2G3HA

Cyanide binding and heme cavity conformational transitions in drosophila melanogaster hexa-coordinate hemoglobin
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
153
structure length
153
Chain Sequence
MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLEELSGNARFRAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTAASSLDESQAATWAKLVDHVYGIIFKAIDDDGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cyanide binding and heme cavity conformational transitions in Drosophila melanogaster hexacoordinate hemoglobin.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
molecule keywords globin
total genus 68
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2006-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 2g3hA00
1Y8WB 1BZ0B 1Y7GA 1B86B 1VWTA 5HY8A 1PBXB 1CG5B 2Z6SA 3UHUA 1JP8A 1YVTB 4G1VA 1GDLA 1A3NB 1NGKA 2EKUA 1S5XA 1VXHA 1GZXA 2R80A 1YGDA 3ZOMA 1Y4VB 1YEUA 1Y2ZA 1U7RA 1B0BA 1YCBA 4MQCA 1IRDB 2C0KA 3IC2B 1Y8KA 4FWYA 4OODA 1NWIA 1Y0TA 1YIHB 2OIFA 3AQ8A 1QPWB 1Y4BA 2OH9A 2D5XA 1DUOA 5EYJA 6HBIA 2AA1B 2DN2A 3UHGA 4BJAA 1XXTA 3GDJB 3R0GA 1GDIA 5AZRA 1HDSA 4QAUA 1DLYA 1WLAA 3UH3A 1MLGA 2HHEA 1OUTB 1MNOA 1BZ1B 1MLMA 2MYDA 3LQDB 5B85A 3P5QA 3MBAA 1XZVB 2ZFBA 3WCVA 4FWXA 3LB1A 4FH7A 1Y0TB 1Q1FA 1DO3A 2O5MX 1Y8KB 5SW7A 1K1KA 2ZSNA 5CMVA 2BLHA 1CQXA 1Y46A 3CIUB 4G51B 1V4WB 3QZZA 2R50A 1YEOB 3HXNA 3ONZB 3G52A 1Y0DA 3HEOA 2WTGA 3BJ2A 4HBIA 1ABYB 2VHBA 3QM8A 1B86A 1VWTB 2GRZA 3WCPA 2GTLB 4UZVA 1FLPA 1COHA 1XZ5A 2FAMA 1UX9A 5JDOE 2RI4B 1JW8A 2JHOA 1VHBA 2EKTA 1FSXA 1MOHA 2D2MC 3ZHWA 2SPOA 4HSXA 1A01B 1Y35A 1YGFA 110MA 1LFQB 2RAOA 2G0VA 1I3DA 4F4OB 2HBGA 3A0GA 3BJ3A 4AVEA 3DHTB 5HBIA 2NRLA 1Y09B 1HBSB 1OFKA 2WTHA 4F69A 1JP6A 4ROMA 1MYIA 4IT8A 1LH7A 1BUWB 4MXKA 1O1MB 5C6YA 3VREB 1CMYB 1CG8B 1NZ3A 1JY7A 2ZLXA 2ZSYA 5JDOD 4H0BA 1XZUA 3QQQA 3ZH0A 1O1PB 4L2MA 3IXFA 1X46A 1XYEB 2MGJA 1N9XA 2GKNA 1CH7A 5HLQA 4MQIA 3AT5B 103MA 2PGHA 2MGFA 3ARLA 1RQ4B 3AT6A 1UIWA 4MQJA 1CMYA 5C6EA 2G12A 3A9MA 2HHDA 1QSIA 3E5OA 3WCUC 1MLJA 2ZLWB 4N7OA 3VRGA 1BUWA 1V75B 4ROMB 1C7BB 1R1XB 2H8DB 4ESAA 4F6DA 1Y0WB 3ECLA 5JGGB 2MGLA 5CHQA 1LA6A 1DWRA 1Y09A 3WCTB 4HHBB 2BK9A 2O5OX 3A0GB 4F6IA 1LTWA 1HGAA 2G14A 1SI4A 1LH5A 1HABA 3UHEA 3UHXA 1NEJA 1M9PB 2ZFOA 3EOKA 2SPNA 1RTEA 1F65A 3WTGA 1Y8IA 1V4UA 5JDOC 1MLLA 2O5QX 3KMFC 1Y8IB 2HBCA 1MDNA 1MNJA 1F5PA 2FRFA 1YFFB 1LUEA 2ZFOB 3AQ5A 1X9FB 3WCWA 1HGAB 2MGDA 2B7HB 2G11A 1BJEA 2OLPA 2V1GA 5EUIB 3AG0A 3LB4A 3BJ1A 3WFWA 4HHBA 3ARJA 2ZS0D 3E4NA 2CMMA 3PELA 3QM5A 1G0AB 2MGHA 1V75A 5AZQA 6HBWB 1TESA 4M4AB 1HBGA 1G09A 3WCWD 2ZLWA 5MBAA 2HHBA 1BZ1A 3M39A 1ITHA 2MHBB 1GBUB 3AT6B 4NI1B 3UHDA 4DC8A 4N7PB 2PGHB 1BZZB 1KFRA 2W72A 1HDSB 5KDQA 5CN9A 4MQGA 1JF4A 1X9FD 2M6ZA 1XYEA 3KUNA 3LR9A 1ECNA 4FC3A 4NI0B 2VEEA 3UHZA 1XZUB 3DUTB 1M6CA 1AJGA 1QPWA 1QI8B 2ZT1A 1GDKA 1VXCA 1URYA 1CP5A 4MXLA 4IROB 5HU6B 4MBNA 3UHKA 4MPMA 4O35A 2R80B 1V4XA 1A6MA 1GLIB 1RSEA 1NS6A 1YVTA 2V1JA 4U8UB 3SZKA 1A00B 3UHTA 1Y7GB 1MGNA 2VLYA 1JWNA 102MA 2RAOB 1CLSB 1A01A 3FH9B 1Y5FA 2AURA 4OF9A 2Z6NA 1DXUB 1K0YB 1CBMA 2EF2A 1YDZA 3RJ6A 1Y4FB 2W6VA 3ECZA 4O2GA 3A59B 108MA 2GNWA 3QJCA 1Y4PA 2W6WA 3D7OB 2G0XA 2VRYA 3GYSB 4DWTA 2GTLA 4F6FA 3W4UB 4HRRA 1Y7ZA 3S1IA 5KERA 3HHBA 1J41A 3A2GA 1LFLB 3QQRA 2AUOA 2W6YA 1OUUA 2WY4A 2MGGA 2H8FB 3UHRA 1MLQA 2ZLTB 3HEPA 1LFLA 2ZSZA 2D2NC 4HRRB 3W4UA 1Y4RB 3UHWA 3PI8B 1HHOB 1K1KB 1O1OB 1S5YA 3GYSA 2HBFA 3O89A 2ZSTA 1UFPA 1YG5A 1RTXA 1J3FA 1Y4PB 2OHAA 5E83B 1HBAB 2V1EA 1A3OA 1GBVA 2MGMA 2VM0A 3LQDA 1YDZB 4B3WA 3WFUA 1BBBB 1Y22A 1K0YA 3UBCA 3VRFB 3PT8B 5JOMA 2ZSQA 4C0NA 2D5ZA 4X0LA 3PT7A 3G46A 1C40A 4PQBA 2DN2B 2AA1A 4U8UA 3SZKB 1MYTA 1Y85B 1IBEA 1FCSA 1N9HA 1X9FC 1DTIA 5E29B 3KUOA 1SDKB 3UHHA 3UHVA 4NK2A 4MQCB 4NXAA 1OR6A 4KMWA 1Y2ZB 1O1IA 2HBDA 3CY5A 1YGDB 1V07A 3DUTA 1LH3A 2HZ3A 1XZ2A 1IBEB 2D6CA 4MQHA 2FALA 7HBIA 1EBTA 1JL7A 2Z85A 2D5ZB 107MA 1XZ2B 1YHRA 1URVA 1J52A 2NSRA 1A0UB 4UURA 3CY5B 1YE0A 3GK9A 1O1IB 4N7NA 1SPEA 1Y4QB 2MHBA 1O1JB 1SHRA 2HHBB 1NWNA 2FRIX 2ZT2A 5E29A 1GBVB 1DLWA 1DM1A 2MYCA 1J3YA 1LH1A 1MLOA 1SPGA 1Y7CA 3WCWC 3G53A 2QSSB 1LFVA 3WI8A 1CPWA 1S5YB 2ZS0B 3D17B 1YCAA 1DXVB 3ZJQA 3UHNA 3FS4B 4XS0A 3AQ9A 3WCWB 1MKOB 1GCVA 3ZJOA 2VLXA 4H07A 3NFEA 1Y0AA 1CQ2A 3MKBB 4YU3A 1UFJA 1J41B 5KERB 1VXDA 2PEGB 2HZ2A 1OJ6A 1Y8HB 1ABWA 4G1BA 1O1OA 3V2VA 1ABWB 2VYYA 1HRMA 3LR7A 4WJGA 1V4UB 1FHJA 1HDAB 3MJPB 3GQRB 4O4TA 1T1NB 2VEBA 1J40B 2GRHA 1NEJB 1Y5FB 1THBA 1NS9B 1CH9A 3QJDA 1DXVA 2HZ1A 2QSPB 3WCTA 3SDNA 1GLIA 2GKMA 5ILMA 1V4XB 1HV4A 3GOUB 1FAWA 1UT0A 3G4WA 1SHRB 1DXUA 1O1JA 5C6EB 3QJEB 1L2KA 3UHCA 3M38A 3UH5A 3PI2A 1YEVA 1UX8A 5IKSA 1IRCA 2D2MA 4TWUA 2ZSSA 3ASEA 2O5LX 1JDOA 1OR4A 3PI9A 1YH9B 3NMLA 3ARKA 4WCHD 4MQGB 5M3SA 3S48C 3BCQB 2YRSA 1KD2A 5HU6A 1HGBA 5EETA 4ZVBA 3ZJPA 1AJHA 1MZ0A 1C7DA 1RVWA 1G09B 1X3KA 2R1HB 4M4AA 1O1LB 1YZIB 1MLRA 2BMMA 4FC3B 1Y85A 3PELB 2MBWA 1LFZA 3ECXA 105MA 5CNEA 3NL7A 1TU9A 1JF3A 1C40B 2O5BX 4X0LB 2DHBA 1MOCA 4DWUA 5KDQB 1VRFA 5EUIA 112MA 1O1NB 1G9VB 4F4OA 3PT8A 3OJ1A 3VAUA 2ZSRA 3TLDA 3D4XA 1BBBA 1Y22B 2LH2A 2BNLA 3E55A 6HBWA 1RQAB 1HJTA 1YG5B 2HBFB 3D1AB 3G4UA 2ZSPA 2Z6TA 4FH6A 1M6MA 3QMAA 3ED9A 1HBRA 2IG3A 106MA 1NPGA 1MWBA 1IDRA 1Y4RA 2ZT4A 1GDJA 1F5OA 1IT3A 2B7HA 5HAVA 1HBHA 1S0HB 1X9FA 1BABA 1U7SA 1V9QA 1HABB 2EVKA 5ILRA 5EE4C 1Y5KB 1KR7A 5E6EB 3GQPB 1V4WA 1Y46B 3CIUA 1UVYA 1Y4GB 3B75A 1YHUB 1LA6B 1JPBA 2MGIA 1LHTA 2ZSXA 4U8UD 5HLXA 4DC7A 1A0ZB 3A59A 1UC3A 1MYJA 4TWVA 1RQAA 2ZS1A 1O1KB 1LJWA 3WCUA 2QRWA 4N7OB 1S6AA 2ZFOC 3LB2A 2FRJX 1DKEB 4PNJA 1UMOA 2GLNA 1OUTA 1UIWB 2Z8AA 3UHYA 5KKKA 3GQGB 1A4FB 2HBSA 4B4YA 4MQIB 2DHBB 4ROLA 4NXCA 4MQKA 2O5SX 3HRWA 2XYKA 4F6JA 5JGGA 4HRTB 1CIOA 3A5BA 3GLNA 4GZGA 1MBNA 1HCOB 4TYXA 1CO8A 1MOAA 2QFKA 1RVWB 2ZLVA 4F6BA 1XCHA 2DN3B 1MLSA 5F2AA 1HCOA 1MWDA 3UHSA 1S69A 5EOHA 4NI0A 5EU2A 5CNDA 1DUKA 1A6NA 2XKGA 3KMFA 3HRWB 3QM6A 3PI9B 1FDHG 1O1PA 2LH1A 2HBSB 1A4FA 3GQGA 1YVQA 1YOGA 3DHTA 3BJ3B 3BA2A 3QZXA 4NI1A 1YEVB 1YHUC 2ZLXB 1BZ0A 1ECOA 1CG8A 1NPFA 2NRMA 3IA3B 1LJWB 3G4VA 2ZS1B 3HYUB 5CN7A 3ZOLA 1DWSA 1G0AA 1CH5A 2G3HA 1HV4B 1J7YB 1Y5JB 1VXFA 3S65B 2D2NA 1MBAA 3G4YA 1YHUA 3IC0B 1COHB 2NX0A 2QSPA 1Y0CA 1OFJA 3BJ1B 2W72C 3E5IA 1HBBA 2SPLA 1DXCA 1VREA 1FDHA 1J3ZA 4ILZA 3ZJLA 1MLNA 1RPSA 1YIEB 1NS9A 1R1YA 2SPMA 1MYMA 1YFFA 1DXTA 1HBHB 1S0HA 3GQRA 1QXDB 1Y0DB 3NG6A 4L7YA 2HBCB 3HXNB 1FHJB 3NMMB 3UI0A 4G51A 1XZ5B 1CH3A 3D1AA 1MTIA 1Y8HA 1CBLA 1MYZA 3WCPB 4MAXA 1ECAA 5CN6A 1MTJA 1QXEA 2FRKX 2ZFBB 5CNBA 3EOKB 3P5QB 1M9PA 1NQPB 1O16A 3BJ2B 4ODCB 2HHEB 1QSHB 2GDMA 2LH6A 2QMBB 2D2MD 4JACA 1XY0B 3UH7A 4M4BB 1LFYA 4N8TB 2MYEA 2G0SA 1NIHA 4H2LA 1XXTB 3NL7B 5B84A 5SW7B 3ZJNA 4NK1A 1LFZB 2XKHA 1BZRA 1LFVB 1R1XA 3LB3A 1C7BA 4O1TA 1YOIA 1J3YB 1SPGB 3WHMA 3VRGB 1Y45B 2R1HA 1XZVA 3WCVC 1YIHA 1C7DB 2HHDB 1IRDA 3IC2A 4MQJB 1AJ9A 1AZIA 1NIHB 1Y7DA 1HGBB 2ZLUA 2YRSB 1YEUB 1EBCA 1Y4VA 1A0UA 2BLIA 1Y01B 3AQ6A 3A5GA 3MOUA 1G08B 3MYMA 4KMVA 3HF4A 1LFTA 4FWZA 2D5XB 2D2MB 3GKTA 1QXEB 1JEBA 3OGBA 3SDHA 1GCWA 3TM9A 2G0RA 1V5HA 2ZS0C 1CH4A 1LHSA 1I3EA 1VXGA 4YU4A 1O1MA 1FAWB 3GOUA 3NMMA 3OZVA 3OZUA 5AB8A 3S1JA 2D60B 1DWTA 1JZKA 2VLZA 2QFNA 3ZJRA 3H58A 5CN4A 1YHUD 1CG5A 1EMYA 4O4ZA 1WMUA 1YE2A 3BOMA 1J3ZB 2VYWA 2BWHA 3QJBA 2DXMB 1YE2B 1WMUB 1HBBB 1IOPA 1YGFB 2ZWJA 1Y35B 1VXBA 2O58X 3TM3A 3IC0A 3OVUC 3EDAA 3UHIA 3DR9A 3D1KB 2AV3A 2MGCA 2D2NB 3GKVB 1FSXB 3EU1B 2D60A 2QLSA 1D8UA 3MJPA 3WR1B 3HYUA 1IT2A 2W31A 1BZ6A 1F63A 4YU4B 1Y83A 1S56A 1A6KA 1GCWB 3ZJJA 2ZS1D 2EB8A 1HSYA 5CNGA 2PEGA 1YVQB 4YU3B 3MKBA 1HGCA 2ZLTA 1ABYA 3MN0A 1G08A 3FS4A 1A9WA 3ONZA 3HHBB 1YEOA 1CIKA 3OO5B 1Y7DB 2ZLUB 3UGZA 2D2ND 1YENA 5ILPA 1N9FA 4LPIA 5F0BA 2QSSA 1Y45A 2R4ZA 3QJCB 3ZJMA 3WCVB 4PQ6A 4U8UC 1YEQA 4HRTA 4ZVAA 1G0BA 3R5IB 2EVPA 2GL3A 1Y4QA 4MQKB 4N7NB 4F6GA 1YE0B 1NZ5A 4M4BA 1XY0A 2DC3A 1MBSA 1YHRB 3ZJSA 1QSHA 2HCOB 2V1FA 2HBEA 1NS6B 2DN1B 3WCUB 3G4QA 3WCTC 1J7WB 1Y4BB 3DHRA 3ODQB 1MBIA 1FSLA 1LH2A 3OZWA 3GQPA 5E6EA 2G10A 1MWCA 1QI8A 4L7YB 2OH8A 1QXDA 1MLFA 1MBDA 1S5XB 1J7SB 1H97A 2MB5A 1BABB 4WJG1 2M6ZB 1R1YB 1PBXA 1BINA 5HY8B 1MYGA 3HENA 1YHEA 4N7PA 3K3UA 3ZJHA 3K8BA 1Y0CB 4KJTA 2R4WA 3VRFA 1MYHA 1HBRB 3K9ZA 4UIQA 1J7YA 1Y5JA 1Z8UB 2AUQA 2QU0A 1JZMA 2ZT3A 1C7CA 111MA 3PIAB 1FN3A 2V1HA 1HBAA 5E83A 3RGKA 1HDBA 2QU0B 1HACA 2ZS1C 2H35A 2MYBA 1HHOA 3PI3A 1MLUA 3D4XB 3PI8A 4KN3A 3RJNB 2AUPA 3K8BB 1CO9A 1G9VA 1O1NA 3OO4A 1CH2A 1MYFA 4NZIA 3S66B 5CN5A 5EE4D 3EDBA 1MBOA 1MCYA 1OUUB 1J7SA 1MLHA 1YZIA 1Y7ZB 1O1LA 1IWHB 1BVDA 2ZT0A 1DO1A 2DN3A 1RQ3B 2ZLVB 1EWAA 1KD2B 3D7OA 2V1IA 2BLJM 1XQ5A 3MJUA 1JZLA 2VYZA 2GNVA 2LHBA 109MA 1SDLB 2Z6NB 2HBEB 4ROLB 3FH9A 1CLSA 2LH7A 2E2YA 3ZJIA 3WFXA 1CH1A 1BZPA 3H57A 4XDIA 1DKEA 5EYSA 1A00A 3O7NA 1VXAA 1XZ4B 3MJUB 101MA 1Y0WA 1O1KA 4ESAB 2LH5A 1CP0A 5EV5A 1A0ZA 1XZ4A 2MGBA 1LH6A 4IROA 3B75B 2IN4A 1MNKA 1Y4GA 1XZ7A 2BKMA 2O5TX 1NZ2A 1W92A 3QJDB 3MVCA 1Y5KA 5ILEA 2G0ZA 2OHBA 1MTKA 2GTLD 1T1NA 3WFTA 1XQ5B 1YMBA 2W72B 2XKIA 1BZZA 3OO4B 3V2ZA 5CNFA 3VHBA 2KSCA 4NS2A 1GBUA 1RQ3A 2H35B 1ECDA 5EQMA 1IWHA 1HACB 4VHBA 1FN3B 1C7CB 1JL6A 3PIAA 5MBNA 1GJNA 5CN8A 5D5RA 3WR1A 1BIJA 1HBSA 3EU1A 1Y31B 3GKVA 1Y0AB 3NFEB 1GCVB 1MKOA 3S66A 1YHEB 3UH6A 1YMAA 3BOMB 3WCVD 4AVDA 1LFQA 1NXFA 2ZS0A 1MODA 5CNCA 1Y31A 1OBMA 1BIJB 1ABSA 1SWMA 1DXDA 1DO7A 1HLBA 4SDHA 3UHQA 3OK5A 1A6GA 2R4XA 3PI4A 5CHRA 3ORDA 3ODQA 3BCQA 1JEBB 1GVHA 1ASHA 3DHRB 4HSWA 5D1VA 2GTLC 5JDOF 3WTGB 1MNHA 1YH9A 1LFTB 3HF4B 2LH3A 2HCOA 1SI4B 4MQHB 1BVCA 1N9IA 3HC9A 2HBDB 1XZ7B 1NZ4A 3M3AA 2MYAA 1MBCA 3QJEA 2MGKA 1AJ9B 1S61A 3R5IA 1DO4A 1SDKA 1YEQB 2H8DA 4PQCA 3WHMB 1J7WA 4MU5A 2DN1A 1QSIB 2MGAA 4H2LB 3PT7B 2NSSA 3PI1A 3OO5A 1RQ4A 1LFYB 4N8TA 1MLKA 2V1KA 2QMBA 3AT5A 3QM9A 1THBB 1JP9A 4ODCA 1MNIA 3GDJA 1SDLA 2W6XA 3UGYA 1J40A 1NQPA 1G0BB 4C44A 104MA 1HGCB 1VXEA 1A3OB 1HDAA 1YOHA 3G4RA 1JY7B 2EB9A 4F68A 1YENB 1HLMA 3WCUD 3VREA 2ZFOD 3UBVA 1A9WE 5HLUA 1NAZA 3AQ7A 1WVPA 3NG6B 2QLSB 1YMCA 1GZXB 4MBAA 1EW6A 1DXTB 2GRFA 1A3NA 3D1KA 2H8FA 2ZSOA 1UVXA 3LHBA 1HBIA 3UHBA 4XS0B 1YIEA 1PMBA 1RPSB 2DXMA 3QJBB 4JYQA 2BW9M 1H1XA 3D17A 1Y8WA 3WCTD 1Y83B 3MYNA 2AV0A 1HDBB 3S65A 1Y7CB 1MOBA 1DTMA 2RI4A 3QM7A 1Y4FA 2W6VB 2MGEA 3U3EA 2R4YA 3M3BA 3A5AA
chains in the Genus database with same CATH superfamily
1Y8WB 1BZ0B 1Y7GA 1B86B 1VWTA 5HY8A 1PBXB 1CG5B 2Z6SA 3UHUA 1JP8A 1YVTB 4G1VA 1GDLA 1A3NB 1NGKA 2EKUA 1S5XA 1VXHA 1GZXA 2R80A 2UUNB 1YGDA 3ZOMA 1Y4VB 1YEUA 3FEWX 1Y2ZA 1U7RA 1B0BA 1QGWC 3V58B 1YCBA 4MQCA 5FVBM 1IRDB 2C0KA 3IC2B 1Y8KA 4FWYA 4OODA 1NWIA 1Y0TA 1YIHB 1UVJA 2OIFA 3AQ8A 1QPWB 1Y4BA 2OH9A 4LMSB 3KVSB 3NUHB 2D5XA 1DUOA 5EYJA 2J96A 6HBIA 2AA1B 2DN2A 1F99A 3UHGA 4BJAA 1XXTA 3GDJB 3R0GA 1GDIA 5AZRA 2VJTB 1HDSA 4QAUA 1SGKA 1DLYA 1WLAA 3UH3A 1MLGA 2HHEA 1OUTB 1MNOA 1BZ1B 1MLMA 2MYDA 3LQDB 5B85A 3P5QA 3MBAA 1XDTT 1XZVB 2ZFBA 3WCVA 4FWXA 3LB1A 4FH7A 1Y0TB 1Q1FA 1DO3A 2O5MX 1Y8KB 5SW7A 1K1KA 2ZSNA 5CMVA 3V58A 4PO5B 2BLHA 1CQXA 1Y46A 3CIUB 4G51B 1V4WB 3QZZA 2R50A 1YEOB 3HXNA 3ONZB 3G52A 1Y0DA 3V57A 3HEOA 2WTGA 3BJ2A 4HBIA 1ABYB 2VHBA 3QM8A 1B86A 1VWTB 2VJRA 2GRZA 2UUND 3WCPA 2GTLB 4UZVA 1FLPA 1COHA 1XZ5A 2FAMA 1UX9A 5JDOE 2RI4B 1JW8A 2JHOA 1VHBA 2EKTA 1FSXA 1MOHA 2D2MC 1B8DB 3ZHWA 2SPOA 1HHSA 4HSXA 1A01B 1Y35A 1YGFA 110MA 1LFQB 2RAOA 2G0VA 1JBOA 1I3DA 4F4OB 2HBGA 3A0GA 3BJ3A 4AVEA 3DHTB 5HBIA 2NRLA 1F0LA 1Y09B 1HBSB 1OFKA 2WTHA 4F69A 1JP6A 4ROMA 1MYIA 4IT8A 1LH7A 1BUWB 4MXKA 1O1MB 1B33B 5C6YA 3VREB 1CMYB 1CG8B 1NZ3A 1JY7A 2ZLXA 2ZSYA 5JDOD 4H0BA 1XZUA 2YSKA 3QQQA 3ZH0A 1O1PB 4L2MA 3IXFA 1X46A 1XYEB 2MGJA 5AQDA 1N9XA 2GKNA 1CH7A 5HLQA 4MQIA 3AT5B 103MA 2PGHA 2MGFA 3ARLA 1RQ4B 3AT6A 1UIWA 4MQJA 1CMYA 5C6EA 2G12A 3A9MA 2HHDA 1QSIA 3E5OA 1UVMA 3WCUC 1MLJA 2ZLWB 4N7OA 3VRGA 1BUWA 1V75B 4ROMB 1C7BB 1R1XB 2H8DB 4ESAA 4F6DA 1Y0WB 3ECLA 5JGGB 2MGLA 3O18B 5CHQA 1LA6A 1DWRA 1Y09A 3WCTB 4HHBB 2BK9A 2O5OX 3A0GB 4F6IA 3PMDA 1LTWA 1HGAA 2G14A 2I88A 1SI4A 1LH5A 1HABA 3UHEA 3UHXA 1NEJA 1M9PB 2ZFOA 3EOKA 2SPNA 1RTEA 1F65A 3WTGA 2JLFA 1Y8IA 1V4UA 5JDOC 1MLLA 1UVNA 2O5QX 3KMFC 1Y8IB 2HBCA 1MDNA 1MNJA 1LIAB 1F5PA 2FRFA 1YFFB 1LUEA 2ZFOB 3AQ5A 1X9FB 3WCWA 1HGAB 2MGDA 1KTPB 2B7HB 2G11A 1BJEA 2OLPA 2V1GA 5EUIB 3AG0A 3LB4A 4HH1A 3BJ1A 3WFWA 4HHBA 3ARJA 2ZS0D 3E4NA 2CMMA 3PELA 5B13G 3QM5A 1G0AB 2MGHA 1V75A 5AZQA 6HBWB 1TESA 4M4AB 1HBGA 1G09A 3WCWD 2ZLWA 5MBAA 1UVKA 2HHBA 3ZTAA 1BZ1A 3M39A 1ITHA 2MHBB 1GBUB 3AT6B 4NI1B 3UHDA 4ETVA 4DC8A 4N7PB 2PGHB 1BZZB 1KFRA 2W72A 1HDSB 5KDQA 5CN9A 4MQGA 1JF4A 1X9FD 2M6ZA 1XYEA 3KUNA 2C7KB 3LR9A 1ECNA 4FC3A 4NI0B 2VEEA 3UHZA 1XZUB 3DUTB 1M6CA 1AJGA 1QPWA 1QI8B 2ZT1A 4ERVA 1GDKA 1VXCA 1URYA 1CP5A 4MXLA 1GH0A 4IROB 5HU6B 4MBNA 3UHKA 4MPMA 4O35A 2R80B 1V4XA 4N6SA 1A6MA 1GLIB 1RSEA 1NS6A 1YVTA 2V1JA 4U8UB 3SZKA 1A00B 3UHTA 2VJHB 1Y7GB 1MGNA 2VLYA 1JWNA 102MA 2RAOB 1CLSB 1A01A 3FH9B 1Y5FA 2AURA 4OF9A 2Z6NA 1DXUB 1K0YB 1CBMA 2EF2A 1YDZA 3RJ6A 1Y4FB 2W6VA 3ECZA 1PHNA 4O2GA 3A59B 108MA 2GNWA 3QJCA 1Y4PA 2W6WA 3D7OB 2G0XA 2VRYA 3GYSB 4DWTA 2GTLA 2UUMB 4F6FA 3W4UB 4HRRA 1Y7ZA 3S1IA 5KERA 3HHBA 1J41A 3A2GA 1LFLB 3QQRA 2AUOA 2W6YA 1OUUA 2WY4A 2MGGA 2H8FB 3UHRA 1MLQA 3V57B 2ZLTB 3HEPA 1LFLA 2ZSZA 2D2NC 4HRRB 3W4UA 1Y4RB 3UHWA 4ESUA 3PI8B 2UUMA 1HHOB 1K1KB 1O1OB 1S5YA 3GYSA 4BJUA 2HBFA 3O89A 2ZSTA 1UFPA 1YG5A 1RTXA 1J3FA 1Y4PB 2OHAA 5E83B 1HBAB 2V1EA 1UVLA 1A3OA 1GBVA 2MGMA 2VM0A 3L0FA 2C7LA 3LQDA 1YDZB 2JL9A 4B3WA 3WFUA 1BBBB 1Y22A 1K0YA 3UBCA 3VRFB 3LQ9A 2C7JA 3PT8B 4F0UB 5JOMA 2ZSQA 2DKAA 4C0NA 4LMXB 2D5ZA 4X0LA 3PT7A 3G46A 1C40A 4PQBA 1F99B 2DN2B 2AA1A 4U8UA 3SZKB 1MYTA 1Y85B 4N6SB 1IBEA 1FCSA 1N9HA 1X9FC 1DTIA 1I7YB 1ALLA 5E29B 3RQRA 3KUOA 1SDKB 3UHHA 3UHVA 4NK2A 4MQCB 2VMLA 4NXAA 4XXIA 1GH0B 1OR6A 4KMWA 1Y2ZB 1O1IA 1NY9A 2HBDA 3CY5A 1YGDB 1V07A 3DUTA 1LH3A 2HZ3A 1XZ2A 1IBEB 2D6CA 4MQHA 2FALA 3O2CB 7HBIA 1EBTA 1JL7A 2Z85A 2D5ZB 107MA 1XZ2B 1EYXA 1YHRA 1URVA 1J52A 1RH1A 2NSRA 1A0UB 4UURA 3CY5B 1YE0A 3GK9A 1O1IB 4N7NA 1SPEA 1Y4QB 2MHBA 1O1JB 2VMLB 1SHRA 2HHBB 1NWNA 2FRIX 2ZT2A 5E29A 1ALLB 3L0FB 1GBVB 1DLWA 1DM1A 2MYCA 1J3YA 1LH1A 1MLOA 1SPGA 1Y7CA 3WCWC 3G53A 2QSSB 1LFVA 3WI8A 1CPWA 1S5YB 2ZS0B 3D17B 1YCAA 1DXVB 3ZJQA 3UHNA 3FS4B 4XS0A 3AQ9A 3WCWB 1MKOB 1GCVA 3ZJOA 2VLXA 4H07A 3NFEA 1Y0AA 2DKCA 4A8OA 1CQ2A 3MKBB 4YU3A 1UFJA 1J41B 5KERB 1HI0P 4ZIZA 1VXDA 2PEGB 2HZ2A 1OJ6A 4Z8KA 1Y8HB 1ABWA 4G1BA 4AE1A 1ON7A 1O1OA 3V2VA 2V8AB 1MDTA 1ABWB 2VYYA 1HRMA 3LR7A 4WJGA 1V4UB 1FHJA 4Q70B 1HDAB 3MJPB 1PHNB 3GQRB 4O4TA 1T1NB 2VEBA 1J40B 2GRHA 1NEJB 1Y5FB 1THBA 1NS9B 1CH9A 3QJDA 1DXVA 2HZ1A 3VNCA 2QSPB 3WCTA 3SDNA 1HHTP 1COLA 1GLIA 2GKMA 5ILMA 1V4XB 1HV4A 3GOUB 1FAWA 1UT0A 3G4WA 1SHRB 1DXUA 1O1JA 5C6EB 3QJEB 4LM6B 1L2KA 3UHCA 3M38A 3UH5A 3PI2A 1YEVA 1UX8A 5IKSA 1IRCA 2D2MA 4TWUA 2ZSSA 2C7KA 3ASEA 2O5LX 1JDOA 1OR4A 3PI9A 1YH9B 3NMLA 3ARKA 4WCHD 4MQGB 5M3SA 3S48C 3BCQB 2YRSA 1KD2A 5HU6A 3MWNA 1HGBA 5EETA 4ZVBA 3ZJPA 1AJHA 1MZ0A 1C7DA 1RVWA 4L1EA 1G09B 1X3KA 2R1HB 4M4AA 1O1LB 1YZIB 1MLRA 2BMMA 4FC3B 1Y85A 3PELB 2MBWA 1LFZA 3ECXA 105MA 5CNEA 3NL7A 1TU9A 1JF3A 1C40B 2O5BX 4X0LB 2DHBA 1MOCA 4DWUA 5KDQB 1VRFA 5EUIA 112MA 1O1NB 1G9VB 4F4OA 3PT8A 3OJ1A 3VAUA 2ZSRA 3TLDA 3D4XA 1BBBA 1Y22B 2LH2A 2BNLA 3E55A 6HBWA 2UULH 1RQAB 1HJTA 1YG5B 1TOXA 2HBFB 3D1AB 3G4UA 2ZSPA 1HI8A 2Z6TA 4FH6A 1M6MA 3QMAA 3ED9A 1HBRA 2IG3A 106MA 1NPGA 1MWBA 1IDRA 1Y4RA 2ZT4A 1GDJA 1F5OA 1IT3A 1KTPA 2B7HA 5HAVA 1HBHA 1S0HB 1X9FA 1BABA 1U7SA 1V9QA 1HABB 2EVKA 5ILRA 3PMCA 1KN1B 5EE4C 1Y5KB 2X4AA 1KR7A 5E6EB 3GQPB 3GIOA 1V4WA 1Y46B 3CIUA 1UVYA 1Y4GB 3B75A 1YHUB 1LA6B 1JPBA 2MGIA 1LHTA 2ZSXA 4U8UD 5HLXA 4DC7A 1A0ZB 3A59A 1UC3A 1MYJA 4TWVA 1RQAA 2ZS1A 1O1KB 1LJWA 3WCUA 2QRWA 4N7OB 4H0MA 1S6AA 2ZFOC 3LB2A 2FRJX 1DKEB 4PNJA 1UMOA 2GLNA 1OUTA 1UIWB 2Z8AA 3UHYA 5KKKA 2VJHA 3GQGB 1A4FB 4A8WA 2HBSA 4B4YA 4MQIB 2DHBB 4ROLA 4F0TB 4NXCA 4MQKA 2O5SX 3HRWA 3O18A 2XYKA 4F6JA 5JGGA 4HRTB 1CIOA 3A5BA 3GLNA 4GZGA 1MBNA 1HCOB 4TYXA 1CO8A 1MOAA 2QFKA 1RVWB 2ZLVA 4F6BA 1XCHA 2DN3B 1MLSA 5F2AA 1HCOA 1MWDA 3UHSA 1S69A 5EOHA 4NI0A 5EU2A 5CNDA 1DUKA 1A6NA 2XKGA 3KMFA 3HRWB 3QM6A 3PI9B 1FDHG 4F0TA 1O1PA 2LH1A 2HBSB 1A4FA 3GQGA 1YVQA 1YOGA 3DHTA 3BJ3B 3BA2A 3QZXA 4NI1A 1YEVB 1YHUC 2ZLXB 1BZ0A 1ECOA 1CG8A 1NPFA 2NRMA 3IA3B 1LJWB 3G4VA 2ZS1B 3HYUB 5CN7A 3ZOLA 1DWSA 1G0AA 1CH5A 2G3HA 1HV4B 1J7YB 1Y5JB 1VXFA 3S65B 2D2NA 1MBAA 3G4YA 1YHUA 3IC0B 1COHB 2NX0A 2QSPA 1Y0CA 1OFJA 3BJ1B 2W72C 3E5IA 1HBBA 2SPLA 1DXCA 1VREA 1FDHA 1J3ZA 4ILZA 3ZJLA 2VJRB 1MLNA 1RPSA 1YIEB 1NS9A 1R1YA 2SPMA 1B8DA 1MYMA 2BV8A 1YFFA 1DXTA 1HBHB 1S0HA 3GQRA 1QXDB 1Y0DB 3NG6A 1UVIA 4L7YA 2HBCB 3HXNB 1FHJB 4Q70A 3NMMB 3UI0A 4G51A 1XG0C 1XZ5B 1CH3A 3D1AA 1MTIA 1Y8HA 1CBLA 1MYZA 3WCPB 4MAXA 1ECAA 5CN6A 1MTJA 1QXEA 2FRKX 2ZFBB 4TMAB 5CNBA 3EOKB 3P5QB 1M9PA 1NQPB 1O16A 3BJ2B 4ODCB 2HHEB 1QSHB 2GDMA 2LH6A 2QMBB 2D2MD 4JACA 1XY0B 3UH7A 4M4BB 1LFYA 4N8TB 2MYEA 2G0SA 1NIHA 4H2LA 1XXTB 3NL7B 5B84A 5SW7B 3ZJNA 4NK1A 1LFZB 2XKHA 1BZRA 1LFVB 1R1XA 3LB3A 4A8SA 1C7BA 4O1TA 1YOIA 1J3YB 1SPGB 3WHMA 3VRGB 1Y45B 2R1HA 1XZVA 3WCVC 1YIHA 1C7DB 4L1EB 2HHDB 1IRDA 3IC2A 4MQJB 1AJ9A 1AZIA 1NIHB 1Y7DA 1HGBB 2ZLUA 2YRSB 1YEUB 1EBCA 1Y4VA 1A0UA 2BLIA 1Y01B 3AQ6A 3A5GA 3MOUA 1G08B 3MYMA 4KMVA 3O2CA 3HF4A 1LFTA 3GUQA 4FWZA 4A8YA 2D5XB 2D2MB 3GKTA 1QXEB 4GY3A 1JEBA 3OGBA 3SDHA 1GCWA 4GXEB 3TM9A 2G0RA 1V5HA 2ZS0C 1CH4A 1LHSA 1I3EA 1VXGA 4YU4A 1O1MA 1FAWB 3GOUA 3NMMA 3OZVA 3OZUA 2UUNA 5AB8A 3S1JA 2D60B 1DWTA 2UULD 1JZKA 2VLZA 2QFNA 3ZJRA 3H58A 5CN4A 1YHUD 1CG5A 1EMYA 3DBJA 4O4ZA 1WMUA 1YE2A 3BOMA 1J3ZB 1JBOB 2VYWA 2BWHA 3QJBA 2DXMB 1YE2B 1WMUB 1HBBB 1IOPA 1YGFB 2ZWJA 1Y35B 1VXBA 2O58X 3TM3A 3IC0A 3OVUC 3EDAA 3UHIA 3DR9A 3D1KB 2AV3A 2MGCA 2D2NB 3GKVB 1FSXB 3EU1B 2D60A 2QLSA 1D8UA 3MJPA 3WR1B 3HYUA 1IT2A 2W31A 1BZ6A 1F63A 4YU4B 1Y83A 1S56A 1A6KA 1GCWB 4GXEA 3ZJJA 2ZS1D 2EB8A 1HSYA 5CNGA 2PEGA 4GY3B 4ZIZB 1YVQB 4YU3B 3MKBA 1HGCA 2ZLTA 1ABYA 3MN0A 1G08A 3FS4A 1A9WA 3ONZA 3HHBB 1CPCB 1YEOA 1CIKA 3OO5B 1Y7DB 2ZLUB 3UGZA 2D2ND 1YENA 5ILPA 1N9FA 4LPIA 5F0BA 2QSSA 1Y45A 2R4ZA 1WACA 1DDTA 3QJCB 3ZJMA 3WCVB 4PQ6A 4U8UC 1YEQA 4HRTA 4ZVAA 1G0BA 3R5IB 2EVPA 2GL3A 2UULA 1Y4QA 4MQKB 2DKDA 4N7NB 4F6GA 1YE0B 1NZ5A 4M4BA 1XY0A 2DC3A 1MBSA 1YHRB 3ZJSA 1QSHA 2HCOB 2V1FA 2HBEA 4H0MB 1NS6B 2DN1B 3WCUB 3G4QA 3WCTC 1J7WB 1Y4BB 3DHRA 3ODQB 1MBIA 1FSLA 1A87A 1LH2A 3OZWA 3GQPA 5E6EA 2G10A 1I7YA 1MWCA 1QI8A 4L7YB 2OH8A 1QXDA 1MLFA 1MBDA 1S5XB 2BV8B 1J7SB 1H97A 2MB5A 1BABB 4WJG1 2M6ZB 1R1YB 1PBXA 1BINA 5HY8B 1MYGA 3HENA 1YHEA 3BRPA 4N7PA 3K3UA 3ZJHA 2WCQA 3K8BA 1Y0CB 4KJTA 2UULC 2R4WA 3VRFA 1MYHA 1HBRB 3K9ZA 2C7LB 4UIQA 1J7YA 1Y5JA 1Z8UB 2AUQA 5B13A 2QU0A 1JZMA 2ZT3A 4YJJA 1C7CA 111MA 3PIAB 1FN3A 2V1HA 1HBAA 5E83A 3RGKA 1HDBA 2QU0B 1HACA 5FVBA 2ZS1C 2H35A 2MYBA 1HHOA 3PI3A 1MLUA 3D4XB 3PI8A 4KN3A 3RJNB 2AUPA 3K8BB 1CO9A 1G9VA 1O1NA 3OO4A 1CH2A 1MYFA 4NZIA 3S66B 5CN5A 5EE4D 3EDBA 1MBOA 1MCYA 1OUUB 1J7SA 1LIAA 1MLHA 1YZIA 1Y7ZB 1O1LA 1IWHB 1BVDA 2ZT0A 1DO1A 2DN3A 1HA7A 1RQ3B 4A8KA 4ERTA 2ZLVB 1EWAA 1KD2B 3D7OA 2V1IA 2BLJM 1XQ5A 3MJUA 1JZLA 2VYZA 2GNVA 2LHBA 109MA 1SDLB 2Z6NB 2HBEB 4ROLB 3FH9A 1CLSA 2LH7A 2E2YA 3ZJIA 4ETUA 3WFXA 1CH1A 1BZPA 3H57A 4XDIA 1DKEA 5EYSA 1A00A 3O7NA 2UULB 1VXAA 1XZ4B 3MJUB 101MA 1Y0WA 1O1KA 4ESAB 2LH5A 4AE0A 1CP0A 5EV5A 1A0ZA 1XZ4A 2MGBA 1LH6A 4IROA 3B75B 2IN4A 1MNKA 1Y4GA 1XZ7A 2BKMA 2O5TX 2X49A 1NZ2A 1W92A 3QJDB 3MVCA 1Y5KA 5ILEA 2G0ZA 2OHBA 1KN1A 4B02A 1MTKA 2GTLD 1T1NA 3WFTA 1XQ5B 1YMBA 2W72B 2XKIA 1BZZA 3OO4B 3V2ZA 5CNFA 3VHBA 2KSCA 4NS2A 2V8AA 1GBUA 1RQ3A 2H35B 1HA7B 1ECDA 5EQMA 1B33A 1IWHA 1HACB 4VHBA 1FN3B 2JLGA 1C7CB 1JL6A 3PIAA 5MBNA 1GJNA 5CN8A 5D5RA 3WR1A 1BIJA 1HBSA 3EU1A 1Y31B 3GKVA 1Y0AB 4XXKA 3NFEB 1GCVB 1MKOA 4RMPA 2UUMX 3S66A 1YHEB 3BRPB 1CIIA 3UH6A 1YMAA 3BOMB 3WCVD 4AVDA 1LFQA 3DBJB 4RMPB 1NXFA 2ZS0A 1MODA 5CNCA 1Y31A 1OBMA 1BIJB 1ABSA 1SWMA 4YJJB 2WCRA 1DXDA 1DO7A 1HLBA 4SDHA 3UHQA 3OK5A 1A6GA 2R4XA 3PI4A 5CHRA 3ORDA 3ODQA 3BCQA 1JEBB 1GVHA 1ASHA 3DHRB 4HSWA 5D1VA 2GTLC 5JDOF 3WTGB 1EYXB 1MNHA 1YH9A 1LFTB 3HF4B 2LH3A 2HCOA 1SI4B 4MQHB 1BVCA 1N9IA 1XF6C 3HC9A 2HBDB 1XZ7B 1NZ4A 3M3AA 2MYAA 1MBCA 4A8FA 3QJEA 2MGKA 1AJ9B 4PO5A 1S61A 3R5IA 1DO4A 1SDKA 1YEQB 2H8DA 4PQCA 4BS9A 3WHMB 1J7WA 4MU5A 2DN1A 1QSIB 2MGAA 4H2LB 3PT7B 2NSSA 3PI1A 3OO5A 1RQ4A 1LFYB 4N8TA 1MLKA 4A8MP 2V1KA 2QMBA 3QM9A 3AT5A 2VJTA 2C7JB 1THBB 4F0UA 1JP9A 4ODCA 1MNIA 3GDJA 1SDLA 2W6XA 3UGYA 1J40A 1NQPA 1G0BB 4C44A 1HI1A 104MA 1HGCB 1VXEA 1A3OB 3KVSA 1HDAA 1YOHA 3G4RA 1JY7B 2EB9A 4F68A 1YENB 1HLMA 1ON7B 3WCUD 3VREA 2ZFOD 3UBVA 1A9WE 5HLUA 4Z8KB 4HH0A 1NAZA 1CPCA 3AQ7A 1WVPA 3NG6B 2QLSB 1YMCA 1GZXB 4MBAA 4A8QA 1EW6A 1DXTB 2GRFA 1A3NA 3D1KA 2H8FA 2ZSOA 1UVXA 3LHBA 1HBIA 3UHBA 4XS0B 1YIEA 1PMBA 1RPSB 2DXMA 3QJBB 4JYQA 2BW9M 1H1XA 3D17A 5AQDM 1Y8WA 3WCTD 1Y83B 3MYNA 4ETTA 2AV0A 1HDBB 3S65A 1Y7CB 1MOBA 1DTMA 2RI4A 3QM7A 1Y4FA 2W6VB 2MGEA 3U3EA 2R4YA 3M3BA 3A5AA
chains in the Genus database with same CATH topology
1Y8WB 1BZ0B 1Y7GA 1B86B 1VWTA 5HY8A 1PBXB 1CG5B 2Z6SA 3UHUA 1JP8A 1YVTB 4G1VA 1GDLA 1A3NB 1NGKA 2EKUA 1S5XA 1VXHA 1GZXA 2R80A 1YGDA 3ZOMA 1Y4VB 1YEUA 1Y2ZA 1U7RA 1B0BA 1YCBA 4MQCA 1IRDB 2C0KA 3IC2B 1Y8KA 4FWYA 4OODA 1NWIA 1Y0TA 1YIHB 2OIFA 3AQ8A 1QPWB 1Y4BA 2OH9A 2D5XA 1DUOA 5EYJA 6HBIA 2AA1B 2DN2A 3UHGA 4BJAA 1XXTA 3GDJB 3R0GA 1GDIA 5AZRA 1HDSA 4QAUA 1DLYA 1WLAA 3UH3A 1MLGA 2HHEA 1OUTB 1MNOA 1BZ1B 1MLMA 2MYDA 3LQDB 5B85A 3P5QA 3MBAA 1XZVB 2ZFBA 3WCVA 4FWXA 3LB1A 4FH7A 1Y0TB 1Q1FA 1DO3A 2O5MX 1Y8KB 5SW7A 1K1KA 2ZSNA 5CMVA 2BLHA 1CQXA 1Y46A 3CIUB 4G51B 1V4WB 3QZZA 2R50A 1YEOB 3HXNA 3ONZB 3G52A 1Y0DA 3HEOA 2WTGA 3BJ2A 4HBIA 1ABYB 2VHBA 3QM8A 1B86A 1VWTB 2GRZA 3WCPA 2GTLB 4UZVA 1FLPA 1COHA 1XZ5A 2FAMA 1UX9A 5JDOE 2RI4B 1JW8A 2JHOA 1VHBA 2EKTA 1FSXA 1MOHA 2D2MC 3ZHWA 2SPOA 4HSXA 1A01B 1Y35A 1YGFA 110MA 1LFQB 2RAOA 2G0VA 1I3DA 4F4OB 2HBGA 3A0GA 3BJ3A 4AVEA 3DHTB 5HBIA 2NRLA 1Y09B 1HBSB 1OFKA 2WTHA 4F69A 1JP6A 4ROMA 1MYIA 4IT8A 1LH7A 1BUWB 4MXKA 1O1MB 5C6YA 3VREB 1CMYB 1CG8B 1NZ3A 1JY7A 2ZLXA 2ZSYA 5JDOD 4H0BA 1XZUA 3QQQA 3ZH0A 1O1PB 4L2MA 3IXFA 1X46A 1XYEB 2MGJA 1N9XA 2GKNA 1CH7A 5HLQA 4MQIA 3AT5B 103MA 2PGHA 2MGFA 3ARLA 1RQ4B 3AT6A 1UIWA 4MQJA 1CMYA 5C6EA 2G12A 3A9MA 2HHDA 1QSIA 3E5OA 3WCUC 1MLJA 2ZLWB 4N7OA 3VRGA 1BUWA 1V75B 4ROMB 1C7BB 1R1XB 2H8DB 4ESAA 4F6DA 1Y0WB 3ECLA 5JGGB 2MGLA 5CHQA 1LA6A 1DWRA 1Y09A 3WCTB 4HHBB 2BK9A 2O5OX 3A0GB 4F6IA 1LTWA 1HGAA 2G14A 1SI4A 1LH5A 1HABA 3UHEA 3UHXA 1NEJA 1M9PB 2ZFOA 3EOKA 2SPNA 1RTEA 1F65A 3WTGA 1Y8IA 1V4UA 5JDOC 1MLLA 2O5QX 3KMFC 1Y8IB 2HBCA 1MDNA 1MNJA 1F5PA 2FRFA 1YFFB 1LUEA 2ZFOB 3AQ5A 1X9FB 3WCWA 1HGAB 2MGDA 2B7HB 2G11A 1BJEA 2OLPA 2V1GA 5EUIB 3AG0A 3LB4A 3BJ1A 3WFWA 4HHBA 3ARJA 2ZS0D 3E4NA 2CMMA 3PELA 3QM5A 1G0AB 2MGHA 1V75A 5AZQA 6HBWB 1TESA 4M4AB 1HBGA 1G09A 3WCWD 2ZLWA 5MBAA 2HHBA 1BZ1A 3M39A 1ITHA 2MHBB 1GBUB 3AT6B 4NI1B 3UHDA 4DC8A 4N7PB 2PGHB 1BZZB 1KFRA 2W72A 1HDSB 5KDQA 5CN9A 4MQGA 1JF4A 1X9FD 2M6ZA 1XYEA 3KUNA 3LR9A 1ECNA 4FC3A 4NI0B 2VEEA 3UHZA 1XZUB 3DUTB 1M6CA 1AJGA 1QPWA 1QI8B 2ZT1A 1GDKA 1VXCA 1URYA 1CP5A 4MXLA 4IROB 5HU6B 4MBNA 3UHKA 4MPMA 4O35A 2R80B 1V4XA 1A6MA 1GLIB 1RSEA 1NS6A 1YVTA 2V1JA 4U8UB 3SZKA 1A00B 3UHTA 1Y7GB 1MGNA 2VLYA 1JWNA 102MA 2RAOB 1CLSB 1A01A 3FH9B 1Y5FA 2AURA 4OF9A 2Z6NA 1DXUB 1K0YB 1CBMA 2EF2A 1YDZA 3RJ6A 1Y4FB 2W6VA 3ECZA 4O2GA 3A59B 108MA 2GNWA 3QJCA 1Y4PA 2W6WA 3D7OB 2G0XA 2VRYA 3GYSB 4DWTA 2GTLA 4F6FA 3W4UB 4HRRA 1Y7ZA 3S1IA 5KERA 3HHBA 1J41A 3A2GA 1LFLB 3QQRA 2AUOA 2W6YA 1OUUA 2WY4A 2MGGA 2H8FB 3UHRA 1MLQA 2ZLTB 3HEPA 1LFLA 2ZSZA 2D2NC 4HRRB 3W4UA 1Y4RB 3UHWA 3PI8B 1HHOB 1K1KB 1O1OB 1S5YA 3GYSA 2HBFA 3O89A 2ZSTA 1UFPA 1YG5A 1RTXA 1J3FA 1Y4PB 2OHAA 5E83B 1HBAB 2V1EA 1A3OA 1GBVA 2MGMA 2VM0A 3LQDA 1YDZB 4B3WA 3WFUA 1BBBB 1Y22A 1K0YA 3UBCA 3VRFB 3PT8B 5JOMA 2ZSQA 4C0NA 2D5ZA 4X0LA 3PT7A 3G46A 1C40A 4PQBA 2DN2B 2AA1A 4U8UA 3SZKB 1MYTA 1Y85B 1IBEA 1FCSA 1N9HA 1X9FC 1DTIA 5E29B 3KUOA 1SDKB 3UHHA 3UHVA 4NK2A 4MQCB 4NXAA 1OR6A 4KMWA 1Y2ZB 1O1IA 2HBDA 3CY5A 1YGDB 1V07A 3DUTA 1LH3A 2HZ3A 1XZ2A 1IBEB 2D6CA 4MQHA 2FALA 7HBIA 1EBTA 1JL7A 2Z85A 2D5ZB 107MA 1XZ2B 1YHRA 1URVA 1J52A 2NSRA 1A0UB 4UURA 3CY5B 1YE0A 3GK9A 1O1IB 4N7NA 1SPEA 1Y4QB 2MHBA 1O1JB 1SHRA 2HHBB 1NWNA 2FRIX 2ZT2A 5E29A 1GBVB 1DLWA 1DM1A 2MYCA 1J3YA 1LH1A 1MLOA 1SPGA 1Y7CA 3WCWC 3G53A 2QSSB 1LFVA 3WI8A 1CPWA 1S5YB 2ZS0B 3D17B 1YCAA 1DXVB 3ZJQA 3UHNA 3FS4B 4XS0A 3AQ9A 3WCWB 1MKOB 1GCVA 3ZJOA 2VLXA 4H07A 3NFEA 1Y0AA 1CQ2A 3MKBB 4YU3A 1UFJA 1J41B 5KERB 1VXDA 2PEGB 2HZ2A 1OJ6A 1Y8HB 1ABWA 4G1BA 1O1OA 3V2VA 1ABWB 2VYYA 1HRMA 3LR7A 4WJGA 1V4UB 1FHJA 1HDAB 3MJPB 3GQRB 4O4TA 1T1NB 2VEBA 1J40B 2GRHA 1NEJB 1Y5FB 1THBA 1NS9B 1CH9A 3QJDA 1DXVA 2HZ1A 2QSPB 3WCTA 3SDNA 1GLIA 2GKMA 5ILMA 1V4XB 1HV4A 3GOUB 1FAWA 1UT0A 3G4WA 1SHRB 1DXUA 1O1JA 5C6EB 3QJEB 1L2KA 3UHCA 3M38A 3UH5A 3PI2A 1YEVA 1UX8A 5IKSA 1IRCA 2D2MA 4TWUA 2ZSSA 3ASEA 2O5LX 1JDOA 1OR4A 3PI9A 1YH9B 3NMLA 3ARKA 4WCHD 4MQGB 5M3SA 3S48C 3BCQB 2YRSA 1KD2A 5HU6A 1HGBA 5EETA 4ZVBA 3ZJPA 1AJHA 1MZ0A 1C7DA 1RVWA 1G09B 1X3KA 2R1HB 4M4AA 1O1LB 1YZIB 1MLRA 2BMMA 4FC3B 1Y85A 3PELB 2MBWA 1LFZA 3ECXA 105MA 5CNEA 3NL7A 1TU9A 1JF3A 1C40B 2O5BX 4X0LB 2DHBA 1MOCA 4DWUA 5KDQB 1VRFA 5EUIA 112MA 1O1NB 1G9VB 4F4OA 3PT8A 3OJ1A 3VAUA 2ZSRA 3TLDA 3D4XA 1BBBA 1Y22B 2LH2A 2BNLA 3E55A 6HBWA 1RQAB 1HJTA 1YG5B 2HBFB 3D1AB 3G4UA 2ZSPA 2Z6TA 4FH6A 1M6MA 3QMAA 3ED9A 1HBRA 2IG3A 106MA 1NPGA 1MWBA 1IDRA 1Y4RA 2ZT4A 1GDJA 1F5OA 1IT3A 2B7HA 5HAVA 1HBHA 1S0HB 1X9FA 1BABA 1U7SA 1V9QA 1HABB 2EVKA 5ILRA 5EE4C 1Y5KB 1KR7A 5E6EB 3GQPB 1V4WA 1Y46B 3CIUA 1UVYA 1Y4GB 3B75A 1YHUB 1LA6B 1JPBA 2MGIA 1LHTA 2ZSXA 4U8UD 5HLXA 4DC7A 1A0ZB 3A59A 1UC3A 1MYJA 4TWVA 1RQAA 2ZS1A 1O1KB 1LJWA 3WCUA 2QRWA 4N7OB 1S6AA 2ZFOC 3LB2A 2FRJX 1DKEB 4PNJA 1UMOA 2GLNA 1OUTA 1UIWB 2Z8AA 3UHYA 5KKKA 3GQGB 1A4FB 2HBSA 4B4YA 4MQIB 2DHBB 4ROLA 4NXCA 4MQKA 2O5SX 3HRWA 2XYKA 4F6JA 5JGGA 4HRTB 1CIOA 3A5BA 3GLNA 4GZGA 1MBNA 1HCOB 4TYXA 1CO8A 1MOAA 2QFKA 1RVWB 2ZLVA 4F6BA 1XCHA 2DN3B 1MLSA 5F2AA 1HCOA 1MWDA 3UHSA 1S69A 5EOHA 4NI0A 5EU2A 5CNDA 1DUKA 1A6NA 2XKGA 3KMFA 3HRWB 3QM6A 3PI9B 1FDHG 1O1PA 2LH1A 2HBSB 1A4FA 3GQGA 1YVQA 1YOGA 3DHTA 3BJ3B 3BA2A 3QZXA 4NI1A 1YEVB 1YHUC 2ZLXB 1BZ0A 1ECOA 1CG8A 1NPFA 2NRMA 3IA3B 1LJWB 3G4VA 2ZS1B 3HYUB 5CN7A 3ZOLA 1DWSA 1G0AA 1CH5A 2G3HA 1HV4B 1J7YB 1Y5JB 1VXFA 3S65B 2D2NA 1MBAA 3G4YA 1YHUA 3IC0B 1COHB 2NX0A 2QSPA 1Y0CA 1OFJA 3BJ1B 2W72C 3E5IA 1HBBA 2SPLA 1DXCA 1VREA 1FDHA 1J3ZA 4ILZA 3ZJLA 1MLNA 1RPSA 1YIEB 1NS9A 1R1YA 2SPMA 1MYMA 1YFFA 1DXTA 1HBHB 1S0HA 3GQRA 1QXDB 1Y0DB 3NG6A 4L7YA 2HBCB 3HXNB 1FHJB 3NMMB 3UI0A 4G51A 1XZ5B 1CH3A 3D1AA 1MTIA 1Y8HA 1CBLA 1MYZA 3WCPB 4MAXA 1ECAA 5CN6A 1MTJA 1QXEA 2FRKX 2ZFBB 5CNBA 3EOKB 3P5QB 1M9PA 1NQPB 1O16A 3BJ2B 4ODCB 2HHEB 1QSHB 2GDMA 2LH6A 2QMBB 2D2MD 4JACA 1XY0B 3UH7A 4M4BB 1LFYA 4N8TB 2MYEA 2G0SA 1NIHA 4H2LA 1XXTB 3NL7B 5B84A 5SW7B 3ZJNA 4NK1A 1LFZB 2XKHA 1BZRA 1LFVB 1R1XA 3LB3A 1C7BA 4O1TA 1YOIA 1J3YB 1SPGB 3WHMA 3VRGB 1Y45B 2R1HA 1XZVA 3WCVC 1YIHA 1C7DB 2HHDB 1IRDA 3IC2A 4MQJB 1AJ9A 1AZIA 1NIHB 1Y7DA 1HGBB 2ZLUA 2YRSB 1YEUB 1EBCA 1Y4VA 1A0UA 2BLIA 1Y01B 3AQ6A 3A5GA 3MOUA 1G08B 3MYMA 4KMVA 3HF4A 1LFTA 4FWZA 2D5XB 2D2MB 3GKTA 1QXEB 1JEBA 3OGBA 3SDHA 1GCWA 3TM9A 2G0RA 1V5HA 2ZS0C 1CH4A 1LHSA 1I3EA 1VXGA 4YU4A 1O1MA 1FAWB 3GOUA 3NMMA 3OZVA 3OZUA 5AB8A 3S1JA 2D60B 1DWTA 1JZKA 2VLZA 2QFNA 3ZJRA 3H58A 5CN4A 1YHUD 1CG5A 1EMYA 4O4ZA 1WMUA 1YE2A 3BOMA 1J3ZB 2VYWA 2BWHA 3QJBA 2DXMB 1YE2B 1WMUB 1HBBB 1IOPA 1YGFB 2ZWJA 1Y35B 1VXBA 2O58X 3TM3A 3IC0A 3OVUC 3EDAA 3UHIA 3DR9A 3D1KB 2AV3A 2MGCA 2D2NB 3GKVB 1FSXB 3EU1B 2D60A 2QLSA 1D8UA 3MJPA 3WR1B 3HYUA 1IT2A 2W31A 1BZ6A 1F63A 4YU4B 1Y83A 1S56A 1A6KA 1GCWB 3ZJJA 2ZS1D 2EB8A 1HSYA 5CNGA 2PEGA 1YVQB 4YU3B 3MKBA 1HGCA 2ZLTA 1ABYA 3MN0A 1G08A 3FS4A 1A9WA 3ONZA 3HHBB 1YEOA 1CIKA 3OO5B 1Y7DB 2ZLUB 3UGZA 2D2ND 1YENA 5ILPA 1N9FA 4LPIA 5F0BA 2QSSA 1Y45A 2R4ZA 3QJCB 3ZJMA 3WCVB 4PQ6A 4U8UC 1YEQA 4HRTA 4ZVAA 1G0BA 3R5IB 2EVPA 2GL3A 1Y4QA 4MQKB 4N7NB 4F6GA 1YE0B 1NZ5A 4M4BA 1XY0A 2DC3A 1MBSA 1YHRB 3ZJSA 1QSHA 2HCOB 2V1FA 2HBEA 1NS6B 2DN1B 3WCUB 3G4QA 3WCTC 1J7WB 1Y4BB 3DHRA 3ODQB 1MBIA 1FSLA 1LH2A 3OZWA 3GQPA 5E6EA 2G10A 1MWCA 1QI8A 4L7YB 2OH8A 1QXDA 1MLFA 1MBDA 1S5XB 1J7SB 1H97A 2MB5A 1BABB 4WJG1 2M6ZB 1R1YB 1PBXA 1BINA 5HY8B 1MYGA 3HENA 1YHEA 4N7PA 3K3UA 3ZJHA 3K8BA 1Y0CB 4KJTA 2R4WA 3VRFA 1MYHA 1HBRB 3K9ZA 4UIQA 1J7YA 1Y5JA 1Z8UB 2AUQA 2QU0A 1JZMA 2ZT3A 1C7CA 111MA 3PIAB 1FN3A 2V1HA 1HBAA 5E83A 3RGKA 1HDBA 2QU0B 1HACA 2ZS1C 2H35A 2MYBA 1HHOA 3PI3A 1MLUA 3D4XB 3PI8A 4KN3A 3RJNB 2AUPA 3K8BB 1CO9A 1G9VA 1O1NA 3OO4A 1CH2A 1MYFA 4NZIA 3S66B 5CN5A 5EE4D 3EDBA 1MBOA 1MCYA 1OUUB 1J7SA 1MLHA 1YZIA 1Y7ZB 1O1LA 1IWHB 1BVDA 2ZT0A 1DO1A 2DN3A 1RQ3B 2ZLVB 1EWAA 1KD2B 3D7OA 2V1IA 2BLJM 1XQ5A 3MJUA 1JZLA 2VYZA 2GNVA 2LHBA 109MA 1SDLB 2Z6NB 2HBEB 4ROLB 3FH9A 1CLSA 2LH7A 2E2YA 3ZJIA 3WFXA 1CH1A 1BZPA 3H57A 4XDIA 1DKEA 5EYSA 1A00A 3O7NA 1VXAA 1XZ4B 3MJUB 101MA 1Y0WA 1O1KA 4ESAB 2LH5A 1CP0A 5EV5A 1A0ZA 1XZ4A 2MGBA 1LH6A 4IROA 3B75B 2IN4A 1MNKA 1Y4GA 1XZ7A 2BKMA 2O5TX 1NZ2A 1W92A 3QJDB 3MVCA 1Y5KA 5ILEA 2G0ZA 2OHBA 1MTKA 2GTLD 1T1NA 3WFTA 1XQ5B 1YMBA 2W72B 2XKIA 1BZZA 3OO4B 3V2ZA 5CNFA 3VHBA 2KSCA 4NS2A 1GBUA 1RQ3A 2H35B 1ECDA 5EQMA 1IWHA 1HACB 4VHBA 1FN3B 1C7CB 1JL6A 3PIAA 5MBNA 1GJNA 5CN8A 5D5RA 3WR1A 1BIJA 1HBSA 3EU1A 1Y31B 3GKVA 1Y0AB 3NFEB 1GCVB 1MKOA 3S66A 1YHEB 3UH6A 1YMAA 3BOMB 3WCVD 4AVDA 1LFQA 1NXFA 2ZS0A 1MODA 5CNCA 1Y31A 1OBMA 1BIJB 1ABSA 1SWMA 1DXDA 1DO7A 1HLBA 4SDHA 3UHQA 3OK5A 1A6GA 2R4XA 3PI4A 5CHRA 3ORDA 3ODQA 3BCQA 1JEBB 1GVHA 1ASHA 3DHRB 4HSWA 5D1VA 2GTLC 5JDOF 3WTGB 1MNHA 1YH9A 1LFTB 3HF4B 2LH3A 2HCOA 1SI4B 4MQHB 1BVCA 1N9IA 3HC9A 2HBDB 1XZ7B 1NZ4A 3M3AA 2MYAA 1MBCA 3QJEA 2MGKA 1AJ9B 1S61A 3R5IA 1DO4A 1SDKA 1YEQB 2H8DA 4PQCA 3WHMB 1J7WA 4MU5A 2DN1A 1QSIB 2MGAA 4H2LB 3PT7B 2NSSA 3PI1A 3OO5A 1RQ4A 1LFYB 4N8TA 1MLKA 2V1KA 2QMBA 3AT5A 3QM9A 1THBB 1JP9A 4ODCA 1MNIA 3GDJA 1SDLA 2W6XA 3UGYA 1J40A 1NQPA 1G0BB 4C44A 104MA 1HGCB 1VXEA 1A3OB 1HDAA 1YOHA 3G4RA 1JY7B 2EB9A 4F68A 1YENB 1HLMA 3WCUD 3VREA 2ZFOD 3UBVA 1A9WE 5HLUA 1NAZA 3AQ7A 1WVPA 3NG6B 2QLSB 1YMCA 1GZXB 4MBAA 1EW6A 1DXTB 2GRFA 1A3NA 3D1KA 2H8FA 2ZSOA 1UVXA 3LHBA 1HBIA 3UHBA 4XS0B 1YIEA 1PMBA 1RPSB 2DXMA 3QJBB 4JYQA 2BW9M 1H1XA 3D17A 1Y8WA 3WCTD 1Y83B 3MYNA 2AV0A 1HDBB 3S65A 1Y7CB 1MOBA 1DTMA 2RI4A 3QM7A 1Y4FA 2W6VB 2MGEA 3U3EA 2R4YA 3M3BA 3A5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8W B;  1BZ0 B;  1Y7G A;  1B86 B;  1VWT A;  5HY8 A;  1PBX B;  1CG5 B;  2Z6S A;  3UHU A;  1JP8 A;  1YVT B;  4G1V A;  1GDL A;  1A3N B;  1NGK A;  2EKU A;  1S5X A;  1VXH A;  1GZX A;  2R80 A;  1YGD A;  3ZOM A;  1Y4V B;  1YEU A;  1Y2Z A;  1U7R A;  1B0B A;  1YCB A;  4MQC A;  1IRD B;  2C0K A;  3IC2 B;  1Y8K A;  4FWY A;  4OOD A;  1NWI A;  1Y0T A;  1YIH B;  2OIF A;  3AQ8 A;  1QPW B;  1Y4B A;  2OH9 A;  2D5X A;  1DUO A;  5EYJ A;  6HBI A;  2AA1 B;  2DN2 A;  3UHG A;  4BJA A;  1XXT A;  3GDJ B;  3R0G A;  1GDI A;  5AZR A;  1HDS A;  4QAU A;  1DLY A;  1WLA A;  3UH3 A;  1MLG A;  2HHE A;  1OUT B;  1MNO A;  1BZ1 B;  1MLM A;  2MYD A;  3LQD B;  5B85 A;  3P5Q A;  3MBA A;  1XZV B;  2ZFB A;  3WCV A;  4FWX A;  3LB1 A;  4FH7 A;  1Y0T B;  1Q1F A;  1DO3 A;  2O5M X;  1Y8K B;  5SW7 A;  1K1K A;  2ZSN A;  5CMV A;  2BLH A;  1CQX A;  1Y46 A;  3CIU B;  4G51 B;  1V4W B;  3QZZ A;  2R50 A;  1YEO B;  3HXN A;  3ONZ B;  3G52 A;  1Y0D A;  3HEO A;  2WTG A;  3BJ2 A;  4HBI A;  1ABY B;  2VHB A;  3QM8 A;  1B86 A;  1VWT B;  2GRZ A;  3WCP A;  2GTL B;  4UZV A;  1FLP A;  1COH A;  1XZ5 A;  2FAM A;  1UX9 A;  5JDO E;  2RI4 B;  1JW8 A;  2JHO A;  1VHB A;  2EKT A;  1FSX A;  1MOH A;  2D2M C;  3ZHW A;  2SPO A;  4HSX A;  1A01 B;  1Y35 A;  1YGF A;  110M A;  1LFQ B;  2RAO A;  2G0V A;  1I3D A;  4F4O B;  2HBG A;  3A0G A;  3BJ3 A;  4AVE A;  3DHT B;  5HBI A;  2NRL A;  1Y09 B;  1HBS B;  1OFK A;  2WTH A;  4F69 A;  1JP6 A;  4ROM A;  1MYI A;  4IT8 A;  1LH7 A;  1BUW B;  4MXK A;  1O1M B;  5C6Y A;  3VRE B;  1CMY B;  1CG8 B;  1NZ3 A;  1JY7 A;  2ZLX A;  2ZSY A;  5JDO D;  4H0B A;  1XZU A;  3QQQ A;  3ZH0 A;  1O1P B;  4L2M A;  3IXF A;  1X46 A;  1XYE B;  2MGJ A;  1N9X A;  2GKN A;  1CH7 A;  5HLQ A;  4MQI A;  3AT5 B;  103M A;  2PGH A;  2MGF A;  3ARL A;  1RQ4 B;  3AT6 A;  1UIW A;  4MQJ A;  1CMY A;  5C6E A;  2G12 A;  3A9M A;  2HHD A;  1QSI A;  3E5O A;  3WCU C;  1MLJ A;  2ZLW B;  4N7O A;  3VRG A;  1BUW A;  1V75 B;  4ROM B;  1C7B B;  1R1X B;  2H8D B;  4ESA A;  4F6D A;  1Y0W B;  3ECL A;  5JGG B;  2MGL A;  5CHQ A;  1LA6 A;  1DWR A;  1Y09 A;  3WCT B;  4HHB B;  2BK9 A;  2O5O X;  3A0G B;  4F6I A;  1LTW A;  1HGA A;  2G14 A;  1SI4 A;  1LH5 A;  1HAB A;  3UHE A;  3UHX A;  1NEJ A;  1M9P B;  2ZFO A;  3EOK A;  2SPN A;  1RTE A;  1F65 A;  3WTG A;  1Y8I A;  1V4U A;  5JDO C;  1MLL A;  2O5Q X;  3KMF C;  1Y8I B;  2HBC A;  1MDN A;  1MNJ A;  1F5P A;  2FRF A;  1YFF B;  1LUE A;  2ZFO B;  3AQ5 A;  1X9F B;  3WCW A;  1HGA B;  2MGD A;  2B7H B;  2G11 A;  1BJE A;  2OLP A;  2V1G A;  5EUI B;  3AG0 A;  3LB4 A;  3BJ1 A;  3WFW A;  4HHB A;  3ARJ A;  2ZS0 D;  3E4N A;  2CMM A;  3PEL A;  3QM5 A;  1G0A B;  2MGH A;  1V75 A;  5AZQ A;  6HBW B;  1TES A;  4M4A B;  1HBG A;  1G09 A;  3WCW D;  2ZLW A;  5MBA A;  2HHB A;  1BZ1 A;  3M39 A;  1ITH A;  2MHB B;  1GBU B;  3AT6 B;  4NI1 B;  3UHD A;  4DC8 A;  4N7P B;  2PGH B;  1BZZ B;  1KFR A;  2W72 A;  1HDS B;  5KDQ A;  5CN9 A;  4MQG A;  1JF4 A;  1X9F D;  2M6Z A;  1XYE A;  3KUN A;  3LR9 A;  1ECN A;  4FC3 A;  4NI0 B;  2VEE A;  3UHZ A;  1XZU B;  3DUT B;  1M6C A;  1AJG A;  1QPW A;  1QI8 B;  2ZT1 A;  1GDK A;  1VXC A;  1URY A;  1CP5 A;  4MXL A;  4IRO B;  5HU6 B;  4MBN A;  3UHK A;  4MPM A;  4O35 A;  2R80 B;  1V4X A;  1A6M A;  1GLI B;  1RSE A;  1NS6 A;  1YVT A;  2V1J A;  4U8U B;  3SZK A;  1A00 B;  3UHT A;  1Y7G B;  1MGN A;  2VLY A;  1JWN A;  102M A;  2RAO B;  1CLS B;  1A01 A;  3FH9 B;  1Y5F A;  2AUR A;  4OF9 A;  2Z6N A;  1DXU B;  1K0Y B;  1CBM A;  2EF2 A;  1YDZ A;  3RJ6 A;  1Y4F B;  2W6V A;  3ECZ A;  4O2G A;  3A59 B;  108M A;  2GNW A;  3QJC A;  1Y4P A;  2W6W A;  3D7O B;  2G0X A;  2VRY A;  3GYS B;  4DWT A;  2GTL A;  4F6F A;  3W4U B;  4HRR A;  1Y7Z A;  3S1I A;  5KER A;  3HHB A;  1J41 A;  3A2G A;  1LFL B;  3QQR A;  2AUO A;  2W6Y A;  1OUU A;  2WY4 A;  2MGG A;  2H8F B;  3UHR A;  1MLQ A;  2ZLT B;  3HEP A;  1LFL A;  2ZSZ A;  2D2N C;  4HRR B;  3W4U A;  1Y4R B;  3UHW A;  3PI8 B;  1HHO B;  1K1K B;  1O1O B;  1S5Y A;  3GYS A;  2HBF A;  3O89 A;  2ZST A;  1UFP A;  1YG5 A;  1RTX A;  1J3F A;  1Y4P B;  2OHA A;  5E83 B;  1HBA B;  2V1E A;  1A3O A;  1GBV A;  2MGM A;  2VM0 A;  3LQD A;  1YDZ B;  4B3W A;  3WFU A;  1BBB B;  1Y22 A;  1K0Y A;  3UBC A;  3VRF B;  3PT8 B;  5JOM A;  2ZSQ A;  4C0N A;  2D5Z A;  4X0L A;  3PT7 A;  3G46 A;  1C40 A;  4PQB A;  2DN2 B;  2AA1 A;  4U8U A;  3SZK B;  1MYT A;  1Y85 B;  1IBE A;  1FCS A;  1N9H A;  1X9F C;  1DTI A;  5E29 B;  3KUO A;  1SDK B;  3UHH A;  3UHV A;  4NK2 A;  4MQC B;  4NXA A;  1OR6 A;  4KMW A;  1Y2Z B;  1O1I A;  2HBD A;  3CY5 A;  1YGD B;  1V07 A;  3DUT A;  1LH3 A;  2HZ3 A;  1XZ2 A;  1IBE B;  2D6C A;  4MQH A;  2FAL A;  7HBI A;  1EBT A;  1JL7 A;  2Z85 A;  2D5Z B;  107M A;  1XZ2 B;  1YHR A;  1URV A;  1J52 A;  2NSR A;  1A0U B;  4UUR A;  3CY5 B;  1YE0 A;  3GK9 A;  1O1I B;  4N7N A;  1SPE A;  1Y4Q B;  2MHB A;  1O1J B;  1SHR A;  2HHB B;  1NWN A;  2FRI X;  2ZT2 A;  5E29 A;  1GBV B;  1DLW A;  1DM1 A;  2MYC A;  1J3Y A;  1LH1 A;  1MLO A;  1SPG A;  1Y7C A;  3WCW C;  3G53 A;  2QSS B;  1LFV A;  3WI8 A;  1CPW A;  1S5Y B;  2ZS0 B;  3D17 B;  1YCA A;  1DXV B;  3ZJQ A;  3UHN A;  3FS4 B;  4XS0 A;  3AQ9 A;  3WCW B;  1MKO B;  1GCV A;  3ZJO A;  2VLX A;  4H07 A;  3NFE A;  1Y0A A;  1CQ2 A;  3MKB B;  4YU3 A;  1UFJ A;  1J41 B;  5KER B;  1VXD A;  2PEG B;  2HZ2 A;  1OJ6 A;  1Y8H B;  1ABW A;  4G1B A;  1O1O A;  3V2V A;  1ABW B;  2VYY A;  1HRM A;  3LR7 A;  4WJG A;  1V4U B;  1FHJ A;  1HDA B;  3MJP B;  3GQR B;  4O4T A;  1T1N B;  2VEB A;  1J40 B;  2GRH A;  1NEJ B;  1Y5F B;  1THB A;  1NS9 B;  1CH9 A;  3QJD A;  1DXV A;  2HZ1 A;  2QSP B;  3WCT A;  3SDN A;  1GLI A;  2GKM A;  5ILM A;  1V4X B;  1HV4 A;  3GOU B;  1FAW A;  1UT0 A;  3G4W A;  1SHR B;  1DXU A;  1O1J A;  5C6E B;  3QJE B;  1L2K A;  3UHC A;  3M38 A;  3UH5 A;  3PI2 A;  1YEV A;  1UX8 A;  5IKS A;  1IRC A;  2D2M A;  4TWU A;  2ZSS A;  3ASE A;  2O5L X;  1JDO A;  1OR4 A;  3PI9 A;  1YH9 B;  3NML A;  3ARK A;  4WCH D;  4MQG B;  5M3S A;  3S48 C;  3BCQ B;  2YRS A;  1KD2 A;  5HU6 A;  1HGB A;  5EET A;  4ZVB A;  3ZJP A;  1AJH A;  1MZ0 A;  1C7D A;  1RVW A;  1G09 B;  1X3K A;  2R1H B;  4M4A A;  1O1L B;  1YZI B;  1MLR A;  2BMM A;  4FC3 B;  1Y85 A;  3PEL B;  2MBW A;  1LFZ A;  3ECX A;  105M A;  5CNE A;  3NL7 A;  1TU9 A;  1JF3 A;  1C40 B;  2O5B X;  4X0L B;  2DHB A;  1MOC A;  4DWU A;  5KDQ B;  1VRF A;  5EUI A;  112M A;  1O1N B;  1G9V B;  4F4O A;  3PT8 A;  3OJ1 A;  3VAU A;  2ZSR A;  3TLD A;  3D4X A;  1BBB A;  1Y22 B;  2LH2 A;  2BNL A;  3E55 A;  6HBW A;  1RQA B;  1HJT A;  1YG5 B;  2HBF B;  3D1A B;  3G4U A;  2ZSP A;  2Z6T A;  4FH6 A;  1M6M A;  3QMA A;  3ED9 A;  1HBR A;  2IG3 A;  106M A;  1NPG A;  1MWB A;  1IDR A;  1Y4R A;  2ZT4 A;  1GDJ A;  1F5O A;  1IT3 A;  2B7H A;  5HAV A;  1HBH A;  1S0H B;  1X9F A;  1BAB A;  1U7S A;  1V9Q A;  1HAB B;  2EVK A;  5ILR A;  5EE4 C;  1Y5K B;  1KR7 A;  5E6E B;  3GQP B;  1V4W A;  1Y46 B;  3CIU A;  1UVY A;  1Y4G B;  3B75 A;  1YHU B;  1LA6 B;  1JPB A;  2MGI A;  1LHT A;  2ZSX A;  4U8U D;  5HLX A;  4DC7 A;  1A0Z B;  3A59 A;  1UC3 A;  1MYJ A;  4TWV A;  1RQA A;  2ZS1 A;  1O1K B;  1LJW A;  3WCU A;  2QRW A;  4N7O B;  1S6A A;  2ZFO C;  3LB2 A;  2FRJ X;  1DKE B;  4PNJ A;  1UMO A;  2GLN A;  1OUT A;  1UIW B;  2Z8A A;  3UHY A;  5KKK A;  3GQG B;  1A4F B;  2HBS A;  4B4Y A;  4MQI B;  2DHB B;  4ROL A;  4NXC A;  4MQK A;  2O5S X;  3HRW A;  2XYK A;  4F6J A;  5JGG A;  4HRT B;  1CIO A;  3A5B A;  3GLN A;  4GZG A;  1MBN A;  1HCO B;  4TYX A;  1CO8 A;  1MOA A;  2QFK A;  1RVW B;  2ZLV A;  4F6B A;  1XCH A;  2DN3 B;  1MLS A;  5F2A A;  1HCO A;  1MWD A;  3UHS A;  1S69 A;  5EOH A;  4NI0 A;  5EU2 A;  5CND A;  1DUK A;  1A6N A;  2XKG A;  3KMF A;  3HRW B;  3QM6 A;  3PI9 B;  1FDH G;  1O1P A;  2LH1 A;  2HBS B;  1A4F A;  3GQG A;  1YVQ A;  1YOG A;  3DHT A;  3BJ3 B;  3BA2 A;  3QZX A;  4NI1 A;  1YEV B;  1YHU C;  2ZLX B;  1BZ0 A;  1ECO A;  1CG8 A;  1NPF A;  2NRM A;  3IA3 B;  1LJW B;  3G4V A;  2ZS1 B;  3HYU B;  5CN7 A;  3ZOL A;  1DWS A;  1G0A A;  1CH5 A;  2G3H A;  1HV4 B;  1J7Y B;  1Y5J B;  1VXF A;  3S65 B;  2D2N A;  1MBA A;  3G4Y A;  1YHU A;  3IC0 B;  1COH B;  2NX0 A;  2QSP A;  1Y0C A;  1OFJ A;  3BJ1 B;  2W72 C;  3E5I A;  1HBB A;  2SPL A;  1DXC A;  1VRE A;  1FDH A;  1J3Z A;  4ILZ A;  3ZJL A;  1MLN A;  1RPS A;  1YIE B;  1NS9 A;  1R1Y A;  2SPM A;  1MYM A;  1YFF A;  1DXT A;  1HBH B;  1S0H A;  3GQR A;  1QXD B;  1Y0D B;  3NG6 A;  4L7Y A;  2HBC B;  3HXN B;  1FHJ B;  3NMM B;  3UI0 A;  4G51 A;  1XZ5 B;  1CH3 A;  3D1A A;  1MTI A;  1Y8H A;  1CBL A;  1MYZ A;  3WCP B;  4MAX A;  1ECA A;  5CN6 A;  1MTJ A;  1QXE A;  2FRK X;  2ZFB B;  5CNB A;  3EOK B;  3P5Q B;  1M9P A;  1NQP B;  1O16 A;  3BJ2 B;  4ODC B;  2HHE B;  1QSH B;  2GDM A;  2LH6 A;  2QMB B;  2D2M D;  4JAC A;  1XY0 B;  3UH7 A;  4M4B B;  1LFY A;  4N8T B;  2MYE A;  2G0S A;  1NIH A;  4H2L A;  1XXT B;  3NL7 B;  5B84 A;  5SW7 B;  3ZJN A;  4NK1 A;  1LFZ B;  2XKH A;  1BZR A;  1LFV B;  1R1X A;  3LB3 A;  1C7B A;  4O1T A;  1YOI A;  1J3Y B;  1SPG B;  3WHM A;  3VRG B;  1Y45 B;  2R1H A;  1XZV A;  3WCV C;  1YIH A;  1C7D B;  2HHD B;  1IRD A;  3IC2 A;  4MQJ B;  1AJ9 A;  1AZI A;  1NIH B;  1Y7D A;  1HGB B;  2ZLU A;  2YRS B;  1YEU B;  1EBC A;  1Y4V A;  1A0U A;  2BLI A;  1Y01 B;  3AQ6 A;  3A5G A;  3MOU A;  1G08 B;  3MYM A;  4KMV A;  3HF4 A;  1LFT A;  4FWZ A;  2D5X B;  2D2M B;  3GKT A;  1QXE B;  1JEB A;  3OGB A;  3SDH A;  1GCW A;  3TM9 A;  2G0R A;  1V5H A;  2ZS0 C;  1CH4 A;  1LHS A;  1I3E A;  1VXG A;  4YU4 A;  1O1M A;  1FAW B;  3GOU A;  3NMM A;  3OZV A;  3OZU A;  5AB8 A;  3S1J A;  2D60 B;  1DWT A;  1JZK A;  2VLZ A;  2QFN A;  3ZJR A;  3H58 A;  5CN4 A;  1YHU D;  1CG5 A;  1EMY A;  4O4Z A;  1WMU A;  1YE2 A;  3BOM A;  1J3Z B;  2VYW A;  2BWH A;  3QJB A;  2DXM B;  1YE2 B;  1WMU B;  1HBB B;  1IOP A;  1YGF B;  2ZWJ A;  1Y35 B;  1VXB A;  2O58 X;  3TM3 A;  3IC0 A;  3OVU C;  3EDA A;  3UHI A;  3DR9 A;  3D1K B;  2AV3 A;  2MGC A;  2D2N B;  3GKV B;  1FSX B;  3EU1 B;  2D60 A;  2QLS A;  1D8U A;  3MJP A;  3WR1 B;  3HYU A;  1IT2 A;  2W31 A;  1BZ6 A;  1F63 A;  4YU4 B;  1Y83 A;  1S56 A;  1A6K A;  1GCW B;  3ZJJ A;  2ZS1 D;  2EB8 A;  1HSY A;  5CNG A;  2PEG A;  1YVQ B;  4YU3 B;  3MKB A;  1HGC A;  2ZLT A;  1ABY A;  3MN0 A;  1G08 A;  3FS4 A;  1A9W A;  3ONZ A;  3HHB B;  1YEO A;  1CIK A;  3OO5 B;  1Y7D B;  2ZLU B;  3UGZ A;  2D2N D;  1YEN A;  5ILP A;  1N9F A;  4LPI A;  5F0B A;  2QSS A;  1Y45 A;  2R4Z A;  3QJC B;  3ZJM A;  3WCV B;  4PQ6 A;  4U8U C;  1YEQ A;  4HRT A;  4ZVA A;  1G0B A;  3R5I B;  2EVP A;  2GL3 A;  1Y4Q A;  4MQK B;  4N7N B;  4F6G A;  1YE0 B;  1NZ5 A;  4M4B A;  1XY0 A;  2DC3 A;  1MBS A;  1YHR B;  3ZJS A;  1QSH A;  2HCO B;  2V1F A;  2HBE A;  1NS6 B;  2DN1 B;  3WCU B;  3G4Q A;  3WCT C;  1J7W B;  1Y4B B;  3DHR A;  3ODQ B;  1MBI A;  1FSL A;  1LH2 A;  3OZW A;  3GQP A;  5E6E A;  2G10 A;  1MWC A;  1QI8 A;  4L7Y B;  2OH8 A;  1QXD A;  1MLF A;  1MBD A;  1S5X B;  1J7S B;  1H97 A;  2MB5 A;  1BAB B;  4WJG 1;  2M6Z B;  1R1Y B;  1PBX A;  1BIN A;  5HY8 B;  1MYG A;  3HEN A;  1YHE A;  4N7P A;  3K3U A;  3ZJH A;  3K8B A;  1Y0C B;  4KJT A;  2R4W A;  3VRF A;  1MYH A;  1HBR B;  3K9Z A;  4UIQ A;  1J7Y A;  1Y5J A;  1Z8U B;  2AUQ A;  2QU0 A;  1JZM A;  2ZT3 A;  1C7C A;  111M A;  3PIA B;  1FN3 A;  2V1H A;  1HBA A;  5E83 A;  3RGK A;  1HDB A;  2QU0 B;  1HAC A;  2ZS1 C;  2H35 A;  2MYB A;  1HHO A;  3PI3 A;  1MLU A;  3D4X B;  3PI8 A;  4KN3 A;  3RJN B;  2AUP A;  3K8B B;  1CO9 A;  1G9V A;  1O1N A;  3OO4 A;  1CH2 A;  1MYF A;  4NZI A;  3S66 B;  5CN5 A;  5EE4 D;  3EDB A;  1MBO A;  1MCY A;  1OUU B;  1J7S A;  1MLH A;  1YZI A;  1Y7Z B;  1O1L A;  1IWH B;  1BVD A;  2ZT0 A;  1DO1 A;  2DN3 A;  1RQ3 B;  2ZLV B;  1EWA A;  1KD2 B;  3D7O A;  2V1I A;  2BLJ M;  1XQ5 A;  3MJU A;  1JZL A;  2VYZ A;  2GNV A;  2LHB A;  109M A;  1SDL B;  2Z6N B;  2HBE B;  4ROL B;  3FH9 A;  1CLS A;  2LH7 A;  2E2Y A;  3ZJI A;  3WFX A;  1CH1 A;  1BZP A;  3H57 A;  4XDI A;  1DKE A;  5EYS A;  1A00 A;  3O7N A;  1VXA A;  1XZ4 B;  3MJU B;  101M A;  1Y0W A;  1O1K A;  4ESA B;  2LH5 A;  1CP0 A;  5EV5 A;  1A0Z A;  1XZ4 A;  2MGB A;  1LH6 A;  4IRO A;  3B75 B;  2IN4 A;  1MNK A;  1Y4G A;  1XZ7 A;  2BKM A;  2O5T X;  1NZ2 A;  1W92 A;  3QJD B;  3MVC A;  1Y5K A;  5ILE A;  2G0Z A;  2OHB A;  1MTK A;  2GTL D;  1T1N A;  3WFT A;  1XQ5 B;  1YMB A;  2W72 B;  2XKI A;  1BZZ A;  3OO4 B;  3V2Z A;  5CNF A;  3VHB A;  2KSC A;  4NS2 A;  1GBU A;  1RQ3 A;  2H35 B;  1ECD A;  5EQM A;  1IWH A;  1HAC B;  4VHB A;  1FN3 B;  1C7C B;  1JL6 A;  3PIA A;  5MBN A;  1GJN A;  5CN8 A;  5D5R A;  3WR1 A;  1BIJ A;  1HBS A;  3EU1 A;  1Y31 B;  3GKV A;  1Y0A B;  3NFE B;  1GCV B;  1MKO A;  3S66 A;  1YHE B;  3UH6 A;  1YMA A;  3BOM B;  3WCV D;  4AVD A;  1LFQ A;  1NXF A;  2ZS0 A;  1MOD A;  5CNC A;  1Y31 A;  1OBM A;  1BIJ B;  1ABS A;  1SWM A;  1DXD A;  1DO7 A;  1HLB A;  4SDH A;  3UHQ A;  3OK5 A;  1A6G A;  2R4X A;  3PI4 A;  5CHR A;  3ORD A;  3ODQ A;  3BCQ A;  1JEB B;  1GVH A;  1ASH A;  3DHR B;  4HSW A;  5D1V A;  2GTL C;  5JDO F;  3WTG B;  1MNH A;  1YH9 A;  1LFT B;  3HF4 B;  2LH3 A;  2HCO A;  1SI4 B;  4MQH B;  1BVC A;  1N9I A;  3HC9 A;  2HBD B;  1XZ7 B;  1NZ4 A;  3M3A A;  2MYA A;  1MBC A;  3QJE A;  2MGK A;  1AJ9 B;  1S61 A;  3R5I A;  1DO4 A;  1SDK A;  1YEQ B;  2H8D A;  4PQC A;  3WHM B;  1J7W A;  4MU5 A;  2DN1 A;  1QSI B;  2MGA A;  4H2L B;  3PT7 B;  2NSS A;  3PI1 A;  3OO5 A;  1RQ4 A;  1LFY B;  4N8T A;  1MLK A;  2V1K A;  2QMB A;  3AT5 A;  3QM9 A;  1THB B;  1JP9 A;  4ODC A;  1MNI A;  3GDJ A;  1SDL A;  2W6X A;  3UGY A;  1J40 A;  1NQP A;  1G0B B;  4C44 A;  104M A;  1HGC B;  1VXE A;  1A3O B;  1HDA A;  1YOH A;  3G4R A;  1JY7 B;  2EB9 A;  4F68 A;  1YEN B;  1HLM A;  3WCU D;  3VRE A;  2ZFO D;  3UBV A;  1A9W E;  5HLU A;  1NAZ A;  3AQ7 A;  1WVP A;  3NG6 B;  2QLS B;  1YMC A;  1GZX B;  4MBA A;  1EW6 A;  1DXT B;  2GRF A;  1A3N A;  3D1K A;  2H8F A;  2ZSO A;  1UVX A;  3LHB A;  1HBI A;  3UHB A;  4XS0 B;  1YIE A;  1PMB A;  1RPS B;  2DXM A;  3QJB B;  4JYQ A;  2BW9 M;  1H1X A;  3D17 A;  1Y8W A;  3WCT D;  1Y83 B;  3MYN A;  2AV0 A;  1HDB B;  3S65 A;  1Y7C B;  1MOB A;  1DTM A;  2RI4 A;  3QM7 A;  1Y4F A;  2W6V B;  2MGE A;  3U3E A;  2R4Y A;  3M3B A;  3A5A A; 
#chains in the Genus database with same CATH topology
 1Y8W B;  1BZ0 B;  1Y7G A;  1B86 B;  1VWT A;  5HY8 A;  1PBX B;  1CG5 B;  2Z6S A;  3UHU A;  1JP8 A;  1YVT B;  4G1V A;  1GDL A;  1A3N B;  1NGK A;  2EKU A;  1S5X A;  1VXH A;  1GZX A;  2R80 A;  2UUN B;  1YGD A;  3ZOM A;  1Y4V B;  1YEU A;  3FEW X;  1Y2Z A;  1U7R A;  1B0B A;  1QGW C;  3V58 B;  1YCB A;  4MQC A;  5FVB M;  1IRD B;  2C0K A;  3IC2 B;  1Y8K A;  4FWY A;  4OOD A;  1NWI A;  1Y0T A;  1YIH B;  1UVJ A;  2OIF A;  3AQ8 A;  1QPW B;  1Y4B A;  2OH9 A;  4LMS B;  3KVS B;  3NUH B;  2D5X A;  1DUO A;  5EYJ A;  2J96 A;  6HBI A;  2AA1 B;  2DN2 A;  1F99 A;  3UHG A;  4BJA A;  1XXT A;  3GDJ B;  3R0G A;  1GDI A;  5AZR A;  2VJT B;  1HDS A;  4QAU A;  1SGK A;  1DLY A;  1WLA A;  3UH3 A;  1MLG A;  2HHE A;  1OUT B;  1MNO A;  1BZ1 B;  1MLM A;  2MYD A;  3LQD B;  5B85 A;  3P5Q A;  3MBA A;  1XDT T;  1XZV B;  2ZFB A;  3WCV A;  4FWX A;  3LB1 A;  4FH7 A;  1Y0T B;  1Q1F A;  1DO3 A;  2O5M X;  1Y8K B;  5SW7 A;  1K1K A;  2ZSN A;  5CMV A;  3V58 A;  4PO5 B;  2BLH A;  1CQX A;  1Y46 A;  3CIU B;  4G51 B;  1V4W B;  3QZZ A;  2R50 A;  1YEO B;  3HXN A;  3ONZ B;  3G52 A;  1Y0D A;  3V57 A;  3HEO A;  2WTG A;  3BJ2 A;  4HBI A;  1ABY B;  2VHB A;  3QM8 A;  1B86 A;  1VWT B;  2VJR A;  2GRZ A;  2UUN D;  3WCP A;  2GTL B;  4UZV A;  1FLP A;  1COH A;  1XZ5 A;  2FAM A;  1UX9 A;  5JDO E;  2RI4 B;  1JW8 A;  2JHO A;  1VHB A;  2EKT A;  1FSX A;  1MOH A;  2D2M C;  1B8D B;  3ZHW A;  2SPO A;  1HHS A;  4HSX A;  1A01 B;  1Y35 A;  1YGF A;  110M A;  1LFQ B;  2RAO A;  2G0V A;  1JBO A;  1I3D A;  4F4O B;  2HBG A;  3A0G A;  3BJ3 A;  4AVE A;  3DHT B;  5HBI A;  2NRL A;  1F0L A;  1Y09 B;  1HBS B;  1OFK A;  2WTH A;  4F69 A;  1JP6 A;  4ROM A;  1MYI A;  4IT8 A;  1LH7 A;  1BUW B;  4MXK A;  1O1M B;  1B33 B;  5C6Y A;  3VRE B;  1CMY B;  1CG8 B;  1NZ3 A;  1JY7 A;  2ZLX A;  2ZSY A;  5JDO D;  4H0B A;  1XZU A;  2YSK A;  3QQQ A;  3ZH0 A;  1O1P B;  4L2M A;  3IXF A;  1X46 A;  1XYE B;  2MGJ A;  5AQD A;  1N9X A;  2GKN A;  1CH7 A;  5HLQ A;  4MQI A;  3AT5 B;  103M A;  2PGH A;  2MGF A;  3ARL A;  1RQ4 B;  3AT6 A;  1UIW A;  4MQJ A;  1CMY A;  5C6E A;  2G12 A;  3A9M A;  2HHD A;  1QSI A;  3E5O A;  1UVM A;  3WCU C;  1MLJ A;  2ZLW B;  4N7O A;  3VRG A;  1BUW A;  1V75 B;  4ROM B;  1C7B B;  1R1X B;  2H8D B;  4ESA A;  4F6D A;  1Y0W B;  3ECL A;  5JGG B;  2MGL A;  3O18 B;  5CHQ A;  1LA6 A;  1DWR A;  1Y09 A;  3WCT B;  4HHB B;  2BK9 A;  2O5O X;  3A0G B;  4F6I A;  3PMD A;  1LTW A;  1HGA A;  2G14 A;  2I88 A;  1SI4 A;  1LH5 A;  1HAB A;  3UHE A;  3UHX A;  1NEJ A;  1M9P B;  2ZFO A;  3EOK A;  2SPN A;  1RTE A;  1F65 A;  3WTG A;  2JLF A;  1Y8I A;  1V4U A;  5JDO C;  1MLL A;  1UVN A;  2O5Q X;  3KMF C;  1Y8I B;  2HBC A;  1MDN A;  1MNJ A;  1LIA B;  1F5P A;  2FRF A;  1YFF B;  1LUE A;  2ZFO B;  3AQ5 A;  1X9F B;  3WCW A;  1HGA B;  2MGD A;  1KTP B;  2B7H B;  2G11 A;  1BJE A;  2OLP A;  2V1G A;  5EUI B;  3AG0 A;  3LB4 A;  4HH1 A;  3BJ1 A;  3WFW A;  4HHB A;  3ARJ A;  2ZS0 D;  3E4N A;  2CMM A;  3PEL A;  5B13 G;  3QM5 A;  1G0A B;  2MGH A;  1V75 A;  5AZQ A;  6HBW B;  1TES A;  4M4A B;  1HBG A;  1G09 A;  3WCW D;  2ZLW A;  5MBA A;  1UVK A;  2HHB A;  3ZTA A;  1BZ1 A;  3M39 A;  1ITH A;  2MHB B;  1GBU B;  3AT6 B;  4NI1 B;  3UHD A;  4ETV A;  4DC8 A;  4N7P B;  2PGH B;  1BZZ B;  1KFR A;  2W72 A;  1HDS B;  5KDQ A;  5CN9 A;  4MQG A;  1JF4 A;  1X9F D;  2M6Z A;  1XYE A;  3KUN A;  2C7K B;  3LR9 A;  1ECN A;  4FC3 A;  4NI0 B;  2VEE A;  3UHZ A;  1XZU B;  3DUT B;  1M6C A;  1AJG A;  1QPW A;  1QI8 B;  2ZT1 A;  4ERV A;  1GDK A;  1VXC A;  1URY A;  1CP5 A;  4MXL A;  1GH0 A;  4IRO B;  5HU6 B;  4MBN A;  3UHK A;  4MPM A;  4O35 A;  2R80 B;  1V4X A;  4N6S A;  1A6M A;  1GLI B;  1RSE A;  1NS6 A;  1YVT A;  2V1J A;  4U8U B;  3SZK A;  1A00 B;  3UHT A;  2VJH B;  1Y7G B;  1MGN A;  2VLY A;  1JWN A;  102M A;  2RAO B;  1CLS B;  1A01 A;  3FH9 B;  1Y5F A;  2AUR A;  4OF9 A;  2Z6N A;  1DXU B;  1K0Y B;  1CBM A;  2EF2 A;  1YDZ A;  3RJ6 A;  1Y4F B;  2W6V A;  3ECZ A;  1PHN A;  4O2G A;  3A59 B;  108M A;  2GNW A;  3QJC A;  1Y4P A;  2W6W A;  3D7O B;  2G0X A;  2VRY A;  3GYS B;  4DWT A;  2GTL A;  2UUM B;  4F6F A;  3W4U B;  4HRR A;  1Y7Z A;  3S1I A;  5KER A;  3HHB A;  1J41 A;  3A2G A;  1LFL B;  3QQR A;  2AUO A;  2W6Y A;  1OUU A;  2WY4 A;  2MGG A;  2H8F B;  3UHR A;  1MLQ A;  3V57 B;  2ZLT B;  3HEP A;  1LFL A;  2ZSZ A;  2D2N C;  4HRR B;  3W4U A;  1Y4R B;  3UHW A;  4ESU A;  3PI8 B;  2UUM A;  1HHO B;  1K1K B;  1O1O B;  1S5Y A;  3GYS A;  4BJU A;  2HBF A;  3O89 A;  2ZST A;  1UFP A;  1YG5 A;  1RTX A;  1J3F A;  1Y4P B;  2OHA A;  5E83 B;  1HBA B;  2V1E A;  1UVL A;  1A3O A;  1GBV A;  2MGM A;  2VM0 A;  3L0F A;  2C7L A;  3LQD A;  1YDZ B;  2JL9 A;  4B3W A;  3WFU A;  1BBB B;  1Y22 A;  1K0Y A;  3UBC A;  3VRF B;  3LQ9 A;  2C7J A;  3PT8 B;  4F0U B;  5JOM A;  2ZSQ A;  2DKA A;  4C0N A;  4LMX B;  2D5Z A;  4X0L A;  3PT7 A;  3G46 A;  1C40 A;  4PQB A;  1F99 B;  2DN2 B;  2AA1 A;  4U8U A;  3SZK B;  1MYT A;  1Y85 B;  4N6S B;  1IBE A;  1FCS A;  1N9H A;  1X9F C;  1DTI A;  1I7Y B;  1ALL A;  5E29 B;  3RQR A;  3KUO A;  1SDK B;  3UHH A;  3UHV A;  4NK2 A;  4MQC B;  2VML A;  4NXA A;  4XXI A;  1GH0 B;  1OR6 A;  4KMW A;  1Y2Z B;  1O1I A;  1NY9 A;  2HBD A;  3CY5 A;  1YGD B;  1V07 A;  3DUT A;  1LH3 A;  2HZ3 A;  1XZ2 A;  1IBE B;  2D6C A;  4MQH A;  2FAL A;  3O2C B;  7HBI A;  1EBT A;  1JL7 A;  2Z85 A;  2D5Z B;  107M A;  1XZ2 B;  1EYX A;  1YHR A;  1URV A;  1J52 A;  1RH1 A;  2NSR A;  1A0U B;  4UUR A;  3CY5 B;  1YE0 A;  3GK9 A;  1O1I B;  4N7N A;  1SPE A;  1Y4Q B;  2MHB A;  1O1J B;  2VML B;  1SHR A;  2HHB B;  1NWN A;  2FRI X;  2ZT2 A;  5E29 A;  1ALL B;  3L0F B;  1GBV B;  1DLW A;  1DM1 A;  2MYC A;  1J3Y A;  1LH1 A;  1MLO A;  1SPG A;  1Y7C A;  3WCW C;  3G53 A;  2QSS B;  1LFV A;  3WI8 A;  1CPW A;  1S5Y B;  2ZS0 B;  3D17 B;  1YCA A;  1DXV B;  3ZJQ A;  3UHN A;  3FS4 B;  4XS0 A;  3AQ9 A;  3WCW B;  1MKO B;  1GCV A;  3ZJO A;  2VLX A;  4H07 A;  3NFE A;  1Y0A A;  2DKC A;  4A8O A;  1CQ2 A;  3MKB B;  4YU3 A;  1UFJ A;  1J41 B;  5KER B;  1HI0 P;  4ZIZ A;  1VXD A;  2PEG B;  2HZ2 A;  1OJ6 A;  4Z8K A;  1Y8H B;  1ABW A;  4G1B A;  4AE1 A;  1ON7 A;  1O1O A;  3V2V A;  2V8A B;  1MDT A;  1ABW B;  2VYY A;  1HRM A;  3LR7 A;  4WJG A;  1V4U B;  1FHJ A;  4Q70 B;  1HDA B;  3MJP B;  1PHN B;  3GQR B;  4O4T A;  1T1N B;  2VEB A;  1J40 B;  2GRH A;  1NEJ B;  1Y5F B;  1THB A;  1NS9 B;  1CH9 A;  3QJD A;  1DXV A;  2HZ1 A;  3VNC A;  2QSP B;  3WCT A;  3SDN A;  1HHT P;  1COL A;  1GLI A;  2GKM A;  5ILM A;  1V4X B;  1HV4 A;  3GOU B;  1FAW A;  1UT0 A;  3G4W A;  1SHR B;  1DXU A;  1O1J A;  5C6E B;  3QJE B;  4LM6 B;  1L2K A;  3UHC A;  3M38 A;  3UH5 A;  3PI2 A;  1YEV A;  1UX8 A;  5IKS A;  1IRC A;  2D2M A;  4TWU A;  2ZSS A;  2C7K A;  3ASE A;  2O5L X;  1JDO A;  1OR4 A;  3PI9 A;  1YH9 B;  3NML A;  3ARK A;  4WCH D;  4MQG B;  5M3S A;  3S48 C;  3BCQ B;  2YRS A;  1KD2 A;  5HU6 A;  3MWN A;  1HGB A;  5EET A;  4ZVB A;  3ZJP A;  1AJH A;  1MZ0 A;  1C7D A;  1RVW A;  4L1E A;  1G09 B;  1X3K A;  2R1H B;  4M4A A;  1O1L B;  1YZI B;  1MLR A;  2BMM A;  4FC3 B;  1Y85 A;  3PEL B;  2MBW A;  1LFZ A;  3ECX A;  105M A;  5CNE A;  3NL7 A;  1TU9 A;  1JF3 A;  1C40 B;  2O5B X;  4X0L B;  2DHB A;  1MOC A;  4DWU A;  5KDQ B;  1VRF A;  5EUI A;  112M A;  1O1N B;  1G9V B;  4F4O A;  3PT8 A;  3OJ1 A;  3VAU A;  2ZSR A;  3TLD A;  3D4X A;  1BBB A;  1Y22 B;  2LH2 A;  2BNL A;  3E55 A;  6HBW A;  2UUL H;  1RQA B;  1HJT A;  1YG5 B;  1TOX A;  2HBF B;  3D1A B;  3G4U A;  2ZSP A;  1HI8 A;  2Z6T A;  4FH6 A;  1M6M A;  3QMA A;  3ED9 A;  1HBR A;  2IG3 A;  106M A;  1NPG A;  1MWB A;  1IDR A;  1Y4R A;  2ZT4 A;  1GDJ A;  1F5O A;  1IT3 A;  1KTP A;  2B7H A;  5HAV A;  1HBH A;  1S0H B;  1X9F A;  1BAB A;  1U7S A;  1V9Q A;  1HAB B;  2EVK A;  5ILR A;  3PMC A;  1KN1 B;  5EE4 C;  1Y5K B;  2X4A A;  1KR7 A;  5E6E B;  3GQP B;  3GIO A;  1V4W A;  1Y46 B;  3CIU A;  1UVY A;  1Y4G B;  3B75 A;  1YHU B;  1LA6 B;  1JPB A;  2MGI A;  1LHT A;  2ZSX A;  4U8U D;  5HLX A;  4DC7 A;  1A0Z B;  3A59 A;  1UC3 A;  1MYJ A;  4TWV A;  1RQA A;  2ZS1 A;  1O1K B;  1LJW A;  3WCU A;  2QRW A;  4N7O B;  4H0M A;  1S6A A;  2ZFO C;  3LB2 A;  2FRJ X;  1DKE B;  4PNJ A;  1UMO A;  2GLN A;  1OUT A;  1UIW B;  2Z8A A;  3UHY A;  5KKK A;  2VJH A;  3GQG B;  1A4F B;  4A8W A;  2HBS A;  4B4Y A;  4MQI B;  2DHB B;  4ROL A;  4F0T B;  4NXC A;  4MQK A;  2O5S X;  3HRW A;  3O18 A;  2XYK A;  4F6J A;  5JGG A;  4HRT B;  1CIO A;  3A5B A;  3GLN A;  4GZG A;  1MBN A;  1HCO B;  4TYX A;  1CO8 A;  1MOA A;  2QFK A;  1RVW B;  2ZLV A;  4F6B A;  1XCH A;  2DN3 B;  1MLS A;  5F2A A;  1HCO A;  1MWD A;  3UHS A;  1S69 A;  5EOH A;  4NI0 A;  5EU2 A;  5CND A;  1DUK A;  1A6N A;  2XKG A;  3KMF A;  3HRW B;  3QM6 A;  3PI9 B;  1FDH G;  4F0T A;  1O1P A;  2LH1 A;  2HBS B;  1A4F A;  3GQG A;  1YVQ A;  1YOG A;  3DHT A;  3BJ3 B;  3BA2 A;  3QZX A;  4NI1 A;  1YEV B;  1YHU C;  2ZLX B;  1BZ0 A;  1ECO A;  1CG8 A;  1NPF A;  2NRM A;  3IA3 B;  1LJW B;  3G4V A;  2ZS1 B;  3HYU B;  5CN7 A;  3ZOL A;  1DWS A;  1G0A A;  1CH5 A;  2G3H A;  1HV4 B;  1J7Y B;  1Y5J B;  1VXF A;  3S65 B;  2D2N A;  1MBA A;  3G4Y A;  1YHU A;  3IC0 B;  1COH B;  2NX0 A;  2QSP A;  1Y0C A;  1OFJ A;  3BJ1 B;  2W72 C;  3E5I A;  1HBB A;  2SPL A;  1DXC A;  1VRE A;  1FDH A;  1J3Z A;  4ILZ A;  3ZJL A;  2VJR B;  1MLN A;  1RPS A;  1YIE B;  1NS9 A;  1R1Y A;  2SPM A;  1B8D A;  1MYM A;  2BV8 A;  1YFF A;  1DXT A;  1HBH B;  1S0H A;  3GQR A;  1QXD B;  1Y0D B;  3NG6 A;  1UVI A;  4L7Y A;  2HBC B;  3HXN B;  1FHJ B;  4Q70 A;  3NMM B;  3UI0 A;  4G51 A;  1XG0 C;  1XZ5 B;  1CH3 A;  3D1A A;  1MTI A;  1Y8H A;  1CBL A;  1MYZ A;  3WCP B;  4MAX A;  1ECA A;  5CN6 A;  1MTJ A;  1QXE A;  2FRK X;  2ZFB B;  4TMA B;  5CNB A;  3EOK B;  3P5Q B;  1M9P A;  1NQP B;  1O16 A;  3BJ2 B;  4ODC B;  2HHE B;  1QSH B;  2GDM A;  2LH6 A;  2QMB B;  2D2M D;  4JAC A;  1XY0 B;  3UH7 A;  4M4B B;  1LFY A;  4N8T B;  2MYE A;  2G0S A;  1NIH A;  4H2L A;  1XXT B;  3NL7 B;  5B84 A;  5SW7 B;  3ZJN A;  4NK1 A;  1LFZ B;  2XKH A;  1BZR A;  1LFV B;  1R1X A;  3LB3 A;  4A8S A;  1C7B A;  4O1T A;  1YOI A;  1J3Y B;  1SPG B;  3WHM A;  3VRG B;  1Y45 B;  2R1H A;  1XZV A;  3WCV C;  1YIH A;  1C7D B;  4L1E B;  2HHD B;  1IRD A;  3IC2 A;  4MQJ B;  1AJ9 A;  1AZI A;  1NIH B;  1Y7D A;  1HGB B;  2ZLU A;  2YRS B;  1YEU B;  1EBC A;  1Y4V A;  1A0U A;  2BLI A;  1Y01 B;  3AQ6 A;  3A5G A;  3MOU A;  1G08 B;  3MYM A;  4KMV A;  3O2C A;  3HF4 A;  1LFT A;  3GUQ A;  4FWZ A;  4A8Y A;  2D5X B;  2D2M B;  3GKT A;  1QXE B;  4GY3 A;  1JEB A;  3OGB A;  3SDH A;  1GCW A;  4GXE B;  3TM9 A;  2G0R A;  1V5H A;  2ZS0 C;  1CH4 A;  1LHS A;  1I3E A;  1VXG A;  4YU4 A;  1O1M A;  1FAW B;  3GOU A;  3NMM A;  3OZV A;  3OZU A;  2UUN A;  5AB8 A;  3S1J A;  2D60 B;  1DWT A;  2UUL D;  1JZK A;  2VLZ A;  2QFN A;  3ZJR A;  3H58 A;  5CN4 A;  1YHU D;  1CG5 A;  1EMY A;  3DBJ A;  4O4Z A;  1WMU A;  1YE2 A;  3BOM A;  1J3Z B;  1JBO B;  2VYW A;  2BWH A;  3QJB A;  2DXM B;  1YE2 B;  1WMU B;  1HBB B;  1IOP A;  1YGF B;  2ZWJ A;  1Y35 B;  1VXB A;  2O58 X;  3TM3 A;  3IC0 A;  3OVU C;  3EDA A;  3UHI A;  3DR9 A;  3D1K B;  2AV3 A;  2MGC A;  2D2N B;  3GKV B;  1FSX B;  3EU1 B;  2D60 A;  2QLS A;  1D8U A;  3MJP A;  3WR1 B;  3HYU A;  1IT2 A;  2W31 A;  1BZ6 A;  1F63 A;  4YU4 B;  1Y83 A;  1S56 A;  1A6K A;  1GCW B;  4GXE A;  3ZJJ A;  2ZS1 D;  2EB8 A;  1HSY A;  5CNG A;  2PEG A;  4GY3 B;  4ZIZ B;  1YVQ B;  4YU3 B;  3MKB A;  1HGC A;  2ZLT A;  1ABY A;  3MN0 A;  1G08 A;  3FS4 A;  1A9W A;  3ONZ A;  3HHB B;  1CPC B;  1YEO A;  1CIK A;  3OO5 B;  1Y7D B;  2ZLU B;  3UGZ A;  2D2N D;  1YEN A;  5ILP A;  1N9F A;  4LPI A;  5F0B A;  2QSS A;  1Y45 A;  2R4Z A;  1WAC A;  1DDT A;  3QJC B;  3ZJM A;  3WCV B;  4PQ6 A;  4U8U C;  1YEQ A;  4HRT A;  4ZVA A;  1G0B A;  3R5I B;  2EVP A;  2GL3 A;  2UUL A;  1Y4Q A;  4MQK B;  2DKD A;  4N7N B;  4F6G A;  1YE0 B;  1NZ5 A;  4M4B A;  1XY0 A;  2DC3 A;  1MBS A;  1YHR B;  3ZJS A;  1QSH A;  2HCO B;  2V1F A;  2HBE A;  4H0M B;  1NS6 B;  2DN1 B;  3WCU B;  3G4Q A;  3WCT C;  1J7W B;  1Y4B B;  3DHR A;  3ODQ B;  1MBI A;  1FSL A;  1A87 A;  1LH2 A;  3OZW A;  3GQP A;  5E6E A;  2G10 A;  1I7Y A;  1MWC A;  1QI8 A;  4L7Y B;  2OH8 A;  1QXD A;  1MLF A;  1MBD A;  1S5X B;  2BV8 B;  1J7S B;  1H97 A;  2MB5 A;  1BAB B;  4WJG 1;  2M6Z B;  1R1Y B;  1PBX A;  1BIN A;  5HY8 B;  1MYG A;  3HEN A;  1YHE A;  3BRP A;  4N7P A;  3K3U A;  3ZJH A;  2WCQ A;  3K8B A;  1Y0C B;  4KJT A;  2UUL C;  2R4W A;  3VRF A;  1MYH A;  1HBR B;  3K9Z A;  2C7L B;  4UIQ A;  1J7Y A;  1Y5J A;  1Z8U B;  2AUQ A;  5B13 A;  2QU0 A;  1JZM A;  2ZT3 A;  4YJJ A;  1C7C A;  111M A;  3PIA B;  1FN3 A;  2V1H A;  1HBA A;  5E83 A;  3RGK A;  1HDB A;  2QU0 B;  1HAC A;  5FVB A;  2ZS1 C;  2H35 A;  2MYB A;  1HHO A;  3PI3 A;  1MLU A;  3D4X B;  3PI8 A;  4KN3 A;  3RJN B;  2AUP A;  3K8B B;  1CO9 A;  1G9V A;  1O1N A;  3OO4 A;  1CH2 A;  1MYF A;  4NZI A;  3S66 B;  5CN5 A;  5EE4 D;  3EDB A;  1MBO A;  1MCY A;  1OUU B;  1J7S A;  1LIA A;  1MLH A;  1YZI A;  1Y7Z B;  1O1L A;  1IWH B;  1BVD A;  2ZT0 A;  1DO1 A;  2DN3 A;  1HA7 A;  1RQ3 B;  4A8K A;  4ERT A;  2ZLV B;  1EWA A;  1KD2 B;  3D7O A;  2V1I A;  2BLJ M;  1XQ5 A;  3MJU A;  1JZL A;  2VYZ A;  2GNV A;  2LHB A;  109M A;  1SDL B;  2Z6N B;  2HBE B;  4ROL B;  3FH9 A;  1CLS A;  2LH7 A;  2E2Y A;  3ZJI A;  4ETU A;  3WFX A;  1CH1 A;  1BZP A;  3H57 A;  4XDI A;  1DKE A;  5EYS A;  1A00 A;  3O7N A;  2UUL B;  1VXA A;  1XZ4 B;  3MJU B;  101M A;  1Y0W A;  1O1K A;  4ESA B;  2LH5 A;  4AE0 A;  1CP0 A;  5EV5 A;  1A0Z A;  1XZ4 A;  2MGB A;  1LH6 A;  4IRO A;  3B75 B;  2IN4 A;  1MNK A;  1Y4G A;  1XZ7 A;  2BKM A;  2O5T X;  2X49 A;  1NZ2 A;  1W92 A;  3QJD B;  3MVC A;  1Y5K A;  5ILE A;  2G0Z A;  2OHB A;  1KN1 A;  4B02 A;  1MTK A;  2GTL D;  1T1N A;  3WFT A;  1XQ5 B;  1YMB A;  2W72 B;  2XKI A;  1BZZ A;  3OO4 B;  3V2Z A;  5CNF A;  3VHB A;  2KSC A;  4NS2 A;  2V8A A;  1GBU A;  1RQ3 A;  2H35 B;  1HA7 B;  1ECD A;  5EQM A;  1B33 A;  1IWH A;  1HAC B;  4VHB A;  1FN3 B;  2JLG A;  1C7C B;  1JL6 A;  3PIA A;  5MBN A;  1GJN A;  5CN8 A;  5D5R A;  3WR1 A;  1BIJ A;  1HBS A;  3EU1 A;  1Y31 B;  3GKV A;  1Y0A B;  4XXK A;  3NFE B;  1GCV B;  1MKO A;  4RMP A;  2UUM X;  3S66 A;  1YHE B;  3BRP B;  1CII A;  3UH6 A;  1YMA A;  3BOM B;  3WCV D;  4AVD A;  1LFQ A;  3DBJ B;  4RMP B;  1NXF A;  2ZS0 A;  1MOD A;  5CNC A;  1Y31 A;  1OBM A;  1BIJ B;  1ABS A;  1SWM A;  4YJJ B;  2WCR A;  1DXD A;  1DO7 A;  1HLB A;  4SDH A;  3UHQ A;  3OK5 A;  1A6G A;  2R4X A;  3PI4 A;  5CHR A;  3ORD A;  3ODQ A;  3BCQ A;  1JEB B;  1GVH A;  1ASH A;  3DHR B;  4HSW A;  5D1V A;  2GTL C;  5JDO F;  3WTG B;  1EYX B;  1MNH A;  1YH9 A;  1LFT B;  3HF4 B;  2LH3 A;  2HCO A;  1SI4 B;  4MQH B;  1BVC A;  1N9I A;  1XF6 C;  3HC9 A;  2HBD B;  1XZ7 B;  1NZ4 A;  3M3A A;  2MYA A;  1MBC A;  4A8F A;  3QJE A;  2MGK A;  1AJ9 B;  4PO5 A;  1S61 A;  3R5I A;  1DO4 A;  1SDK A;  1YEQ B;  2H8D A;  4PQC A;  4BS9 A;  3WHM B;  1J7W A;  4MU5 A;  2DN1 A;  1QSI B;  2MGA A;  4H2L B;  3PT7 B;  2NSS A;  3PI1 A;  3OO5 A;  1RQ4 A;  1LFY B;  4N8T A;  1MLK A;  4A8M P;  2V1K A;  2QMB A;  3QM9 A;  3AT5 A;  2VJT A;  2C7J B;  1THB B;  4F0U A;  1JP9 A;  4ODC A;  1MNI A;  3GDJ A;  1SDL A;  2W6X A;  3UGY A;  1J40 A;  1NQP A;  1G0B B;  4C44 A;  1HI1 A;  104M A;  1HGC B;  1VXE A;  1A3O B;  3KVS A;  1HDA A;  1YOH A;  3G4R A;  1JY7 B;  2EB9 A;  4F68 A;  1YEN B;  1HLM A;  1ON7 B;  3WCU D;  3VRE A;  2ZFO D;  3UBV A;  1A9W E;  5HLU A;  4Z8K B;  4HH0 A;  1NAZ A;  1CPC A;  3AQ7 A;  1WVP A;  3NG6 B;  2QLS B;  1YMC A;  1GZX B;  4MBA A;  4A8Q A;  1EW6 A;  1DXT B;  2GRF A;  1A3N A;  3D1K A;  2H8F A;  2ZSO A;  1UVX A;  3LHB A;  1HBI A;  3UHB A;  4XS0 B;  1YIE A;  1PMB A;  1RPS B;  2DXM A;  3QJB B;  4JYQ A;  2BW9 M;  1H1X A;  3D17 A;  5AQD M;  1Y8W A;  3WCT D;  1Y83 B;  3MYN A;  4ETT A;  2AV0 A;  1HDB B;  3S65 A;  1Y7C B;  1MOB A;  1DTM A;  2RI4 A;  3QM7 A;  1Y4F A;  2W6V B;  2MGE A;  3U3E A;  2R4Y A;  3M3B A;  3A5A A; 
#chains in the Genus database with same CATH homology
 1Y8W B;  1BZ0 B;  1Y7G A;  1B86 B;  1VWT A;  5HY8 A;  1PBX B;  1CG5 B;  2Z6S A;  3UHU A;  1JP8 A;  1YVT B;  4G1V A;  1GDL A;  1A3N B;  1NGK A;  2EKU A;  1S5X A;  1VXH A;  1GZX A;  2R80 A;  1YGD A;  3ZOM A;  1Y4V B;  1YEU A;  1Y2Z A;  1U7R A;  1B0B A;  1YCB A;  4MQC A;  1IRD B;  2C0K A;  3IC2 B;  1Y8K A;  4FWY A;  4OOD A;  1NWI A;  1Y0T A;  1YIH B;  2OIF A;  3AQ8 A;  1QPW B;  1Y4B A;  2OH9 A;  2D5X A;  1DUO A;  5EYJ A;  6HBI A;  2AA1 B;  2DN2 A;  3UHG A;  4BJA A;  1XXT A;  3GDJ B;  3R0G A;  1GDI A;  5AZR A;  1HDS A;  4QAU A;  1DLY A;  1WLA A;  3UH3 A;  1MLG A;  2HHE A;  1OUT B;  1MNO A;  1BZ1 B;  1MLM A;  2MYD A;  3LQD B;  5B85 A;  3P5Q A;  3MBA A;  1XZV B;  2ZFB A;  3WCV A;  4FWX A;  3LB1 A;  4FH7 A;  1Y0T B;  1Q1F A;  1DO3 A;  2O5M X;  1Y8K B;  5SW7 A;  1K1K A;  2ZSN A;  5CMV A;  2BLH A;  1CQX A;  1Y46 A;  3CIU B;  4G51 B;  1V4W B;  3QZZ A;  2R50 A;  1YEO B;  3HXN A;  3ONZ B;  3G52 A;  1Y0D A;  3HEO A;  2WTG A;  3BJ2 A;  4HBI A;  1ABY B;  2VHB A;  3QM8 A;  1B86 A;  1VWT B;  2GRZ A;  3WCP A;  2GTL B;  4UZV A;  1FLP A;  1COH A;  1XZ5 A;  2FAM A;  1UX9 A;  5JDO E;  2RI4 B;  1JW8 A;  2JHO A;  1VHB A;  2EKT A;  1FSX A;  1MOH A;  2D2M C;  3ZHW A;  2SPO A;  4HSX A;  1A01 B;  1Y35 A;  1YGF A;  110M A;  1LFQ B;  2RAO A;  2G0V A;  1I3D A;  4F4O B;  2HBG A;  3A0G A;  3BJ3 A;  4AVE A;  3DHT B;  5HBI A;  2NRL A;  1Y09 B;  1HBS B;  1OFK A;  2WTH A;  4F69 A;  1JP6 A;  4ROM A;  1MYI A;  4IT8 A;  1LH7 A;  1BUW B;  4MXK A;  1O1M B;  5C6Y A;  3VRE B;  1CMY B;  1CG8 B;  1NZ3 A;  1JY7 A;  2ZLX A;  2ZSY A;  5JDO D;  4H0B A;  1XZU A;  3QQQ A;  3ZH0 A;  1O1P B;  4L2M A;  3IXF A;  1X46 A;  1XYE B;  2MGJ A;  1N9X A;  2GKN A;  1CH7 A;  5HLQ A;  4MQI A;  3AT5 B;  103M A;  2PGH A;  2MGF A;  3ARL A;  1RQ4 B;  3AT6 A;  1UIW A;  4MQJ A;  1CMY A;  5C6E A;  2G12 A;  3A9M A;  2HHD A;  1QSI A;  3E5O A;  3WCU C;  1MLJ A;  2ZLW B;  4N7O A;  3VRG A;  1BUW A;  1V75 B;  4ROM B;  1C7B B;  1R1X B;  2H8D B;  4ESA A;  4F6D A;  1Y0W B;  3ECL A;  5JGG B;  2MGL A;  5CHQ A;  1LA6 A;  1DWR A;  1Y09 A;  3WCT B;  4HHB B;  2BK9 A;  2O5O X;  3A0G B;  4F6I A;  1LTW A;  1HGA A;  2G14 A;  1SI4 A;  1LH5 A;  1HAB A;  3UHE A;  3UHX A;  1NEJ A;  1M9P B;  2ZFO A;  3EOK A;  2SPN A;  1RTE A;  1F65 A;  3WTG A;  1Y8I A;  1V4U A;  5JDO C;  1MLL A;  2O5Q X;  3KMF C;  1Y8I B;  2HBC A;  1MDN A;  1MNJ A;  1F5P A;  2FRF A;  1YFF B;  1LUE A;  2ZFO B;  3AQ5 A;  1X9F B;  3WCW A;  1HGA B;  2MGD A;  2B7H B;  2G11 A;  1BJE A;  2OLP A;  2V1G A;  5EUI B;  3AG0 A;  3LB4 A;  3BJ1 A;  3WFW A;  4HHB A;  3ARJ A;  2ZS0 D;  3E4N A;  2CMM A;  3PEL A;  3QM5 A;  1G0A B;  2MGH A;  1V75 A;  5AZQ A;  6HBW B;  1TES A;  4M4A B;  1HBG A;  1G09 A;  3WCW D;  2ZLW A;  5MBA A;  2HHB A;  1BZ1 A;  3M39 A;  1ITH A;  2MHB B;  1GBU B;  3AT6 B;  4NI1 B;  3UHD A;  4DC8 A;  4N7P B;  2PGH B;  1BZZ B;  1KFR A;  2W72 A;  1HDS B;  5KDQ A;  5CN9 A;  4MQG A;  1JF4 A;  1X9F D;  2M6Z A;  1XYE A;  3KUN A;  3LR9 A;  1ECN A;  4FC3 A;  4NI0 B;  2VEE A;  3UHZ A;  1XZU B;  3DUT B;  1M6C A;  1AJG A;  1QPW A;  1QI8 B;  2ZT1 A;  1GDK A;  1VXC A;  1URY A;  1CP5 A;  4MXL A;  4IRO B;  5HU6 B;  4MBN A;  3UHK A;  4MPM A;  4O35 A;  2R80 B;  1V4X A;  1A6M A;  1GLI B;  1RSE A;  1NS6 A;  1YVT A;  2V1J A;  4U8U B;  3SZK A;  1A00 B;  3UHT A;  1Y7G B;  1MGN A;  2VLY A;  1JWN A;  102M A;  2RAO B;  1CLS B;  1A01 A;  3FH9 B;  1Y5F A;  2AUR A;  4OF9 A;  2Z6N A;  1DXU B;  1K0Y B;  1CBM A;  2EF2 A;  1YDZ A;  3RJ6 A;  1Y4F B;  2W6V A;  3ECZ A;  4O2G A;  3A59 B;  108M A;  2GNW A;  3QJC A;  1Y4P A;  2W6W A;  3D7O B;  2G0X A;  2VRY A;  3GYS B;  4DWT A;  2GTL A;  4F6F A;  3W4U B;  4HRR A;  1Y7Z A;  3S1I A;  5KER A;  3HHB A;  1J41 A;  3A2G A;  1LFL B;  3QQR A;  2AUO A;  2W6Y A;  1OUU A;  2WY4 A;  2MGG A;  2H8F B;  3UHR A;  1MLQ A;  2ZLT B;  3HEP A;  1LFL A;  2ZSZ A;  2D2N C;  4HRR B;  3W4U A;  1Y4R B;  3UHW A;  3PI8 B;  1HHO B;  1K1K B;  1O1O B;  1S5Y A;  3GYS A;  2HBF A;  3O89 A;  2ZST A;  1UFP A;  1YG5 A;  1RTX A;  1J3F A;  1Y4P B;  2OHA A;  5E83 B;  1HBA B;  2V1E A;  1A3O A;  1GBV A;  2MGM A;  2VM0 A;  3LQD A;  1YDZ B;  4B3W A;  3WFU A;  1BBB B;  1Y22 A;  1K0Y A;  3UBC A;  3VRF B;  3PT8 B;  5JOM A;  2ZSQ A;  4C0N A;  2D5Z A;  4X0L A;  3PT7 A;  3G46 A;  1C40 A;  4PQB A;  2DN2 B;  2AA1 A;  4U8U A;  3SZK B;  1MYT A;  1Y85 B;  1IBE A;  1FCS A;  1N9H A;  1X9F C;  1DTI A;  5E29 B;  3KUO A;  1SDK B;  3UHH A;  3UHV A;  4NK2 A;  4MQC B;  4NXA A;  1OR6 A;  4KMW A;  1Y2Z B;  1O1I A;  2HBD A;  3CY5 A;  1YGD B;  1V07 A;  3DUT A;  1LH3 A;  2HZ3 A;  1XZ2 A;  1IBE B;  2D6C A;  4MQH A;  2FAL A;  7HBI A;  1EBT A;  1JL7 A;  2Z85 A;  2D5Z B;  107M A;  1XZ2 B;  1YHR A;  1URV A;  1J52 A;  2NSR A;  1A0U B;  4UUR A;  3CY5 B;  1YE0 A;  3GK9 A;  1O1I B;  4N7N A;  1SPE A;  1Y4Q B;  2MHB A;  1O1J B;  1SHR A;  2HHB B;  1NWN A;  2FRI X;  2ZT2 A;  5E29 A;  1GBV B;  1DLW A;  1DM1 A;  2MYC A;  1J3Y A;  1LH1 A;  1MLO A;  1SPG A;  1Y7C A;  3WCW C;  3G53 A;  2QSS B;  1LFV A;  3WI8 A;  1CPW A;  1S5Y B;  2ZS0 B;  3D17 B;  1YCA A;  1DXV B;  3ZJQ A;  3UHN A;  3FS4 B;  4XS0 A;  3AQ9 A;  3WCW B;  1MKO B;  1GCV A;  3ZJO A;  2VLX A;  4H07 A;  3NFE A;  1Y0A A;  1CQ2 A;  3MKB B;  4YU3 A;  1UFJ A;  1J41 B;  5KER B;  1VXD A;  2PEG B;  2HZ2 A;  1OJ6 A;  1Y8H B;  1ABW A;  4G1B A;  1O1O A;  3V2V A;  1ABW B;  2VYY A;  1HRM A;  3LR7 A;  4WJG A;  1V4U B;  1FHJ A;  1HDA B;  3MJP B;  3GQR B;  4O4T A;  1T1N B;  2VEB A;  1J40 B;  2GRH A;  1NEJ B;  1Y5F B;  1THB A;  1NS9 B;  1CH9 A;  3QJD A;  1DXV A;  2HZ1 A;  2QSP B;  3WCT A;  3SDN A;  1GLI A;  2GKM A;  5ILM A;  1V4X B;  1HV4 A;  3GOU B;  1FAW A;  1UT0 A;  3G4W A;  1SHR B;  1DXU A;  1O1J A;  5C6E B;  3QJE B;  1L2K A;  3UHC A;  3M38 A;  3UH5 A;  3PI2 A;  1YEV A;  1UX8 A;  5IKS A;  1IRC A;  2D2M A;  4TWU A;  2ZSS A;  3ASE A;  2O5L X;  1JDO A;  1OR4 A;  3PI9 A;  1YH9 B;  3NML A;  3ARK A;  4WCH D;  4MQG B;  5M3S A;  3S48 C;  3BCQ B;  2YRS A;  1KD2 A;  5HU6 A;  1HGB A;  5EET A;  4ZVB A;  3ZJP A;  1AJH A;  1MZ0 A;  1C7D A;  1RVW A;  1G09 B;  1X3K A;  2R1H B;  4M4A A;  1O1L B;  1YZI B;  1MLR A;  2BMM A;  4FC3 B;  1Y85 A;  3PEL B;  2MBW A;  1LFZ A;  3ECX A;  105M A;  5CNE A;  3NL7 A;  1TU9 A;  1JF3 A;  1C40 B;  2O5B X;  4X0L B;  2DHB A;  1MOC A;  4DWU A;  5KDQ B;  1VRF A;  5EUI A;  112M A;  1O1N B;  1G9V B;  4F4O A;  3PT8 A;  3OJ1 A;  3VAU A;  2ZSR A;  3TLD A;  3D4X A;  1BBB A;  1Y22 B;  2LH2 A;  2BNL A;  3E55 A;  6HBW A;  1RQA B;  1HJT A;  1YG5 B;  2HBF B;  3D1A B;  3G4U A;  2ZSP A;  2Z6T A;  4FH6 A;  1M6M A;  3QMA A;  3ED9 A;  1HBR A;  2IG3 A;  106M A;  1NPG A;  1MWB A;  1IDR A;  1Y4R A;  2ZT4 A;  1GDJ A;  1F5O A;  1IT3 A;  2B7H A;  5HAV A;  1HBH A;  1S0H B;  1X9F A;  1BAB A;  1U7S A;  1V9Q A;  1HAB B;  2EVK A;  5ILR A;  5EE4 C;  1Y5K B;  1KR7 A;  5E6E B;  3GQP B;  1V4W A;  1Y46 B;  3CIU A;  1UVY A;  1Y4G B;  3B75 A;  1YHU B;  1LA6 B;  1JPB A;  2MGI A;  1LHT A;  2ZSX A;  4U8U D;  5HLX A;  4DC7 A;  1A0Z B;  3A59 A;  1UC3 A;  1MYJ A;  4TWV A;  1RQA A;  2ZS1 A;  1O1K B;  1LJW A;  3WCU A;  2QRW A;  4N7O B;  1S6A A;  2ZFO C;  3LB2 A;  2FRJ X;  1DKE B;  4PNJ A;  1UMO A;  2GLN A;  1OUT A;  1UIW B;  2Z8A A;  3UHY A;  5KKK A;  3GQG B;  1A4F B;  2HBS A;  4B4Y A;  4MQI B;  2DHB B;  4ROL A;  4NXC A;  4MQK A;  2O5S X;  3HRW A;  2XYK A;  4F6J A;  5JGG A;  4HRT B;  1CIO A;  3A5B A;  3GLN A;  4GZG A;  1MBN A;  1HCO B;  4TYX A;  1CO8 A;  1MOA A;  2QFK A;  1RVW B;  2ZLV A;  4F6B A;  1XCH A;  2DN3 B;  1MLS A;  5F2A A;  1HCO A;  1MWD A;  3UHS A;  1S69 A;  5EOH A;  4NI0 A;  5EU2 A;  5CND A;  1DUK A;  1A6N A;  2XKG A;  3KMF A;  3HRW B;  3QM6 A;  3PI9 B;  1FDH G;  1O1P A;  2LH1 A;  2HBS B;  1A4F A;  3GQG A;  1YVQ A;  1YOG A;  3DHT A;  3BJ3 B;  3BA2 A;  3QZX A;  4NI1 A;  1YEV B;  1YHU C;  2ZLX B;  1BZ0 A;  1ECO A;  1CG8 A;  1NPF A;  2NRM A;  3IA3 B;  1LJW B;  3G4V A;  2ZS1 B;  3HYU B;  5CN7 A;  3ZOL A;  1DWS A;  1G0A A;  1CH5 A;  2G3H A;  1HV4 B;  1J7Y B;  1Y5J B;  1VXF A;  3S65 B;  2D2N A;  1MBA A;  3G4Y A;  1YHU A;  3IC0 B;  1COH B;  2NX0 A;  2QSP A;  1Y0C A;  1OFJ A;  3BJ1 B;  2W72 C;  3E5I A;  1HBB A;  2SPL A;  1DXC A;  1VRE A;  1FDH A;  1J3Z A;  4ILZ A;  3ZJL A;  1MLN A;  1RPS A;  1YIE B;  1NS9 A;  1R1Y A;  2SPM A;  1MYM A;  1YFF A;  1DXT A;  1HBH B;  1S0H A;  3GQR A;  1QXD B;  1Y0D B;  3NG6 A;  4L7Y A;  2HBC B;  3HXN B;  1FHJ B;  3NMM B;  3UI0 A;  4G51 A;  1XZ5 B;  1CH3 A;  3D1A A;  1MTI A;  1Y8H A;  1CBL A;  1MYZ A;  3WCP B;  4MAX A;  1ECA A;  5CN6 A;  1MTJ A;  1QXE A;  2FRK X;  2ZFB B;  5CNB A;  3EOK B;  3P5Q B;  1M9P A;  1NQP B;  1O16 A;  3BJ2 B;  4ODC B;  2HHE B;  1QSH B;  2GDM A;  2LH6 A;  2QMB B;  2D2M D;  4JAC A;  1XY0 B;  3UH7 A;  4M4B B;  1LFY A;  4N8T B;  2MYE A;  2G0S A;  1NIH A;  4H2L A;  1XXT B;  3NL7 B;  5B84 A;  5SW7 B;  3ZJN A;  4NK1 A;  1LFZ B;  2XKH A;  1BZR A;  1LFV B;  1R1X A;  3LB3 A;  1C7B A;  4O1T A;  1YOI A;  1J3Y B;  1SPG B;  3WHM A;  3VRG B;  1Y45 B;  2R1H A;  1XZV A;  3WCV C;  1YIH A;  1C7D B;  2HHD B;  1IRD A;  3IC2 A;  4MQJ B;  1AJ9 A;  1AZI A;  1NIH B;  1Y7D A;  1HGB B;  2ZLU A;  2YRS B;  1YEU B;  1EBC A;  1Y4V A;  1A0U A;  2BLI A;  1Y01 B;  3AQ6 A;  3A5G A;  3MOU A;  1G08 B;  3MYM A;  4KMV A;  3HF4 A;  1LFT A;  4FWZ A;  2D5X B;  2D2M B;  3GKT A;  1QXE B;  1JEB A;  3OGB A;  3SDH A;  1GCW A;  3TM9 A;  2G0R A;  1V5H A;  2ZS0 C;  1CH4 A;  1LHS A;  1I3E A;  1VXG A;  4YU4 A;  1O1M A;  1FAW B;  3GOU A;  3NMM A;  3OZV A;  3OZU A;  5AB8 A;  3S1J A;  2D60 B;  1DWT A;  1JZK A;  2VLZ A;  2QFN A;  3ZJR A;  3H58 A;  5CN4 A;  1YHU D;  1CG5 A;  1EMY A;  4O4Z A;  1WMU A;  1YE2 A;  3BOM A;  1J3Z B;  2VYW A;  2BWH A;  3QJB A;  2DXM B;  1YE2 B;  1WMU B;  1HBB B;  1IOP A;  1YGF B;  2ZWJ A;  1Y35 B;  1VXB A;  2O58 X;  3TM3 A;  3IC0 A;  3OVU C;  3EDA A;  3UHI A;  3DR9 A;  3D1K B;  2AV3 A;  2MGC A;  2D2N B;  3GKV B;  1FSX B;  3EU1 B;  2D60 A;  2QLS A;  1D8U A;  3MJP A;  3WR1 B;  3HYU A;  1IT2 A;  2W31 A;  1BZ6 A;  1F63 A;  4YU4 B;  1Y83 A;  1S56 A;  1A6K A;  1GCW B;  3ZJJ A;  2ZS1 D;  2EB8 A;  1HSY A;  5CNG A;  2PEG A;  1YVQ B;  4YU3 B;  3MKB A;  1HGC A;  2ZLT A;  1ABY A;  3MN0 A;  1G08 A;  3FS4 A;  1A9W A;  3ONZ A;  3HHB B;  1YEO A;  1CIK A;  3OO5 B;  1Y7D B;  2ZLU B;  3UGZ A;  2D2N D;  1YEN A;  5ILP A;  1N9F A;  4LPI A;  5F0B A;  2QSS A;  1Y45 A;  2R4Z A;  3QJC B;  3ZJM A;  3WCV B;  4PQ6 A;  4U8U C;  1YEQ A;  4HRT A;  4ZVA A;  1G0B A;  3R5I B;  2EVP A;  2GL3 A;  1Y4Q A;  4MQK B;  4N7N B;  4F6G A;  1YE0 B;  1NZ5 A;  4M4B A;  1XY0 A;  2DC3 A;  1MBS A;  1YHR B;  3ZJS A;  1QSH A;  2HCO B;  2V1F A;  2HBE A;  1NS6 B;  2DN1 B;  3WCU B;  3G4Q A;  3WCT C;  1J7W B;  1Y4B B;  3DHR A;  3ODQ B;  1MBI A;  1FSL A;  1LH2 A;  3OZW A;  3GQP A;  5E6E A;  2G10 A;  1MWC A;  1QI8 A;  4L7Y B;  2OH8 A;  1QXD A;  1MLF A;  1MBD A;  1S5X B;  1J7S B;  1H97 A;  2MB5 A;  1BAB B;  4WJG 1;  2M6Z B;  1R1Y B;  1PBX A;  1BIN A;  5HY8 B;  1MYG A;  3HEN A;  1YHE A;  4N7P A;  3K3U A;  3ZJH A;  3K8B A;  1Y0C B;  4KJT A;  2R4W A;  3VRF A;  1MYH A;  1HBR B;  3K9Z A;  4UIQ A;  1J7Y A;  1Y5J A;  1Z8U B;  2AUQ A;  2QU0 A;  1JZM A;  2ZT3 A;  1C7C A;  111M A;  3PIA B;  1FN3 A;  2V1H A;  1HBA A;  5E83 A;  3RGK A;  1HDB A;  2QU0 B;  1HAC A;  2ZS1 C;  2H35 A;  2MYB A;  1HHO A;  3PI3 A;  1MLU A;  3D4X B;  3PI8 A;  4KN3 A;  3RJN B;  2AUP A;  3K8B B;  1CO9 A;  1G9V A;  1O1N A;  3OO4 A;  1CH2 A;  1MYF A;  4NZI A;  3S66 B;  5CN5 A;  5EE4 D;  3EDB A;  1MBO A;  1MCY A;  1OUU B;  1J7S A;  1MLH A;  1YZI A;  1Y7Z B;  1O1L A;  1IWH B;  1BVD A;  2ZT0 A;  1DO1 A;  2DN3 A;  1RQ3 B;  2ZLV B;  1EWA A;  1KD2 B;  3D7O A;  2V1I A;  2BLJ M;  1XQ5 A;  3MJU A;  1JZL A;  2VYZ A;  2GNV A;  2LHB A;  109M A;  1SDL B;  2Z6N B;  2HBE B;  4ROL B;  3FH9 A;  1CLS A;  2LH7 A;  2E2Y A;  3ZJI A;  3WFX A;  1CH1 A;  1BZP A;  3H57 A;  4XDI A;  1DKE A;  5EYS A;  1A00 A;  3O7N A;  1VXA A;  1XZ4 B;  3MJU B;  101M A;  1Y0W A;  1O1K A;  4ESA B;  2LH5 A;  1CP0 A;  5EV5 A;  1A0Z A;  1XZ4 A;  2MGB A;  1LH6 A;  4IRO A;  3B75 B;  2IN4 A;  1MNK A;  1Y4G A;  1XZ7 A;  2BKM A;  2O5T X;  1NZ2 A;  1W92 A;  3QJD B;  3MVC A;  1Y5K A;  5ILE A;  2G0Z A;  2OHB A;  1MTK A;  2GTL D;  1T1N A;  3WFT A;  1XQ5 B;  1YMB A;  2W72 B;  2XKI A;  1BZZ A;  3OO4 B;  3V2Z A;  5CNF A;  3VHB A;  2KSC A;  4NS2 A;  1GBU A;  1RQ3 A;  2H35 B;  1ECD A;  5EQM A;  1IWH A;  1HAC B;  4VHB A;  1FN3 B;  1C7C B;  1JL6 A;  3PIA A;  5MBN A;  1GJN A;  5CN8 A;  5D5R A;  3WR1 A;  1BIJ A;  1HBS A;  3EU1 A;  1Y31 B;  3GKV A;  1Y0A B;  3NFE B;  1GCV B;  1MKO A;  3S66 A;  1YHE B;  3UH6 A;  1YMA A;  3BOM B;  3WCV D;  4AVD A;  1LFQ A;  1NXF A;  2ZS0 A;  1MOD A;  5CNC A;  1Y31 A;  1OBM A;  1BIJ B;  1ABS A;  1SWM A;  1DXD A;  1DO7 A;  1HLB A;  4SDH A;  3UHQ A;  3OK5 A;  1A6G A;  2R4X A;  3PI4 A;  5CHR A;  3ORD A;  3ODQ A;  3BCQ A;  1JEB B;  1GVH A;  1ASH A;  3DHR B;  4HSW A;  5D1V A;  2GTL C;  5JDO F;  3WTG B;  1MNH A;  1YH9 A;  1LFT B;  3HF4 B;  2LH3 A;  2HCO A;  1SI4 B;  4MQH B;  1BVC A;  1N9I A;  3HC9 A;  2HBD B;  1XZ7 B;  1NZ4 A;  3M3A A;  2MYA A;  1MBC A;  3QJE A;  2MGK A;  1AJ9 B;  1S61 A;  3R5I A;  1DO4 A;  1SDK A;  1YEQ B;  2H8D A;  4PQC A;  3WHM B;  1J7W A;  4MU5 A;  2DN1 A;  1QSI B;  2MGA A;  4H2L B;  3PT7 B;  2NSS A;  3PI1 A;  3OO5 A;  1RQ4 A;  1LFY B;  4N8T A;  1MLK A;  2V1K A;  2QMB A;  3AT5 A;  3QM9 A;  1THB B;  1JP9 A;  4ODC A;  1MNI A;  3GDJ A;  1SDL A;  2W6X A;  3UGY A;  1J40 A;  1NQP A;  1G0B B;  4C44 A;  104M A;  1HGC B;  1VXE A;  1A3O B;  1HDA A;  1YOH A;  3G4R A;  1JY7 B;  2EB9 A;  4F68 A;  1YEN B;  1HLM A;  3WCU D;  3VRE A;  2ZFO D;  3UBV A;  1A9W E;  5HLU A;  1NAZ A;  3AQ7 A;  1WVP A;  3NG6 B;  2QLS B;  1YMC A;  1GZX B;  4MBA A;  1EW6 A;  1DXT B;  2GRF A;  1A3N A;  3D1K A;  2H8F A;  2ZSO A;  1UVX A;  3LHB A;  1HBI A;  3UHB A;  4XS0 B;  1YIE A;  1PMB A;  1RPS B;  2DXM A;  3QJB B;  4JYQ A;  2BW9 M;  1H1X A;  3D17 A;  1Y8W A;  3WCT D;  1Y83 B;  3MYN A;  2AV0 A;  1HDB B;  3S65 A;  1Y7C B;  1MOB A;  1DTM A;  2RI4 A;  3QM7 A;  1Y4F A;  2W6V B;  2MGE A;  3U3E A;  2R4Y A;  3M3B A;  3A5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...