2G3FA

Crystal structure of imidazolonepropionase complexed with imidazole-4-acetic acid sodium salt, a substrate homologue
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
414
structure length
414
Chain Sequence
PKQIDTILINIGQLLTMESSGPRAGKSMQDLHVIEDAVVGIHEQKIVFAGQKGAEAGYEADEIIDCSGRLVTPGLVDPHTHLVFGGSREKEMNLKLQGISYLDILAQGGGILSTVKDTRAASEEELLQKAHFHLQRMLSYGTTTAEVKSGYGLEKETELKQLRVAKKLHESQPVDLVSTFMGAHAIPPEYQNDPDDFLDQMLSLLPEIKEQELASFADIFTETGVFTVSQSRRYLQKAAEAGFGLKIHADEIDPLGGAELAGKLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPGTTFYLGKSTYARARAMIDEGVCVSLATDFNPGSSPTENIQLIMSIAALHLKMTAEEIWHAVTVNAAYAIGKGEEAGQLKAGRSADLVIWQAPNYMYIPYHYGVNHVHQVMKNGTIVVNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A catalytic mechanism revealed by the crystal structures of the imidazolonepropionase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Imidazolonepropionase
total genus 153
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature ec 3.5.2.7: Imidazolonepropionase.
pdb deposition date 2006-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2g3fA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2g3fA02
4C6NA 3QY8A 2EG6A 4QS6A 2VM8A 3B0XA 3DUGA 4EP8C 2Z7GA 4B91A 3MVIA 1EYWA 1P1MA 4B90A 3PAOA 2YB4A 4WHBA 4ZSTA 1NFGA 2GZXA 3B0YA 4C6EA 3C86A 3K5XA 3GTFA 1KCXA 1P6CA 3OQEA 4XAYA 4P5UA 4C6OA 3O7UA 3E0LA 4JOMA 3R0DA 1A5LC 4C6DA 4PCNA 4MUPA 4CNUA 2HBXA 2Z26A 1EJSC 5HMEA 3S2JA 4LCQA 5G4HC 4DLMA 1I0DA 3IPWA 1I0BA 1V77A 1NDYA 4C65A 4IQJA 4F0LA 1EJUC 3IGHX 3GU1A 4ICMA 4L6DA 4QTGA 4GY7A 3RHGA 4KEUA 4IG2A 2P53A 1WXYA 1ITUA 1PB0A 3URBA 1GKQA 1KRMA 3A3WA 4C6JA 4GX8A 4IFKB 1FWGC 2FVMA 4IH3A 3MPGA 4HK6A 2VC5A 2YXOA 1YNYA 3LA4A 3TNBA 1IE7C 4QRNA 3HPAA 1J79A 1ONWA 2FFIA 3AUOA 3GU2A 4WGXA 3LNPA 2D2JA 4KIRA 4KESA 4XAZA 1J6PA 4LH8A 1V79A 3TN3A 3DC8A 1EJRC 3SO7A 3ORWA 4INFA 4C6LA 1R9ZA 4GBDA 4GY1A 2WJEA 1KRBC 3ICJA 3GU9A 1UIPA 3RN6A 1RJPA 3EWDA 3F4DA 3T1GA 2QVNA 1V7AA 1A5KC 3KM8A 2ICSA 1NDZA 3E3HA 4M51A 1PSCA 1W1IE 4GZ7A 4TQTA 2QPXA 3WMLA 4GK8A 3SFWA 3AU2A 4IG2B 3UF9A 2GWGA 4C6KA 4KF1A 1XRTA 4EPDC 4KETA 4CNTA 1KRCC 2AQOA 4AQLA 3E2VA 3N2CA 4XAGA 4ERAA 3NEHA 1FWFC 4IFOA 4F0SA 2HPMA 1O12A 1V51A 2FTWA 4C60A 4CNSA 4ZSUA 3UR2A 4G7EA 4DO7A 3OOQA 2PGRA 4RDVA 3LY0A 1UMLA 4YIWA 1BF6A 3WZ0E 1UBPC 4LCRA 3EGJA 4PCPA 1M65A 1UIOA 3GTXA 2YB1A 4DYKA 1A5NC 2HNHA 3HTWA 4J2MA 3O0FA 3V7PA 2O4MA 5FSEC 4GY0A 4DNMA 3FEQA 4CEXC 3OVGA 3T8LA 4PBEA 2AMXA 4EPBC 2D2GA 4GXWA 5LXXA 4XD4A 4I6VA 3RCMA 4LFYA 1EF2A 3QGAC 4PBFA 3EWCA 1YBQB 3ID7A 1S3TC 3GIPA 2Q09A 2GSEA 3PNUA 1RK5A 4G2DA 2Z4GA 3A3XA 4B3ZA 2ADAA 4EPKA 2Z28A 3BE7A 1QXLA 1E9YB 4OFCA 4CQDA 1K6WA 4Z42C 1J6OA 4DI8A 4C6CA 4RZBA 2PUZA 3F4CA 4UB9A 3FDKA 3GTHA 4GYFA 1J5SA 2I9UA 1FWAC 3CAKA 4XAFA 3URAA 2R1KA 4HA0A 3MKVA 3G77A 3GGMA 4LAMA 4C6FA 4NI8A 4H9TA 3LGGA 1EJXC 5FSDC 2WJDA 4RE0A 4DZIA 1ADDA 4C5YA 1A4MA 1V4YA 1QW7A 2Q01A 4LCSA 4H00A 2KAUC 3MTWA 1YIXA 4DIAA 3TN6A 1FKXA 4C5ZA 1M68A 2E1WA 2DVXA 2HPIA 1R9XA 3S2MA 2Z25A 4G7EB 3GUWA 2OODA 3UBPC 2P9BA 4CEUC 4CQBA 2Z2AA 4UBPC 1A4LA 2R1MA 4XD6A 4C6IA 4AC7C 2F6KA 2XIOA 4H9XA 4KEVA 3F2CA 3TN5A 3LGDA 3OU8A 4XD3A 2RAGA 3B40A 3RYSA 4LANA 2HBVA 3LSCA 2GOKA 1EJVC 1POKA 2FTYA 1M7JA 3E0FA 2VR2A 3PBMA 3IACA 5CH9A 4HK5A 2OQLA 2ANUA 3URQA 4ERIA 4B92A 4H9YA 1RJQA 4HK7A 1KRAC 2PLMA 1JGMA 3OODA 2R1NA 3NURA 4BJHA 1YRRA 4EPEC 4E3TA 4LAKA 4GOAA 2WM1A 1RA0A 3QY6A 4GC3A 3E74A 4DI9A 1POJA 2P50A 3CS2A 3MJMA 3NQBA 2PAJA 4HJWA 3URNA 1EJWC 2BGNE 3GRIA 2YZ5A 1E9ZB 3FDGA 5HMDA 3UR5A 3IV8A 3CJPA 1K1DA 3MVTA 1EZ2A 1GKPA 3PNZA 1R9YA 3S2NA 3IRSA 4H9UA 3TN4A 3T81A 1FWIC 2W9MA 4PE8A 2D2HA 4R85A 2Z29A 5A6TC 4LAOA 2VUNA 4ERGA 3ITCA 1RAKA 1FWJC 2Z2BA 3GG7A 2Z00A 2Z24A 3QGKC 2Z27A 1YBQA 3HM7A 4IFRA 1XRFA 1DPMA 4BY3A 2QS8A 2VC7A 2O4QA 1PO9A 2BB0A 4BKNA 2OB3A 4V1XA 4IGNA 1PTAA 3GIQA 2WJFA 3GTIA 3PANA 1FWHC 4H9VA 4KEZA 4R88A 2R1LA 3MDUA 2DVTA 4C6BA 2EG8A 1RA5A 3K4WA 2E25A 4F0RA 2VHLA 3JZEA 1RK6A 1FWEC 2UZ9A 1NDVA 3E38A 1RJRA 4J35A 5HMFA 1VFLA 3OJGA 2Y1HA 2G3FA 1ITQA 2R1PA 4DZHA 1EJTC 4CQCA 3AU6A 1K70A 4C6QA 1YMYA 4H9MA 4R7WA 1A5MC 1A5OC 4H01A 1GKRA 1ZZMA 3MSRA 4LEFA 2EG7A 3QY7A 4RDWA 5AKQA 3K2GA 3F2DA 4KQNA 4QSFA 3LSBA 4KERA 4C6PA 1P6BA 4QS5A 4I6KA 3D6NA 2IMRA 1FWCC 4NG3A 2GWNA 1NDWA 3S4TA 1XWYA 2DVUA 4IGMA 1ONXA 4C6MA 1XGEA 2ZC1A 1FWDC 3LS9A 4XD5A 3MDWA 4D8LA 4IF2A 4IFKA 4J5NA 2A3LA 2OGJA 3F2BA 4H9ZA 3UPMA 2QT3A 4V1YA 3A4JA 1FWBC 3S2LA 3IARA 3ISIX 4QROA 2PGFA 4RDYA 2OOFA 5E5CA 2AQVA 3DCPA 2CZVA 2UBPC 4LALA 4DLFA 4WVXA 1FKWA 1HZYA 2I5GA 1WXZA 4L9XA 3WYZA 1O5RA 3IJ6A 4GX9A 4NP7A 2FVKA 2HQAA 4RDZA 3LU2A
chains in the Genus database with same CATH superfamily
4S38A 1ZP3A 5TIMA 5ECUA 3JZUA 1TX2A 4KT2A 1H09A 3UA4A 2G96A 1SMDA 1TCDA 4YTRA 3IUDA 2VX6A 2PWFA 1FCVA 3GTFA 3TA9A 1JZ7A 1TE6A 5EY5A 5HWNA 4C6OA 3LBCA 3VD5A 3WH5A 2Z7KA 3L2LA 1XPYA 4I5XA 2ZWZA 1MYRA 1FBAA 4DZAA 5I3GA 1QBBA 1QTWA 1PZ0A 3VCRA 4RW5A 4AF0A 2FTPA 3VNIA 4IUOA 1RPKA 4IPIA 3M41A 4GWEA 2CYGA 3A9IA 1XLEA 5KFJA 3RB0A 4NXSA 4IH3A 3W23A 3MV11 2YCJA 4AWUA 4WKHA 5F9LA 4QRNA 1UR3M 1ZAHA 2VI0A 1UHVA 4JQ4A 1L8PA 3MI3A 4K7VA 1XC4A 4PN2A 4BF9A 1WKDA 3DYMA 1PX3A 3BW3A 1J6PA 2VX4A 5T8GA 4C6LA 1G4SA 4EVZA 2WWCA 1QVBA 3BMXA 3MMUA 5D9OA 2VOTA 1RR2A 2NV9A 3FSUA 3EWDA 2DT0A 3GVWA 4MY1A 1ZAJA 3ZT6A 4JX5A 5KZEA 1XIMA 5C7HA 2QPSA 1OD0A 3SRKA 5F2MA 3AU2A 4ZR8A 2AAAA 1F8IA 4DXXA 3FIGA 1OF8A 1KRCC 2IUZA 3PC0A 3SGZA 3NOEA 2JKAA 1MDRA 3SIZA 1CENA 3BAXA 1T3NA 4IWWA 3RLVA 5TNVA 4ZSUA 1GJPA 4R5EA 4HCLA 4PMZA 4NXKA 1XH2A 3H4DA 3GDKA 1KV5A 4JFTA 3HGSA 1A49A 4E38A 3AC0A 4PCTA 3NQAA 3HTWA 2XIMA 5HQMA 4LYRA 1VFSA 3TH6A 4GCXA 5HATA 3FEQA 3NL2A 3GHUA 4MM1A 3E2QA 2J13A 3M0XA 1QATA 4HMCA 2J7BA 3NQFA 5DO8A 3VILA 1QOPA 1V0LA 3BAJA 1X8FA 2CWXA 3RUBL 3QKZA 1RK5A 3UW6A 2YBUA 2C91A 2PDHA 3SBFA 4IL2A 4JTKA 2NXGA 1AJ0A 1CGWA 3NGJA 1XIGA 1YEYA 2GQ3A 3L4UA 3EPIA 4FF5A 3B9OA 4CQDA 1TV5A 1XH0A 4XWUA 3S5NA 4A4AA 1C8YA 2ONEA 4DI8A 4UTHA 1FA2A 3QW4B 1W1A1 1GPWA 4YPJA 1KC7A 2PU1A 5FEXA 4UMBA 3FA4A 4XUGA 4TO8A 2I9UA 5HA7A 1ONEA 3EMZA 2Y7EA 4MWAD 1ZETA 3LRMA 1NOWA 1GUVA 1EX5A 1LUCA 5FA5A 2WNWA 3N04A 1KFBA 1OX4A 3S1WA 1WDPA 4K7YA 1JCYA 5DT7A 4HVXA 3EOOA 2A21A 3WENA 2CFFA 1XFBA 4GI4A 1M68A 3H70A 4JTUA 1EUAA 3MBDA 2X8RA 2OZ0A 2DV0A 3W2UA 3A21A 3CASA 3SADA 3SCRA 2ZUSA 4HTBA 3IIZA 3ZQ9A 4ZTYA 2WHJA 1XISA 1QNSA 2P3EA 1O5KA 1UD8A 5CZKA 2YXGA 3W84A 1LT8A 5J5DA 4BA0A 2OCZA 2YLLA 2NUWA 1OGBA 2OQLA 1W5NA 4CKQA 3FEMA 2XM1A 1KKOA 1JGMA 3TMLA 3NURA 3G6YA 4UTLA 1YRRA 4O1AA 4LV4A 2X1RA 1XIIA 3EX4A 1KBJA 1OCQA 5CC7A 3B9NA 3N19B 3QYQA 4XISA 3PZQA 2X30A 5D8ZA 4Z2LA 4W9TA 4UFHA 3W75A 4CUCA 2VZOA 4QWBA 1L0PA 5DFAA 1IEWA 1C92A 3NQGA 3OA5A 4ERGA 3IJIA 2WVVA 2VJXA 1H41A 4JN8A 4S3GA 5KT7A 1K8YA 1R85A 1RPXA 4AIUA 1GW1A 4KWOA 4QCEA 1EP1A 3LHVA 1OYBA 3BMWA 1TUFA 3WFZA 2FLIA 2UY2A 4KGLA 5XIMA 4A3UA 2UVVA 3K4DA 2PZ0A 4PULA 3VFCA 5MKGB 1QO2A 4KRTA 2ABBA 2W8LA 1JZ4A 1BD0A 3VNJA 2BWGA 4PUMA 3JZEA 3BLOA 3LK6A 3KHRA 1RJRA 3PP7A 4QBXA 3CWHA 3NYZA 4OTKA 2CBIA 4L6OA 4LUTB 3HGOA 4LB3A 2GQ8A 4NZCA 1QI5A 3UZ5A 3QV8A 1XS2A 2QR6A 3HA1A 5DXYA 1XBYA 2XH4A 3OIHA 2VO5A 1PIGA 3EDEA 3ARTA 4Q8WA 2FDMA 2WCAA 3VCCA 3ITOA 3L5LA 4YWIA 1BTMA 5A6SA 3L2MA 4YWSA 3Q45A 5AC6A 3W74A 1REQB 2WMFA 1XWYA 4DL6A 4L9ZA 3VUSA 2W9BA 2ZTKA 5HMSA 2DJXA 2ZXDA 2E8YA 2JEJA 4WCJA 1MQPA 4FI4A 2OOFA 1D3GA 1LG2A 3PJXA 4U28A 4QJ3B 3OO2A 1KCZA 1RQEA 3NOYA 1KR0A 5CC3A 2PU0A 2J27A 3UEQA 2V3DA 1ZAIA 3B8TA 4GUFA 3IEBA 3AXIA 1QHPA 2IKHA 5K9CA 3WJXA 2AAMA 3MVIA 3P74A 4DQWA 1P1MA 4B90A 1NEYA 3CUIA 2P0OA 2VRQA 1OM0A 4F2UA 3MY9A 1UP0A 5AOUA 3WH6A 3APGA 4HSHA 3RLGA 4RLIA 1OGSA 2HBXA 2Z26A 3GG1A 3TEVA 2VXNA 1C8QA 3UPWA 4AWTA 4O10A 5HMEA 2JEQA 4WK9A 3QH2A 1VFUA 2FGBA 3IPWA 2DSUA 1H1YA 1RCQA 3BLIA 3MQTA 2E6FA 3LHWA 3Q2DA 2PDUA 1TVNA 1ELSA 2P53A 2O56A 3BGGA 1EPXA 2TMDA 1PKNA 4GNJA 4FO4A 4IHCA 1MMFA 1NFPA 3R0UA 3HURA 4XX6A 3W7EA 2YCLB 3UCQA 8XIMA 4HPXA 4J9MA 4XTIA 1YX1A 3LZ5A 3FKRA 3MFIA 4ICCX 4Q4RA 3OZYA 1E0WA 1E4MM 4MF4A 1Q6EA 3H6OA 2G3IA 2VEIA 1NARA 4QNWA 4RUAA 3EX1A 3TWAA 4F48A 1VHNA 3LPPA 3T2OA 3SFWA 3CLMA 3F7JA 4GQ0A 1B9BA 3H8AA 3LM7A 4FXJA 1W9DM 3JU2A 1JCTA 4GD0A 2W0UA 3L0KA 2B4GA 1H50A 3NEHA 2VELA 4TR9A 3DGBA 4YQWA 4PUKA 1OIFA 3AS2A 2WZIA 2PRMA 4A21A 5EPDA 2OEJA 3WZ0E 1W3KA 3NM3A 3BXWA 3KS6A 4ZOBA 3WK3A 4U10A 1DYSA 4FNTA 1YDYA 2HVMA 3U9IA 3H2FA 5C8BB 2X1UA 2R6OA 2V30A 3OVGA 3QZ8A 3EB4A 1OJXA 5KZ6A 3TSDA 4MIMA 3D5HA 2P88A 1GJWA 2VZTA 2EAWA 3RIKA 3T0BA 4C90A 2E5CA 1S3TC 1PEZA 3ZMRA 1N8IA 1CECA 2PZNA 2ADAA 1FHLA 1RALA 1ZALA 4UWMA 3WH7A 1D3HA 4JFVA 3UR8A 3ZLFA 3TWBA 5C9XA 2QXWA 4JYDA 4U7CA 4YLWA 3M0IA 3E96A 4GNVA 3GR7A 4QEEA 3UVIA 3CUGA 1OFBA 4ECVA 4IP5A 4RNIA 3VU2A 1QRQA 1W56A 1WUEA 3V5FA 2V63A 4KIEA 3K46A 4XB3A 3AALA 4FR6A 1L6YA 5CXPA 1JZ3A 2W61A 4GI6A 4LCSA 2ZZ5A 2OO6A 1ODZA 2YFOA 4UTWA 4EF9A 2R24A 2E1WA 1BHGA 2FB2A 4O8AA 4LNCA 4D6GA 1SFTA 7ODCA 3L66A 4JIQA 1XYBA 4UBPC 4GUIA 2WNZA 3LV5A 3WBXA 2NQ9A 2ISSA 1OK6A 3GDBA 3O05A 1RD6A 1HW6A 4PB3A 2CNCA 1W5QA 1F9CA 1DQWA 4J3UA 2H9AB 1M7JA 1FY6A 3WD3A 1GG1A 2PF0A 1LL4A 1KBIA 1KBKA 4HBKA 2ISFA 3EXRA 4J9KA 1ISXA 5D30A 4NAFA 3AYSA 1KBBA 2F8QA 3CZLA 3AISA 1G67A 3GH7A 2XFFA 4NU7A 4ZO7A 1E43A 2E28A 3CS2A 4AZ7A 3OZPA 4XZWA 3GDMA 3U57A 3OIXA 1TSIA 4IJRA 3GRIA 1UZHA 4JD4A 5I02A 3AIQA 4UIOA 3IUIA 1OFRA 1R9YA 3S2NA 5LNUA 3AHZA 1W5OA 2JF6A 1RH9A 3S5YA 3O2LA 4XSLA 5KG4A 1UR8A 3SUVA 3EDJA 2Z1BA 2PTYA 4ZOCA 2V4RA 2C8NA 2Z2BA 3C0JA 3GG7A 4ZOAA 1MNZA 3QGKC 3FSTA 3ZJ8A 1J0YA 3CZ8A 7A3HA 1H7RA 1TWIA 5AHIA 5JIWA 1S0MA 1TREA 5GJMA 3GIQA 2CXGA 4XZMX 3RM9A 2V2CA 2DVTA 4NAFB 2OOGA 2J8FA 5FL0A 3STPA 3QMRA 1G7UA 3E38A 1UD6A 3B97A 4FS2A 1SFSA 3W1AA 4D6HA 1O95A 2A6NA 4CQCA 3AAMA 3UWVA 3AJXA 5AFDA 3QGVA 2NVAA 3OQ8A 1M3UA 1GKRA 2A85A 2ZDRA 4TMBA 5FAGA 1US2A 5I03A 1M5WA 3EWYA 2Z1KA 3RR4A 4JIHA 1JCJA 4JXCA 3ZM8A 2F6XA 4C6PA 2DFAA 1M03A 1Q85A 2R82A 2WLYA 3M07A 3MMWA 3N3TA 2XU2A 2ZDSA 3MP3A 1KNWA 2C16A 1SZFA 2KZHA 1F6PA 4L4OA 1JCNA 2ZE3A 4DXKA 1XG4A 1XLDA 5ABTA 4S2BA 5JH1A 4MWAA 4V15A 2AQVA 3DCPA 1PDZA 2I7GA 1D9EA 3SI9A 1JDAA 1M04A 4CN6A 1FKWA 3CPGA 4H6RA 3EMQA 1U22A 1KGUA 3I7RA 4GX9A 3W28A 5C2CA 5D02A 5HR6A 2PTXA 3RMEA 5KFRA 4LBRA 2FZDA 1J2WA 3LU2A 5HBFA 1UPMB 4JY9A 2ZUWA 4XZHA 3UYCA 3AXKA 5E1QA 3E1F1 3BMVA 2BGSA 4A8LA 5FEPA 3PPFA 4GC7A 3EPNA 3ARWA 2VDHA 1KXTA 4FMVA 3AIUA 2C1IA 1R3RA 2GJNA 2FQIA 4CU6A 3SGGA 1H5YA 1TPVA 4W8BA 2REQA 3M1ZA 2BHZA 2E4TA 3L4YA 4JOMA 2V68A 3GLCA 4G7FA 1TJ2A 1QPNA 4CNUA 1VEMA 2F61A 3IV3A 3S2JA 5AYIA 1IT8A 5EMUA 1QU4A 4FBUA 3CIWA 4CQAA 1KLYA 3MA8A 2HWGA 1TX0A 4MG4A 1S0NA 1QFEA 2FLNA 3VMNA 3DBPA 2EKCA 4FEZA 5KFCA 3HQ1A 3I3BA 1XIFA 3KWXA 2WZEA 3S9IA 1IYXA 4IMGA 2Q3OA 3AQUA 3ITGA 4ECSA 2F2HA 1LQ2A 4S3AA 2Z6JA 3MC5A 2INFA 3CC1A 4RNMA 5A6AA 4UTWC 5TQLA 2J6UA 5BOFA 3M0ZA 3WLRA 4LS2A 5C9UA 2YXOA 4L64A 4U6PA 1YNYA 3LHZA 2CWNA 1IE7C 2ZRVA 2BXVA 4H4IA 1V3KA 1MUWA 1H51A 2A5HA 2IMWP 3W53A 4GZEA 3E12A 3VDHA 4ZCWA 4J3WA 4B15A 1HX0A 3EPOA 1A53A 1ZU8A 2BOGX 1E1FA 4O53A 3SO7A 1X7IA 1BYDA 4FLRA 2X1IA 4JTRA 3PTQA 4RNOA 4CVWA 2WJZA 4GISA 5AHNA 3MSYA 2W8KA 1ZS2A 4Q6JA 1TFVA 1IIHA 3GVQA 2ICSA 2HISA 4ADUA 4LRTA 5E6ZA 1CTNA 3CUJA 1UKOA 3W07A 4FLQA 1RUSA 1N7KA 4XVDA 4IIHA 4HNUA 3W7OA 1O12A 1V51A 1J0JA 1GNXA 5JBEA 2W67A 4KCTA 3KP0A 4DO7A 4XO7A 4ADTA 5BU6A 3V16A 2QAFA 4HNTA 4J9PA 1GOXA 3E2RA 3PZOA 1DHPA 5JMUA 3EGJA 2VR4A 1XQKA 2QCNA 4Q22A 3AS0A 1H49A 4GZJA 4ECYA 3DXIA 3SUSA 1FCBA 4QE1A 1EIBA 3DEQA 3RITA 1Z9AA 4EX4A 1LORA 1R5YA 4M7TA 4O1BA 3MJYA 1YBQB 4MYAA 4DWSB 4W8LA 1R2RA 4F66A 5JUMA 1E1EA 2KX9A 1H1NA 4LRSA 1YDVA 5HJLA 1RLDA 3KE0A 2BASA 2HDJA 4EWND 2QJMA 3GVGA 4MZYA 1N82A 3BJYA 4C6CA 5AECA 1UWTA 3LCFA 3GW3A 4EXQA 1F07A 1Q2RA 3URAA 4CU8A 2A3CA 3MHFA 1EJXC 4IL0A 2O9RA 3ARVA 4C5YA 5F1VA 5LZLA 2Q01A 3S5ZA 4DIAA 3RAQA 5AYXA 3VO0A 2QHAA 5TF0A 1EP3A 1AH4A 4JR5A 5REQA 1UD4A 1DWAM 2C7FA 3O16A 5AC8A 1M41A 4QCFA 4AC7C 2HK0A 1NM9A 2ATSA 4JIPA 5D8WA 3ZJKA 9XIMA 3VC6A 5D32A 3PWAA 2F7FA 1EO5A 1X39A 3UJEA 4B9ZA 1WYIA 3A13A 1W2VA 3IACA 5CH9A 4QHRA 4Z1DA 4ERIA 4B92A 1CIUA 3KBJA 1VJZA 1N8FA 3TIMA 3WQDA 1WB0A 1YXDA 4URIA 2WPGA 2V3EA 1XLKA 4BJHA 4R7JA 3TCSA 3V6HA 1EWDA 2Y8KA 3QR1A 3M0MA 3WSUA 4S3FA 4BI7A 3ARXA 4CN4A 1LLWA 3TX9A 3WLJA 4MNJA 2XVGA 3CJPA 3ENLA 3RLHA 1TELA 5CPNA 3VX1A 4LOCA 4LVBA 1NVMA 1Q66A 4HN4A 1RY8A 1XLMA 5A6TC 4ED0A 1B3ZA 1JRBA 3WLHA 4W93A 1FWJC 3Q37A 2J8TA 4L65A 4ADSA 1Q6DA 2GGEA 3PM6A 1XL9A 5KT5A 4BY3A 1JGIA 3HU7A 3T5KA 4JY8A 5F4WA 1BPLB 4NAEB 5AB3A 4NF7A 3VZXA 3WLTA 1W9VA 1K7EA 3RDKA 4C91A 1XDLA 5LKYA 2XVPA 1JAKA 3PB0A 3QQWA 1HXJA 4JIIX 5C2GA 3L0GA 2ACUA 4Q4KA 3K4AA 1MZRA 3K4WA 4BR1A 4AHPA 2I56A 2E6YA 3WO8A 2A1YA 4XUYA 2Y1HA 4WOQA 2CETA 3QZAA 3W7GA 1Y8BA 5DELA 4AIEA 2WKLA 3JVAA 1OQFA 3GXTA 3W25A 1UR4A 3I4KA 3WNLA 3OLDA 3ZT5A 2OFJA 5KFWA 2D20A 1X96A 3HF3A 2FJUB 1KXQA 5CCZA 3QFEA 3U7VA 4E2OA 2GJXB 4XBKA 1J2BA 2W7PA 4F0MA 5D4YA 5C2XA 2R9RA 5EMMA 3HIJA 1UASA 2WZMA 6XIAA 1W3IA 1AMKA 1AH3A 2BFGA 1AODA 3WNOA 5FJRA 3PHAA 2QT3A 3SAZA 1FWBC 1N55A 5BROA 2OPJA 3Q58A 4Q8FA 4Y9MA 4X0NA 5FF2A 3T0TA 4FNSA 3PW7A 3MUIA 4UTIA 3VIIA 3GG0A 1K4HA 4TOQA 5EWFA 2ALDA 4LUSA 1IM4A 3PZ9A 2YB4A 1RD5A 3W2JA 4WHBA 5CJ5A 1DIEA 2B7OA 3QLDA 2QIWA 3BSGA 4UR8A 2C1GA 3QBUA 3VNLA 1HJWA 4JTTA 3NZPA 2Z0IA 1NH6A 1HGWA 2JGYA 4IOTA 1DJXA 3H22A 3Q8QB 5H2ZA 5FJTA 1TQXA 3QHMA 1WCGA 3T5LA 1H63A 4W87A 1ITUA 1PB0A 5KFFA 4IQLA 4DL2A 2B7QA 4N4PA 3Q8PB 5BW6A 3E0WA 4JTIA 1VPQA 2YYTA 4HK6A 3LCXA 1WKEA 1BTCA 1LP6A 1YHTA 4UQBA 1TZZA 1BSLA 1TUXA 3DKJA 1RHCA 3FHQA 3MZNA 2I5IA 3TV8A 4IRCA 2FIQA 2HVOA 2X05A 3TN3A 4B5TA 3EAUA 5KFSA 3VDBA 3TUUA 1TV3A 3TOYA 5A6JA 3EX3A 2VGBA 2QAPA 4ECZA 2HXUA 2I1OA 1RJPA 3TQKA 3DHDA 3G1YA 1WDDA 1DQXA 3PAJA 1C29A 1PXGA 4IIEA 3VD3A 3PVFA 3QXBA 3OPSA 3KP1A 1J10A 4GNKB 2ALZA 5LSMA 3BCJA 2Z2UA 4HTYA 1EBGA 1US3A 4RCXA 4BS0A 3DH7A 3H53A 4J1OA 2Y70A 2ON3A 3I3DA 4HHMA 3UWYA 3MT1A 4MHBA 1GORA 1GQLA 2HPMA 3FA3A 1MW0A 3UR2A 5IBXA 4A35A 1XDJA 3WLPA 4ACZB 4UFIA 2D23A 1PKYA 3R10A 2HS8A 1I6NA 3ELFA 4LVAA 2FH8A 4WD0A 4JEQA 4UQCA 4RR4A 2GK1B 2YGYA 1LRQA 1RBLA 2OLAA 4RNHA 4ZE5A 4JDBA 4EAMA 1CZ1A 3UY7A 1EF2A 1ZCCA 2PDBA 1JPIA 1EUNA 2C3ZA 3EEZA 5LIKX 2Y8UA 3EOUA 5D9PA 1UR2A 4N42A 4HU3A 3IVUA 5DBUA 4UFLA 1XBVA 1QXLA 3GH4A 3IS4A 3ZVHA 3CK5A 2FVLA 2BZNA 2ZRYA 4Z42C 5LGXA 5A6MA 1TE1A 7XIMA 3LXBA 4JTAA 1XD0A 4GYFA 1J5SA 1FFQA 3UERA 4DZ5A 2VFEA 1FWAC 1DIKA 2C14A 1C91A 4XAFA 1JJKA 1ZUAX 4NVTA 3G77A 4PSPA 2J6SA 1IGSA 3MI6A 3IJDA 2G8ZA 4M6UA 1A4MA 3W9ZA 3TROA 3POCA 2HRWA 1FHDA 4K1WA 4DJEC 3VM7A 1MVYA 3PZUA 2X0YA 1TTIA 2Y6ZA 4BWLA 4FLOA 2OODA 3UBPC 4PEEA 3WDQA 2P9BA 2INEA 3P84A 3TR9A 2NLIA 1VQTA 3BLPX 5IOBA 3NVDA 2R1MA 3PZPA 4C6IA 3WH8A 4R27A 4WXYA 3EDFA 3PB2A 3LCLA 4OOZA 3HPSA 1QNVA 2WMHA 3PBWA 2G3MA 2ATLA 2WMIB 1KQYA 1QW8A 4IQDA 3STEA 5JXQA 2ISWA 1JI2A 5J04A 2XGZA 4H8UA 1ZBKA 4DBEA 4DF1A 2HK1A 3PK7A 1KRAC 3OYXA 4UOQA 3HPXA 4X3ZA 2PDCA 4WGHA 4HKPA 3PPHA 1CLKA 4QDWA 3E74A 4DI9A 4EOUA 1E6PA 4GI9A 4YU1A 4QFUA 4ZO9A 4Z1AA 4U4MA 1NIUA 2AKMA 5A2BA 3IK4A 5BOEA 3NWRA 5HMDA 2J6VA 7REQB 3TA6A 3AI0A 4G56A 1L6SA 3YPIA 3BGAA 4U5KA 3KVJA 4JQAA 1R3SA 2WPBA 4X61A 1FWIC 1A50A 1MUMA 3HJZA 4JL1A 4QQ3A 1XLHA 2V3FA 2Z29A 1EZWA 4QIUA 1MXDA 2VRJA 3THUA 4HHPA 4OUEA 1UQYA 2ZC8A 4MLRA 4ZO8A 3TP4A 4JTCA 3IK2A 1PO9A 5DXXA 6REQB 2FFCA 2OXNA 1A5UA 2PWUA 1Q6CA 1A5SA 5ENLA 5D2YA 2UWFA 2OKTA 4XBSA 1HTIA 2AU0A 1UJQA 4UZSA 2HVNA 3SDOA 3OA3A 3BV4A 1V8EA 5FJOA 3K30A 3KTXA 4FHAA 4OECA 3T40A 4QLJA 1U1JA 2UVWA 1EJTC 3AU6A 1K9DA 1A5MC 3TW7A 5G5IA 3ALFA 3EKZA 5CC6A 4QM1A 4GE8A 1S39A 4F4RA 2VEGA 2CLHA 3CZKA 2VYOA 2AQ4A 4RDWA 2BX7A 4CVUA 1JFXA 4QS5A 2C18A 2C79A 3N17A 3W7RA 5AHFA 3ITTA 1SO3A 4BK9A 1WZMA 3EB2A 5DGBA 2ZUUA 3FLUA 3C0LA 3T78A 1THFD 4N7QA 4KS0A 3NQ8A 2PDLA 1Q6LA 1VD6A 3H2EA 3H55A 3WQEA 1E4NA 1JPMA 4P7OA 4LF1A 5F4XA 3CU2A 4S39A 1E73M 2FVKA 4O13A 4OHQA 2XIIA 1E6RA 1UKTA 2XH7A 3N6HA 1OB0A 2VM8A 3F4VA 4IZGA 4B91A 2IQDA 3NUKA 4DPPA 4HNNA 2G3JA 3S1GA 5G2WA 4D6FA 5HAOA 4C6EA 1Y0EA 3CUHA 3I7QA 3OHMB 3VOHA 1C90A 3K1DA 4IRDA 2CLEA 3M6DA 4DJDD 4YCPA 4H7ZA 1TVLA 2AMGA 4H6QA 1P4CA 4UTUA 1LWIA 4LW7A 1V02E 3KL0A 1V77A 3B9EA 1NDYA 1KM3A 2R94A 4ONVA 2EXOA 5IDIA 3HG2A 1DJQA 1WXYA 4WY0A 4JTQA 4ZQNA 1MWOA 2XGBA 3VOJA 2JIWA 1J01A 3DYPA 2R8WA 2CHNA 4HZMA 3M43A 1TPB1 2X2YA 3BARA 1I1WA 2PPGA 3WQ6A 3BURA 2CHOA 1QDSA 3LN3A 2FFIA 4MGGA 4C1LA 4UR7A 2BQ3A 5KEZA 2ISDA 1UG6A 4LVGA 1S5NA 3WY1A 3DC8A 3GIJA 3NQVA 1BG4A 1KRBC 2HSAA 3ICJA 2Q8LA 1OG0A 4Y90A 2VFGA 4F50A 1CGTA 4HPHA 2WBKA 3NQ2A 3WQ8A 2C2RA 2QUNA 1O5QA 1Q6OA 4O19A 1L2QA 1O1ZA 5DGAA 1B9ZA 2TRSA 1EDGA 1ZPTA 3FY1A 3AOFA 3KCLA 4UTJA 5DLFA 3G18A 2BG5A 1H4PA 1RZMA 1S0OA 1ADSA 2GGIA 4JQ2A 2O55A 5I00A 2FKPA 4F0SA 1X38A 3ABQA 1ICSA 2VGFA 2Z6IA 2DPIA 1YTKA 4RDVA 1F3XA 2PS2A 3LY0A 1DVJA 3CIXA 3CL6A 4AVFA 3WKZA 2WVSA 3QYSA 4XVEA 3KFTA 3PBYA 5FEWA 2WVUA 4R9OA 3MO4A 4D8AA 2O4MA 4A3YA 5FSEC 2FZNA 4I8YA 4DNMA 3W1PA 2WQDA 1JCXA 3OZOA 4I6VA 3UGVA 4K39A 4PBFA 2JEIA 2C0AA 5IM51 2WSKA 2FZBA 1BYCA 1JPKA 1KFEA 1VR6A 2ZUVA 3B8DA 4EEYA 2ZRWA 4JL2A 3WEZA 1E9LA 1O4UA 4M19A 4O0KA 4DHGA 4I5RA 3WLMA 4K1GA 3DX5A 4GIEA 2BQUA 3TQPA 4WQ6A 1QUMA 4J9NA 3WJSA 5ECVA 3WDIA 2QLYA 5DLGA 2VCCA 2R8KA 1MW3A 2B7NA 3M0JA 2FB3A 3LGGA 2VD8A 3S6DA 4GVIA 3H21A 1TTPA 5DG9A 3TN6A 1XLAA 7TIMA 3QZ7A 1XKJA 3QMSA 3LHUA 4UR9A 1T94A 4ZBCA 5AYZA 5L9FA 3LCWA 3WQ4A 1A4LA 1TR1A 3W2LA 1GEHA 5KFNA 3PULA 4O18A 1PHQA 4D6JA 2HBVA 5EU9A 1NF0A 1UUOA 3VI2A 3SJ3A 1RYSA 3VDGA 2V0TA 2ISVA 2O9TA 2Q02A 5I3KA 2J7CA 1J12A 2DIJA 3QC0A 3L4WA 1PAMA 3F5KA 4IMFA 3VKCA 4Q8NA 4I90A 5B7ZA 2F9RA 2IQTA 1GTHA 4E4FA 2WO5A 3DFTA 2RDUA 3NCOA 3AXMA 3TC7A 4OBRA 3G6MA 1OEPA 2D1ZA 2DEPA 4D6CA 2GUUA 4F3HA 3DESA 3CHCA 3CAVA 5DLCA 1DXFA 5G4EA 5EKYA 1XD1A 4GACA 1DE6A 3IRDA 3ZR5A 4H19A 1HKWA 1BRLA 5LHFA 2HMCA 5KFZA 3AZRA 1XRFA 4OGZA 5A8NA 4J3ZA 4BKNA 2BDQA 4V1XA 4GIRA 4N9BA 2XGPA 4RZRA 2BY1A 5LNVA 4NL1A 5F7UA 3EWXA 1BWKA 3GTIA 2TSYA 1IZKA 2D73A 4GXMA 1SW3A 3U7BA 3W73A 1JXJA 4AWSA 1T0OA 2VKZG 4RXFA 3WEOA 4QX4A 3DGRA 4OOUA 1E6SM 2E3ZA 4F4ZA 2WVTA 3O06A 2GDVA 2G3FA 3L68A 1H60A 1C3FA 1YDOA 4ML4A 3VKKA 4HYRA 5KFVA 1O1HA 4DM1A 4NI3A 2CEQA 3M7WA 3M0LA 4H01A 3AWOA 3JS3A 4NZFA 3ZVIA 3SJNA 3VNZA 4G1NA 5EBUA 1R7OA 3A22A 1GEQA 3VIHA 3W7HA 1UA3A 4QSFA 1B5TA 3DHFA 3UT0A 3U3HA 4GRSA 2A0NA 2DH3A 3KHGA 2POTA 3AFBA 4GBUA 3AIWA 1VBUA 2IKJA 3KZSA 4JKKA 4KWVA 4EF8A 2W4XA 5E5CA 3W1TA 1V3HA 1H7OA 3A64A 4EK7A 2CLPA 3EWWA 2G50A 1AJZA 1GG0A 5K9DA 5A95A 3NL3A 1K4GA 2GQ9A 3KBVA 1TQJA 2FJKA 1D8WA 1EJ7L 1QPKA 4LSBA 3KDNA 2EPNA 2FYMA 5IXEA 3VGFA 1F05A 1XIDA 5I79A 2PDYA 1NFGA 2GZXA 3W1QA 1IIGA 1QHOA 3CHFA 3V5CA 1WAUA 5CPLA 5I24A 3PZTA 3AROA 4AH7A 2NQJA 2EGZA 1VRXA 2Y5JA 2X42A 3UD6A 2VCBA 4LBUA 5JQ9A 3T0DA 1AZ1A 2YL9A 3ZZ1A 3CV6A 1IR1A 5CSUA 4LCQA 3W2KA 1VF8A 2BVDA 1I0DA 2XSBA 4HYKA 4C65A 3JW7A 3IGHX 4ZQRA 3PR2A 2ACQA 4JNYA 4R34A 1DEDA 3PTKA 3EPMA 4NNAA 2OWCA 3W22A 5PTDA 1DXIA 1OFOA 2VEPA 3POHA 5A5WA 3N12A 3ATYA 3HB9A 5I0DA 3LA4A 5KSWA 3SCSA 3HPAA 1R6WA 3TONA 3XISA 3KL5A 2PC4A 5CZTA 3V6KA 3MHUA 2QJGA 2JK2A 1K7XA 2QCMA 3LQLA 3THDA 4YTQA 1SJBA 3RMJA 4LH8A 4R8UB 2IW0A 2V2HA 2VZSA 3QR0A 1FCUA 2BODX 1W32A 4N0RA 4JN6A 5GQBA 2HE5A 2WHMA 1G01A 5F2LA 4PMVA 1W9XA 1YTEA 4DL4A 3NQDA 1BSIA 3KS5A 3GC4A 3GY1A 1JDEA 1A5KC 3IVTA 4NHVA 3N34A 4P2VA 1XH1A 1B3YA 4GK8A 2BGQA 5KFEA 4HMEA 3E0VA 3HV9A 4M56A 1KM2A 3OYZA 4EANA 3SN0A 1NF7A 1DTUA 4CNSA 4PUEA 1OC5A 1TJPA 1XSKA 2ZKMX 3LEPA 2FHBA 4KKXA 3S5OA 4FNUA 1LL7A 1M65A 1UIOA 4HYVA 3WBYA 3CMGA 1A5NC 1W17A 4Q43A 1QI3A 3TW9A 3O0FA 1WZLA 2OG9A 1HP5A 3LG3A 3U2CA 2NWRA 1J0ZA 1BXBA 4LUIA 3PW2A 4EBDA 4DY1A 3L4XA 3HGJA 5K4XA 4A3HA 4JTJA 3A3XA 3SEPA 1W1TA 4TQSA 2V81A 2DDXA 2A7PA 4H3DA 5BWFA 5CSRA 1B31A 4LY4A 1NQ6A 4M80A 4YL2A 3A5FA 2H8XA 1P1XA 3F4CA 1R7AA 3SN4A 1SMAA 3VIFA 4PUDA 1K9TA 3MKVA 2QGHA 1HKVA 3GGMA 2EPLX 1IZJA 2I17A 3W4RA 4DBUA 2YYUA 3NJ3A 1SSDA 1TA3B 6A3HA 1CXEA 3ZLGA 1WO2A 4CNOA 8XIAA 3TLQA 3GUWA 3NZQA 4FPSA 4G1KA 4CQBA 4DF2A 4XD6A 2DZBA 4DAIA 3DFSA 5K3VA 3IN5A 2F6KA 4LUTA 3MYPA 3MYOA 4AZCA 3PBUA 1VFTA 4F40A 2HJPA 2AGTA 1GVQA 4PODA 4ECLA 4WX2A 3DIPA 2PDGA 1BKHA 2I5QA 4F79A 4WJEA 4O50A 5KMYA 1D7KA 3TTEA 1WZAA 3OLIA 2PLMA 5KFYA 1C8VA 3IGSA 1ODUA 5CQ1A 3OGRA 4DJFC 5HJXA 1V5XA 1S2WA 3TNOA 1O6IA 1RA0A 3G0XA 1PIIA 2GVEA 1CLXA 4EBCA 4K37A 4HU4A 1S9FA 1QNRA 4YTSA 3BAIA 1E9ZB 1OZMA 3CQIA 4FIRA 3NQ7A 5L6UA 3MVTA 1GKPA 3GNRA 3NL6A 2OX1A 4PC8A 1OCBA 3UCDA 2JEFA 4S23A 4AZIA 3WUEA 3H23A 3WDJA 3GC2A 4RW3A 3GV8B 1B3VA 1XLCA 3E49A 4YVVA 4UNKA 3B9AA 1RAKA 4JQ3A 4JPGA 5HK4A 1OD8A 3RPMA 1ESWA 1VBJA 3AMCA 5EMKA 3GX9A 4GHRA 3AMLA 3H40A 4RX0A 1U5HA 2CZ5A 4FK9A 5C5JA 4JEJA 1Y7VA 3QC3A 3J7HA 5DMMA 2O92A 1MEHA 3BO9A 1UUQA 3EB3A 5L1IA 3QOKA 2IPWA 3BAYA 5G1YA 3SZ8A 3L21A 2VOMA 2ALRA 3ARZA 3NO3A 3ONBA 2YCKX 1CGYA 1XM3A 4HD5A 2OU4A 3PTMA 1W5PA 4MY8A 3P93A 5I07A 1EDQA 3VX0A 1KM6A 3OJGA 5EWGA 5E93A 3CWOX 4HSOA 4MAZA 1YMYA 4ZA0A 2QUUA 3WQWA 4L4MA 4IPLA 4CNPA 5DN1A 2DUXA 2YDSA 1EHNA 1Q6QA 4U5IA 4I9JA 4ED3A 5FF7A 4GLEA 3S8HA 2YKKA 2O0TA 1MXGA 4KERA 3H7RA 3EDDA 4A05A 3RX4A 2QIIA 4NG3A 4PFHA 3GB6A 4B3KA 2NT1A 3GNXA 4XKMA 4H8NA 3BLFA 2PGWA 3F5JA 1LOQA 1J8VA 1ZJHA 3CWNA 5LIWX 3S9YA 2H8ZA 2GJPA 3AHTA 2XINA 5FL1A 1Q7QA 4ACYA 1F5ZA 5H6HA 4MKVA 3N3MA 4WVXA 3V36A 4PBGA 3KUMA 3UU0A 1JNDA 1PV8A 1WXZA 3KLLA 1BEUA 1JD9A 3AHVA 4NP7A 3C0SA 4WDUA 3RJXA 4C6NA 2YBVA 5I3HA 5MHBA 1D8CA 4HHLA 3B0XA 3DUGA 3B8IA 2DGAA 1JPDX 4DJFA 3BDKA 3NM1A 3P5YA 5KINA 4EAYA 1FP8A 4Q4OA 3C86A 3N2XA 3KZPA 2J24A 3W7CA 4P5UA 2ASDA 3LI1A 4GYPA 2W9AA 3ZYZA 1TCMA 4QW9A 4O3RA 1YNQA 2ZTJA 2VMFA 1T99A 3SUWA 1RCXB 2BBFA 4S3JA 1W1PA 2J47A 1MW1A 3O9NA 3W00A 5KTLA 1OX5A 1GQIA 3R43A 3CT2A 4FA3A 2XFWA 3PWGA 3INPA 4R33A 1WBHA 3QHNA 5C7VA 4UQDA 2JFEX 1HP4A 1ZB5A 3FOKA 1Q2SA 1VJIA 2I16A 4J9SA 2WK2A 3CO4A 4QITA 1VAHA 3QOMA 4Q8EA 2VC9A 1BLIA 1KM4A 3CAQA 3B4UA 3VNMA 5KFTA 1QOXA 1E6NA 1B0IA 3MFHA 3GD6A 2EQDA 1YADA 1Z89A 1KO0A 3WDRA 1AK5A 3G1SA 3BLKA 4I7WA 4KEMA 4UTTA 4LWWA 4B5VA 4LBSA 1JVNA 3F4DA 3IANA 3R1ZA 4Y8FA 1NTHA 4AEOA 2UY5A 4TQTA 4DM2A 1FDYA 3W70A 1LOLA 2J7EA 4MZ8A 5HNTA 1V3JA 2XZ7A 4X0VA 3UQNA 3V35A 3I7SA 4JDYA 5M17A 4CNTA 4EXAA 3TYZA 4ZENA 2AQOA 3PJWA 4V28A 2BY0A 2QNEA 3UNDA 3QLLA 4UUIA 2ZXBA 5KITA 4G7EA 3KOWA 1XIEA 4GUGA 3UZXA 1UMLA 3HV8A 1HL2A 4KRUA 4XO6A 2E6AA 3H2OA 3GQCA 3G6LA 3UZWA 2QUMA 4N4QA 1QO5A 3C0QA 4PTDA 4S3EA 4PBEA 1S5VA 2NT0A 2DP3A 4Y9AA 3VIKA 4IGHA 5LXXA 1FDJA 2VWSA 3ARUA 4OZOA 2QQ6A 1UH2A 4LEQA 3G3MA 3I10A 3BGJA 1M1BA 3G2GA 4X9SA 4CNNA 3OBAA 4M3PA 2DT1A 1VEPA 1HO4A 2BVTA 3NL5A 5AC5A 2WB5A 1G7VA 4QSHA 3H2AA 5AY7A 1DJNA 1A0DA 2ASHA 1IT7A 4W7UA 2WSPA 1EGVA 2EJAA 5K7JA 1GTEA 2YX0A 4D71A 2J6XA 1OCJA 3NZRA 2E09A 4P7RA 2DIKA 3KLKA 4DZIA 3PY2A 4P8VA 5A2CA 3RBDA 1ME8A 1P0DA 1J93A 1T8QA 2OGYA 2R91A 3MTWA 1Z3NA 3MR6A 1E3XA 3NQMA 1E15A 3KW3A 3NVTA 4QWDA 1AW2A 1Z6KA 1VLWA 3DECA 1FCQA 2EHHA 3SRDA 3A4XA 3AICA 2DZVA 1MQQA 2GVJA 3EEGA 4N6EA 4XD3A 4ALDA 4YHEA 4IP7A 5T26A 2A3HA 3TW6A 1VIZA 1Z32X 2VRKA 4KFOA 3R58A 3LBMA 3P3BA 4PMYA 3VE7A 4RL3A 4L1XA 4DUXA 1BG9A 3N6QA 4M81A 4CGTA 3VD4A 3QSRA 1A5AA 3P61A 2QCGA 3W1UA 2FLLA 3W71A 3IJLA 1U5VA 1RJQA 1F3EA 3DFPA 4RE2A 3FNDA 5HWMA 2R1NA 4H1ZA 3ANVA 4L7ZA 4OVXA 4E3TA 2ZXAA 2A7RA 3H2NA 2WM1A 4O8RA 3MHGA 3TYUA 2BP1A 3Q65A 1T96A 2E67A 3KCJA 4Z2JA 1ZGDA 1NWUA 3QKEA 2C28A 5HQLA 4IX2A 2XTKA 1O7AA 3WLOA 4AEFA 4XKYB 3IUHA 3IRSA 3KRSA 2CXEA 2V9DA 4JICA 2YCEA 1EH9A 3VINA 1VB9A 4B4HA 3N14A 2YDQA 3K8MA 1FQ0A 3W7IA 1C7TA 2J74A 4W84A 2GUYA 3MUAA 3AYVA 5DANA 3IAQA 1YBQA 3HM7A 3F4WA 3MZ2A 3QEZA 4YHGA 1PYMA 2O4QA 3UJSA 2XIBA 3CL8A 4M24A 1V6VA 4W89A 3BL3A 3R8RA 3BVJA 2OO0A 3CV7A 5H8UA 3IIOA 5FOOA 5KFKA 3E5PA 3CUFA 1PTAA 3WUBA 1VBRA 3LI0A 2UY3A 1ZSXA 5KFIA 4GJIA 3ABZA 5LIUX 5HNNA 4IMCA 4TVCA 4DXVA 4O14A 1AVAA 4PYSA 1QK2A 4PB4A 5FJJA 2QJIA 4BQ4A 3PW5A 2CBJA 1Z7AA 4GPNA 3TOPA 4RZ6A 2WNNA 3KWSA 3TTQA 1TA3A 5AYYA 4HOWA 1UWQA 5AVNA 1XW8A 3NDOA 1K9FA 4OQVA 2IXVA 5I6SA 4IJBA 4LEFA 2EG7A 1B2YA 3VXGA 3TYDA 4ASTA 2WMKA 1X1OA 3O6AA 4V27A 3TJ4A 2W27A 1W1B1 1E4LA 3G24A 2W7OA 4I6KA 1TV7A 4O12A 5G2HA 3MKKA 1I1XA 1UWUA 4C6MA 4KCUA 3I3EA 1XGEA 4YP3A 3SCNA 1OWQA 4IF2A 4IFKA 2YBTA 1GHSA 1PWMA 4AD4A 3F2BA 1LOSA 3SCVA 2F38A 1SZEA 5DT5A 2UBPC 2OT1A 3II1A 4DLFA 1S5MA 2V5CA 2V4QA 5I3FA 1VGAA 3WF2A 5FF0A 2WANA 3G3DA 5ABFB 5EFFA 1RXOB 1JUBA 4RNFA 1O5RA 2FPYA 2Y85A 3ZO9A 3NSXA 5T14A 4P7LA 3FHAA 3VKDA 3QY8A 2EG6A 2YA0A 5E9AA 3TC3A 2OZTA 2DSVA 5TBOA 3QV9A 4G6CA 3MUZ1 4K8HA 3M5YA 1HN1A 1QPOA 3GDTA 3M9YA 4B5UA 2A3EA 3B9DA 3PZNA 1WX0A 3BW4A 3R0DA 2YA2A 3W26A 3S5SA 2GJLA 4V33A 2ZZ2A 1H62A 4PRTA 5KG6A 4ROQA 3VKAA 1SW0A 5TD4A 4DUWA 3GIMA 4TTUA 4U2ZA 1VC4A 4MJ4A 4HNLA 1SYTA 4Q4SA 2E9MA 1LM1A 3PWIA 2WNQA 4GX8A 1E5JA 1R30A 3N11A 3W81A 1GPFA 1IV8A 1HJSA 3WX7A 4JKLA 1IWBA 2FVMA 2IXUA 2W3ZA 1Y5XA 4ZO6A 4UNLA 4N9CA 1SR9A 1WDRA 1XINA 1JXKA 3GNPA 4BWLC 4R53A 1J18A 4GY1A 2GSHA 4Q8QA 5KT6A 3P5ZA 5CZJA 4GQGA 3ECQA 1V0NA 1VH7A 3KBSA 2WW5A 1M7XA 4ZFMA 3VA8A 1XFCA 3I6EA 1W1IE 2BOFX 1AL8A 1W8GA 3WLIA 2QPXA 5D9MA 4REQB 4EYHB 1DL3A 4IPPA 4KF1A 5CG7A 3BICA 4TX9A 3N2CA 1W1VA 3CQJA 3FA5A 3WJZA 1EGZA 2OH2A 2NQZA 1S3HA 1IQ8A 4L80A 3W7DA 2IKGA 3NPWA 3T6CA 4AVNA 4YIWA 2Y7DA 3LXAA 3B3DA 1G94A 5CAKA 2OQYA 1F73A 3UY8A 1Z44A 4ECRA 5FESA 4PUUA 3WLSA 5HINA 2QCDB 3CLWA 3VZYA 4K8EA 4PTVA 2Y4SA 3BQ1A 1NU5A 4GY0A 3SQLA 2VC6A 4LJ3A 5TAOA 4OV9A 2IPJA 4H6EA 2X0HA 9CGTA 3QSTA 3RCMA 4RXGA 2GLKA 3R25A 1XSIA 4B3ZA 3AMGA 4IIDA 3MO7A 2NW0A 4P8UA 2PFHA 1AQFA 3TE9A 4OFCA 4MWAE 3RB4A 4AUBA 1ZRQA 4NT0A 1H7XA 4X9YA 3SI8A 3OG3A 2WBGA 2Q8ZA 2FMOA 2TYSA 3ZT7A 1OK4A 2QCCA 1NOFA 4MKSA 1M7PA 4LAZA 4WIWA 5GJNA 5FJIA 2JKPA 1RP9A 3Q67A 4O54A 1K6AA 5BMXA 4NZ3A 1TJ1A 2ZCGA 4DN1A 4EXBA 2X16A 1BXNA 4I7VA 2Z2AA 3S3GA 3P62A 3T5HA 5RUBA 5KG5A 1JIHA 2YXXA 1AMYA 1TPDA 4TV6A 2FPVA 1KR1A 1EJVC 1P48A 4N2YA 1UKPA 2DUAA 4MB5A 4S3BA 4L6HA 1ZP4A 5D2VA 4C7FA 1P0NA 1FUYA 1SPQA 3MCNA 6ALDA 6TAAA 3UG5A 3URQA 1ENUA 4IT1A 1H2JA 3OSNA 3Q8RB 2R8HA 1Q6GA 1W54A 2PLKA 1QBAA 1MQRA 3U0HA 5BRQA 2H3DA 1YYAA 4GIAA 1POJA 2P50A 4ED6A 4YS1A 3MJMA 3MR3A 1QWKA 3NQBA 4HJWA 3LPOA 3TKFA 1QPRA 2BQRA 3VDAA 3GIIA 2DY3A 3HZ3A 2YZ5A 2FDSA 3FDGA 1IXPA 2GVLA 3WLNA 3GV5B 3QFWA 2QJJA 3QHOA 4FXFA 4D1JA 3M6YA 2PWVA 3O1NA 1KA9F 4LC6A 1XI3A 4R8UA 1IR2A 2OKOA 2C2DA 1CXIA 4HOZA 4S1FA 5KFDA 3EYPA 7TAAA 3UXAA 2Z00A 2A4AA 2XG9A 1SGJA 4AZ5A 2YJQA 1A0EA 2NX1A 2HXTA 1EBHA 1F6KA 3WF4A 5U4NA 4C1NB 2PLJA 2XM2A 2ZIDA 4E0CA 1PIFA 2WJFA 4GH3A 3UJRA 2RGLA 4H9VA 4L9YA 2F2KA 3SM0A 2XH0A 4JTLA 1BF2A 2V38A 2H3BA 4TVUA 2QCLA 1W3LA 1G4EA 1OYCA 2FHFA 4EE9A 1UP2A 4HCHA 3T0CA 1FWEC 3QV6A 1PUDA 2XWDA 3S2CA 3ZSSA 3FJ6A 5SWUA 5E09A 4UQ9A 5IBXC 1VLIA 1MSSA 1PYFA 2PDJA 3E02A 4JNZA 2XPKA 3ITVA 4JX6A 3EPGA 4HU0A 3UR7A 1AD1A 1VFHA 1MO0A 1A5OC 1YNPA 3KHLA 4PB5A 3VD7A 4N6FA 1N56A 1XYCA 4C7GA 4NJHA 1XYAA 3BPWA 5K4ZA 4O57A 1VKFA 2R8IA 3VYLA 1UJPA 5A8PA 3GAKA 1DIOA 3WF3A 1JF5A 4TVDA 1US0A 1G69A 1CCWB 2GVGA 4US5A 3VOCA 4HB7A 1E72M 1A80A 4V2XA 2CLFA 1FX6A 3VGGA 1ZJAA 2XVLA 5HJYA 3LCGA 3TFCA 4H7VA 5I3IA 1I2QA 1OCNA 2W91A 3BUVA 4AU0A 2CZVA 1EX1A 5T91A 1IEXA 2VGIA 2Y61A 3WYZA 3GUGA 2OWXA 2V82A 2A2IA 4GKLA 4HQVA 5A3HA 3MP4A 1WKFA 2Z7GA 2G3NA 3RF9A 3WN6A 1QNOA 2B0MA 5JVLA 1KFKA 1NAL1 3NNTA 5M2FX 1MZHA 2FZ9A 3GG8A 1XYZA 4NRSA 4JTDA 7REQA 1G0CA 1JQVA 3FW6A 2C0HA 5A8QA 1F74A 2J9ZA 3OQEA 3O7UA 4Z2HA 1R8LA 5KETA 5CSYA 1IEQA 1K8XA 3C2OA 2CITA 3LHTA 3P80A 1UBSA 4GA8A 4MNMA 1XLJA 3TJLA 3QPZA 4WRHA 2TPSA 1EJUC 3GU1A 4QTGA 5BNKA 1ZBCA 4QXIA 4LX4A 1OT2A 2ZFAA 4FOKA 3OTRA 4HOXA 2C6QA 3KHHA 1KTNA 2VQUA 4POCA 4NILA 3H4WA 2PDIA 1QCWA 3ZJ6A 1EDTA 2QKFA 2XSAA 3MPGA 4UNIA 2FPTA 5K9XA 4EWJA 5FACA 1ZTVA 3HFYA 4EKJA 1B3XA 1UB3A 3Q94A 1JZ5A 1MW2A 1FRBA 3PPCA 4E6MA 3CEPA 4XIAA 2H90A 1WE5A 1BYAA 1XIHA 1AJ2A 5H91A 4D6EA 2JBMA 4GYKA 1UROA 1YXYA 3MMDA 3A3HA 1QI0A 4GBDA 2WJEA 4HYWA 1HG3A 3CUZA 1SSGA 4YJ5A 1EXPA 4CD6A 2IPFA 4Y9OA 2XHYA 5BU9A 1J0HA 4IGSA 3LRLA 1VFMA 4AW7A 2NUXA 1G9HA 3N15A 4I5UA 3PZMA 3BAKA 3V3WA 4PL2A 2D24A 2RH9A 3WMLA 4BI6A 2VFHA 2HCVA 1PBGA 4O3QA 1KM5A 4C6KA 4TIMA 5C9RA 1A5CA 5GJPA 1NQKA 1SW7A 4XTDA 4F9JA 2OMAA 4KWUA 4JNMA 3ZIZA 1H7WA 4Z0JA 3MR5A 3P60A 2VGGA 4XQ6A 4GIYA 1LWHA 4OV4A 2ASJA 1M53A 2VURA 1XX1A 4F2BA 1HT6A 2BOEX 1W9UA 1ZCOA 1RV8A 2PTZA 3D0CA 3BG9A 3WLLA 3GTXA 2YB1A 5CSSA 2ABAA 4E3VA 3SRFA 1U2YA 2X1TA 3R13A 4DWSD 2A3AA 1VJSA 1KM0A 4UOJA 3W6YA 2ZWYA 5L1LA 2PCEA 1S10A 4QP0A 2GJRA 4LFYA 3FDSA 4WF7A 4QG8A 3WCZA 5BWAA 1L6FA 1J11A 1P0BA 2WVVB 2V67A 1CGVA 4PMRA 1I2PA 2AL1A 5DEZA 2EJ1A 2JF7A 3T4CA 1LT7A 1IXQA 4NJGA 4NLGA 1OGGA 2QCFA 1J6OA 4ATLA 1PDYA 4ZQCA 4J3TA 3BLLA 1XDMA 3NQCA 3STGA 2R1KA 1A0CA 4LAMA 2DSKA 4PZVA 5I3DA 1YPFA 2V2DA 4ZGYA 2IKIA 1GOMA 4AVOA 4US6A 2WSYA 1ISVA 1OABA 1XBXA 3VGDA 1BVWA 2MUCA 3HMJG 4RNNA 4JN7A 3RCYA 2CLMA 3LM3A 3C61A 2DVXA 1B30A 1WV2A 5GPRA 3BW2A 3KL3A 4W86A 3U6WA 4JBRA 3VM5A 5KFPA 3NXFA 4J9OA 3OU8A 3BJTA 4LANA 4D72A 3UZYA 3LSCA 2P1FA 3N2MA 4FAMA 3TXVA 3T7VA 3KTCA 5JH2A 3PBMA 3G1VA 3T2PA 5BRBA 1Z41A 2E0PA 2ACRA 3UPBA 1XCXA 1J4EA 4CD4A 1UKQA 3MCOA 1KBLA 1Q8JA 1WPCA 4LGXA 2ZVIA 3DN5A 4LAKA 1T5AA 4REQA 5H1WA 1AQ0A 2J77A 4GC3A 4DPQA 1C8XA 3C3UA 4QG9A 1LUCB 4ILSA 4W7VA 4MNKA 8TIMA 5LNSA 3O6DA 4LYQA 4FNPA 1UCWA 4OWGA 3REQB 3IV8A 2B81A 4O1CA 2PURA 3L4TA 4FIQA 1XQLA 1G4TA 2J7DA 3RNDA 4J9RA 1U83A 3KRUA 3VTRA 4HA3A 1U33A 4IX0A 1GWJA 1MUCA 2QDGA 2D3NA 4R85A 3LB0A 4KGJA 3G6XA 2XDFA 3CMFA 3IWPA 1B54A 1L2UA 1E4IA 3PF3A 4RV3A 1X8CA 3HQNA 1RP8A 2RKXA 2NWSA 1TJ0A 5AVHA 2VC7A 1WUFA 2JIEA 2QULA 1SQ7A 2YPIA 3BZJA 4LQ1A 4MDPA 3ZWSA 2BB0A 3ES7A 1F7BA 1P7TA 2ZA1A 2DZPA 3QRHA 2Y7FA 4IMEA 3OGSA 1TZ7A 4E2BA 4FZIA 5HNUA 5MKGA 3LDVA 1DJZA 1N48A 4HJFA 4PMXA 1M9HA 4CLMA 2W63A 1BQGA 1HFBA 2J78A 3WBWA 3KHDA 1FHVA 3W88A 4P61A 2DJLA 1MXSA 4D2JA 3FX4A 3OHBA 1LQAA 4AIOA 1WOBA 3M16A 4LVFA 3SSJA 2EBNA 4DZHA 4ACZA 4UFMA 2WV8A 4FX8A 2W9CB 3W76A 5DCBA 1Q65A 3KBNA 3UWZA 1QK0A 4AYGA 4FXRA 5JIPA 4QJ5B 3UWQA 1P6BA 3MUY1 1XV8A 2PSNA 3NFUA 3IJQA 4LUJA 3MDWA 3ERPA 3TC6A 4D8LA 1V08A 3LCIA 1EF3A 2VFDA 3E6EA 2OGJA 1XRSA 3A4JA 4QROA 2AGOA 2ZX9A 3NO1A 3NPXA 2E9BA 4FR1A 2CCRA 2DH2A 1K8ZA 3EXTA 4Z0SA 4BF7A 3HPFA 4IMDA 2PWEA 3F1QA 1MDLA 4XK2A 4Q7IA 1MEWA 2RDJA 2D0GA 2OLHA 1RYRA 2JKEA 1CNVA 3WQCA 1EHAA 5C70A 3ARQA 3FJLA 5AZ1A 3SCTA 1FDZA 1XLFA 3CM4A 1YE4A 1LROA 1GZJA 1L8NA 1E0TA 3W7KA 2P3ZA 5F1UA 3BG3A 2NX3A 2NVCA 4F0KA 1B3WA 4W5ZA 1UWIA 1VPXA 3FFSA 4Q8UA 2E8ZA 4ZE4A 1I0BA 1F76A 4WSJA 3BQ6A 2BY2A 4GY7A 4IUGA 4D6DA 3VMPA 2OYLA 3JUGA 3GXDA 2WC7A 3VDCA 3CH0A 2GFTA 1XUZA 4GUHA 4HNVA 3A3WA 2G95A 1X7FA 3P67A 4WLCA 1FWGC 1ME9A 4L5ZA 2PMQA 1WBJA 1XKYA 1E71M 4QW8A 1A3WA 1J79A 5FJPA 2VWTA 4FF7A 1ONWA 3LHYA 1KV8A 1WNOA 3WIJA 3WELA 4JYFA 3GU2A 7ENLA 3PS7A 2DIEA 3GTNA 3OVPA 4GFIA 2B7PA 3G1FA 3GILA 3NG3A 1V6WA 3RPDA 1C7SA 1UD3A 4H83A 3G22A 4GVFA 1PCKA 4P7NA 4M6PA 3A23A 1F4HA 4IQEA 4GFSA 3O6YX 2HZGA 2H9AA 4RV8A 3R79A 4IRKA 1X6UA 4M6QA 4Y2WA 3WUGA 2P76A 3WF1A 1XIBA 3TTOA 1PX8A 4JKMA 4WKAA 4X22A 3R6IA 4MY9A 2YW4A 1YKWA 3W37A 4EPDC 2WWDA 1E5NA 2DSWA 2PDNA 4DBDA 3A9BA 4AQLA 4XAGA 1TR9A 4B2DD 3U4AA 3ARRA 1X6LA 1QMLA 1DWFM 3GE7A 1EL3A 1ISWA 1V7YA 4TTGA 4PCPA 2VX7A 2C13A 4KWWA 1LJYA 2G4JA 3TDFA 3B8SA 4Y9NA 2BMBA 3OHAA 1CPUA 3CNYA 4GXWA 3CQKA 3P14A 3DG3A 5E70A 1GHRA 3N2TA 2R8GA 3E0IA 4HP5A 2PDKA 1JR1A 3RM4A 3WG6A 1QOQA 3RU8X 3HQOA 3EBVA 1E51A 3FVMA 3STCA 1K1SA 2VFIA 1DV7A 3QPYA 5I06A 1PZ3A 5C71A 3MR2A 2VX5A 1GVEA 3PSWA 1F61A 1UR9A 4ED2A 2P8CA 3BSMA 4AWEA 4RZBA 1U1UA 2E9LA 4PFMA 2NXIA 2G97A 1CEOA 3KVKA 1MI3A 1IXNA 1FH8A 4AZHA 5FKYA 1UA7A 1W9PA 4LPCA 4C6FA 5B7YA 4H9TA 4NYYA 1E70M 3NGFA 1V4YA 1FWWA 1SZRA 3NSMA 2E1DA 3KCOA 1ML1A 2FGLA 1H0IA 1Y5VA 2CKRA 1CT5A 3TSMA 2BVWA 4L61A 3ANYA 3W7QA 4AEEA 2D22A 3BZGA 1VS1A 4H9XA 1ZBVA 3B06A 3LV6A 3K8KA 4MFEA 5ABEA 3VD9A 5KFAA 3RYSA 4ECUA 1GGOA 3C5QA 1EEXA 4C1KA 3M9MB 1QW9A 2VVNA 4PMNA 5E0FA 2QEZA 2VZUA 1JUEA 4GUJA 3H26A 4O0QA 4AZ6A 2E6DA 2IA6A 3VOGA 1UD2A 3KX6A 3SB0A 4Q7BA 4NAEA 2CZDA 3H2CA 3DHUA 1BGAA 1PPIA 4AF0B 2ASLA 3OODA 1SZNA 3GFXA 3S42A 3CZGA 1M6JA 3COTA 2AGQA 3VABA 1XCFA 4YYCA 4J7RA 4CU7A 4QDPA 1CGUA 2CLIA 2OJPA 3U5YA 2PAJA 3ABOA 4PMDA 3GWQA 4NUWA 1LG1A 3DENA 5D05A 3GBDA 3UR5A 2J7FA 4H2CA 1VHCA 4IR9A 1EZ2A 1TRIA 2V9WA 3CMJA 5DY2A 5LA2A 5KFXA 4JCLA 3B03A 1JZ2A 1AA1B 3XINA 3QQ1A 1HUVA 3N9SA 3W27A 5D37A 4W88A 4ECTA 6CGTA 1JPHA 4GO8A 1ZL1A 3FXYA 4IFRA 1OFQA 3OEXA 1UZ1A 1T6MA 4R7OA 5I78A 1NOUA 1S97A 3AIBA 4B5SA 1LDCA 4O17A 1RBAA 5DCEA 1VBHA 5M1TA 3VUPA 3OVRA 2DUZA 2J9XA 1O60A 3SCQA 3LPFA 1GYNA 1XPGA 2VHLA 1C9DA 4DYEA 3N1AA 1OX4B 4CCCA 3M44A 1TPWA 2PA6A 4J35A 5CPQA 4ZTXA 2ZBTA 1AQHA 2R1PA 5XINA 3ES8A 1UD5A 5D33A 2ZYFA 5C9WA 4R7WA 1QHZA 1ZJBA 3R12A 4RZ4A 2GPTA 1AD4A 1EGMA 3KOFA 4GQBA 4Q8OA 3VIJA 1BAGA 1R3WA 3TFXA 1JYNA 3I68A 3PSVA 5CLTA 3WBAA 5J8LA 3L4ZA 4XZBA 2C15A 3EA3A 2GWNA 1EA0A 2POZA 3NIYA 2PE4A 4KMQA 5CGQA 3IJ7A 4MWAB 3VAVA 2GQAA 3UPMA 4GMEA 1VENA 2VR5A 4ZXLA 1I9CB 3T8QA 2WHLA 4DWSC 4L9XA 4Z2IA 1XP3A 2NQHA 3GDRA 4RDZA 1JNEA 3FS2A 5FEZA 1NP0A 3B0UX 4QS6A 5A2AA 4BCEA 2RDIA 1KWKA 3L2IA 1TIMA 3RAXA 1TPH1 5D2WA 4GABA 1SFLA 1R38A 4FS9A 1R46A 2C19A 3PUOA 1PZ1A 4ZSTA 1CXHA 2GK1A 2ZICA 4HNCA 1W37A 3OBEA 3VOFA 4F4WA 1T8XA 5F2GA 4Q3MA 3OHIA 1A5LC 3APYA 4PCNA 4C6DA 4AY8A 4UTKA 3W0KA 2C1HA 3RLUA 4B5XA 4O28A 3UGRA 1HJUA 1DE5A 4JQ1A 5G4HC 1K9EA 1LRNA 3SY8A 1TV8A 4IQJA 1JL8A 4Y96A 3R11A 1H3GA 1HJQA 1UZ4A 3T08A 3NSNA 1UWAA 3URBA 5BRPA 3PG8A 3TYAA 1KGWA 1W91A 1ADOA 4C6JA 5MF5A 3GQYA 1TTJA 2W66A 1V03A 3WJYA 1X1ZA 5DF0A 5L1JA 5BCAA 4PL1A 1CWYA 1S2TA 4TX6A 1RBOB 1GVSA 4WGXA 3A4AA 3LNPA 4Q4PA 3SQSA 4FOJA 2NV1A 4Q8MA 3CTTA 1DJGA 2GDUA 3ORWA 4PMJA 5DY3A 1R87A 1TMQA 1UIPA 3RBEA 3RN6A 2WAGA 3OSPA 2I9EA 3W83A 2HV5A 5BZAA 3T05A 1FWTA 3O8AA 4XZIA 2OT0A 5JUVA 3E3HA 4BEUA 1KKRA 3M5XA 4G8TA 4GZ7A 2BS9A 3FJNA 5D2TA 4ZL1A 4KPLA 4WZHA 4MMWA 3SY5A 4IG2B 1YPIA 3EOLA 3LUTA 5I23A 2NSOA 4ECWA 3GSMA 5D2XA 5AHLA 3Q4DA 3AXHA 2OSYA 3CHVA 4M82A 5HPOA 3AS3A 3UESA 2FTWA 4C60A 3RX3A 3WNNA 5A69A 4QG6A 4AZBA 2RDXA 3M9NB 1TG7A 1XBZA 1UBPC 4LCRA 4Y7EA 2Z1SA 2XCAA 1CBGA 5FAJA 1NFBA 3GIYA 2HNHA 3MWAA 1HF6A 4QISA 4DYJA 3CBWA 4CEXC 3G6VA 4EPBC 3NA8A 5ABGA 2WSQA 3AS1A 1E1CB 5CJNA 2IPGA 1GYMA 1DJWA 3EWCA 3ARYA 1VFFA 4AB4A 1GVYA 2ZVRA 3LLXA 2V5JA 4LUYA 4O15A 3TYBA 4MUZA 2A79A 3USBA 3TXZA 3UXIA 1KWGA 2PI6A 4AX6A 2YSWA 1V6XA 1RSCA 1O66A 4J28A 4O1DA 1ALDA 3TAOA 4J9LA 3DFHA 3GTHA 3HN3A 4TMCA 2DPJA 4WEVX 2ZUMA 3KTSA 4OKDA 3OW1A 1P7TB 4PRRA 4YNGA 4GVGA 2WJDA 8A3HA 2OX4A 1ADDA 4NSBA 4A2SA 1CW2A 2EO7A 1X6NA 4H2HA 4YTUA 1ONRA 5KG7A 4KCWA 1YQ2A 2ODOA 5I7GA 4W7WA 3S2MA 2Z25A 4AXNA 4G7EB 4RK8A 5I2UA 3WQGA 3N4EA 5CPTA 4AAJA 3TAKA 1TWZA 3GKAA 2X2GA 1VCGA 2RAGA 3D3AA 3B40A 3EKLA 1IT0A 4BZYA 3IIXA 4MJ2A 1GW9A 3QV7A 4E2DA 2IBKA 4BF5A 3BCDA 4HT3A 1CB2A 5KFQA 1ZBWA 3LX9A 4LT9A 2ANUA 1B4KA 3L9CA 2QZRA 2JGQA 5BOOA 4ORIA 1VFOA 4YR2A 3EWBX 4AX7A 3WQFA 1U1HA 1Q7MA 4H6KA 4DVOA 3DFNA 2GGHA 4O4WA 3ZOAA 1H1ZA 8CGTA 5KFUA 1ZNNA 1I45A 1AQMA 2OLSA 2FZ8A 3LMYA 1TMLA 3LGEA 2QYGA 3CH9A 4FNQA 3GVVA 2ZZ4A 3AIVA 1DWIM 3T07A 3UWWA 3RX2A 3KEHA 3GHTA 4Z2KA 1UW9A 3OGVA 3A24A 3UG3A 4PCSA 1HKMA 4FX7A 4MDOA 4NIRA 3GHSA 3S1XA 2CPUA 4LNYA 2D69A 2PEVA 3U8GA 2BHYA 3W3OA 3FKKA 5GVJA 3ABSA 2EPOA 5KFLA 4IGNA 4GYPC 4FSAA 4IP4A 1Q4NX 3P81A 4H41A 5HQEA 2BV9A 3PVXA 1FWHC 1CDGA 2NQLA 2GGGA 3N2OA 5U7SA 2CC0A 1RA5A 1ZHAA 3LLFA 4A6GA 1VEOA 1VYRA 5KFOA 3GFZA 1XR2A 2G4FA 2A3BA 4LUSB 1TYGA 5T9BG 3UJFA 4A8NA 3NQEA 1NSJA 3VGBA 3M0HA 1RLCL 3TJXA 4XKYA 2Z1VA 2X7WA 3VKBA 3C52A 4YR0A 5E0CA 3QPEA 5FIPA 4Z1CA 1XGDA 2OEKA 1ONXA 1UKSA 4BQ2A 1LBLA 2Y8VA 3WNMA 2DPEA 1EIXA 3GAYA 2DQWA 2QCHA 1PKMA 1VCVA 4IR1A 4LXFA 4WDXA 1OC7A 4GQQA 4V1YA 4Z17A 5DQIA 2XCPA 1ICQA 2PGFA 2CW6A 3LTYA 1TWWA 3G1XA 1JF6A 2VUYA 4Q45A 2I5GA 4JZ5A 4I3GA 2V69A 3AYTA 1IGWA 4H8HA 1KFCA 3QQ0A 3APTA 1OG6A 4D6IA 1CX9A 1GCYA 4QGCA 2V5BA 2QDDA 3NDYA 1GQKA 3N13A 2YCLA 1S1RA 1G6CA 4AMCA 4MADA 1PJ9A 5KG0A 1OSEA 3G0SA 4A29A 3IVSA 1A3XA 1FWNA 3ONCA 2XN1A 3DAQA 3RFAA 1P6CA 4B16A 2QMKA 1Z42A 1S46A 1YE6A 4HIBA 4MUPA 6ENLA 5E9XA 3I4EA 3SR7A 1KW1A 3NR0A 1JG9A 1Z69A 4JGDA 3CO8A 4DLMA 4QQUA 3ME3A 1VPYA 2WZTA 1V93A 3QZ6A 4KEUA 4FBTA 1I2OA 3VIPA 1GVRA 4J2PA 4S2CA 1FXQA 4O1EA 3OG2A 4UOZA 4K3ZA 1GKQA 1KRMA 1BVZA 1UR0A 2X09A 4IFKB 1TKKA 4YCOA 3NEVA 2DZSA 2BTMA 2VC5A 2QPUA 4FB7A 4H04A 3RAOA 4RUBA 6PTDA 4XAPA 1R2TA 1SVDA 2QV4A 3H2MA 5GNXA 2J25A 1PX4A 3W7LA 9RUBA 1JX4A 2D2JA 4GINA 4XZNX 3BH4A 3H4BA 1V79A 1W31A 2C22A 1OINA 4FALA 1R9ZA 5CKSA 4Y8EA 2WMIA 1TMHA 3IIVA 4FOUA 3RO8A 4DELA 1R47A 3QTPA 5AN7A 1EC7A 1V6UA 5EYWA 1QAPA 1KB3A 1E3ZA 2J79A 3M0KA 1PSCA 4ECQA 5BXRA 4O0ZA 1CLVA 3L67A 4U2YA 3BLDA 3CQ0A 1WOAA 3NZGA 4Q4QA 5CBJA 5GNYA 3UG8A 4CN1A 2PD5A 1JDCA 1YLVA 3AMKA 4ERAA 3P2VA 1OFAA 3RPTA 5C6MA 4O3OA 3H7UA 1GJUA 4K36A 4S3CA 4BHYA 3GXPA 2Y62A 3GO2A 2ZZ3A 3BOXA 2XVKA 4DYKA 1BYBA 1VP5A 5EA9A 3PUGA 2RHGA 1HVXA 2ZRZA 1GOWA 3L7RA 3N73A 3P8JA 2AMXA 3L23A 4XD4A 3T2QA 3UZJA 1BFNA 4UCFA 2YL6A 1NWTA 4O3PA 2BNJA 3FYYA 4LC8A 2QDHA 2I14A 4HZ8A 4EPKA 3BE7A 3WEMA 1LLZA 3FJ4A 4GQRA 2OWWA 2WOQA 1XLBA 1OFDA 2PGEA 4AMAA 3VOIA 1GOQA 2PB1A 3SY1A 2C71A 3RG6A 4B3LA 4RUCA 3LOTA 3T44A 3AIRA 1EPVA 4PTWA 3CAKA 5C55A 4HA0A 3TQ1A 1GQJA 4I7UA 4UTFA 1UP3A 3NZ1A 3CPRA 1W8SA 4XIMA 4AD2A 3RXZA 1XC6A 4MJMA 3CB8A 4JV2A 3UZZA 5EB8A 3MU7A 3E5BA 3USZA 4Y6GA 2WCGA 3MSDA 4MJZA 1W2PA 4QWCA 4UCGA 4BQ3A 1NJJA 1QWGA 4HPJA 3F2CA 1JCMP 4OIFA 4QAWA 4NY2A 4ZMGA 5J5RA 1PVNA 3W6MA 3S1VA 1P0KA 4G5DA 3ARSA 4KBXA 4KFPA 1POKA 4L1GA 4B2DA 3GXFA 3T5JA 1EXBA 5DBTA 1HIZA 3ALGA 2EKGA 2Z1XA 3PJTA 3WD2A 4PGLA 3FYPA 2NXHA 5H8PA 2XUCA 1PZ2A 4RU9A 4DBSA 2YW3A 2RDTA 1F6YA 1T41A 4QJ4B 1F8MA 5EL1A 3L12A 4J9QA 1BGGA 1LRTA 1W6TA 3NPUA 3KVMA 4RNJA 2RGMA 5FI8A 1PTGA 3DG7A 4P7QA 3PNZA 3F5LA 5CPSA 1QNPA 3WNPA 1AH0A 2PDFA 2PWDA 2QF7A 3T81A 4PE8A 1OIMA 1C93A 4GH1A 3PBVA 2YCIX 3I6TA 3BOLA 5HANA 1XUUA 3VGHA 3ITCA 1KTBA 1I60A 1X97A 4HMNA 5DMLA 3T0AA 3V18A 5CC5A 1JUKA 2W62A 4S3DA 4UFJA 3NYDA 4B4FA 1LF1A 4UTMA 5HPCA 2Y2WA 4E8GA 4K8GA 1OF6A 4X2RA 3IAPA 4R88A 3DFYA 1VCFA 3PJUA 4XV0A 1CGXA 1RVKA 2VQTA 2E77A 4F0RA 3SUUA 2PD9A 2QUVA 4AG0A 3FAXA 3M9OB 3HOJA 3TSBA 1H0GA 2PRHA 3WF0A 4CQ9A 1VFLA 4IISA 3P82A 1ITQA 4GI8A 5HUOA 4L56A 3W1RA 1ISYA 4C6QA 1NP2A 1XGZA 1L6WA 3EKGA 1HVQA 2E5BA 4XG1A 4FP1A 2G5WA 3MSGA 1OX6A 3QY7A 4O52A 3CYVA 4R3UA 1C9WA 2CESA 5KT2A 5AKQA 1QASA 2GDQA 3TJIA 2DZWA 3GNDA 4IPNB 4BFAA 5B80A 5XIAA 3QW3A 4WJXA 3WMSA 1R0MA 1E6ZA 2ZX8A 1NDWA 3WMCA 3GZAA 2DVUA 1PE1A 2OSWA 4L1WA 2ZX7A 4J3XA 3FCPA 2DZUA 1HL8A 3UP8A 2NUYA 4GO9A 1OFEA 2ZZ1A 3PTDA 1S2CA 2ZUNA 4Q8VA 1P6WA 3QR3A 4NJIA 2WCSA 5IRPA 1F2JA 3RCNA 4M5PA 2BHUA 3UJ2A 1OBAA 4GCAA 3UXLA 3C3NA 3GR8A 6TIMA 1V0MA 2VP8A 3OVQA 5DX7A 2AL2A 1TV4A 4JV1A 1LBFA 4M1BA 1XICA 4OE7A 1UC5A 2X7VA 1P43A 1LBMA 3KOYA 4J3VA 5DQGA 3B0YA 4AD3A 2RFGA 3LD5A 1OZQA 1TPFA 2FHCA 1E0XA 4AZCB 2NX9A 2PTDA 2VDIA 4CD8A 2VENA 2NZLA 3VPLA 3T4WA 2VEMA 3V5OA 4F0LA 2WMJA 4L6DA 4J40A 2RJHA 4CD7A 5I09A 4JX4A 2WC3A 1OYAA 1DHKA 1XHGA 2V8ZA 3DFQA 3W38A 4AYSA 2DU2A 4DJDC 5IHRA 4ENLA 4ECXA 1KCKA 1Q5MA 5GNZA 3VNYA 1SUXA 3G0UA 4W85A 5I3JA 4MZ1A 3BK0A 3WQPA 5C54A 3MMTA 2HNEA 3LXCA 1R2SA 4E5TA 1DJYA 1V3LA 3IGUA 5A6BD 3PW4A 3W01A 3TZNA 3OLEA 4HCDA 3RM8A 3QM3A 1PKLA 3OBKA 2DZXA 2NSXA 1REQA 3C2FA 4XAZA 3CIVA 4J9JA 1JZ6A 3DU0A 2OTDA 4ZOEA 3CYJA 4IMAA 4ZEPA 2DQXA 1GVOA 1J9YA 2O7SA 4DO5A 2Y5EA 4K68A 1S5TA 1FWRA 4I8DA 3B05A 4Q7NA 4JCMA 2V3GA 3C56A 4L4LA 2GWGA 4KCVA 4JIRA 4UFKA 3AMDA 1UH3A 1EO7A 3BJSA 3M4HA 2Y0FA 3E2VA 7PTDA 2OZ3A 3B0VC 5KG2A 1FWFC 1DBTA 3CHEA 3TU9A 4ZVJA 1TB3A 5EDWA 3G1RA 2D2OA 4K38A 3OOQA 2GGJA 2PGRA 3LCHA 1BF6A 1Z48A 2BXZA 4NRRA 5BXTA 1IF2A 5ABHA 1ITCA 2PC8A 4E4UA 1DORA 1H7PA 4DJEA 3DERA 1DIDA 3C2RA 3DOPA 3LYEA 2Y24A 2X41A 3T8LA 2BR0A 3KOZA 3KBMA 4DBWA 1W5MA 3QF0A 2VCAA 3SQMA 5G1MA 3WFLA 2ZZ7A 1H7NA 3OP2A 1B4EA 3PNUA 5CJMA 3WDHA 1WDWA 2Z4GA 5IHSA 5L1KA 3K1GA 4ZQOA 3N18A 1QI2A 3WD1A 1XJBA 2W6RA 4NQ1A 2HROA 1I4NA 1KGXA 3FDKA 3M46A 5G2IA 5EFDA 1EC9A 3QN3A 3MANA 2J8GA 3ITXA 2ZX5A 5AHEA 3LQGA 3D47A 5FSDC 2BSLA 2DSZA 5C5YA 4XZLX 2DW6A 2CU0A 4UTTC 3HQPA 1JDFA 1G1YA 1CB7B 4PUNA 3CEUA 1YIXA 1Q3NA 1FKXA 3TZFA 2XYLA 1GOOA 1VRDA 2ZRUA 2HPIA 4O11A 4UQEA 4LYKA 3ARPA 1OVDA 3ZR6A 2Y7GA 1L9WA 4JUZA 3CGTA 3CL7A 1NY1A 5HWJA 3TK7A 3G1AA 2CBUA 1TZ9A 3BAWA 5LNRA 2QV5A 4P8XA 3U5UA 3NO5A 3WNKA 3WDPP 3JR2A 3E0FA 1L6GA 2VR2A 4LV9A 3BQ5A 4A22A 3DZ1A 1O94A 4QLLA 1EC8A 3SN1A 2PP1A 3KVLA 4GG9A 2HEJA 2RDWA 1TO3A 4HK5A 4DX3A 4Z08A 1RQHA 4N9DA 2XFYA 3ZR4A 4W4QA 4HGXA 4DL7A 4H9YA 1E0UA 2EPKX 1JYXA 4DL3A 1KM1A 5CEWA 4DO4A 1R3TA 2ZX6A 4WSKA 3LNMA 4A8IA 2NQ5A 2OSXA 1WXJA 1SU5A 1DKWA 4OBTA 4AISA 2BGNE 1CYGA 2WSRA 2HTMA 2X1SA 3AIEA 3DKLA 3MP5A 2XSXA 1E6QM 5CGTA 3DYOA 1UPPA 3HG4A 1JXLA 2VEKA 3N25A 3W85A 3PZGA 2XWEA 3L4VA 4PTXA 2W9MA 3GXNA 2D2HA 3W1MA 5FF4A 3HO8A 4WDWA 3DI0A 5JBFA 3HJEA 1DWGM 2Z1WA 4GJ1A 4Q33A 4M0XA 2CLLA 3C8FA 3V75A 2J6TA 4NX0A 4YMZA 2PDWA 2Z27A 1LWJA 2XVNA 4QWEA 4JTSA 3PW0A 3HPZA 2LLEA 5HULA 4C1NA 2UY4A 5HUPA 3W82A 1F3TA 4XZ9A 1ICPA 2OB3A 3GBEA 5A6KA 3EWUA 1V0KA 2PP3A 4JHZA 3Q8SB 3STFA 3RB6A 3PANA 4KEZA 4AD1A 3SCWA 4FLSA 3WK1A 3FK4A 4E8DA 4O16A 3PPGA 4PTMA 4MFDA 5FF3A 4E4PA 3CXOA 2XZ9A 1VYSX 5AHMA 3N6JA 1W3JA 2XGQA 1TWDA 2FH6A 2IQ0A 1W0MA 1ZZMA 1Q4WA 3W7JA 4DEZA 4YTTA 1E1CA 2J9YA 1LQ0A 2GVYA 1FWSA 4WUIA 1DJHA 3D6NA 2XJ7A 1EB3A 3ZVHB 2QF8A 2CKSA 1FWDC 5LYRA 2C2EA 4YVPA 1FH7A 5A6BA 2ZOXA 1X1NA 5A8GA