2G2WB

Crystal structure of the shv d104k beta-lactamase/beta-lactamase inhibitor protein (blip) complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
165
structure length
164
Chain Sequence
AGVMTGAKFTQIQFGMTRQQVLDIAGAENCETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKFNQVTVGMTRAQVLATVGQGSCTTWSEYYPAYPSTAGVTLSLSCFDVDGYSTGFYRGSAHLWFTDGVLQGKRQWDLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Structural and Computational Characterization of the SHV-1 beta-Lactamase-beta-Lactamase Inhibitor Protein Interface.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 164
sequence length 165
ec nomenclature
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07467 BLIP Beta-lactamase inhibitor (BLIP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 2g2wB01
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 2g2wB02
3D4EA 3E2KC 3C4PB 2B5RC 2KM7A 5EKQE 1XXMC 2G2WB 1JTGB 3C7UB 2PXGA 3C4OB 5D0QE 2G2UB 3C7VB 2YH9A 2KXXA 3N4IB 1S0WC 3GMUB 5AYWE 3E2LC 4DM5A 5D0OE
chains in the Genus database with same CATH superfamily
4L1RA 3D4EA 3NWAA 3E2KC 3C4PB 2B5RC 2KM7A 5EKQE 1XXMC 3NWDA 2G2WB 1JTGB 3C7UB 2PXGA 3C4OB 3NW8A 3FVCA 5D0QE 4HSIA 2G2UB 3C7VB 3NWFA 2YH9A 2KXXA 3N4IB 2GUMA 1S0WC 3GMUB 5AYWE 3E2LC 4DM5A 5D0OE
chains in the Genus database with same CATH topology
4L1RA 3D4EA 3NWAA 3E2KC 3C4PB 2B5RC 2KM7A 5EKQE 1XXMC 3NWDA 2G2WB 1JTGB 3C7UB 2PXGA 3C4OB 3NW8A 3FVCA 5D0QE 4HSIA 2G2UB 3C7VB 3NWFA 2YH9A 2KXXA 3N4IB 2GUMA 1S0WC 3GMUB 5AYWE 3E2LC 4DM5A 5D0OE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4E A;  3E2K C;  3C4P B;  2B5R C;  2KM7 A;  5EKQ E;  1XXM C;  2G2W B;  1JTG B;  3C7U B;  2PXG A;  3C4O B;  5D0Q E;  2G2U B;  3C7V B;  2YH9 A;  2KXX A;  3N4I B;  1S0W C;  3GMU B;  5AYW E;  3E2L C;  4DM5 A;  5D0O E; 
#chains in the Genus database with same CATH topology
 4L1R A;  3D4E A;  3NWA A;  3E2K C;  3C4P B;  2B5R C;  2KM7 A;  5EKQ E;  1XXM C;  3NWD A;  2G2W B;  1JTG B;  3C7U B;  2PXG A;  3C4O B;  3NW8 A;  3FVC A;  5D0Q E;  4HSI A;  2G2U B;  3C7V B;  3NWF A;  2YH9 A;  2KXX A;  3N4I B;  2GUM A;  1S0W C;  3GMU B;  5AYW E;  3E2L C;  4DM5 A;  5D0O E; 
#chains in the Genus database with same CATH homology
 4L1R A;  3D4E A;  3NWA A;  3E2K C;  3C4P B;  2B5R C;  2KM7 A;  5EKQ E;  1XXM C;  3NWD A;  2G2W B;  1JTG B;  3C7U B;  2PXG A;  3C4O B;  3NW8 A;  3FVC A;  5D0Q E;  4HSI A;  2G2U B;  3C7V B;  3NWF A;  2YH9 A;  2KXX A;  3N4I B;  2GUM A;  1S0W C;  3GMU B;  5AYW E;  3E2L C;  4DM5 A;  5D0O E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...