4G10 A;  4OD7 A;  4WR5 A;  4ZBD A;  2YN1 A;  4MF7 A;  1CQG A;  3VWX A;  4O92 A;  2GLR A;  4K7N A;  4MLY A;  13GS A;  1Z5Y E;  5GST A;  1R4W A;  4EXJ A;  2VD0 A;  3GL3 A;  1F37 A;  5CRE A;  4BA7 A;  2EIR A;  3RAZ A;  9GSS A;  4Q5Q A;  3VWW A;  1W89 A;  3LG6 A;  1NHY A;  3O3T A;  2DML A;  2C0F A;  5ECR B;  3QOU A;  4TN8 A;  2HFD A;  4ZBB A;  2DJ2 A;  3D4M A;  4YQM A;  1A2M A;  1XBS A;  3F3Q A;  4OO5 A;  1SL1 B;  3F4S A;  5IMD A;  3A2X A;  5DJM A;  3GNJ A;  3UAR A;  1ZZY A;  1X0R A;  3DEX A;  2H01 A;  2VCW A;  2WZ9 A;  3GKM A;  3U5R E;  1N8J A;  4PQI A;  4KX4 A;  1PX7 A;  3RPP A;  2V32 A;  4P3Y B;  3GUR A;  2GZP A;  4WXT A;  1FVK A;  3L4N A;  1AQW A;  1OYJ A;  4YH2 A;  4HJM A;  3ME7 A;  4O5U A;  1V57 A;  4JR4 A;  4MNN A;  4ECI A;  3G7Y A;  5A5K A;  3F3R A;  2YPM A;  1VF4 A;  1B9Y C;  1YY7 A;  2DJK A;  4MJB A;  1G7O A;  4POL A;  1ERU A;  3H93 A;  1TTZ A;  3M9K A;  2REM A;  5AIS A;  3KJY A;  4HOJ A;  1QK8 A;  4TXO A;  1TRV A;  4OCE A;  2GSR A;  1GNW A;  2WB9 A;  4CY6 A;  2X8H A;  4DSS B;  2E0Q A;  4V2L A;  3D4T A;  2HSM A;  4WF4 A;  2H6X A;  2HZF A;  4XS1 A;  2JZS A;  2BMX A;  3E3E A;  5J41 A;  3NOF A;  4WKW A;  2YZH A;  1YEP A;  2VAF A;  3LQ7 A;  5ECO B;  4F0C A;  4BVX A;  4ZB9 A;  3M3M A;  4PX1 A;  1QXH A;  2PVO C;  4MPF A;  2XHF A;  2VIM A;  3I9V 2;  5IMV A;  1GUH A;  5G1L A;  2KP1 A;  1AQV A;  3BJ5 A;  1V58 A;  1XWC A;  4X1U A;  3KM6 A;  4BPY A;  3CSI A;  3ZTL A;  1OE7 A;  5IO0 A;  3GN3 A;  5B6N A;  4ECC A;  4IJI A;  2RM5 A;  1DBY A;  1U3I A;  3GIX A;  4HI7 A;  5JWO B;  2QA2 A;  4K8M A;  2JZT A;  3F4T A;  2GGT A;  3G7I A;  2M72 A;  5KEJ A;  5D96 A;  4JRR A;  3AY8 A;  3MAK A;  3IDV A;  4EE0 A;  2YNX A;  3W8J A;  1SYX A;  3BBY A;  1Z7P A;  4NHZ A;  1JZR A;  4LL1 B;  5CRD A;  2AB6 A;  3EMP A;  3ED3 A;  1FW1 A;  4HU7 A;  3IAS 2;  5E59 A;  3I6A A;  5IPH A;  4NV5 A;  1K0D A;  1Y6E A;  16GS A;  1A0R P;  3DRN A;  3HXS A;  2PU9 C;  3TJG A;  3G9B A;  3M9J A;  2MYG A;  3EWL A;  1ZOF A;  2A4V A;  3TKS C;  3IV4 A;  3IHQ A;  3TCO A;  4KDY A;  5JWQ B;  1XW9 A;  2ON5 A;  2X64 A;  4F0B A;  1XWA A;  4TVE A;  5ECP B;  4ICY A;  3O6T A;  2R3X A;  2YCD A;  2QGV A;  1ZYP A;  2GS3 A;  4G0I A;  3KEB A;  2HT9 A;  4G0K A;  1B4Q A;  2LJK A;  4ML1 A;  3LYK A;  4O7H A;  5DAK A;  2H73 A;  5LD0 A;  1KBN A;  1F3B A;  1OC3 A;  5LCZ A;  4IQA A;  5KN2 A;  4IP1 A;  2QSI A;  3ZVJ D;  1GP1 A;  4XCS A;  5FHI A;  3QR6 A;  5B7C A;  3R2Q A;  2FWE A;  3DVX A;  2VLT A;  2GSQ A;  3D21 A;  4DEJ A;  1ABA A;  3EU3 A;  1PGT A;  2O8V B;  2OAC A;  2H70 A;  3GKK A;  4LMV A;  1JLV A;  3ZMK A;  2KUC A;  1YJ6 A;  4V2N A;  3GX0 A;  2H1B A;  2VL2 A;  4RQR A;  3IE3 A;  2H30 A;  2H76 A;  2IIY A;  3ERG A;  1GUK A;  3Q74 A;  2I4A A;  4EL1 A;  3GH6 A;  1GSF A;  3P8W A;  4KCE A;  1BJX A;  3TGZ A;  3UVT A;  5D8I A;  2LUS A;  2K9F A;  2VCZ A;  5AGY A;  3ZIJ A;  3SBC A;  4IGJ A;  1F2E A;  1ZL9 A;  4EDY A;  3GTU A;  2OA7 A;  4EO3 A;  2LNT A;  3F6F A;  4IS0 A;  2KHP A;  1O8W A;  4GF0 A;  4XTS A;  3C71 A;  1T1V A;  3D6I A;  4TXO B;  3L78 A;  4CDO A;  3C7M A;  5DJL A;  2HYX A;  2OBK A;  3L0H A;  2H66 A;  4J57 E;  5DBQ A;  2TRX A;  3HVX A;  1AUC A;  5IPG A;  4OO4 A;  2B1L A;  2LEG A;  3L9U A;  1I9D A;  1EV4 A;  3CRU A;  3C73 A;  1K0O A;  4BVX B;  1G7E A;  1GL8 A;  1EGO A;  1GTU A;  1PN9 A;  1MDK A;  3LXZ A;  4O32 A;  3O76 A;  4QL9 A;  2DJ3 A;  2OJL A;  1FB6 A;  4HDE A;  1YEX A;  1Y25 A;  2PN8 A;  4MH3 A;  5A4W A;  3CTG A;  3TRQ A;  4GQC A;  1USB A;  1SKS B;  3A2V A;  3UL3 A;  5C04 A;  2B6M A;  2IMD A;  1AW9 A;  1ZCP A;  1X5E A;  1BG5 A;  2KLX A;  1QUW A;  3GKX A;  1CQH A;  4NAX A;  3TKR A;  3EYT A;  3HHV A;  2E2G A;  4FYC A;  4XRD A;  18GS A;  1THO A;  1TRS A;  1URM A;  1GRX A;  3DML A;  1HYU A;  1ML6 A;  5ECI B;  3GST A;  3A3T A;  2FA8 A;  1SK0 A;  3LFL A;  2VLU A;  3GA4 A;  4AF2 A;  2DJJ A;  2OBI A;  1KEB A;  5JCW A;  2YV9 A;  3TJF A;  1TW9 A;  4F82 A;  1S3A A;  4XIH A;  3CBU A;  1AC1 A;  2V2G A;  1XOB A;  8GSS A;  3DVW A;  3F63 A;  3UBL A;  2OE0 A;  1F6M C;  2OAD A;  1GSU A;  4KH7 A;  1SJZ A;  4KUN A;  3TB2 A;  5HQP A;  5IO2 A;  1ZGN A;  2NVL A;  5INY A;  1SJ6 A;  4GCI A;  1GSQ A;  2PER A;  5J9B A;  5KOW A;  1C72 A;  6GSS A;  3VK9 A;  2FWH A;  3FEU A;  3P90 A;  4NXI A;  1OAZ A;  3I43 A;  2R0P A;  2LJA A;  1XVW A;  2M46 A;  3KCM A;  3LJR A;  1KNG A;  3EVI A;  4I2U A;  5DAK B;  4POK A;  5DVB A;  5IMF A;  4WBR D;  4I5Q A;  2C3T A;  5L71 A;  1K0M A;  2X99 A;  1GLQ A;  1TK5 B;  5G1K A;  4PUR A;  4ZL7 A;  4LA1 A;  4AJ8 A;  3ZIV A;  3ZIT A;  2R2J A;  3PPU A;  2C0G A;  3C1S A;  4PUA A;  1YF1 A;  2HZE A;  5F06 A;  5ECQ B;  2AAW A;  4IQ1 A;  1K3O A;  4PNF A;  5LNK e;  2HSH A;  3EPT A;  3FYG A;  5CP1 A;  3WD6 A;  4CY8 A;  2MMZ A;  1RK4 A;  4G2E A;  2BJX A;  3MIX A;  4JE1 A;  4BWQ A;  4BL7 A;  2JL4 A;  3HJP A;  1GUL A;  2VCV A;  3CSJ A;  1GH2 A;  2QKE A;  2WCI A;  3VFI A;  1VF2 A;  3PH9 A;  3TJB A;  3UEM A;  2HRA A;  1TK8 B;  2CVD A;  3N9J A;  4ZB8 A;  4YQU A;  2CV4 A;  3ZYW A;  1K0C A;  4V1A p;  3H79 A;  2NDO A;  5ECK B;  3GTU B;  3UVH A;  1DSB A;  4YAP A;  4DSR A;  4XS4 A;  4EUY A;  2H1G A;  3K8N A;  2DKI A;  2JU5 A;  4MA9 A;  4FH8 A;  3HVV A;  4YQV A;  3QDN A;  5DDL A;  4K2D A;  1UC7 A;  1GSD A;  1LBK A;  1FHE A;  5F05 A;  2EIO A;  2HSY A;  17GS A;  4MF6 A;  3VPT A;  2DBC A;  3GX8 A;  5DCG A;  2HLS A;  1MDI A;  1R26 A;  5HR2 A;  12GS A;  5JCU A;  2CX3 A;  2TIR A;  5HFG A;  5IM9 A;  5KN0 A;  5IIZ A;  1ILO A;  2GST A;  2B5E A;  1PD2 1;  2GQM A;  1A2J A;  2K8S A;  3MYD A;  4O5Q A;  4XS6 A;  3JCM L;  3V1W A;  4TR3 A;  2H75 A;  4KGI A;  1U88 A;  6GSU A;  4WF5 A;  1PL1 A;  4AJ6 A;  2E7P A;  1EOH A;  2DJ0 A;  3KGK A;  1HNB A;  1JZO A;  4E8H A;  3APQ A;  4V2M A;  1A2L A;  2LQO A;  5BRT A;  2HXK A;  2UZ8 A;  2J9H A;  6GST A;  1X5C A;  3UOM A;  4MK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...