2G2SA

Structure of s65g y66s gfp variant after spontaneous peptide hydrolysis
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
64
structure length
64
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Understanding GFP Posttranslational Chemistry: Structures of Designed Variants that Achieve Backbone Fragmentation, Hydrolysis, and Decarboxylation.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 12
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2006-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.40 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2g2sA00
2G5ZA 2A54A 2G2SA 2G3DA 3CFAL 3CFFL 2A53A 2A50A 3LF4A 2G16A 3CFHL 2A52A 5EXCA 2GW4A 2A56A
chains in the Genus database with same CATH superfamily
4MULA 2A88A 5EXCA 5BW0B 2A7XA 2I52A 1IHOA 2G5ZA 3UY4A 3INNA 4DDMA 2A56A 3MXTA 4EFKA 4MUIA 4G5FA 2RETA 3AG6A 3AG5A 3Q10A 1MOPA 1V8FA 2GR7A 3EMOA 3IOCA 3IUBA 3HL6A 3MUEA 2A53A 2IECA 3LE8A 2A84A 2G3DA 4MUKA 3IMGA 3Q12A 5G2FA 5KWVA 1N2OA 1N2GA 4MUGA 3UA0A 4MUEA 4MUHA 3CFAL 3N8HA 3CI0I 2X3FA 4BHRA 1N2JA 2LMEA 3IMCA 4DDKA 3COYA 1N2EA 3COWA 3LF4A 3CFHL 3CFIA 4EF6A 1N2BA 3IOBA 2A54A 4MUFA 2GR8A 2A50A 3IODA 4MQ6A 2GW4A 3ISJA 5HG0A 4MUJA 3CFFL 3IVGA 2G16A 2A52A 1N2IA 3IMEA 3COVA 2A86A 3IVXA 4FZJA 4DE5A 1N2HA 4IXJA 2EJCA 3COZA 4MUNA 3IOEA 3IUEA 2OGFA 3UK2A 1UFVA 2G2SA 3CI0K 3IVCA 3QTTA 4G5YA 4DDHA
chains in the Genus database with same CATH topology
4MULA 2A88A 5EXCA 2A7XA 1IHOA 2G5ZA 3UY4A 3INNA 4DDMA 2A56A 3MXTA 4EFKA 4MUIA 4G5FA 3AG6A 3AG5A 3Q10A 1MOPA 1V8FA 3IOCA 3IUBA 3HL6A 3MUEA 2A53A 3LE8A 2A84A 2G3DA 4MUKA 3IMGA 3Q12A 5G2FA 5KWVA 1N2OA 1N2GA 4MUGA 3UA0A 4MUEA 4MUHA 3CFAL 3N8HA 2X3FA 4BHRA 1N2JA 3IMCA 4DDKA 3COYA 1N2EA 3COWA 3LF4A 3CFHL 4EF6A 1N2BA 3IOBA 2A54A 4MUFA 2A50A 3IODA 4MQ6A 2GW4A 3ISJA 5HG0A 4MUJA 3CFFL 3IVGA 2G16A 2A52A 1N2IA 3IMEA 3COVA 2A86A 3IVXA 4FZJA 4DE5A 1N2HA 4IXJA 2EJCA 3COZA 4MUNA 3IOEA 3IUEA 3UK2A 1UFVA 2G2SA 3IVCA 3QTTA 4G5YA 4DDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G5Z A;  2A54 A;  2G2S A;  2G3D A;  3CFA L;  3CFF L;  2A53 A;  2A50 A;  3LF4 A;  2G16 A;  3CFH L;  2A52 A;  5EXC A;  2GW4 A;  2A56 A; 
#chains in the Genus database with same CATH topology
 4MUL A;  2A88 A;  5EXC A;  5BW0 B;  2A7X A;  2I52 A;  1IHO A;  2G5Z A;  3UY4 A;  3INN A;  4DDM A;  2A56 A;  3MXT A;  4EFK A;  4MUI A;  4G5F A;  2RET A;  3AG6 A;  3AG5 A;  3Q10 A;  1MOP A;  1V8F A;  2GR7 A;  3EMO A;  3IOC A;  3IUB A;  3HL6 A;  3MUE A;  2A53 A;  2IEC A;  3LE8 A;  2A84 A;  2G3D A;  4MUK A;  3IMG A;  3Q12 A;  5G2F A;  5KWV A;  1N2O A;  1N2G A;  4MUG A;  3UA0 A;  4MUE A;  4MUH A;  3CFA L;  3N8H A;  3CI0 I;  2X3F A;  4BHR A;  1N2J A;  2LME A;  3IMC A;  4DDK A;  3COY A;  1N2E A;  3COW A;  3LF4 A;  3CFH L;  3CFI A;  4EF6 A;  1N2B A;  3IOB A;  2A54 A;  4MUF A;  2GR8 A;  2A50 A;  3IOD A;  4MQ6 A;  2GW4 A;  3ISJ A;  5HG0 A;  4MUJ A;  3CFF L;  3IVG A;  2G16 A;  2A52 A;  1N2I A;  3IME A;  3COV A;  2A86 A;  3IVX A;  4FZJ A;  4DE5 A;  1N2H A;  4IXJ A;  2EJC A;  3COZ A;  4MUN A;  3IOE A;  3IUE A;  2OGF A;  3UK2 A;  1UFV A;  2G2S A;  3CI0 K;  3IVC A;  3QTT A;  4G5Y A;  4DDH A; 
#chains in the Genus database with same CATH homology
 4MUL A;  2A88 A;  5EXC A;  2A7X A;  1IHO A;  2G5Z A;  3UY4 A;  3INN A;  4DDM A;  2A56 A;  3MXT A;  4EFK A;  4MUI A;  4G5F A;  3AG6 A;  3AG5 A;  3Q10 A;  1MOP A;  1V8F A;  3IOC A;  3IUB A;  3HL6 A;  3MUE A;  2A53 A;  3LE8 A;  2A84 A;  2G3D A;  4MUK A;  3IMG A;  3Q12 A;  5G2F A;  5KWV A;  1N2O A;  1N2G A;  4MUG A;  3UA0 A;  4MUE A;  4MUH A;  3CFA L;  3N8H A;  2X3F A;  4BHR A;  1N2J A;  3IMC A;  4DDK A;  3COY A;  1N2E A;  3COW A;  3LF4 A;  3CFH L;  4EF6 A;  1N2B A;  3IOB A;  2A54 A;  4MUF A;  2A50 A;  3IOD A;  4MQ6 A;  2GW4 A;  3ISJ A;  5HG0 A;  4MUJ A;  3CFF L;  3IVG A;  2G16 A;  2A52 A;  1N2I A;  3IME A;  3COV A;  2A86 A;  3IVX A;  4FZJ A;  4DE5 A;  1N2H A;  4IXJ A;  2EJC A;  3COZ A;  4MUN A;  3IOE A;  3IUE A;  3UK2 A;  1UFV A;  2G2S A;  3IVC A;  3QTT A;  4G5Y A;  4DDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...