2G3FA

Crystal structure of imidazolonepropionase complexed with imidazole-4-acetic acid sodium salt, a substrate homologue
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
414
structure length
414
Chain Sequence
PKQIDTILINIGQLLTMESSGPRAGKSMQDLHVIEDAVVGIHEQKIVFAGQKGAEAGYEADEIIDCSGRLVTPGLVDPHTHLVFGGSREKEMNLKLQGISYLDILAQGGGILSTVKDTRAASEEELLQKAHFHLQRMLSYGTTTAEVKSGYGLEKETELKQLRVAKKLHESQPVDLVSTFMGAHAIPPEYQNDPDDFLDQMLSLLPEIKEQELASFADIFTETGVFTVSQSRRYLQKAAEAGFGLKIHADEIDPLGGAELAGKLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPGTTFYLGKSTYARARAMIDEGVCVSLATDFNPGSSPTENIQLIMSIAALHLKMTAEEIWHAVTVNAAYAIGKGEEAGQLKAGRSADLVIWQAPNYMYIPYHYGVNHVHQVMKNGTIVVNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Imidazolonepropionase
publication title A catalytic mechanism revealed by the crystal structures of the imidazolonepropionase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 153
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature ec 3.5.2.7: Imidazolonepropionase.
pdb deposition date 2006-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2g3fA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2g3fA02
2Q09A 4UBPC 4AQLA 3MPGA 2QPXA 1IE7C 4H9MA 4H00A 4QTGA 4ERAA 4ICMA 2FTWA 4D8LA 1M7JA 1UMLA 1EJUC 2Z24A 1PB0A 4KESA 3HPAA 4QROA 3TN3A 3LS9A 3URBA 2WJDA 3GIQA 5A6TC 2P50A 4R88A 2O4QA 4H9UA 3ORWA 3LY0A 2WJFA 3GTXA 3AU2A 3KM8A 4LCRA 2O4MA 2EG8A 3IRSA 3QY8A 4B92A 3F2BA 4PE8A 3SO7A 4QS6A 3ID7A 3B0YA 2QVNA 3S2MA 4DI9A 1RK6A 4C6NA 4GX9A 1PTAA 4LAKA 1ITQA 4C6CA 4LANA 3S2NA 4C6FA 2OB3A 3URQA 5HMDA 4WVXA 1XGEA 4H01A 4LALA 4AC7C 4EP8C 4C6LA 3E0FA 1PO9A 2PGFA 3GUWA 2FVMA 2AQVA 3IV8A 3A3XA 4I6VA 4IH3A 3WMLA 3K4WA 4GY1A 4C6OA 1FWIC 4GOAA 2FTYA 1JGMA 1GKQA 3BE7A 1ADDA 1EF2A 4L6DA 5HMEA 1BF6A 4CNUA 4GZ7A 1R9YA 3GTHA 1EJVC 1KRMA 1QW7A 2Z27A 4M51A 1O5RA 4JOMA 4B91A 1YMYA 2FFIA 1ONXA 1XRFA 3E74A 4LH8A 2DVXA 1R9XA 3IARA 3S2LA 3PNUA 1VFLA 3F4DA 4KIRA 4C6KA 1RK5A 1M65A 2Z00A 4XAZA 3MDWA 3B0XA 1A5KC 1FWAC 3C86A 3OQEA 4DNMA 2PLMA 1YBQA 1EJXC 4BKNA 2UZ9A 3MSRA 4RDYA 3D6NA 4DIAA 4WGXA 4IGNA 4IFKB 2IMRA 5HMFA 2Q01A 4C6PA 4V1XA 1HZYA 1A5NC 4EPEC 4GK8A 1P6CA 4H9ZA 3JZEA 4C60A 2Z28A 3AU6A 5AKQA 3UF9A 2Y1HA 4C6IA 1RJPA 4H9YA 3QGAC 3MDUA 4G7EA 4QS5A 3IJ6A 2RAGA 2ANUA 1EJWC 4PCNA 3S2JA 3EWCA 4C6DA 3UR2A 3MKVA 4IG2B 4DI8A 1UBPC 2YZ5A 1EJSC 3DCPA 4C65A 3F4CA 1P1MA 4P5UA 4HJWA 2Z2AA 3RYSA 2ADAA 4DLFA 1FKXA 1NFGA 1O12A 3QY6A 3F2DA 1NDZA 2GWNA 1KRBC 1DPMA 5LXXA 4WHBA 3URNA 4B90A 4F0LA 3IACA 1NDWA 1A5LC 4CNTA 4IGMA 2OQLA 3E3HA 4C6BA 4CEXC 3B40A 4H9XA 2W9MA 3LNPA 4OFCA 4LEFA 2Z26A 4V1YA 2BGNE 4IQJA 3QGKC 3GG7A 3FDKA 1GKPA 1RJQA 2Z4GA 3NEHA 4GYFA 4CQDA 4DZHA 3AUOA 3TN4A 4XAYA 2YB1A 2Z25A 4J35A 2GSEA 3RHGA 3GIPA 5FSDC 4I6KA 1J6OA 4UB9A 2OODA 4NG3A 3OU8A 1KRAC 4HK5A 3CJPA 2E1WA 1KCXA 4YIWA 2HPMA 2YXOA 2GOKA 2GWGA 1E9YB 3O0FA 2HPIA 3NURA 4PBFA 4XD4A 4EPKA 4RE0A 1R9ZA 3PANA 2HBVA 1NDYA 4E3TA 3URAA 1K1DA 4IFOA 3NQBA 1POKA 4HK6A 2OOFA 1A5OC 2EG7A 2D2HA 4KETA 3UR5A 2QT3A 1FWDC 1ONWA 1RA5A 4BJHA 3K2GA 2D2GA 4EPDC 1P6BA 4LCSA 4GXWA 1YNYA 1WXYA 3G77A 1RA0A 4DZIA 1V7AA 4XAFA 2G3FA 2I9UA 4IF2A 3K5XA 4C6MA 2VR2A 1K70A 1ZZMA 4ERIA 4KEUA 1FWHC 1UIOA 1FWCC 2ICSA 4J5NA 2WJEA 3EWDA 4C6QA 2VC7A 3E38A 4R85A 1POJA 3OVGA 2KAUC 4CQCA 1V4YA 3PAOA 4GC3A 4DLMA 2R1LA 1PSCA 2FVKA 3UPMA 4PBEA 5CH9A 1I0BA 1A5MC 4XD5A 1J5SA 2I5GA 5E5CA 1UIPA 1K6WA 3OJGA 1KRCC 3UBPC 2XIOA 2BB0A 1FWEC 4H9TA 2R1MA 4GY7A 3V7PA 1E9ZB 4XD6A 1V77A 4G2DA 2Z29A 4ZSTA 1FKWA 1EJRC 4C5YA 1YRRA 4IG2A 4BY3A 3GU2A 2CZVA 2PGRA 1FWFC 1V51A 4ERGA 2VUNA 4F0RA 4J2MA 3FEQA 3MTWA 4KEZA 4MUPA 2Z7GA 2GZXA 3F2CA 3LSBA 4IFRA 2WM1A 1FWGC 5FSEC 4RDZA 4HA0A 3CAKA 4HK7A 4R7WA 3T1GA 2YB4A 2VM8A 4LFYA 3LSCA 3RCMA 3MVIA 3LGDA 2UBPC 1RAKA 1WXZA 3FDGA 3ISIX 1EYWA 4C6JA 4NI8A 3CS2A 1XRTA 4RDVA 4DYKA 3WZ0E 3GTIA 2QS8A 4QSFA 2VHLA 2DVTA 3GGMA 4DO7A 3GU9A 3A4JA 3HTWA 3GTFA 3LU2A 3MJMA 1YIXA 2OGJA 1A4MA 4GBDA 1NDVA 5G4HC 4H9VA 3T8LA 4QRNA 4KEVA 3RN6A 2A3LA 3S4TA 3OOQA 3DUGA 1S3TC 2Z2BA 1J6PA 1J79A 3LA4A 3PBMA 1RJRA 3IPWA 3PNZA 3E0LA 2R1NA 1EJTC 2P53A 4ZSUA 4GX8A 4Z42C 1GKRA 1W1IE 4TQTA 3A3WA 3TN6A 1A4LA 3HM7A 2PAJA 4C6EA 3WYZA 4NP7A 4L9XA 4KQNA 4B3ZA 1YBQB 3QY7A 3N2CA 3GRIA 2DVUA 2HNHA 4EPBC 2VC5A 3IGHX 1M68A 4LCQA 4RDWA 3LGGA 2P9BA 3ICJA 2AMXA 2EG6A 2F6KA 2E25A 4IFKA 3GU1A 3R0DA 2PUZA 1I0DA 2R1PA 4CNSA 4C5ZA 4KF1A 4LAMA 4PCPA 1V79A 2HBXA 3MVTA 3TNBA 3TN5A 4RZBA 4CQBA 3OODA 4KERA 1ITUA 3E2VA 4G7EB 4LAOA 3SFWA 3ITCA 1XWYA 2AQOA 4GY0A 3EGJA 3T81A 2R1KA 4INFA 3O7UA 2HQAA 1FWJC 4CEUC 2ZC1A 1FWBC 4F0SA 2D2JA 3DC8A 1EZ2A 4XD3A 1QXLA 4XAGA
chains in the Genus database with same CATH superfamily
4XUGA 2I16A 4H1ZA 1IEVA 2QPXA 2HTMA 3STEA 5AHFA 4MZYA 3I6TA 1JZ8A 4XZNX 4H8NA 3S5ZA 1LYXA 3STGA 4HNCA 1D9EA 3LS9A 1QWGA 4M6VA 4KS0A 1EUNA 3IGSA 4ML9A 3V5OA 3B97A 1WP6A 1JXJA 1LL7A 5A6BA 2EAWA 1TTIA 2YBUA 3Q8PB 2VRQA 1P6WA 1OHLA 5LKYA 4IP5A 1KM2A 1IR1A 1Z6KA 5DMMA 4C6FA 3KBMA 1SZEA 3QFEA 1B3YA 3M6DA 2TRSA 2JBMA 2V0TA 4J28A 3R8RA 2V5DA 4XBSA 5H91A 4B91A 4FF7A 3VNZA 1S5VA 1IT8A 3TZNA 1VYRA 2FFCA 4N4PA 5HANA 1FWWA 5CC3A 3MDWA 2HXUA 4LUSA 4R5EA 1H7PA 2WANA 3OQEA 2VZTA 3PW4A 3V6KA 2EPMX 2PZ0A 2VCCA 4D1JA 3N04A 3ZR5A 2C6QA 3TYEA 5AYXA 4OECA 3NR0A 4Q8PA 4IWWA 1JF5A 5HJXA 4A2SA 3BZGA 3EMCA 4JQ4A 3BK0A 1MZRA 3WQDA 5KG3A 2QJHA 5KFMA 1L8NA 5D8ZA 3CZEA 3Q65A 1I1WA 3BQ6A 3HV8A 5DRCA 2HCVA 4G1NA 3KZSA 2R9RA 5FJUA 2RDWA 4I7VA 1P7TA 1ZBCA 2WNNA 3N3TA 1UHVA 2TAAA 4UQBA 3LI0A 4GI9A 3D0CA 4DJEA 5EMKA 1WOAA 2GWNA 3NWRA 2V38A 2XTKA 2GGJA 1PWLA 2F84A 1VHNA 4DO6A 4HU0A 2B7QA 1M7PA 5MHBA 4A3UA 3L4XA 2UVUA 2QAFA 3BXWA 4F3HA 1EC8A 1XCFA 4Q7BA 3AMLA 4O1FA 4M6QA 1OC6A 4ALDA 4JIEA 1TPVA 1CT5A 1B3VA 1VP5A 4IQEA 2FHBA 2NVCA 5JIWA 1E3ZA 1E0VA 1OG0A 3FVDA 1MWOA 3IV3A 1TTQA 2Z1KA 2GOKA 4HZ7A 3SJNA 4AUBA 4QW9A 3B03A 1SFLA 1J0IA 1Q6LA 6A3HA 1L6SA 3UU0A 2FPTA 4PMDA 2ZX6A 2CIPA 1R2RA 3OZMA 1UP3A 5KFRA 2QT3A 3UXDA 3VOHA 2YW3A 3IJ7A 2WXDM 3TH6A 2DQXA 4V33A 2ZWYA 2Y61A 2P8BA 3ITYA 5KFBA 2OO0A 4P2VA 1XBYA 2G3NA 3RR1A 1GOQA 2ZRWA 2EO7A 4ADUA 2WJEA 7XIMA 5C54A 4OU1A 1SR0A 1YDNA 3SRHA 1I1XA 3PZQA 3W7MA 4J3XA 1CYGA 1VJZA 5K4ZA 1BSLA 1DEDA 3W2UA 4JDYA 1Q4NX 1I0BA 1DWJM 4FPSA 2Q02A 1LL6A 1D3HA 4IRCA 2OVLA 3PSWA 5JMUA 5BRBA 1EEPA 2BGQA 2C1GA 2VDIA 2AGPA 3CAWA 3A22A 2DP3A 3QM3A 4Q33A 4NJHA 2Z29A 4MF4A 2VGBA 1O68A 3TCSA 1E5NA 4NHVA 4GABA 4F9DA 2W66A 3G8EA 1CXEA 4F66A 3FEQA 1FA2A 3DOPA 1OYBA 1EUAA 4DL6A 4TXEA 1L6FA 1OFDA 2W4XA 1VPQA 4D6CA 5DBUA 4AXKA 2QJMA 2VM8A 1XIBA 3VX1A 5C7HA 3ZJ8A 3LB0A 5A8OA 4IGHA 5AC8A 3W26A 4ICNA 4DYKA 4L7ZA 4RNIA 3KVLA 4D6FA 1EX1A 4QSFA 4NIRA 4PSPA 1FCVA 4UUIA 1CENA 3F1QA 3XINA 3M41A 3T8LA 3PUEA 3SADA 2QCLA 2ZCGA 2RGLA 1NAL1 4S38A 3PUOA 3U5YA 4J9SA 3NXFA 3OA5A 4NL1A 3FLUA 2CHOA 1NP2A 1PPIA 4DL3A 3NSMA 1QVBA 2WMHA 2AKMA 2OCZA 4MAZA 2E4TA 1O60A 5C8BB 3TJIA 1ISYA 5AC6A 3TEVA 4GXPA 2RKXA 1GVSA 2WC7A 2WC3A 3LK6A 5KFAA 5FF3A 5H8MA 3NQVA 1B1YA 3WNKA 2Z2UA 1ZLPA 3CHFA 2WMGA 3ZLGA 1BYCA 4XBKA 4JTHA 1C92A 5I3HA 1K8CA 2IMWP 2QEZA 1JFXA 4W9TA 1JCXA 3SUVA 3L65A 2R14A 4J3VA 5DQIA 4CQBA 3HOJA 1QO2A 4D9PA 5AYYA 4TVDA 4GY0A 1JIHA 3A13A 2P5NA 4LS1A 2XPKA 5AOUA 1YPIA 3W7QA 3H4BA 1XYFA 3AIBA 1OABA 4I3GA 1FWBC 2D2JA 1X6NA 1OC7A 1Q6OA 1XYCA 4WKFA 2XN2A 2W0UA 5KFCA 1XBZA 3GVWA 3ANUA 1TE1A 2VP8A 3AMCA 1OC5A 2XYLA 4D2JA 4IQDA 4UXDA 3CAQA 2ZUVA 1DV7A 2P50A 4Q8VA 3QF0A 3VD3A 2WJFA 3M0IA 3FEMA 3EAUA 2CKRA 4K68A 4JNYA 4B92A 1UR1A 2Y7FA 3H2FA 1HL8A 1K9DA 2E6FA 3T4CA 4E38A 3QV8A 2VD8A 3NA8A 4AAJA 4WX2A 2ZADA 3W00A 3EWBX 2GJXB 2P3EA 4W7VA 2V3GA 3K30A 3BLDA 3GUWA 4MKSA 2FVMA 3IV8A 2BQ3A 3GDMA 1TPUA 1FWIC 3OTRA 2W9AA 4PODA 2QUTA 1IZJA 1QW7A 2DSKA 4DXKA 3TR2A 1R3TA 4C91A 2NVDA 3S5YA 4N4QA 3UXKA 3REQA 3K46A 3ENLA 4UTWA 1F4AA 4FHAA 4O57A 2QR6A 1NIUA 1GJUA 1XYLA 1W9XA 1UWQA 5CPLA 1DKWA 3MYPA 3QC3A 1KGUA 1G4TA 2O55A 1RPXA 2DH2A 1UH3A 2WZEA 3WG6A 4J27A 3ZR4A 2IS7A 3WLOA 3W28A 1UWTA 1CXFA 2QCHA 3CGTA 3BURA 3PPGA 4HHHA 3BG5A 5HDRA 4A2RA 3P81A 2GPTA 4AU0A 1MW0A 2NUWA 3QGAC 4GFIA 3WUEA 3O05A 1E1CB 3K4AA 4M6PA 2Q71A 2QUNA 4GNVA 3MKVA 1XP3A 4EE9A 4P5UA 1LQAA 3Q67A 5KMYA 4N42A 1TSIA 3URNA 1BRLA 1UZDA 2L5HA 2EQDA 1QBBA 2W9CB 2DT3A 3TMQA 7ENLA 4YVVA 4ZQRA 2BGNE 3MFIA 4JIHA 3GG7A 3G1XA 1CGVA 1TO3A 4G56A 1C7SA 1MQPA 2FB2A 1NP0A 5D2VA 3G24A 3MU7A 4K7YA 5HWJA 1V6VA 4UTHA 1KM4A 4BF9A 3V1HA 2EKCA 3WDJA 1UD6A 2ASLA 4WEVX 1YPFA 1VBUA 1US2A 2DUAA 1YE6A 5A6LA 5HXMA 1FP9A 5E70A 4G7FA 4BQ2A 3JVAA 3LUTA 3QR3A 1RCOB 3VE7A 5LYRA 3DI0A 2J27A 3KHHA 4J2PA 4YN5A 3CTTA 1M04A 2ZUUA 4EPKA 1WXJA 3AAMA 4JTDA 5I3FA 1K8ZA 4WOQA 5BROA 3V3WA 2X2YA 1MNZA 5LNRA 3VINA 3WD3A 1J11A 3NZGA 4A21A 3M1ZA 4YL2A 1EBGA 3HG3A 3TMLA 1ONWA 1AQHA 2WWCA 2HSAA 5AYBA 3WBYA 3NM3A 3E6EA 2XWEA 1BGGA 1Q6RA 3GHUA 4AWUA 1R38A 4CKQA 1HJQA 3OBKA 1KQYA 3L2LA 1J5TA 3KBNA 1U30A 1KR0A 1H5YA 1UBSA 1EF3A 3BQ5A 3JS3A 3OHBA 3JRKA 1DYSA 2FVKA 5CG7A 4JHZA 5C2GA 1FCBA 1KCLA 1QPQA 1GEQA 4U31A 3UT0A 4N0RA 2XIIA 4AX7A 3FNDA 4ZOCA 4Z1DA 2P88A 1XM3A 1IXPA 4OHQA 4KRUA 1V77A 2RGMA 1FKWA 3P8JA 1XDJA 3PZUA 3T44A 4ATWA 4EKJA 1GVOA 2PDHA 3W71A 4D6GA 3N2TA 4A22A 3I6RA 3NGJA 3O07A 4CCDA 3I68A 2Z7GA 3L0GA 4AEEA 2TPSA 4WLCA 1B3XA 1XLCA 2J66A 4TMCA 3RO6A 1V93A 3E9AA 3STCA 3WENA 1GYLA 2XFFA 2ATMA 1P48A 1TKKA 1XUZA 5HNNA 3F03K 4JN7A 1OQFA 2C3ZA 3UWWA 4ECWA 3NOYA 2IW0A 1W8GA 4DXXA 3WLLA 3W7RA 2QNEA 2W9BB 4QWDA 1TA3B 2DIEA 3AQUA 4DAFA 1WUEA 5GJPA 4UTLA 4GZJA 1TV8A 3RMJA 2PZNA 1Z32X 2VI0A 2D1ZA 2Y7GA 2WKJA 3G1RA 5HINA 1LOQA 1W91A 3DESA 3V5FA 3IAQA 3M0KA 5H1WA 1F61A 3GS6A 1VHCA 4LBSA 3BCFA 2H8XA 4AC1X 1UOZA 3HM7A 3XISA 3MSYA 5ABGA 3VAVA 1VBGA 4YS1A 2Y5EA 2E09A 2J77A 2DVUA 1LUCB 3C2OA 1JUEA 3PTQA 2YA2A 4JXCA 3S6DA 4DY1A 1UR3M 3JUGA 4O16A 3QQ0A 2J6XA 2WQDA 1JAEA 1OYCA 1TCDA 4ZODA 1CW2A 4NY2A 4ILSA 4QP0A 5H8UA 1V3LA 4KT2A 1GZGA 3UZ5A 3GKFA 3OW1A 3U3HA 1W1VA 3RLUA 3VGHA 1QI0A 1TIMA 3WQFA 1W3HA 4IMEA 4FBTA 4CUCA 4HD5A 3VNJA 4JX6A 1IZKA 4A35A 3GO2A 3VMNA 3WEOA 3K8MA 3QQ1A 5KFEA 5F2MA 4US6A 5TAOA 3RR4A 4HNUA 3BAKA 2W61A 2WVVB 3EX6A 2R8IA 4WY0B 3WCZA 2RFGA 4EEYA 2QDGA 2ALRA 4GH3A 3L2IA 5A6TC 4LB3A 3CYVA 3FJLA 2NWSA 1VEMA 3QOMA 1TZZA 4JYEA 3BV7A 3E49A 4AWSA 3KX6A 4YTRA 3GV5B 2YLAA 3ID7A 1WA3A 2IKHA 3B0YA 4LQ1A 2G4JA 2XDFA 3PK7A 1LBLA 3TLLA 1PTAA 1EEXA 1ITQA 2OYMA 4RR4A 1LF1A 1WKEA 2DPJA 3E0FA 5A6BD 4M1BA 3QOKA 3B9EA 3AHZA 4C6OA 3WJWA 2WMFA 2PS2A 1JGMA 2FZBA 4S3GA 3UXAA 2CETA 5EA9A 4MB5A 3SCRA 4JQ2A 5D02A 3N2OA 3ZT7A 1UA3A 2XZ9A 3KCOA 3LENA 1MEHA 2VFFA 2FLNA 3QPEA 3BQ1A 4QITA 4MM1A 3PNUA 1XH1A 3H40A 3E2SA 5KG0A 1KTBA 3SRFA 4DO4A 5GQBA 5D2WA 1V0LA 3QLLA 1T96A 1ZPTA 2E3ZA 1BG4A 4F48A 1O94A 4ED2A 3GVGA 2NQLA 3WBEA 3AOFA 2VEIA 4GK8A 4ZB5A 1KBLA 5BRPA 1YADA 4H9ZA 3AICA 1HL9A 2PP1A 5I78A 1V6TA 4DL4A 1OIMA 4REQB 1Q8JA 5CZJA 3V6JA 4F4RA 2ZUSA 4KWUA 1QPNA 1KBKA 3RAOA 1HO4A 4OUIA 2I7GA 1J9YA 4AF0B 1FP8A 3HF3A 3F4CA 3WDPP 4RNMA 4NJIA 2Z2AA 2YL9A 4WXZA 1OGGA 2RUSA 4IPPA 1UWRA 2C2EA 3DECA 4HB7A 2J7GA 2A3CA 3W70A 3Q94A 4X63A 2D69A 3HN3A 2PLJA 1O1HA 2A7PA 4LEFA 2Z1WA 1K9EA 3WLPA 2QV5A 2E6DA 4AX6A 4GVHA 3VI2A 3MBDA 3N14A 1NF0A 3H4DA 4O12A 1DL3A 5KZDA 4PCFA 3DHPA 3AHVA 3VIPA 2XJ7A 3DGRA 1A80A 3T07A 1BXBA 3NPVA 3KVMA 1TX0A 1KCKA 3L7RA 2YZRA 4PTWA 3H23A 4QJ1A 4YIWA 1YE4A 5EMMA 1XQKA 3WLNA 3UNTA 4N6EA 1K9FA 3EPMA 4MWAB 5L1LA 3I4EA 7TAAA 3RX4A 1A5UA 2J6UA 1MQQA 4IX2A 3LPOA 4KWWA 1Q8AA 3BLIA 1R3VA 3LI1A 1MUCA 2QGYA 2BXVA 1P6BA 3TU9A 2H8ZA 4Y90A 3ONCA 3G77A 2Y89A 3GNOA 1W3KA 3LMZA 3UA4A 3KTSA 1GHSA 3UETA 4HCLA 2YCKX 2UVWA 1PYMA 2EPLX 2DZTA 3J7HA 3PAJA 4LXFA 4ERIA 3GIKA 1RYRA 4U28A 1F73A 2FZ8A 1N55A 4RUBA 5AC7A 3WQVA 4CU6A 3EPGA 3PJUA 1KGXA 3WD4A 1U5VA 3P80A 2GFTA 4GC3A 3B0PA 1PSCA 3GDBA 3A9IA 3QSRA 4PBEA 2OSYA 3W37A 3FS2A 1OGBA 4K2SA 3UCCA 3WK2A 3LXCA 3AIWA 2CZFA 5B7ZA 3G1SA 3CPUA 3VDHA 3TTSA 1LM1A 2B4GA 1XUUA 2JEIA 2PCEA 1BVNP 1P43A 4CN6A 2D3LA 4C5YA 4IP7A 4KIEA 2FHFA 3RNDA 1WKYA 4HVXA 1RQBA 1N48A 1GGOA 2D0FA 4J2MA 3GNDA 5IHRA 1S39A 4KW2A 1HF6A 3NGFA 4MJ2A 1JNDA 4Q43A 4IRDA 3M5YA 3W6MA 4XZLX 1SZNA 3DKLA 1FWGC 4PR4A 3M0LA 3M7WA 3LBMA 4E4FA 4NILA 1YHTA 4CNOA 1H5VA 4TX8A 4QSHA 2REQA 3GV7B 3MVIA 3BLEA 1RAKA 1KXHA 4XTIA 4WUIA 3ZWSA 1UJQA 4Y2WA 3NAVA 4D8AA 2WC4A 4POCA 2IUZA 4LRTA 2ZXAA 5G1YA 3M9OB 2IA6A 1P0EA 3UERA 4QRNA 3WD2A 1Q6EA 3VFCA 3W7PA 1S2UA 2Z2BA 4JFUA 4P7LA 3QC0A 1J6PA 1RQHA 1JYVA 3MW7A 2A7NA 4PTXA 3AYSA 1SUXA 3ITGA 1XF0A 5LGZA 1M01A 4IJRA 4UR8A 4C6EA 2ZFAA 3DKJA 4GUFA 1N8WA 3EWUA 5M5DA 3PBWA 4QJ4B 4EPBC 3G1YA 2QQ6A 3QHMA 1AQ0A 4L61A 2F6KA 1YX1A 2C1HA 3AALA 2J25A 2ZTJA 3MHUA 4DXVA 1FCQA 3TNBA 4N2YA 2E0PA 3CUIA 4HYKA 1O7AA 3QEZA 1ZETA 4LV4A 1Q65A 1TE6A 2Z6JA 3B8IA 3R58A 1LWIA 3PZOA 2CYGA 3IN5A 2ZZ1A 3EEZA 1EIBA 1D8WA 3R79A 4NRSA 2PP3A 3LBCA 5AVNA 3RX3A 4NNBA 2X2GA 3B9OA 1CLVA 2D0HA 4Q4SA 4AY1A 1ECQA 4GUHA 1EKOA 1AUSL 2NLIA 3CIWA 4ICMA 3AIVA 1GOMA 2QIIA 4M7TA 3M16A 4HN4A 3L68A 3G6YA 4NNCA 4O1EA 3AJ7A 1HJSA 1WBJA 4LEQA 3N1AA 4FOKA 1ZU8A 4WIWA 4YR3A 2J88A 4IJBA 4ECQA 5D9MA 1W2PA 2O4QA 3ORWA 3DIPA 7REQB 3GQYA 1RR2A 4DELA 2ZZ5A 4JTAA 3P2VA 3KOYA 1SO4A 4HZ8A 3CUZA 1W3LA 4M1RA 2QVNA 3NDZA 1GT8A 4MWAE 1DQWA 1YXYA 4UIOA 3C61A 3S2NA 3RPDA 5HMDA 4CD5A 1JDDA 4LUTB 3IK2A 4XTDA 5KG2A 3L66A 1RD5A 4PMNA 4E0CA 4KMQA 5I24A 3TAKA 1XDMA 3GBEA 3QZ6A 4GY1A 2A1YA 1RALA 4HMCA 4JICA 1OF8A 1IZCA 5BZAA 1UWIA 3Q8RB 3O8AA 3RCNA 5DFAA 4PUDA 4LVDA 2YFNA 3HO8A 1R0MA 3AZRA 1YMYA 4AZIA 3FSTA 4GYJA 3TYZA 3Q58A 5E9AA 4E8CA 1YDVA 1FDJA 3IIZA 3BAJA 4C1KA 1H50A 3PVXA 3B8TA 3LCHA 5AN7A 3FGCA 4GPNA 1GYMA 4L5ZA 6TAAA 2YL5A 5A69A 1BLIA 4DPQA 4WGXA 3FHQA 3H4WA 2PDIA 2X1SA 5CG0A 3ARXA 1V02E 4GJIA 1U1HA 1W5OA 4W5ZA 2NQ9A 5AHEA 3DGBA 2PDBA 5CGMA 2BMBA 4XK2A 2HXTA 5TQLA 1IXOA 5BYWA 3AROA 4IOTA 2BHYA 3T0TA 4H7CA 1WDSA 4DBEA 4H8HA 1O12A 3GG0A 3O1NA 3TC7A 3W0KA 3M9YA 4PFMA 2R8JA 4JHMA 4B90A 1BHGA 5J5DA 2A2IA 4BI5A 2OQLA 1PKYA 1V8EA 1JZ4A 3S5NA 3FSUA 4EAYA 3P82A 3GHSA 3MZ2A 4ZGYA 2VA3A 3UYCA 1B2YA 3DDMA 4ACZB 4Q4MA 4CQDA 2AAMA 1OFAA 3UJEA 5J5RA 3ZVIA 4JKKA 4B5UA 4EBCA 3KBWA 4O0ZA 1CX9A 3EKGA 1GUVA 1B5TA 4C7GA 1XIMA 1CWYA 3BMWA 2O7SA 1ELSA 1KQZA 1BTMA 4KFPA 1TV3A 4MAVA 4AD1A 2VGFA 3OHMB 2YOCA 1K7FA 1UCWA 4LB4A 2CFFA 3T55A 4FA3A 4XVEA 4TTGA 3T0DA 4HHLA 3CV7A 3QHNA 3ABQA 4UTIA 4CVWA 1A5OC 1TUXA 4MYAA 1VENA 2VRJA 2FTPA 5AHIA 4BJHA 4MG4A 1PIFA 1Z44A 3LM7A 1UB3A 2NXGA 4ML4A 2OX4A 5IXEA 5KT6A 1NARA 2CLOA 2VFDA 2YPIA 1UD3A 3N29A 4XZ9A 4JTJA 1O1ZA 2PDWA 1HKJA 3TVAA 3VXGA 3RLVA 3CZ8A 3APGA 1VR6A 4KCVA 4HNNA 4D8ZA 2DSVA 4F2UA 1J5SA 2ZE0A 3AO0A 1RVGA 4IL2A 1M5WA 4PMQA 4UFJA 3V75A 3CB8A 4Z17A 1XSIA 2QGHA 3AXMA 1A5BA 3W2JA 4AZ7A 3U57A 2PMQA 4LF2A 1SO5A 3E0WA 3I7SA 1K8YA 1OY0A 2PWGA 2YA0A 3WK3A 3A12A 4HA3A 2DGAA 2V82A 2Y5JA 3M46A 4ERGA 4MB4A 4GLEA 2RHGA 3P62A 1H09A 1XIHA 3VTRA 4MUPA 4A8RA 2Y70A 1NF7A 3WFAA 1PJ9A 3LPFA 4HA0A 1LL4A 4R7WA 3IJLA 2DFAA 1GQLA 3VGBA 3BW3A 4JTUA 2ISFA 4JEQA 3LGDA 2ACUA 2OYLA 4A05A 3WD1A 5E0CA 5EU9A 2R8HA 2EPOA 3AIEA 2V4QA 1K3UA 1MO0A 5KG6A 3A24A 2VHLA 1YQ2A 4RNFA 3GTFA 3KEHA 1KLZA 1G4EA 3HQOA 1X39A 4CNNA 5D09A 2XVKA 2IQDA 4DHGA 1J79A 3CUJA 3E96A 2R1NA 5T14A 3TYDA 2P53A 1GK8A 1GVIA 1L6GA 2WSKA 2XISA 2CHRA 1UP2A 2V2CA 1HVXA 4FLSA 3OZOA 3OHAA 4EBEA 3QY7A 3AISA 1Z48A 3NQ2A 3GRIA 3HPXA 1VBHA 3A21A 2F6UA 1VZWA 1LORA 1TV4A 3LGGA 4NX0A 1W1TA 3QV9A 1QDSA 2AMXA 1XICA 3MUAA 4N9DA 4JGDA 2EJ1A 3MQTA 4M6UA 4UQEA 2FPVA 4UFKA 3OGVA 3GFYA 3AHXA 5J8LA 3ALGA 4MIMA 2KX9A 3GC5A 4HU3A 2WNZA 3GX9A 2X0HA 3EOLA 3ITCA 3CT2A 1X1NA 2WKLA 2XCPA 1BVZA 1RP8A 4TQRA 1TJ2A 1J2BA 4PB3A 2O9RA 2DV0A 2AL2A 4UFIA 4IMGA 3TLQA 4RNNA 4QWAA 2VCBA 3OBEA 3S9IA 3SY1A 4LC6A 4ROPA 2Q09A 3ELFA 4JR5A 2E40A 2VZSA 3RPMA 2VA2A 5DCDA 5ECUA 3V36A 4CD7A 1TRDA 4QTGA 3M0MA 2OR2A 2QIWA 1RUSA 1ME7A 4B5WA 2AAAA 5FEWA 1A0EA 2NX9A 3H7VA 5CXPA 2ZRVA 5CJMA 2WLYA 3QHOA 1IEWA 5A6AA 4ZQPA 3I65A 5JH1A 1MXDA 3LY0A 4MNMA 3GTXA 2HMCA 4LX4A 4FS1A 5BU9A 1AZ1A 3VYLA 4GI4A 2PP0A 1AMKA 2BNJA 4FLOA 2ZE3A 5C0QA 2BY1A 4HNOA 1Q6FA 3URQA 5KFVA 4JTLA 2MNRA 2BHZA 1T8QA 1X8FA 1B90A 4O10A 2OO6A 3GKAA 4GIEA 2AQVA 3NPUA 5T9CE 3IK4A 4MVAA 1GKQA 3UJ2A 1ADDA 3ZVHA 3GVQA 4X2RA 4K8GA 2EPKX 1R9YA 3B9NA 4B4FA 2Q8LA 2GDVA 1TMHA 3NNTA 2DVXA 2FH6A 1R9XA 2GQ3A 2IXVA 3IARA 3BJTA 3G6XA 1GOKA 4KIRA 5FJIA 2XCAA 1UA7A 3MI3A 4NT0A 1XH0A 1XFCA 1BWVA 3CHDA 3NSNA 2XFWA 3GXDA 4IGNA 3KTCA 3GXNA 4KWOA 2Q01A 1OT2A 1A5NC 1FHVA 4NZ4A 1EWDA 2CNCA 2G95A 4JX4A 3GW3A 5HAOA 3W6LA 4C60A 5C7VA 1DJHA 2JKPA 3PHAA 1BG9A 2D24A 4HOZA 1OF6A 1O66A 1US3A 3MUIA 4Z1BA 2DZPA 3M0YA 1NM9A 2GJLA 3KCJA 4AD3A 5EFFA 4GC4A 3W38A 1CGTA 3DCPA 3N12A 3GNPA 1J0JA 1PX8A 4ED6A 3BV4A 1WX0A 1MI3A 4F79A 1EP1A 3F2DA 2GUBA 3SUSA 5AYZA 5HPOA 3GXMA 1EQCA 1XLFA 3PFMA 1X7IA 3DZ1A 2AGKA 4NZ5A 3KCLA 4QGCA 4OIFA 2VZUA 3S83A 2PA6A 1QATA 2DT2A 3CYJA 2WNWA 5LNSA 1W3NA 3VIHA 4GIAA 1UKSA 2PBGA 5D8WA 3WLSA 1JCTA 3BAWA 4EVZA 3PY2A 4D72A 2Y85A 2C79A 4HT3A 3H2AA 1XINA 4EYIB 1X97A 3AXKA 4XWUA 2GWGA 4RE4A 1DORA 4HCHA 3SUWA 1NWUA 4U33A 1A3WA 1UP0A 2B81A 2WYSA 5C55A 1Z8AA 4DEZA 2G37A 2IPFA 2ZDSA 1BWKA 3WSUA 4LOCA 5E6ZA 5GNXA 1IWAA 3W75A 2FZDA 1KFLA 4GZIA 2JF7A 3TW6A 2EG7A 2D2HA 4KETA 1VFSA 2INEA 1H41A 1IEQA 5A8QA 3H12A 1SVDA 3BAYA 4E2BA 4AXNA 3V4BA 3V35A 1AVAA 4UR7A 2IPGA 1V3MA 1PTGA 4LVFA 3G6VA 3GD6A 3VKCA 4EXQA 1SJBA 5DGAA 1S9FA 4XAPA 3NM1A 4MADA 4ZVJA 4O0QA 4MZ8A 4XKYB 2X09A 3B9AA 4J5NA 1L9WA 7ODCA 3C0QA 3W7LA 3DHFA 4LV9A 1JYXA 3AHTA 2KAUC 3KL3A 2V3EA 4O19A 1IT7A 4IIBA 5KFTA 5CH9A 4HJFA 1ITXA 4XD5A 1QTWA 4C1NA 1YDOA 4HPHA 3UG4A 1CTNA 3PR4A 2J79A 3RF9A 3U4AA 3H2CA 4XO6A 1E0UA 3VKKA 1JZ3A 4GINA 1E40A 3U2ZA 3OIXA 1JI1A 4ZSTA 2BQUA 1LROA 2YR1A 3DERA 1UKPA 1I4NA 3U2OA 3RB4A 3EA3A 5E9XA 3VIFA 2ZC8A 4X22A 3ZJ6A 1S5NA 2FZ9A 2QUVA 2ZX5A 4W87A 1NWTA 2B31A 2XIBA 3CIVA 3SY5A 3WUGA 2Y0FA 1LWHA 3H4GA 3NQ8A 5DELA 1C8VA 3WL1A 3MT1A 3MR5A 1FOBA 1C90A 3PM6A 4QLKA 5M03A 5LNVA 4D71A 3LXBA 4QJ3B 1E6RA 2ZRZA 4B9ZA 1WXZA 3UWVA 4AY7A 1EYWA 1HJWA 4QBXA 5E1QA 4RL3A 2P0OA 2ZXBA 2ATSA 1BTCA 1F4HA 2GJXA 1KV5A 5L6UA 3VGFA 1YIXA 5ABFB 4E2VA 3MCMA 2WHMA 5FEZA 1JPKA 1SFSA 4XIMA 3W1NA 3BOLA 4DN1A 3LCWA 4ONVA 3W07A 3ZS4A 2GVLA 3F5LA 1FTXA 1FFRA 4XV0A 2E5CA 4X60A 4GX8A 3BTNA 3LBOA 3ZLHA 4FNSA 2XGPA 3T40A 4GISA 2PAJA 2OG9A 1K03A 1WKFA 5G1MA 3JR2A 3LCGA 1S2AA 4O17A 3VABA 3SGGA 3EKZA 3PZTA 4A3QA 3BL3A 3W1XA 3W29A 4WSJA 4QFUA 4S2CA 3H2EA 3ICJA 2PSNA 3ME3A 4DWSD 1GQKA 3HZ3A 1Y5WA 2IPWA 1OINA 2QJJA 1S0MA 3KFTA 3GM8A 2YXGA 1TVNA 5KG1A 3COTA 2O7QA 5D30A 4FLQA 1ITUA 3E2VA 2QZRA 1EH9A 4LC8A 5CEWA 4JEJA 4AZHA 1E1CA 3QW4B 3CXOA 1ZBVA 3M0JA 4UQDA 2OZ0A 4FR1A 3OLIA 4AZCA 4TVCA 3HFTA 1V6XA 4UBPC 4L4LA 1A5SA 2G3IA 4UMCA 2DPEA 1MXGA 1SZGA 3GB6A 2XVPA 3TTQA 4UTJA 3UYIA 4HHPA 3S6TA 2ASDA 4R9XA 2Z0IA 1OD0A 2Z6IA 3W1QA 2HISA 1I2QA 4PGLA 3VD9A 3KWSA 3W2KA 4KBXA 4ZA0A 3IJDA 2O4MA 3IRSA 3SO7A 1O95A 1GOOA 3NL2A 4MDOA 5HNUA 3GDKA 2WAGA 3TJ4A 5I3DA 4O1AA 4DWSC 2DUXA 1FRBA 4AC7C 4C6LA 2DEPA 1JYWA 3AS0A 3E12A 3T4WA 1F6PA 3ANVA 3AXXA 1TPEA 1AG1O 1LG1A 4AVFA 1V3KA 3PWIA 4EWJA 3IVTA 3MHGA 1OX4A 3TE9A 1XR2A 1ZBKA 3MUZ1 2ASJA 4Q8OA 3INPA 1YDYA 4LH8A 1G6CA 4ED7A 3SCUA 1NU5A 1ME9A 3EDKA 4I5UA 1VCGA 4Q8TA 1GVFA 1KBIA 3FJ4A 2CW6A 4AISA 3HA1A 1FBAA 1MXSA 2PLMA 1LCOA 1VFUA 4MYXA 1RHCA 1QHOA 3SCWA 2EJAA 1OJXA 3FJNA 1LWJA 1NQKA 1VIZA 3R25A 5AZ1A 2D20A 1VCVA 5HMFA 5EGRA 1EGVA 1ESWA 3C2YA 2YKKA 4EPEC 4H3DA 2W63A 3LTPA 1E5JA 2DSWA 3ZMRA 5DGBA 2OKTA 3I3BA 3UPWA 5JQ9A 1Z9AA 1Y5VA 1JL8A 3NIYA 3VFLA 4KPLA 1DJXA 1W1PA 1B31A 3KRSA 5A95A 2B7PA 1QR7A 3SN0A 3OSNA 4NYUA 4YVPA 3S2JA 4PTMA 3B8SA 4E2DA 2DJLA 2V5JA 3M07A 2O56A 3MV01 2NZLA 1NDZA 5BXTA 4GJ1A 2NXHA 2CZDA 1UYQA 4CCZA 5CPNA 3VD5A 4Q8UA 2YXXA 4MY1A 4BF5A 3UJSA 3NEHA 1U1UA 4C90A 4P7NA 1ZP4A 3OLEA 4GYFA 4K3ZA 2W79A 2Z25A 2IXUA 3S5SA 2OWWA 1ISXA 2FJKA 2ZRXA 1UR8A 1J6OA 4UB9A 3FYYA 4QG9A 2WO5A 2E1WA 4IIEA 4RW3A 2E9MA 1TR1A 2X8RA 3O0FA 4ZO9A 1OGSA 3IGUA 3EMZA 2HE8A 5D32A 1RBAA 4IM4A 3URAA 3V5CA 2IQ0A 3PG9A 4ZB2A 1FH7A 4KGJA 4MUZA 3NGDA 2XH4A 1UC5A 3L67A 5AB3A 3ONBA 3CTLA 2CBIA 1R7AA 3FKRA 4YCPA 2XGZA 4O14A 4DZAA 3V6HA 3TA9A 1H0IA 1B57A 3W1RA 3NQAA 4GXWA 1TIWA 1V7AA 1Q6QA 2JQXA 1VQTA 3PUDA 4ACYA 4IUOA 1TG7A 4HA4A 1T94A 1ZZMA 3SGZA 5I06A 2WHJA 5KZ6A 2C16A 2WCGA 3QTPA 2B7OA 2Z7KA 3W88A 1R5YA 4DYJA 1F05A 4LYPA 4QX4A 1KW1A 2PDUA 5FJOA 1W1B1 5A8MA 4QM1A 2ZZ3A 2IKGA 3DFPA 5PTDA 1QT1A 1JR1A 4DBDA 4AD0A 4EAMA 1UIPA 2XIOA 5D2XA 2R1MA 1A3HA 3W7JA 3UA3A 4P7OA 3EWZA 3SM0A 1AD4A 1H4PA 4F0RA 4EK7A 5JUVA 5DQHA 1KTCA 4DJDD 4ZR8A 2NT1A 2F2KA 2VZVA 4B5VA 2OJPA 3RITA 3DYPA 3VVGA 6PTDA 5C6MA 4EACA 2CXGA 3BMVA 1I2PA 3KVJA 3VGEA 3PR2A 1E70M 2DZWA 3ZQ9A 1XLJA 4Q8EA 3RBEA 3ITTA 2ISVA 4LYQA 1XYBA 4Q4PA 3GZ3A 5DQPA 5B7YA 4ZBCA 3UNDA 3OYZA 1A4MA 1IIGA 3PJXA 3B0UX 4MSSA 4AWTA 4H7ZA 4E4PA 1SW7A 3C0JA 2FZMA 3WK1A 4LUYA 2VX5A 3VIJA 3LA4A 1QAPA 1GEHA 2VGIA 1EJTC 3TYUA 2CLEA 4FK9A 3KDOA 2BBFA 4QWBA 4U2ZA 4C7DA 3HV9A 4LUSB 4L9XA 2WQPA 3ARVA 5A5WA 2A6LA 1UW9A 2Y5SA 3WLHA 2NWRA 3RX2A 4J9PA 4OQVA 5EBAA 3AHYA 2DZUA 1FQ0A 3VDGA 5KFZA 3TR9A 3U7BA 5I02A 4I8DA 3R0DA 2ODOA 3L9CA 4EANA 1WV2A 1A5AA 2V2DA 4PCPA 1PE1A 1WPCA 4REQA 1D7KA 3EPIA 3FA4A 2A7RA 2XFRA 3GHTA 2CZ5A 1EFZA 1R87A 3DG3A 3STPA 1QRQA 3NPWA 1Q45A 3TQVA 1X1ZA 3AFBA 3VIKA 3ARZA 4Q4RA 4E3VA 5FD0A 4QJ5B 4LUIA 4HNLA 3B8UA 1JUBA 2DZAA 3O2LA 1W3TA 5C70A 1CIUA 1FY6A 4JQAA 5A6MA 1SZFA 9CGTA 3GFXA 1VFFA 2J78A 1QASA 4FXRA 3PPCA 4L1WA 3HBLA 3M44A 4JYFA 1XJBA 1XV8A 2PDXA 2EG8A 4FX7A 4R27A 3QY8A 1QNOA 4GQBA 2ALZA 3VIMA 2YLLA 4Y9MA 3ES8A 3TXZA 1TWDA 2QPUA 1UWUA 1S0NA 3LCXA 3MUCA 1GVRA 1HGYA 4WKAA 2J9XA 2PGFA 1HIZA 1IEXA 4I6VA 1IWPA 3WMLA 4IH3A 4P8UA 1K4HA 4GOAA 3ZYZA 2VD9A 3SCSA 1DWAM 1P4CA 3ZSSA 3G0XA 1BF6A 1WDQA 4U3CA 4GO9A 2J4GA 1V03A 1CLKA 5HATA 2FMOA 5IDIA 1KFCA 4GVFA 4QCEA 4HP5A 4FBUA 5HMSA 1RK5A 3T2OA 4EYHB 2J8TA 2V9WA 2X30A 3C86A 1YBQA 2BY0A 3RO8A 4JX5A 1MFVA 4YU1A 4GACA 1Z3NA 4DUXA 3WUFA 2BV9A 2IPJA 3PZVA 4O4WA 3VUSA 4L9YA 2Z28A 4DNHA 4CQ8A 2J13A 1ZTVA 3TKFA 2ALDA 3QXBA 4UOZA 3HG4A 3KAOA 8TIMA 3MMUA 3PZPA 3D3AA 1V02A 3V0TA 1RP9A 3AYTA 5AC4A 2ADAA 4GZEA 1NFGA 2GK1A 3BQ0A 1PL9A 2VEMA 2YCEA 1Y5XA 1V5XA 3H2MA 3W2MA 3QH2A 3WH5A 3EMQA 1PKMA 1ZUAX 1HGWA 4Z2JA 2XM1A 2Z26A 4OOUA 1BEUA 4A8LA 1BXNA 2XVLA 5D03A 4DZHA 3DFQA 2WJZA 3M9NB 4J35A 2A0NA 5AY7A 1O6IA 3F4VA 2I9EA 2QPSA 2VVSA 3GIPA 3T09A 1H49A 3PFRA 4U2YA 1OADA 2X40A 2J7HA 1M7XA 2X0YA 3N17A 4MY9A 2I1OA 3H2OA 6REQA 3PB0A 5A6JA 5LIXX 1PHWA 3P14A 1A0DA 3M64A 3T2PA 2W6RA 4PBFA 2ZX7A 3SCOA 1SQ7A 4UMBA 1NY1A 3T0CA 1UR4A 4RLIA 1HW6A 1W56A 4MNKA 2DW6A 3S1XA 1BYDA 1T41A 3KOZA 2CLIA 5CPOA 2C18A 5DF0A 3E2QA 1SPQA 4GKTA 2OZTA 5A2CA 3TNOA 4BI6A 5L1KA 3T5JA 3LHYA 3VD4A 1YNYA 5C71A 4FO4A 4OE7A 5A2AA 1C8YA 4OKDA 3NDYA 1JZ6A 3QMSA 1EGZA 3G1AA 2CESA 1A5CA 1FWHC 3W02A 1Q66A 2QW5A 3EWDA 4O1CA 4BQ5A 1SMAA 3HIJA 1TPDA 2XSBA 3OVGA 4UNKA 2PC4A 1PCKA 1J0KA 5CC5A 1AK5A 1E56A 3POCA 4D1IA 3EOEA 4ZQOA 5KINA 4HTYA 1MYRA 3TW7A 4ECSA 3ZXWA 4PTDA 4ZXLA 4PH6A 1B3OA 3GYCA 2ZX9A 4A3YA 5IHSA 3SY8A 4HNTA 1FXQA 4HNVA 2XVNA 3BGGA 1BKSA 2GGGA 1FDZA 3HQNA 4S1FA 3TDFA 2QCGA 2E6AA 2PURA 1OFOA 2Y7EA 4N02A 3RGTA 4DYEA 3FAXA 5I79A 3W7CA 2OWXA 1TR9A 3KZPA 4ZMGA 3AZTA 2VGGA 3LSBA 2X42A 3TFCA 1L2UA 3W7DA 1E6SM 1UG6A 4UOJA 2OT1A 4CGTA 1CB2A 3KRZA 4I7UA 1UKTA 2GSJA 5CZTA 4LSBA 1UKOA 5FEXA 2QXWA 4H19A 5FIPA 2PRHA 2G4FA 3QR0A 2NW0A 2E8YA 4X2PA 4CCEA 1US0A 3WF0A 2BR0A 1BGAA 1JI2A 5GJNA 3GTIA 4HSNA 1ICSA 4IT1A 3KDNA 3THDA 4IPLA 2GDUA 1XHGA 3BMXA 2BDQA 3W73A 5G4HC 1Q6CA 3UPBA 1X7FA 5I03A 2OGYA 3N73A 4D6DA 3S4TA 5HNRA 5FF0A 1B54A 3PNZA 4H41A 4ZSUA 3W86A 3D3FA 2TODA 1WDRA 4U5IA 5HULA 4JTFA 1Z69A 4FIQA 5H8PA 1JZ5A 3GG8A 4R34A 5REQA 3N2CA 3CNYA 3G2GA 3FA5A 2G50A 3GDRA 3WJSA 2DPIA 3IGHX 4HHMA 3N25A 4RDWA 4IXXA 3FCPA 1W0MA 5E09A 1NQ6A 3ARQA 1GNXA 4S3DA 5AHLA 1R3QA 4MMWA 4ICCX 3P67A 4D6JA 3EWWA 3D5HA 3EX3A 2NT0A 2X7VA 4XZIA 4QISA 1GONA 4P7RA 3ERPA 1GJPA 2CBVA 3TQ0A 2DT0A 3GFZA 3EDJA 4INFA 4PMUA 5G4EA 4DL5A 5EWFA 5K9XA 1UJPA 3PW0A 4JKMA 4BI7A 4XD3A 5XIMA 3GV8B 4W88A 2P1FA 3PP7A 1YPXA 3JU2A 4B4HA 2R24A 1EPVA 2ZZ7A 3TONA 1CDGA 8CGTA 2VT0A 2W3ZA 2ISWA 3LQGA 4D8LA 1M7JA 1E15A 1UMLA 3W27A 2Z24A 1XLMA 3N4FA 4PMYA 4JFSA 4CN1A 1I45A 3SB0A 5ECVA 4ACZA 2QDDA 1B4KA 3ABOA 2NVAA 3R89A 3EB4A 4LVGA 3FYOA 1QNVA 3CH9A 2JGQA 4U5KA 1W6TA 4AZ5A 2QCDB 4UFLA 4WZHA 4QS6A 3WLTA 3QLDA 3TOYA 1U33A 4EF8A 1O5XA 3E0IA 3ALFA 4TV5A 4W5UA 1WZKA 3DHDA 4HYWA 4EXBA 1OX6A 5I3GA 1XLBA 2OSXA 4FX6M 2JEQA 3EX2A 4G9PA 5FF4A 3LZ3A 2BWGA 2BODX 1HN1A 3H21A 4GZ7A 1RBOB 3GVRA 3ZFHA 1LP6A 1O5RA 4Z08A 4RJEA 1F76A 1LOLA 1M41A 1TFVA 3TA6A 1QW9A 1PS9A 5TNVA 5K7JA 2NQHA 1AW2A 4XAZA 5KFGA 1JPMA 4CQAA 5BMWA 5CBJA 5CZ0A 4E8DA 5FF7A 1B30A 3RLGA 3PTDA 2V69A 4PUEA 1TELA 4BKNA 2HE5A 1ZHAA 3WLMA 4OT7A 4YWIA 1J01A 1PKNA 4YLWA 3HGRA 2IMRA 3HGSA 5I07A 3QR1A 4GHRA 1KTNA 3GH5A 3JZEA 3AU6A 4CD6A 5BNKA 4F8XA 2Y1HA 3FY1A 1PTDA 1GVEA 4G7EA 3AS2A 3AWNA 3Q8SB 1D3GA 2F2HA 2O9TA 2W92A 3RB6A 7PTDA 3KXQA 1KR1A 3CPGA 1X6UA 4HJWA 3WH9A 4KFNA 3NFUA 4KRZA 4LVBA 4NUWA 4BCEA 1S2VA 3NUKA 4BWLC 5LXXA 2A85A 4O1DA 4PCTA 4C6BA 3TOPA 3WQCA 3VCCA 5KFDA 2XSAA 3QGVA 1M6JA 4RW5A 3GR8A 5M2FX 4MFEA 1CXHA 4E5TA 2HVOA 1P5BA 3R11A 3KRUA 5EMUA 4J3WA 1S46A 1EC7A 3LHZA 1VFTA 1ISVA 1HP5A 4GI8A 3W7NA 1KKOA 2H3BA 4JV0A 3GQCA 1KCXA 1JQXA 2DH3A 3PWGA 1DIEA 3T08A 4XD4A 1FFQA 2ZQ0A 3NURA 3UWQA 5KZEA 1WAUA 2ASHA 1I75A 1SYTA 2VEFA 1UROA 1XRSA 4J9QA 1SJCA 4DPPA 3CZKA 3ANYA 4L65A 1POKA 3CH0A 2DZSA 3OHIA 5HUOA 1BVWA 1UASA 4EIVA 4ZO6A 3PSVA 4DQWA 3VC5A 5FI8A 4XAFA 2WKGA 3VKDA 8XIAA 4NF7A 4RPQA 3M9MB 2CERA 3HURA 4WSKA 1FWCC 2J8GA 1EOMA 1JX4A 4X9YA 2PLKA 2Q3RA 3BICA 4ATDA 1EGMA 2R94A 8RUCA 1Y0EA 3LCLA 5C2CA 2WSQA 4UQCA 4CN4A 1V3JA 5CPTA 3TYCA 2DJXA 3NDOA 4Q44A 3LOTA 4JCMA 1OK4A 2O0TA 3ZIZA 2BS9A 3BO9A 4NSBA 2C28A 1YNQA 5D04C 1TPB1 1XBVA 2PDFA 2OQYA 1G0CA 1FXPA 4G2DA 1EPXA 3NZPA 2ISSA 1AW1A 4FIRA 3W7EA 1C9WA 1FWFC 1A50A 1QBAA 2VUNA 4AZ6A 4EOUA 1DXFA 4O28A 1PZ3A 1I8JA 2EXOA 1OFPA 4YP3A 1CLXA 2XVGA 3GR7A 4C1LA 1OB0A 5LIYX 2WVUA 5FSEC 3LHVA 4BR1A 3T1GA 5D9PA 1NH6A 2YB4A 4UNIA 2R8GA 5K2ZA 3RU8X 2JGYA 5F2GA 3W84A 4Q8MA 1RV8A 4GNJA 1BYBA 4NZ3A 3LQLA 1VYPX 2C2RA 4QQUA 3ZWTA 5JU6A 4TV6A 4J1OA 3GK0A 3VOIA 4S3FA 1NDVA 4H9VA 3NEVA 3VKBA 3K1GA 3RN6A 3WH7A 4F2TA 3OOQA 4AHQA 4DJFD 1E71M 2OX1A 3IVUA 3G1DA 1RY0A 4QWEA 3KRBA 4E2OA 3TJXA 4IIDA 4Z42C 4I8YA 3EWYA 1GKRA 1BF2A 2IBKA 1I2RA 1F6YA 1VC4A 2PDGA 5CZKA 9XIAA 3S9ZA 3MP3A 1H7RA 2FH8A 3GXPA 1G4SA 1TTJA 5GVJA 4N6FA 3I7RA 1VJSA 3O6CA 4LCQA 1D8CA 3PWAA 3SZ8A 3W72A 1IV8A 1U1JA 2P9BA 3BJSA 3NYZA 1R2SA 3CPRA 4XVDA 2ZRUA 2W67A 4J40A 2PU0A 1C93A 5HBFA 4WCJA 5D05A 4RZBA 4FEZA 1PBGA 5A3HA 4YMZA 3MUXA 4D6IA 3G0SA 3M5VA 1RZMA 3CASA 2VR5A 4RE3A 1LOSA 1FWSA 3CB3A 3APTA 5DQGA 2RDIA 4ORIA 4K36A 1EJXC 2PDPA 1QCWA 2VYOA 1KO0A 2CLLA 4H83A 1Q6GA 2VZOA 4LY4A 5FJJA 4DJFC 4OBSA 5CC7A 1SM9A 5CCZA 3P0XA 4S3CA 4R88A 1EO5A 3PZIA 1ICQA 4MPQA 1TPWA 1UWSA 2Y63A 1RLCL 5BOOA 3EYPA 2UY4A 1EIXA 4L9ZA 4H04A 3OYXA 4Y96A 3VNIA 2PFHA 3S2MA 3T05A 4PRWA 5DBTA 2J7BA 4YQWA 4GNKB 4JS3A 3GVVA 1XD1A 4ORMA 2D73A 4PUUA 1CPUA 1KFEA 2VEGA 1ONRA 1J12A 4EP8C 1BWLA 1PO9A 3C0LA 4K6AA 3A3XA 1KV8A 1G7UA 1E1EA 3WFLA 2E28A 3N18A 3TWBA 1XGZA 3WNMA 4Z2IA 3KUMA 1S5TA 4JOMA 4L4PA 4F2BA 2C15A 3MP4A 3GILA 1XQLA 4MWAD 2UY3A 2VJXA 1OK6A 3CQJA 1QI4A 3LYEA 3R10A 2Z00A 3ATZA 4ASTA 1PEZA 4IMCA 4Y6GA 3B0XA 3A5VA 4WK9A 3ZJ7A 1VH7A 3CWOX 3MSRA 1HX0A 3NZRA 3CAVA 3UY8A 3W1TA 1QK2A 4NZ1A 3CL6A 2YX0A 1YEYA 3W85A 2A79A 1BQGA 3EOUA 4TMBA 2CLPA 4MZ1A 2QULA 1MDRA 3DAQA 2DZXA 1QI5A 3APYA 2VTFA 3S42A 3EPOA 1EJWC 2FJUB 1DE6A 3O15A 1R85A 1EWEA 1CGYA 4ZQNA 4JV1A 1ZY9A 4ED8A 1REQA 1N7KA 2J9ZA 3CUFA 3CZGA 2WB5A 4H9XA 4W93A 5IRPA 1WZAA 1X1OA 4QEHA 2YYUA 4UZUA 2Z4GA 3W2NA 3KP1A 3Q4DA 4UZSA 2REQB 3U0HA 4ZZ9A 4ECZA 1W1YA 4IJCA 1UD2A 2VQTA 4NAEA 1DQXA 1R2TA 4QDPA 2F61A 4O54A 2XZ7A 3O0KA 4TOQA 3C3UA 1AODA 4ZXOA 4NZCA 4BQ4A 3N34A 2TSYA 4NKCA 4FLRA 4EF9A 1E9YB 1IF2A 5FAGA 5AFDA 4RE0A 3WEZA 3NJ3A 5LA1A 3PANA 3RB3A 1GQIA 4HA1A 3BCDA 4B2DA 2PTWA 1V6YA 3PBYA 3DFOA 3EDDA 4R8UA 4IFOA 3AS1A 2JKAA 3SCPA 4ED1A 2VFEA 3TJLA 3N9RA 3ZSTA 2YCLA 4NAFA 6ENLA 1HJUA 4NNAA 4MOZA 4LRSA 3T42A 3UVIA 3WQ4A 1I60A 4YJ5A 2HDJA 3K5XA 1K70A 3CO4A 4WGHA 3IWPA 1Y65A 5LHEA 2ICSA 2OEKA 3PF3A 3NQFA 4JKLA 4C6QA 4AYSA 3MYOA 1SU5A 4R85A 3TP4A 2P0IA 1V6WA 2BQRA 3RAXA 3W7IA 4LPCA 3P0WA 1JIBA 4HU4A 2BTMA 1SGJA 4YR2A 2BZNA 4Q7IA 3AMGA 1L8PA 1IM4A 4GY7A 1AL8A 1E9ZB 1TMQA 4O3RA 4QNWA 4GCXA 3WF1A 1ZJBA 1VBJA 4O3OA 1WO2A 4L1GA 3NO5A 3S9YA 4AIUA 2BVYA 1XKYA 4W7WA 3B3DA 3LPPA 1K77A 4GUIA 4UTMA 1IYXA 4R33A 1KC7A 3E5PA 2DZVA 2V30A 3WH8A 3HU7A 2OXNA 3ARTA 4U6PA 1DIKA 2BX7A 5A2BA 1TJ1A 1HKWA 5EWGA 2O9OA 3KHRA 3WF4A 1XRTA 1VRDA 2NQZA 3O3RA 3A4AA 5DO8A 2UV8G 1MW2A 1E43A 1F8IA 3P61A 5TIMA 6TIMA 1YKWA 4OOZA 4HMNA 1KWKA 1OWQA 1TWWA 1K1QA 3BQ2A 4F4ZA 4RKAA 3MBFA 1XS2A 3LRLA 3I6EA 2H90A 4JIQA 2GJPA 4DX3A 1OM0A 1QJWA 2QF8A 5GPRA 2VX7A 2WV8A 1O4UA 4I9TA 4QG8A 3IVSA 4Z0JA 1MFUA 3TK7A 2YSWA 3QSTA 3GR4A 3VCNA 1GWJA 2WVTA 1X38A 3CIXA 3MWAA 3S46A 3THCA 3FGCB 5EMYA 4O1BA 3VIOA 3LM3A 2VC5A 2JEGA 2J6VA 5D9NA 2V67A 2E25A 4HSOA 2NSOA 4PZVA 3VM5A 1EA0A 4JPGA 3LCFA 4JTRA 1V79A 3MVTA 4AD2A 4KERA 3HG5A 3RRXA 3WFZA 3OG3A 2JEFA 3OZPA 3QKEA 2J6TA 1V0MA 1XLAA 2XN1A 4O18A 2VFGA 4IQLA 4PBGA 1UUOA 3VK5A 1PYFA 4CEUC 1K1SA 4K8HA 2ZC1A 5FCZA 2OELA 3T7VA 2XHYA 4HZMA 4AQLA 3DBNA 1CB7B 4CLMA 3EOOA 4GVGA 3HGOA 5A1AA 1DWHM 3WLJA 1HJVA 2FTWA 2WMIA 1H61A 3SJ3A 2Z1VA 3WL0A 5AYIA 2FGLA 2PGEA 5TBOA 4CU8A 5CBIA 2W27A 4TU1A 1Z41A 3NG3A 4H9UA 4ZB0A 1TJ0A 3SCNA 3NVTA 4NJKA 4MLRA 2FLLA 3FKKA 4S2BA 1J10A 2CU0A 4GGHA 3CQKA 1XIFA 1QI2A 3OQ8A 2OEMA 4UWMA 4Y8EA 2VVNA 4FR6A 3UJFA 1ZNNA 2OB3A 1OFQA 3S3GA 1BSIA 5KFWA 3NZ1A 3TQ1A 4MNJA 4MJZA 3THQA 4GIYA 1FX6A 5F1VA 4PC8A 1XLDA 2FTYA 1Q13A 4B15A 3V0UA 2CHNA 4AW7A 4CNUA 2FB3A 3V0SA 3GTHA 1EJVC 3NO1A 3BSMA 3VX0A 3CC1A 2HZGA 4RXGA 4J9KA 3VILA 3W24A 1ONXA 4JV2A 3BDKA 1F3WA 1BXCA 3UZJA 1M65A 3NCOA 4IIFA 4LWWA 3CZLA 3KE0A 3L2MA 3HMJG 2QCNA 3NQCA 3O6YX 2VOMA 5MKGB 3BUVA 1EA9C 3GYEA 4UTUA 2PWVA 4IP4A 3MV11 2FIQA 4UNLA 1HZYA 2QUMA 5BOEA 2BG5A 4AD5A 3WKZA 3VGDA 7TIMA 1L2QA 4X3ZA 4K1WA 4GFSA 3VUPA 4LUJA 1DJYA 1VYSX 3UF9A 4S3BA 3O6AA 3OA3A 1FHDA 1HUVA 1TPC1 5DCBA 3MR3A 2Z1XA 3HQPA 4W8BA 4S23A 3VOFA 4FNRA 3RLHA 4HTBA 2YZ5A 2NUYA 3GIIA 3OIHA 3RYSA 3TTEA 2J7CA 3GUGA 3L4ZA 3RM4A 4DBWA 1VFHA 1HO1A 5HR7A 1ZRQA 1A5LC 4P8WA 2HJPA 2IQTA 4Q6XA 3LV6A 4BHYA 5T26A 2W9MA 5KT2A 4DRSA 2HEJA 1YXCA 2AQ4A 1ADSA 2AGTA 1XPGA 1PIIA 3EEGA 4QE1A 3CWHA 3F4NA 5U7SA 3UGRA 1HXJA 5RUBA 1I9CB 2G96A 2JIEA 3IJ9A 4B9YA 4N7QA 1R8LA 3OU8A 3IJ8A 1KRAC 1GVQA 5ABTA 1YLVA 2IKIA 2W7PA 3W82A 4QAWA 1NOFA 3U9IA 1DQUA 2HPIA 2AGOA 3TUUA 1PCWA 1NDYA 4L56A 4O15A 1P0KA 2OLHA 2ZZ2A 1E6XM 5G4WA 1ECEA 1IGSA 3LLXA 4QW8A 1G67A 3S47A 1QNPA 5DLCA 3PB2A 4V2XA 3SBFA 3CLWA 4NVTA 5TF0A 2AOSA 3T0BA 3CUHA 1EYEA 4PL1A 4AHPA 2BP1A 2D2GA 1JRBA 5FEPA 1N8FA 1CEOA 4QEEA 4KWVA 4DWSA 1WDWA 4MNLA 1OFRA 3GY1A 5BXPA 1LLWA 4YHGA 4EXAA 4JTKA 1ZQ5A 1DWFM 1ZJAA 5KFYA 1EX5A 3LDVA 5FJRA 1J18A 4JN6A 1AMYA 4A3RA 1POJA 1EJ7L 5CJNA 2VXNA 3FIGA 1AZ2A 4CD8A 2O92A 2OKOA 1JPDX 3H22A 3GC4A 1KCZA 3UY7A 3G6MA 5LIUX 2PDYA 2X41A 2I5GA 3PBVA 3IJQA 1DE5A 4BQ3A 3SQSA 1E0XA 1LLZA 3GNXA 3ITVA 2AL2B 5E0KA 3BW4A 4H9TA 5D2TA 1SMDA 3M0HA 3UXLA 4DL2A 1YRRA 4IG2A 4BY3A 4DVOA 1Q4WA 1V51A 3QW3A 5I5RA 1XLLA 2AMGA 3GAYA 5A6SA 3VOCA 1LQ0A 4KGLA 1XBXA 2XU2A 4U7CA 1GZ1A 2R6OA 3G5EA 3GH4A 5M1TA 3F2CA 1DIOA 5A6KA 3VD7A 5BW6A 1IIHA 1ZAIA 2WM1A 3LHUA 4B3LA 4GI6A 3SR7A 4RNJA 3UJRA 1EL3A 3VGGA 2G97A 1FCUA 3L5LA 1G4PA 3MKKA 3GIMA 1HKVA 3W1LA 3CK5A 4NI8A 2R91A 3WZ0E 4LBUA 1DBTA 4S3KA 1G5AA 3HTWA 3EX1A 3LU2A 4FZIA 3IIXA 1E1FA 4DBSA 1WBHA 3ZVHB 1R3RA 1J2WA 4R3UA 3TSBA 3FOKA 1U2YA 4P8VA 1GCYA 3IPWA 4RV8A 3L4TA 3CMGA 3DG7A 1ENUA 3WMSA 2PDCA 4QE5A 3PTMA 1YYAA 2HWGA 1T99A 2GOUA 4FNTA 2D22A 2GVGA 1Q6DA 1B3ZA 4KQNA 1JYNA 1XC6A 2HNHA 3P60A 4JTIA 1M68A 1RCQA 2ZUNA 2DDXA 1XXXA 3AIQA 5CSSA 4M56A 1MNSA 2YYTA 2CPUA 5JH2A 4NXKA 3T9PA 4D6HA 3VA8A 3HMCA 3I4KA 2A3BA 1K8XA 2JF6A 2WCSA 1H63A 2X05A 4UCFA 1H7OA 4XB3A 1PDZA 1YTEA 3NQDA 3ARUA 1KXTA 2J9YA 3SCQA 3B8DA 3H53A 3T81A 4WY0F 1JDEA 1DJWA 1SSGA 1H1NA 2JEJA 4PA8A 3CEPA 4QAIA 3PR5B 2GVYA 5DANA 2VELA 1JPHA 1IE7C 3IIVA 2C14A 4H9MA 1E51A 4DL7A 4JN8A 3M47A 4B5XA 3VIGA 3WO8A 4HOWA 2ZZ6A 3QBUA 3DFHA 4MB1A 5DY2A 3BLFA 3OLDA 3RJYA 4XBJA 3WJYA 1MRAA 1NSJA 5M17A 5KITA 1G69A 3KLLA 3Q45A 2VX6A 5DLFA 2ZZ4A 4HSHA 3HPZA 5HWMA 4GJJA 4DI9A 1R30A 3KOWA 4GX9A 1NVMA 2H9AA 4JIIX 2PTYA 2W7OA 3B8WA 5BMXA 3RB0A 1XG3A 4WVXA 3NO3A 1ONEA 1R6WA 3UZYA 3OO2A 5F9NA 4OGZA 1GOWA 3WJZA 1HT6A 4US5D 4OJYA 1E4MM 3PPFA 5I3KA 2PDLA 4LU0A 1OCBA 3H24A 3BCJA 2XC9A 4HQVA 1S2TA 5XIAA 3O63A 2AGQA 4DEFA 3BJFA 1JDAA 1JGIA 2WK2A 2XG9A 1T8XA 4GC6A 3L4WA 3AXIA 3MI6A 1MEIA 4M82A 4S3AA 3E74A 1I6NA 5HJLA 4AY8A 2VC6A 1A5KC 4O0KA 5C9UA 1MDLA 2QF7A 5L1JA 1W37A 1TQJA 1MEWA 5DN1A 1E4NA 2BHUA 1M3UA 5AZ0A 1FHUA 1K4GA 3AYVA 3BJYA 2OQHA 3LZ5A 1KBBA 1C91A 4GC7A 2PTXA 4AYGA 1UZHA 3EBVA 2WHKA 3MR2A 2CZEA 2GGEA 3A6OA 3KW3A 4RNHA 4C1NB 3C2RA 4CD4A 2OFJA 3N11A 4MKNA 3WQ6A 2VO5A 1S2CA 4AHOA 5AECA 3S1WA 5KFHA 5BXSA 2Y88A 4M0XA 5EMJA 4B5TA 3EWCA 5EMLA 3WX7A 5IM51 4C65A 4DJDA 4R9OA 4DLFA 1CCWB 1FKXA 5SWUA 3DU0A 1EDGA 2OPJA 4F0LA 2CBJA 3IACA 3RAQA 3N4AA 5U4NA 1A47A 4D6EA 3N2XA 4ED3A 1O5QA 4RNOA 3NQGA 5KG5A 2FHCA 1RQEA 1NTHA 1ICPA 1ZGDA 2NV2A 3FW6A 3ITOA 1RVKA 3AUOA 4GO8A 1JCNA 5DXXA 3B8VA 1V3IA 1GPWA 1C29A 1EHAA 2GSEA 1SO3A 3QZEA 4GG9A 3R43A 4Q4OA 4UQAA 3HFYA 2OODA 2OZ8A 3TFXA 3RRAA 4RCXA 2A6NA 1GVYA 5I00A 4ECTA 4AH7A 2PDJA 2QJNA 3GXIA 2J74A 3T5KA 1F9CA 1DTUA 3WJXA 5I6SA 3ABZA 4QDWA 3EB3A 1ME8A 5DMLA 4TX9A 3AXHA 4XZHA 3K2GA 3VMOA 2P3ZA 4EPDC 4B2DD 3MO7A 3EKLA 3E2RA 4IMFA 2E7FA 1RA0A 4JIRA 3U4FA 3TC6A 4Q8QA 2G3FA 1DWGM 3SN1A 3FYPA 4C6MA 3U7VA 2FLPA 1OD8A 3LX9A 4KEUA 2EPNA 3VIIA 3EZ4A 3VKAA 3SSJA 4WJEA 4ZO7A 2FDSA 2J62A 1S0OA 2WZTA 2VC9A 5BWFA 3L4UA 4AWEA 1RSCA 2XWDA 1TREA 1TZ7A 1CI1A 1VB9A 3V1PA 1F74A 2GGHA 1DOSA 5KFKA 1WDPA 3PZMA 1S1RA 1JZ7A 3U2CA 4IGSA 4J3UA 4AZCB 3NPXA 1GHRA 1AH4A 2QLYA 1PIGA 1KXQA 4XD6A 4JNZA 3I10A 3CT7A 4FMVA 4QG6A 1XIIA 3PULA 1ZFJA 3W7GA 5BWAA 4J7RA 3GU2A 1Q7MA 2CZVA 3LCIA 3TAOA 1F7BA 1Q2SA 5LGXA 5L9FA 4ES4A 4ECVA 1G1YA 1NOWA 2XSXA 1H3GA 3TW9A 3EPNA 1JCLA 2GZXA 4CQ9A 3EWXA 4GYKA 1ITCA 4OBRA 4BF7A 5J04A 3IRDA 2Q8ZA 3F5JA 2QCDA 2UBPC 1R7OA 1TQXA 3H54A 1KM3A 3G3DA 1GJWA 4LYRA 4O8AA 4AIEA 3GIYA 3FDGA 4J3ZA 5CZSA 4ZO8A 2HROA 2BOGX 1B3WA 4G6CA 2FPYA 2PPGA 2P8CA 2C0HA 3RDKA 1N56A 3GGMA 4PEKA 4ROQA 4AVOA 1XC4A 5KFLA 4JZ5A 2PD9A 3RILA 1RLDA 3VNLA 3NVDA 5KFIA 3WMBA 3GLCA 4ECXA 4FNQA 4W86A 3POHA 2NUXA 3TC3A 2Q8XA 5IBXC 1OX4B 1RJRA 3WBAA 1XLKA 1DHKA 1AW5A 1X6LA 3N9KA 2PF0A 3W25A 4UFHA 1CZ1A 3A3WA 3W3OA 5LHFA 1A4LA 5KZMA 2YW4A 1U5HA 4XIAA 3L4YA 4HCDA 3R8GA 1KFWA 2X7WA 1JF6A 1VD6A 1UPMB 2INZA 5CGQA 3NQ7A 1W17A 4W85A 2FKPA 1UD5A 4M7SA 2DIKA 4H2CA 3A9BA 3GU1A 1MUWA 5KFNA 1I0DA 3M0XA 3TROA 4CU7A 2WSPA 4G3IA 2JALA 1TJRA 1T0OA 2JFEX 1XCWA 2JE8A 2D3NA 1XWYA 3OBAA 4TTUA 3EGJA 1A0CA 1W9BM 4O13A 2R1KA 4E8GA 3O7UA 3E02A 1J0HA 3BOFA 3GXTA 3RK8A 2R8KA 3M7SA 5AVHA 1KFKA 3OZYA 4XAGA 1JCYA 4Y9AA 3L5MA 3M4HA 1WYIA 3MPGA 3M5ZA 2V3DA 3RUBL 4ZTYA 5KTLA 2ZRYA 4YTQA 1TTPA 1BQCA 4AFYA 4QE4A 3FN9A 2P76A 4XZBA 4UTTC 3I7QA 1PB0A 1UWAA 5I0DA 1NOUA 2V8ZA 4UR9A 1LDCA 2E1DA 2PWDA 2WJDA 3GH7A 1R3WA 3R4IA 4F40A 3HJEA 5G2HA 3W4RA 1MW3A 1SO6A 3PS7A 1ZSXA 4PMOA 3C2FA 5KG4A 3VZZA 2V63A 3PW7A 1QWKA 4DB7A 4EX4A 1ISWA 2PU1A 2VX4A 3UXIA 1DP0A 3TYBA 7CGTA 4GQ0A 5FL1A 1J96A 3TTOA 5FA5A 4FOJA 3VCRA 1QUMA 4YVXA 5CAKA 1CECA 1XGEA 4H01A 1XDLA 4QLLA 3F5KA 2C0AA 5I09A 3KL0A 1OX5A 1OIFA 4JTCA 1GZJA 4WQ6A 1EZWA 3KOFA 4R7JA 4LAUA 2JEPA 2PGWA 3ATYA 4PRRA 1S2WA 3S5OA 3CHVA 4J9LA 1GOXA 2WSYA 3CQ0A 5CPSA 1OSEA 3C2VA 4IHCA 3S1VA 5KG7A 4JYDA 2YDAA 2QCFA 2XH2A 3R6IA 4PULA 1XSJA 5HWNA 3DH7A 4R53A 3F4DA 4O3QA 3NOEA 3LLDA 3Q37A 3WNPA 2QMKA 3RM8A 5EL1A 2ZTKA 3TSMA 2NV1A 5A8GA 4PN2A 3F4WA 2HK0A 3NL6A 2BVWA 4IFKB 5DY3A 5I2UA 3VE9A 4BA0A 1TV7A 1TZ9A 1XH2A 3XIMA 2E77A 4YYCA 4M3PA 1DXEA 5DLGA 2C7FA 3FAWA 4CNPA 3T8QA 3T2QA 1W2VA 1WKDA 1B4EA 3QQWA 1GG1A 1R3SA 4UMAA 5G2IA 4J9OA 3E0VA 4PCNA 3BANA 1QOXA 3GE7A 3W81A 1FHLA 2Y24A 2GQAA 4GUGA 2DSUA 1XLIA 4LJ3A 1ISZA 5HJYA 1N82A 1M7OA 4DUWA 4WHBA 3ZR6A 1SJDA 3WNLA 1NDWA 3MUY1 3T0AA 3CHEA 3UFYA 4CNTA 1UR2A 1VFOA 2PB1A 3E3HA 4IPIA 4WF7A 4CEXC 1P0BA 2GGIA 4M80A 2EPHA 4MKVA 3QGKC 2V3FA 3P74A 3C56A 2E67A 5GJMA 1RYSA 3UP8A 1Q5MA 3P93A 4GKLA 4GYPA 1BKHA 1VLIA 1VF8A 2J75A 3W53A 1OBAA 4FXJA 3WQPA 2E9BA 2ZXDA 4X9SA 1HG3A 4OTKA 4GMEA 4J9NA 2J6SA 1JDFA 4WKHA 2YXOA 3SSZA 1ZJHA 1B0IA 3KL5A 2X1IA 3P8IA 3KHLA 1R9ZA 3TCEA 1V7YA 2PDKA 4E3TA 2CKSA 3GZAA 2OYKA 3IANA 3SQLA 3WLRA 4JL2A 4AMCA 2X0SA 2V5BA 4YHEA 1YTKA 1Q3NA 1XRVA 2QJIA 1KLYA 3UWZA 3QYQA 4XQ6A 4DF1A 4Q8NA 1ZB5A 1WXYA 5KFSA 4LNYA 4O52A 1TMLA 3OLGA 2I9UA 3C0SA 5CGTA 1EXPA 2VDGA 3S6OA 5DT7A 4PMZA 1KWGA 1UC4A 3U6WA 2OEJA 3SI8A 1QO5A 3U2EA 1KM0A 1QMLA 1UIOA 1E6ZA 4O53A 2LLEA 1TV5A 2QHAA 4OBTA 4JY8A 4RPPA 1JRCA 4A4AA 3NTYA 5D38A 4ADSA 4UTKA 2FZNA 5LNUA 1TWSA 1V4YA 2I57A 1H60A 3CMJA 3MHFA 1PWMA 1PZ1A 4O8RA 4A29A 3MB9A 5E5CA 3IUIA 4JTGA 3PJWA 3UBPC 1GG0A 4YXGA 3V7PA 1E9LA 1V0NA 1OFEA 4DUOA 4PB4A 9RUBA 2PGRA 3N15A 3AYRA 4LY8A 4F4XA 1JEZA 2VKZG 3G6LA 2V5KA 4DJED 2SFPA 4WXYA 1M53A 5C9ZA 3Q2DA 2W9CA 3G1FA 1UZ1A 3WQOA 2ZICA 4RDZA 1HJXA 2I17A 2CLHA 2RJHA 4YCOA 2HVNA 4PCSA 3WDHA 2P10A 4QQ3A 4FNUA 4XO7A 4HPNA 4QHRA 3AMKA 1B9BA 1HKMA 3MMWA 4BWLA 2HV5A 5BCAA 1JFHA 4RUAA 4M8UA 2WVSA 3B0VC 4B5NA 3LERA 2DVTA 4OVXA 4M29A 2PBOA 1Q7ZA 5CLTA 1K7EA 2G0WA 3OEXA 1SSDA 1XIGA 4XG1A 4L6OA 4KEVA 1PV8A 4UOQA 3VNMA 4HPJA 4UCGA 3BLLA 3C3NA 4AG0A 4JTSA 2ZBTA 2YFOA 1AJZA 1UR0A 5DEZA 4Z2GA 4P7QA 4BK9A 3LTSA 1W1IE 4TQTA 4H6EA 2C91A 3EXSA 4JY9A 3VPLA 3OGRA 1BPLB 1DHPA 4FB7A 3WYZA 1OT1A 4IIGA 3BAIA 4NP7A 5F4SA 1YBQB 4WDXA 4Z2KA 1S97A 1RXOB 5BXRA 4MDPA 1XW8A 1XSKA 5F4XA 4YWSA 5CSYA 1MSSA 1LZOA 4DJEC 1EO7A 3P5YA 1XPYA 2PI6A 3F7JA 4IL0A 3MO4A 3VU2A 2EG6A 3BLPX 3LG3A 2CCRA 3BW2A 3VZYA 1T40A 2QAPA 4C5ZA 1DJGA 2DU2A 4KF1A 1H7NA 4OZOA 4LAMA 3SAZA 1OCJA 3QZ7A 5I77A 1QNRA 2HBXA 2ABAA 3NXLA 1AH3A 2YIHA 2J7EA 3CU2A 3T5LA 2YA1A 2ZUWA 4F9JA 3USBA 3O06A 3L0KA 1Y7VA 2RH9A 4LF1A 5EBUA 2GK1B 2OLSA 4F0SA 2AL1A 1C3FA 3DC8A 3GNNA 4HKPA 3LD5A 4AVNA 3OVQA 3LXAA 4XUYA 1VJIA 2UVRA 1XLHA 4LYKA 2ZA2A 4OV4A 3EDEA 1VEOA 5KFJA 2QMJA 4H6KA 1PAMA 2XH7A 2JKEA 1RH9A 2BXYA 3TQKA 3W83A 4HMEA 1OCQA 1F3TA 2BGSA 4RZRA 2XIQA 4PE8A 1VGAA 1G9HA 1XYAA 3HGJA 6REQB 4C6CA 1GORA 1T7LA 4L4MA 4W84A 3T6CA 1E6PA 5HK4A 4RU9A 5K9DA 1YNPA 3SRDA 2VUYA 3W23A 1IQ8A 5HNTA 1PUDA 2AKZA 2W9BA 2X1TA 3QPZA 1TA3A 4GQGA 3ABXA 1H7XA 1E55A 1H2JA 1E3XA 3AIRA 4PUKA 2WCAA 5F7UA 3UZWA 1H1YA 5MF5A 5EDWA 4ZQCA 4M51A 1DVJA 2CLMA 3SDOA 4KEMA 1VEPA 3KVKA 3A5FA 4GUJA 2X16A 3EDFA 1XRFA 4MFDA 1EOKA 1LG2A 3PBUA 1GTEA 1YW1A 3VDCA 1IWBA 5IOBA 4J9JA 4C6KA 4GQRA 4JTTA 4H2HA 3SQMA 3BLOA 3GC2A 3ARRA 2WMJA 3GG1A 5A94A 2UZ9A 4BEUA 2E9LA 4YTSA 1LUCA 1QPOA 3IUDA 3V16A 1ZALA 5I3IA 3UWUA 2R82A 1GOIA 3EB2A 4LBRA 1JAKA 1PVNA 1QOQA 8XIMA 2OZ3A 1VPXA 3TTYA 1X8CA 4FX8A 5ENLA 4Y7EA 1QU4A 3H7RA 3THAA 2V5CA 4HZ6A 4WOZA 4JFWA 1HKIA 4GQQA 4C6IA 3AS3A 1RJPA 4H9YA 2H6RA 2FQIA 5DMNA 3SW6A 4KFOA 3IJ6A 3MSDA 2BOFX 1GTHA 4FALA 3UR2A 2NQ5A 1XLEA 3LV5A 3WNNA 3P7YA 3R5EA 1FWNA 2VL4A 3R94A 3DN5A 2ZUTA 1KRBC 1DIDA 3H70A 3GIJA 4FP1A 4XISA 1QPKA 3A23A 3GTNA 3PJTA 5DG8A 2TMDA 4M5PA 2WZHA 5DXYA 2PODA 5T91A 3B40A 5CBBA 3DFSA 3LNPA 4OFCA 5HUPA 4K1GA 2WVVA 4IR1A 4WY0A 3FDKA 1GKPA 4ZFMA 3ZT6A 2CBUA 3FK4A 2VURA 4F4YA 3GHRA 3I3DA 4XAYA 2G3MA 4GE8A 1MMFA 1SZRA 1F6KA 3K4DA 4NG3A 3SCVA 3BSGA 5FAJA 4H8UA 1W9UA 5DMYA 4AIBA 3G1VA 4GBUA 5C5YA 4DJFA 1W5MA 3BG3A 2ZA1A 3I3EA 1A3XA 1KBJA 4F50A 3H7UA 1F07A 3B06A 3R7MA 3QV6A 2X1RA 4X0NA 1XX1A 2WOQA 3KHJA 1K1DA 4MJ4A 5G2WA 3WF3A 1HFBA 3LNMA 1OEPA 1EP3A 3M0VA 1E4LA 4HPXA 2B0MA 3WUBA 3VNDA 4GWEA 5REQB 4FSAA 4LCSA 4ECYA 3WDQA 3TSDA 3P6LA 1EDTA 3STFA 4AEOA 4GVIA 2PRLA 2OT0A 2WW5A 1MW1A 5JBFA 1DTNA 1LT7A 4NASA 4DJDC 1ZS2A 1V08A 2PD5A 2OWCA 1ALDA 4Q22A 2ZIDA 3KBVA 3PZ9A 2YBVA 4LVAA 2V4RA 3C8NA 1DXIA 1NEYA 2PTZA 2QV4A 2Y4SA 3P3BA 4PUWA 4DUVA 3UWEA 4F4WA 1K6WA 1LLOA 2HK1A 5HR6A 1UH2A 3RJXA 4X0VA 2BB0A 1P7TB 3PUGA 2RDJA 3G3MA 3UZXA 5KETA 3KHGA 5GNYA 3S2CA 4AF0A 1TWIA 3SCTA 1MQRA 1E72M 3KBJA 1W1A1 5EWEA 2A3AA 5C9RA 1TV2A 5AC5A 5CKSA 3CV1A 4JD4A 4E4UA 3ZM8A 5KEZA 1VAHA 1UUMA 2PF8A 5JIPA 4GGBA 3MTWA 2WBKA 4KEZA 2YBTA 4IRKA 1C9DA 3QYSA 4XZWA 3SIMA 3VC6A 5LA2A 1EP2A 6CGTA 4P8XA 3SFKA 4RUCA 3CBWA 1TJPA 1WOBA 5BRQA 1HVQA 4NQ1A 1SW3A 3BSHA 3A64A 3E5BA 1KB3A 3MMTA 4AB4A 3ITXA 4UTWC 2GUUA 3CL7A 3OG2A 3VOGA 5HOSA 3MJMA 2I14A 1N2VA 2CC0A 3VDBA 2J47A 4OV9A 2KZHA 3WQGA 5LXEA 4ZL1A 3QVQA 2VRKA 3UR8A 4MWAA 4JAWA 5EFDA 5TD4A 4PRTA 3TIMA 3TQPA 3P84A 1UQYA 5F1UA 3UWYA 5FOOA 3T78A 3GXFA 2A21A 2I5IA 1T6MA 3MSGA 1N8IA 3MANA 3UCQA 4DF2A 4B3ZA 3H26A 2Y2WA 2YCJA 2J7DA 5G1TA 2WM0A 1KXVA 5MKGA 3B4UA 5IDZA 3QZAA 1NELA 4NLGA 1JPIA 2WTFA 1P1XA 4XX6A 2PUZA 1FH8A 3R13A 1F3XA 3M43A 3MC5A 1XL9A 2ESCA 1MVYA 4Q8WA 1OFBA 1PKLA 4DM2A 5G5IA 4L80A 3LRKA 3OODA 3THUA 4G7EB 3UG5A 1AJ2A 1XFBA 3WMCA 2PTDA 2PE4A 2AQOA 4V27A 3EXTA 1TPH1 4JL1A 3VZXA 1PDYA 1SR9A 3VMPA 4DO5A 5AHMA 3BARA 3LN3A 3MI2A 2C1IA 2RDXA 4WDUA 4BFAA 1QXLA 2BY2A 2OH2A 1RCXB 4RZ5A 3FV9A 4NRRA 2DT1A 3DFYA 3OSPA 3G0UA 4KESA 3WD0A 2CITA 4K38A 4F0KA 6XIMA 4IXHA 3QV7A 3GIQA 1GPFA 3WQEA