2G4LA

Anomalous substructure of hydroxynitrile lyase
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
256
structure length
255
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
molecule tags Lyase
molecule keywords (S)-acetone-cyanohydrin lyase
total genus 96
structure length 255
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2g4lA00
3D2BA 2XUPA 2GYUA 1U65A 5AI6A 5ALXA 3DL4A 4H7KA 5DLPA 3MGAA 4EZIA 2OAEA 4A5SA 4DMCA 2IIVA 2Z8XA 5DTJA 4UBNA 4OB6A 1CUCA 2NW6A 2XMQA 3I2GA 5E4TA 3IULA 3WKBA 5CBKA 5HQ3B 1XRQA 1IVYA 2ACKA 5AJHA 4Q82A 1SC9A 5FDFA 1RP1A 2GZSA 4KAFA 5IKXA 1WB6A 3WZLA 5JAHA 3QPAA 4Y2VA 4OB8A 4CI9A 4IHAA 4CG1A 2JEYA 3C87A 4GWLA 4MJ3A 3FOBA 5DNVA 5LKAA 2ZYHA 2PVSA 3BE8A 5ALTA 1CQWA 1QIJA 1ISPA 2ZYIA 1G5FA 4U2EA 4BC1A 4C4XA 1LPSA 1JI3A 4RGYA 4MYDA 3HABA 4J0HA 5AOAA 5AKGA 5ALOA 5K3FA 2QOEA 1VXRA 1DWPA 1XRMA 5AM3A 1R1DA 5LZ2A 4JEIA 3U1TA 4XWGA 3T52A 1XRLA 2OQVA 3ZLUA 4GHWA 1SCKA 1IMJA 1HDEA 4G4IA 4OYLA 1CR6A 1W75A 4G4GA 4P08A 3WKAA 3C6YA 2YASA 4B81A 3WZMA 1DQZA 4EY5A 3G9TA 1THGA 3DEAA 4UUQA 5JANA 3DS8A 5KREA 3DKKA 3FAKA 2XB6A 4DGQA 2XUFA 2Y6VA 5ALVA 2Y6UA 2CKMA 4EY4A 5AM0A 4HVTA 1B6GA 5CT5A 4MQMA 4AXBA 4H77A 5ALMA 1MJ5A 2WKWA 2QJRA 1QIFA 5AM5A 3BJMA 3G9UA 1EK1A 4AQDA 1CIJA 1UFOA 3DDUA 4X6XA 4HXGA 4DIUA 2HA3A 4J0KA 4Q3LA 2Z8ZA 2JGMA 4HZGA 1ODCA 5AO9A 4P9NA 4FKBA 1DWQA 2JGEA 1UXOA 1QE3A 2PSFA 5AOBA 5FLKA 1FSSA 4B9EA 3G0DA 1JJBA 5AKEA 5JAPA 4U2DA 1ZOIA 4S0XA 5AP9A 1LGYA 1UWCA 3RM3A 3DLTA 1QIDA 4GW3A 1UZAA 2HADA 1C7IA 1WPRA 1IZ8A 1UOOA 3PICA 1Y37A 3E3AA 3AILA 2JBWA 1NX9A 2JF0A 5AM4A 2HA0A 4FLFA 3H2JA 5ALNA 2HFKA 4PSDA 2VA9A 4OSEA 3G9XA 2HA5A 5EGNA 2WFLB 1X2BA 2OCIA 4J0JA 5A2GA 5LZ9A 1K4YA 5JAOA 4M0EA 3BWXA 4QEKA 3CN9A 4UBLA 4E46A 3HI4A 5CT6A 3ESAA 1RWQA 4KEAA 4Y2UA 3I2IA 4GXNA 4DYHA 1XZJA 4DNPA 2Z5GA 4KJXA 4Y9SA 5CT4A 2H7CA 4ROTA 5FKJA 1H22A 3AZOA 3HJUA 3AZPA 5BOVA 2AJBA 4D9JA 5AICA 4Y7DA 4H18A 4HXEB 3WLAA 2XLBA 2OCGA 2O2IA 2VJCA 4LYDA 4MEAA 5YASA 2HU8A 2ZJFA 1AZWA 1KEZA 3Q8WA 3ZWQA 4BP8A 1CUVA 4UFPA 4H7HA 4PSCA 1GPKA 3IUMA 1BEZA 4INZA 5IVIA 3M83A 4BAZA 4G1FA 5LZ7A 3DNMA 3IIIA 4TVKA 2QJWA 5AI4A 5CT9A 5EI5A 4QLAA 5IH7A 2XUKA 1W52X 3STTA 1FFEA 4YX9A 5FPPA 3ILSA 5K3DA 2CB9A 4G5XA 1AURA 4KE8A 1YR2A 3QBJA 4QDOA 1AC5A 2YXPX 4PF1A 1XQYA 4OU5A 4WY5A 3H1BA 4B83A 4X91A 1JFRA 1JT2A 1QO9A 5K3CA 5ISMA 1QFSA 4LKOA 1JJFA 5JATA 5HZGA 3FVRA 2WM2A 4G9EA 3V1MA 1UK7A 5A6VA 1FFDA 1F8UA 2VSQA 2Z3ZA 4J0IA 5E4JA 4QDZA 2WU4A 4X85A 3O4HA 1EH5A 4FLEA 1QO7A 5I8PA 2YYSA 5ALIA 4BRZA 3K6KA 1TQHA 5EIAA 4L3WA 1XZCA 3D2CA 4AMYA 4Q3OA 5JD5A 2W6CX 1Q84A 4AO7A 3O0DA 1JU4A 5K5EA 5SYMA 1CVLA 1QIGA 1N5RA 2XQGA 2CZQA 5D3ZA 4BZZA 3C8DA 4ZXFA 3QYJA 4ZGBA 5AK5A 3EQ9A 3ED1A 2QXTA 4JYPA 4F0JA 3BIXA 3STXA 3OM8A 2ZSHA 1IUPA 3RARA 2OAGA 1TCBA 2C58A 3W9BA 1VXOA 1XQXA 5KWIA 4BP9A 2WUDA 4AO8A 2HRRA 4Y2QA 1ZGCA 1XRRA 3ESCA 4UFNA 1P0PA 2WIFA 4BTVA 5AKKA 4L0CA 5AKJA 4DSZA 4C88A 2J4CA 4MWSA 4YASA 1EVEA 5DJ5A 4WCVA 3CN7A 3E0XA 5AK6A 3WI7A 4A16A 5HFAA 1A8SA 1MAHA 5HF5A 2O7VA 4PQEA 1GZ7A 3H1AA 5FOQA 2HHAA 4LXGA 1MX5A 1U8EA 2GZRA 1BS9A 2D0DA 3LLCA 4CCYA 2ECFA 1BRTA 1VKHA 4BCDA 3TEJA 1BCRA 2Z3WA 1UOPA 5JADA 2OGTA 4OYYA 1ZD4A 4C87A 5K3AA 1P0QA 3NOXA 1H23A 1ACJA 3IVMA 1UK8A 3AIOA 4K6HA 1XZAA 3I2FA 4UHBA 2ZJ6A 4FTWA 4U2FA 5AK4A 4F5ZA 3QPCA 5ALWA 2O2HA 4O08A 4Y2TA 1CUAA 4N8DA 5I7UA 1UOQA 2WUFA 5J3JA 1JMKC 3JWEA 4K6KA 2ZVDA 1FFAA 3WQHA 3R3XA 3WYDA 1CUDA 2EDAA 4QDXA 2DSNA 4J7AA 3D0KA 1G4HA 2PKYX 1CEXA 2I03A 1DU4A 2CJPA 3D7RA 3V1LA 4ZREA 1S8OA 3WK7A 3ICVA 5DWDA 4WFIA 4NS4A 4M0MA 4H7EA 3SC2A 4J0GA 1ETHA 1MPXA 4YK7A 5LIPA 1FFCA 2EDCA 1X2EA 3VXKA 2ORYA 1FFBA 3VDXA 3WWEA 3QPDA 4RE5A 1XZGA 1DT5A 1EXWA 1JMYA 3AUKA 4CIBA 2XMGA 2HFJA 1ORVA 2PU5A 1YASA 5C8ZA 4MQLA 3BDIA 5D3KA 5AKZA 4Z49A 1M33A 3I2KA 3OURA 5D6OA 4Y2JA 4X92A 3QVMA 5AM1A 4AN1A 4F60A 3FLAA 3HACA 2WLSA 1XZMA 1HBJA 1TCAA 4WDQA 3WA7A 1ZJ4A 1ODSA 3H18A 1LPBB 3E1GA 5ALFA 5ALGA 3WKEA 4X97A 3DYVA 2VT6A 5HCUA 2HU5A 3F96A 4U2GA 3WJ1A 3QMVA 2OGSA 1LBSA 2BUCA 3V1KA 1EINA 1P0MA 5BV7A 4FLMA 2JIDA 4H7JA 4CFSA 1F0NA 2EEPA 3O95A 3WKDA 2PSEA 2Q0XA 4X7BA 1VE6A 1AGYA 1DX6A 3H2IA 3HZOA 3QM1A 4ETWA 2PPLA 3A2NA 2WFZA 1BROA 1XRNA 3G0IA 2H7XA 3R0VA 5FP0A 2FX5A 2B9VA 3DL7A 1I6WA 2FJ0A 1L7QA 1ZIYA 3OG9A 1K5PA 2C5GA 2ONCA 4AO6A 3RK4A 3YASA 7YASA 1HLGA 4DMHA 2HDWA 4UBOA 3EQ7A 3ANSA 2IX9A 2VF2A 2GBFA 1ORWA 1TAHA 4G8CA 4DTCA 3S2ZA 3HC7A 4AB1A 2WUGA 1LZLA 1DX4A 4XJVA 2HA4A 4B85A 3DQZA 4P93A 4FHZA 3WIBA 1GPLA 2G5PA 1BEEA 5AK3A 5E2IA 5ESRA 5CT8A 1QGED 4WDRA 2ACEA 3I1IA 4C6HA 2QTBA 4BC0A 3G7NA 1BN7A 4EY7A 4WY8A 1LPOA 2XUOA 2DR0A 2OCKA 1K6EA 5C8VA 1EDDA 5BWBA 2BUBA 1U4NA 1R50A 1IUNA 1YAJA 4CIAA 1QTRA 3AJAA 3BDVA 1GQRA 3BIWA 3GA7A 1MNQA 1UKCA 3I6YA 4CG3A 3R40A 1ZD2P 1CUEA 5JZSA 1USWA 4B6GA 2GYVA 3FYTA 1H2WA 4C89A 4GECA 1ZI8A 4Q1VA 3W2TA 3C8HA 3WK9A 3R41A 4X6UA 5D7BA 3FLBA 5SYNA 1WB5A 5CRIA 4NMWA 2X76A 5DYYA 3FNBA 2HU7A 3VVLA 3QZUA 4NZZA 3ZLVA 3BL8A 2RHTA 2HRQA 5LZ5A 4AZ0A 3PUHA 1EK2A 2I3ZA 4IH9A 1MT3A 2C0QA 3MUOA 1E8DA 1H2ZA 4HXFB 2V97A 4J03A 2XMSA 1E8MA 4QWWA 1HKHA 2CMFA 3O9MA 5JZBA 5T4FA 5AIAA 2K2QB 1OILA 3FCYA 4QDUA 4UBIA 3IDAA 1WM1A 1TK3A 3RLIA 5ALQA 4G8DA 2O7RA 1VA5A 2QR5A 2PM8A 2XMBA 5ALRA 1XZEA 4FFWA 3WKCA 1IZ7A 2XMRA 1QIIA 3ANTA 5C7YA 5A7HA 4HTAA 3IUNA 5JYCA 2J3DA 4CCYB 1XZIA 1E89A 1UT6A 3MVEA 2VTVA 4GLBA 2ROQA 5HK8A 1R9MA 5CW2A 3G0BA 2JGIA 4X95A 4H35A 4OB7A 5AI8A 2BAGA 2JGKA 3L1HA 4H7DA 5BWCA 3QMMA 3FSGA 5HKBA 3KXPA 2PUJA 2PBLA 4XX1A 4DM7A 2QRUA 3TGLA 1E66A 4IO0A 3I6ZA 1LBTA 5HFNA 1E8NA 1QIHA 5DTIA 2X5XA 2DCMA 1K63A 2QUBA 2H9YA 4EA6A 5ALZA 2PUHA 2V98A 4G8BA 2XT0A 2OPHA 3W9UA 1XZHA 3PF9A 3NWOA 1VOTA 3H17A 2X8BA 2WTMA 3X3HA 5K3BA 4A23A 4X00A 1XLWA 4BRSA 4MXDA 4B80A 2VAVA 5C8XA 2WHRA 1SCIA 4EBBA 1O6GA 4Y2SA 3UMJA 5AKLA 1CFJA 4BB0A 4W9RA 5ALUA 1ZI6A 3VJMA 2AJLI 3EF3A 4RPCA 2QS9A 2XUJA 5LP1A 1VLQA 5A62A 1CUYA 2R8BA 2XLCA 1IUOA 2XDWA 3LIPA 3WK6A 3PI6A 1CUIA 3L1JA 4B9AA 3AFIA 2WJ4A 4V2IA 4WJLA 5ALJA 2XUQA 2V9ZA 3B12A 4X6YA 2Y2UA 4J3JA 2I3DA 5C81A 3DKRA 3GELA 3C5VA 3R3YA 5I9IA 2WJ6A 2DQYA 1XZDA 2VJDA 3FVTA 1GKKA 1XRPA 2B20A 4C4YA 1ZICA 3F98A 3D5EA 1XZLA 5EHXA 1MTZA 1CPYA 2XMCA 3A70A 3B5EA 1SOMA 3VVMA 3IBTA 5EFZA 1CUZA 4B0PA 2VJAA 4EY6A 1GXSA 1QFMA 5AIBA 2XQKA 3FCXA 1A88A 1QONA 2AJ8A 1J2EA 4IH1A 4UHFA 5DNUA 2FJPA 2BGRA 5AHXA 1VZ2A 1O6FA 3AZQA 1N5MA 2G63A 4MYSA 2AXEA 4N8EA 5HF9A 1THTA 5HF6A 4WFKA 2BJHA 1YA4A 4DNOA 3F9CA 1BCSA 3LIIA 1R3DA 2B4KA 3I2JA 5EIHA 1A7UA 3R3WA 1LPNA 3AIKA 2ZJ7A 1C4XA 1PFQA 1EDEA 4UPDA 3PUIA 3I6MA 1JKMA 3AIMA 1OXMA 1UK6A 3C43A 5A7FA 3BF8A 2IITA 5IVDA 4AMZA 3WWPA 4DLNA 2XUIA 4EUSA 4JNCA 1N1MA 1A8UA 1TRHA 1CUSA 4K6GA 1YB6A 1CV2A 5FXMA 1D07A 4IH4A 3UUEA 3MUNA 4UBMA 3TJMA 3GUUA 4BVJA 1AKNA 3STVA 2I78A 3C6ZA 3FYUA 4ZI5A 1P0IA 4K2AA 2JGJA 4EB0A 2QVBA 3WJ2A 2JGLA 2JEZA 5ALHA 5JALA 3M3DA 1QZ3A 3F8SA 1GQSA 2PSHA 1DT3A 1CUWA 2RIPA 3H2KA 5ALYA 1XZBA 2J3QA 4N8SA 4UHHA 3AINA 3C5WP 1CUXA 1MN6A 4NVRA 4FDMA 4X90A 3BXPA 1Q0ZA 4RNCA 5H3HA 2H7YA 4HS9A 2Y2VA 5A71A 2QXUA 4W1PA 3QITA 3DCNA 2UZ0A 1XROA 2WHPB 1HQDA 4Y2XA 1T2NA 3LCRA 4PV7A 1ODTC 4HRYA 4B7ZA 1MX9A 1Y7IA 2WQZA 4X3CA 3OTQA 1WOMA 2HA6A 4N5IX 2CEKA 1CQZA 3STWA 3WL5A 3OPMA 3WK8A 1UK9A 4L9AA 1CUHA 1X70A 1QIEA 5CH8A 4H7IA 3WWOA 1RYYA 1CLEA 3KD2A 4PSUA 3V48A 4LHEA 3C45A 4X94A 5IVHA 5CH5A 4I3FA 1MU0A 2XUAA 1E5TA 3VISA 3C6BA 5FPQA 4KAAA 5LLSA 1QIMA 2PSJA 2QT9A 4LYEA 4DNQA 4PW0A 3KDAA 4MWTA 1XQVA 4BYMA 1YB7A 3H2HA 4BDTA 5HKAA 2VATA 1WCYA 4QA9A 4KR0A 3F97A 4Y2YA 1C7JA 1YS1X 3CXUA 1UKBA 5JARA 1XLUA 5AH0A 3WL6A 4EY8A 3E4DA 4OPMA 4C4ZA 3STYA 4KRXA 2WU3A 4KE9A 4BAUA 3FLEA 4JH0A 4KE6A 1Q0RA 2WHPA 3I28A 2WSLA 1XZFA 4KRYA 3WL7A 5CXUA 3U0VA 4BZWA 1G42A 1JU3A 3VJKA 4RE6A 5T4EA 3KWFA 2OG1A 1LZKA 3F67A 3H2GA 3WK5A 5JASA 2P8SA 2BGNA 3VKFA 4UHCA 1VE7A 5FUMA 3DYIA 3ESBA 5AM2A 3SK0A 3WIOA 3ZPXA 4W1QA 1XZKA 4QNNA 3V9AA 2OCLA 4HAIA 4J0CA 2WIGA 3IB3A 4OU4A 4GEGA 2V96A 4Q3KA 4BCCA 2XQIA 6YASA 4UBJA 1DTEA 2QKYA 4JYMA 5EHQA 3WL8A 3I2HA 4F21A 3B3QA 2XUDA 4Y2RA 4LXIA 2VQ6A 4U2CA 4ZWNA 4BAGA 1HL7A 2WHQA 1PJAA 3IURA 3W05A 5T4HA 1EHYA 3BJRA 4AZ3A 1ZD3A 2ZYRA 2RGUA 1ZJ5A 4E15A 4QLOA 3M82A 3GZJA 4BE4A 5HQ3A 3R3ZA 5A7GA 1VJ5A 3STUA 5CTAA 1QJ4A 4BBZA 4ZV9A 1W1IA 2GBGA 5ALPA 1WHTA 3Q0TA 5JD4A 1J1IA 1ZIXA 4QDTA 4DSAA 4I4CA 2Y1KA 3G8YA 3TRDA 2RHWA 1QOZA 4UHDA 1KU6A 5JAUA 5DYTA 2ZSIA 2BUAA 3BF7A 4H0CA 1L7AA 4E14A 4KAJA 4QE3A 3G9ZA 5EHNA 1LPPA 4C01A 2QMQA 2WG2A 2XI4A 2XQFA 5HK9A 1R9NA 3FYUB 2VAXA 3HSSA 1B41A 3W04A 1MNAA 5DNWA 1ACLA 3A2MA 5KWJA 2DHCA 3JW8A 3DJYA 4LIPD 4UBKA 3D4LA 1TKRA 5ALLA 1J07A 1EX9A 1AQLA 1NU8A 3UUFA 3G0CA 3HLKA 1VZ3A 3H19A 3ICWA 4XIIA 3WK4A 2WG1A 1J06A 4PNZA 5CMLA 1BE0A 5AI0A 2PX6A 2PSDA 1K8QA 1DINA 3PFCA 2XMZA 3W06A 4DMFA 1LPMA 5ALKA 1Q83A 4W63A 1H2XA 3OC0A 2W22A 5IVKA 1FJ2A 1XQWA 2BFNA 3QH4A 2B61A 2OQIA 5AI9A 3ZI7A 3LS2A 1LPAB 2VT7A 1A8QA 4Q34A 2H1IA 4B84A 2GBCA 1W76A 2XE4A 1EVQA 3IUJA 5T4BA 3O4JA 2R11A 5JIBA 2GBIA 2JGFA 1ZD5A 3KSRA 1JJIA 1SFRA 1W4LA 4QZVA 4KACA 5K3EA 5FRDA 4HRXA 4P92A 5AKXA 5K3FB 5EHZA 2WFLA 3HYSA 3T4UA 5CXXA 3FBWA 5JD6A 4ITVA 4FOLA 1AUOA 2AJDA 4UHEA 2HA2A 1GT6A 2XUGA 2C5FA 3H0CA 3D3NA 2XMDA 1CUGA 4FBLA 2OGZA 5EIEA 1AMNA 2G4LA 3D59A 2ES4A 5FV4A 1T4MA 2RONA 1EB8A 2VEOA 3VJLA 2WIDA 3A2LA 3LP5A 4TPKA 3FWHA 2BKLA 3V1NA 4UFOA 3KWJA 3EBLA 2J4FA 5ALSA 4CCWA 3WWCA 3ZLTA 4WFJA 1XKTA 3D2AA 1H2YA 4N5HX 4BATA 1QIKA 2CUTA 5AKYA 5JZ9A 1DQYA 1EB9A 1YA8A 2PU7A 2WIJA 4JUIA 1YAHA 2OLEA 4ZV7A 3EIOA 5CURA 2D5LA 4CG2A 4FWBA 5F4ZA 2WUEA 5KBYA 1MAAA 1YS2X 4ZRDA 3O4IA 2WFMA 4KYVA 1CRLA 3R3VA 2OXEA 1U2EA 2QM0A 4FNMA 4FFVA 3KOOA 3NGMA 3PDCA 4BVKA 3EQ8A 5AOCA 3M81A 4KE7A 4H7FA 4DMKA 1F6WA 2QZPA 1WPXA 3DOHA 4LXHA 2HIHA 4K5QA 4MEBA 2WTNA 2C0PA 3FSGD 3PF8A 2FUKA 3L1IA 4BCBA 1HPLA 4GDMA 4AX4A 1QLWA 3WA6A 4TGLA 5LZ4A 1GKLA 5LKRA 3H04A 1XLVA 1NU6A 1EA5A 3PE6A 3NUZA 1SCQA 2DQZA 2LIPA 4X93A 3FYUC 1KU0A 4BE9A 3SWWA 1E3QA 4Y2PA 3WWDA 3GFFA 1OCEA 3CCCA 5LZ8A 1BU8A 2G5TA 2C7BA 4B0OA 4ARAA 1MX1A 1R88A 4QWMA 3K2IA 3C70A 3CCBA 2DHEA 4ARBA 1EI9A 3N0TA 5CH3A 4BDSA 2CBGA 4OUKX 2GYWA 3O4GA 1XFDA 2WG0A 3WMRA 2WIKA 1CUBA 3G0GA 1N8SA 2RAUA 5HF8A 3P2MA 1Y7HA 5ALDA 1YCDA 2HL6A 2VJBA 1GPNA 1WB4A 1F0PA 3ZV7A 2DHDA 3A6ZA 1L7RA 3DD5A 5LYYA 4B82A 1WHSA 4FNGA 4PO3X 4EHBA 3GROA 3O9VA 3RKSA 3I1YA 4BTLA 1BN6A 2PL5A 1AX9A 4XVCA 3SX4A 4U2BA 1EDBA 2YH2A 2O2GA 3S8YA 4DNFA 2DFPA 3DOIA 4OCZA 4M0FA 3QMWA 4W1SA 2ZYSA 4YPVA 2QUAA 4GI1A 4L72A 4AN0A 4OD0A 1G66A 3HRHA 4FMPA 2XQJA 2BCEA 2RI6A 1YSCA 4X71A 1CUJA 4Q05A 2XUHA 1TIBA 5ALEA 3R3UA 2WJ3A 3K9BA 3HXKA 2AJCA 3ESDA 4G4JA 4W1RA 3WYNA 1ZI9A 5AKIA 1W6RA 1GGVA 3GBSA 4I19A 3C6XA 5AI5A 3G02A 5AKHA 4J0DA 4GBGA 4G9GA 2C4HA 4E11A 2HA7A 1ZGBA 5E4YA 3N2ZB 1R4ZA 4IQ4A 1TCCA 3IUQA 1PV1A 2WILA 3JYHA 5DYWA 1QTIA 3OOSA 4BVLA 1UKAA 2E3JA 3PFBA 1LLFA 1MO2A 1CUUA 1VA4A 1XKLA 1Z68A 1LNSA 3IA2A 1CUFA 4FBMA 1DWOA 3HEAA 2HM7A
chains in the Genus database with same CATH superfamily
3WFIA 1LRJA 4LFAB 2QUHA 3FR8A 4GKKB 3JY6A 5H9WA 1L6RA 3LY7A 1G4AE 3HB1A 1GITA 4XEUA 3OLCX 1YE3A 3S68A 4A73A 3TSCA 3ISJA 3LZ6A 3V7WA 1I30A 4M1KA 5IUNC 4BX2A 4H7KA 4M7OA 3RUEA 1QVAA 1U81A 2AN9A 5EESA 5BWOA 2O2ZA 3ZE2B 1FFXA 1RS0A 3IKLA 3MAAC 4M76B 2Y4NA 3V2IA 5K1ZA 3K1TA 1ZNZA 2UYQA 3TW0A 4RABA 1M6YA 4RHFA 2FPOA 3SEZA 2VNJA 1I3LA 1SEPA 5KYUA 2FF5A 5SZKB 2PS1A 5L3SB 4UASA 3IXLA 1E1QA 4OA8A 3DT6A 1U1FA 3GVCA 1IM8A 3B3GA 3G5AA 3NORA 3ZD8A 4CKWA 2C2XA 3BJIC 3GRCA 3I2GA 1QG6A 1FUYB 1YR8A 2WVAA 3CEJA 5E4TA 2OVFA 3WKBA 5CBKA 2JZCA 3D8BA 1Z47A 4JSTA 3W3AD 3LHIA 1ZK0A 2HNAA 4YMHA 1GDHA 1K88A 1DC5A 1NBEA 4YUVA 4MYHA 3TLGB 1TVKA 4E2FA 4TS3A 2OSVA 3IUYA 3KEQA 4DWWA 3LRXA 4NRDA 4WGFA 5LQKA 3UJ8A 5FDFA 5HE8A 1GAWA 1UQRA 3IBGA 4MW7A 4P5EA 1R5JA 3WZLA 2JAHA 3OIVA 4YV2A 5B6IA 3O8BA 4JK3A 2ZJBA 1UT8A 2B3TA 1GFWA 3BHMA 3I3SR 3N0XA 5IS2A 4QBIA 2UXBB 4QEZA 1GYPA 2MTBA 3OZXA 2GMWA 1Y5LA 2ET6A 4HZUB 2JEYA 3C87A 1HI9A 1J4AA 4KIJA 4CEJB 4GWLA 2G08A 4MJ3A 5B3AA 1GTG1 1WW2A 3A9RA 3PRHA 1FDRA 1PFGA 2ZYHA 4ND1A 4YMWA 1MO5A 4OOEA 4CGYA 3OT5A 2ESRA 2H00A 1WG8A 1QIJA 5LOVA 4KPYA 2FP4A 4CIDA 1PYOA 5JS8A 1WXDA 4TZTA 4U2EA 5K2OA 4BC1A 4V38A 3ZHYA 2V7XA 1LPSA 5DGXA 4CJXA 2WJHA 3NHUA 3UQZA 1ZQ1A 4RD0A 2IOQA 2PKWA 7MHTA 3VYVA 2BFFB 3TDKA 1U4OA 5F12A 1K5DA 4J0HA 3GJ0A 2JVKA 4NBUA 4ZIRA 1C2YA 4Y2HA 2XRFA 1R4NA 4O4LB 4ZO9A 1GQQA 5AKGA 5LJLA 1X38A 3EH2A 1FLNA 2W6OA 3Q8XB 3RSZA 4D45A 4OUDB 3ZQUA 2QRVB 2V4MA 3A3NA 3MILA 1R1DA 2BSXA 4TRNA 4MITA 1IBKB 2JDIA 3DTYA 1S6YA 3IKJA 4MI1A 4KREA 2A6PA 2ZYWX 3LLUA 1FYEA 4XWGA 1J70A 2HSWA 4XQ9A 3PUJA 3MMXA 3B78A 5TF4A 4YUXA 2H4YA 1XRLA 4JI1B 2OQVA 4DJFC 4LVOA 4W7HA 3IIKA 1C29B 1SCKA 2YJ5A 4BN5A 2FPSA 3JQCA 1U8TA 3JX9A 4M7WA 2P4QA 2PIDA 4G4GA 1E9EA 5DRTA 5EE0A 5CFMA 2R2GA 1TQDA 4HN9A 3HNPA 4W7IA 3S7ZA 3OZFA 1CQJB 1XZ8A 2FSHA 2YASA 2FP4B 2Q1SA 1E9AA 4I9FA 1P1IA 4Y67A 4ZVRA 3G2LA 5FHQA 4ZYYA 1PTJC 5TJ9A 4AVYA 2RFLA 3EFBA 1D0VA 4U1RA 2PE5A 4EMSA 1U2QA 4QYIB 4OGLA 4IR7A 2WIBA 1NXSA 4QPJC 4E4YA 5FIUA 4FFLA 1JG2A 3HP7A 1Q0QA 1VJGA 2BBSA 2XXAB 4CLHA 3N70A 3O7MA 4EELA 1WBBA 1YZQA 3RJZA 1X1AA 5KREA 4JJIA 4BXOB 1VL8A 2WOJA 4RH0A 1NVWQ 3R6GA 4H6VA 4XLZA 3CA8A 4DGQA 2XUFA 1LV7A 5ALVA 4UQLA 1L4YA 2C98A 1JS1X 1ECFA 3SZMA 5CB6A 2X15A 3UB3A 3NV9A 5AM0A 3IEIA 4HVTA 1B6GA 1IZ0A 3AEXA 2E0IA 2JVJA 4MYUA 3A6FA 3V55A 4CG0A 3UQYS 3TPZA 4RK7A 1QRSA 1ESZA 5B1SA 2AR9A 5P21A 3EAFA 1XYGA 1R16A 5E6UB 3SX2A 4LYYA 2Q5QA 4LDAA 1VG1A 4C0HA 4U7WA 1N2HA 1IJEA 2QJRA 3WIVA 4IUCS 4U8HA 1I7NA 5AM5A 1GSAA 1QH0A 3PFWO 4M1ZA 1PR4A 5JO9A 1XX6A 4ZYUA 3KYDB 1U1CA 2I80A 3ASUA 3DTNA 4QU8A 3E81A 2GI4A 4M83A 1L7XA 2GXUA 2J0VA 4OATA 3SSNA 2P35A 3DTTA 1VIYA 4YT2A 4X6XA 1LDEA 4P7KA 1M5TA 2CXRA 4L9WA 4J3FA 4J1TC 5DYNA 4UUPA 3VV2A 1KVRA 3PITA 2WWFA 2YJZA 4RHYA 3AGPA 2JGMA 1UFVA 4YJ2B 4UPVA 3T35A 3MBIA 4ND4A 2JGEA 4PAWA 1RPAA 2IHKA 2P65A 3O4RA 2VZ0A 1K0UA 3PXDA 1BS1A 2RHHA 2JCBA 3P9XA 4PG6A 2J87A 4DG5A 4YV7A 721PA 2AFHE 2VEDA 5J2UA 1L5HA 3RRYA 4X8OA 2WF5A 2R1VA 4GE0A 3WLQA 3G0DA 4KIUA 4B9EA 4PN7A 5K6AC 4KOEC 2WM8A 5AKEA 1XPJA 3DAPA 1EP9A 1JLSA 2LTAA 3MLEA 5BPHA 4U2DA 1S2MA 5COAA 1HT2E 5FB3A 5GP1A 3ROPA 4BMNA 1CJTC 3F6EX 5FA6A 2IBSA 2V1XA 4QFMA 3I6QA 3Q6IA 1ZMOA 4LF5B 1JPJA 2O8EB 1RP7A 1U0NA 4XASA 3NIGB 2R48A 4L8WB 2DCUA 4DL9A 4OHYA 3DLTA 4Z4GA 4A8PA 2Q62A 3CV3A 3A31A 4RSHA 3ZWNA 1RMTA 1Z5VA 5ERYA 2X0RA 3RYHB 1UZAA 2UZ3A 1G5HA 2FLVA 5JCPA 2H92A 4L6IA 2AMLA 3NS7A 2FN4A 3R7SA 5E8JA 4GLLA 4QHTA 3FFWA 4D9HA 1RFGE 3TM4A 3I52A 4O4IF 1U6JA 1QNLA 5LA6B 1N2BA 4RQBA 3H2JA 1IPEA 2BN4A 6REQB 4K05A 1F7UA 2PFGA 4LRUA 4L2IB 2FQXA 4O63O 4AYXA 4C03A 1Y80A 1BDHA 2VA9A 4ZYTA 2FLWA 1VB5A 3W5BA 2FFQA 3G9XA 2HA5A 4HX5A 5I7WA 2SKCA 1K6JA 3N87A 3RVNA 2EP8A 2NXWA 3IE1A 2G40A 4DR5B 3TLBA 5TS3A 1FU8A 3THYA 1BKYA 2CNLA 2O1WA 1DBSA 1E9VA 1JQ3A 2FZ4A 4OHWA 1VGVA 4EI7A 1X2BA 3FKQA 3PQ7A 5IPFA 1HTTA 1N92A 2OCIA 5JO0A 3REFA 1HYGA 3HJBA 1K4YA 3K31A 4M0EA 5JAOA 3BWXA 4HEQA 1GL6A 2SCUB 1DC8A 3D6NB 5EWMB 1X0VA 3WE7A 1GNPA 4F9TA 5B12A 1BFDA 3PC7A 4ER7A 2IF2A 4WBSA 4E46A 4ZOQI 4OEHA 3M3HA 2CLLB 2C00A 3HI4A 1KAEA 2DRIA 3RVMA 1RADA 4BN4A 5KU7A 2J5XA 1T9ZA 2P9CA 4TWBA 1SUIA 2WKRA 3WGMA 3Q87B 2AMJA 1XZJA 5P8WA 2Z5GA 1C3XA 4RK4A 5IDQA 1UMKA 5F52A 1Z07A 4Y9SA 3KKOA 3DMNA 2AE2A 1TT5A 2WE8A 3AY3A 4JX8A 1HE1C 3DDSA 1HETA 4DUGD 4BFSA 4NK4A 1M2HA 1XRJA 5DHFA 5ENZA 2VSNA 4ALLA 2OFOA 3F7OA 4QARA 2BI8A 3DBIA 2ZIWB 5BOVA 1B6TA 3L0CA 4LX8A 4DLTA 4RQUA 1I1OA 3TAHA 4D9JA 4Y7DA 3U16A 5TQ0A 1X1CA 1E4VA 1JYFA 3EEIA 4H18A 4J43A 1CZHA 3GRZA 3TTUA 5HJ5A 4ZJPA 3AEQB 3KQQA 3KQVA 4HXEB 4KTVE 4LGVA 4IOLA 1A95A 5FOSA 1T5IA 2VO1A 2I2CA 2WU0A 3A4YA 4UVHA 2OCGA 5EJMA 1X1EA 2AOWA 3MXOA 3AQIA 4EG6A 4Z4FA 4OHVA 3PEWA 2CF6A 4FS3A 1IY8A 1I6MA 4M0UA 2PGNA 4QNRA 3GLFE 4HFMA 1J00A 2C29D 2X40A 4C6SA 3P2OA 1O3YA 1N9KA 4Z7JA 4KWHA 1T35A 4JP1A 1T2UA 4PS1A 3BM5A 3WICA 1NBAA 2IZ0A 3Q8WA 1JHPA 4FN5A 1M3SA 3T7JA 5AXDA 4BP8A 4DQDA 3H7AA 3NRBA 1DTWB 3AKZA 3DZIA 2Y0PA 2IPAB 2X8JB 2IDKA 1WZCA 3D2LA 2BIFA 2YC2C 3PT5A 5IEBA 2I6UA 3HBNA 1FFXB 1KOFA 2YUIA 2H2HA 1BEZA 3I32A 2QAIA 4INZA 1Z0SA 2H6EA 2ZR7A 4TT8A 2AQ8A 2FPIB 3L18A 4UDNA 1S9DA 3U1BA 1K6MA 3D3JA 1Z9BA 4KPUB 4B46A 5EUMA 5BYBA 3JQ9C 2RI0A 2VDMB 4KXYA 1SELA 5LZ7A 1E6WA 4I5IA 4B45A 1L1FA 4LC9A 4FU0A 3P2EA 3IIIA 2WMYA 1OW3B 3IOYA 3IOEA 2G3YA 3N8DA 4TVKA 1CW2B 2CXXA 1IY2A 1Y1RA 4KX5A 2ZAYA 3LLMA 3V4VB 4NBRA 5A4FS 2VSYA 7REQB 4RZ2A 2BC9A 1XMSA 3JD0A 4QLAA 1GNLA 1LLUA 3BH6A 1W52X 3GRYA 1FFEA 3ZZUA 3FZNA 3PYXA 3DBVO 3ELWA 2FWIA 3N75A 5CNJA 4YX9A 1N6KA 5THXA 3ILSA 2IYSA 1NMYA 4MQ5A 2G9UA 1FDOA 1QP8A 5DM60 3KZNA 4QDKA 4CNBA 4OGWA 4EG7A 4GZMA 4B34A 1RYNA 3KALA 3NDRA 4URFA 4EZBA 2H52A 2XECA 2BZ1A 4DDMA 1XVVA 3B6EA 3H9QA 4KE8A 3FKSA 1QGDA 5CK4A 1YBMA 4JQYA 5DNEA 4KLRA 5CJJA 3LDFA 3QBJA 5EMHA 4HD8A 2ZQ5A 4QDOA 5G53C 1W2GA 1EM8A 1R5BA 1I7PA 1OKKA 2X22A 3K9GA 4PF1A 1XQYA 2B7CA 4O6VA 1HNNA 1LVUA 3AVPA 3FNIA 4X64B 1QQAA 4YRAA 3L7CA 1NBWB 5E3HA 4EL5A 3QPWA 3C8UA 4PNPA 1CZOA 1KQPA 4GYJA 3GOHA 5IBCA 1I0IA 1H8HD 5K3CA 1QO9A 1M67A 4BQEA 1TIPA 3GP8A 4GSKA 4YMSA 3ROZA 1X3LA 3NHMA 1YOVB 2BFFA 4YUYA 2CFIA 3CZMA 4OXRA 1S89A 4BNLA 5JATA 2GSDA 4AMUA 1B43A 1IY0A 2O54A 2K87A 5JCOC 1T9BA 3BXOA 1T8RA 2WM2A 3R8XA 2NXJA 2XOKA 4DR3B 1UPAA 4JKOA 1W93A 2VDKB 3O3MB 4QJ4A 2GA9A 2ZBUA 3K1ZA 3A1TA 4D4MA 3UJNA 1B3BA 3BXXA 4WJKB 3SXPA 2I4IA 4LHSA 5FT9A 5JYBA 1RI4A 1L4KA 3HXPA 2XF8A 1ZN2A 4W5OA 5E4JA 5EZ5A 4UNIA 4IXWA 2QIOA 3T99A 1QTNA 4ZYVA 2NPIA 3RDPA 1XELA 2NP6A 4KP7A 3O4HA 3V8PA 2QZZA 1M10A 3IVRA 3O2SB 4ZVVA 3K6JA 2BKAA 1JXOA 2P2NA 2WKPA 3DO8A 4RETA 3W79A 3UHOA 4H4EA 5CEJA 2F3UA 3GGDA 2YYSA 3A6LA 3WLRA 1NUTA 3RFFA 1EUZA 2LKDA 1C50A 2WTXA 1C7QA 4DV1B 1KEEA 1U7HA 1TQHA 3CRRA 3PXEA 4JBXA 1A76A 1IULA 1NVEA 5EIAA 3HN2A 3V4FA 1ZOLA 4HQFA 4BJ6A 4I14A 1AZSC 2AN1A 2D0PB 2O20A 3D2CA 4QOSA 4QUKA 4AMYA 2FSPA 4HMQA 2H18A 3KB8A 4LJ5A 4DDVA 1PVOA 1XP8A 4Q3OA 4JT4A 4WACA 2EJWA 2LNDA 1Q84A 2YVQA 2OGWA 3JQBA 3WB2A 5DW3A 1JU4A 2II6A 2H2FA 2FETA 1XKQA 1DCTA 3OE4A 3BH0A 3GOQA 4QQKA 4E5MA 5BW8A 2HREA 1DBVO 4P82A 1TX4B 1K3FA 1R18A 3HZRA 1XXLA 3DP9A 3MQFA 1QBKC 4C4SA 3TEMA 3U4QB 1C8LA 1PEDA 2XQGA 3RASA 5BMVA 3PBKA 5FJJA 4I1YA 1XVTA 5BPFA 3H8WA 4D8XA 1GQYA 3DL0A 4FW8A 4Y6PA 3U5TA 1LBQA 1SQ0A 1KK1A 2M9MA 2Q5OA 4KQCA 2OT3B 4LXUA 5BMVF 1U0LA 2P62A 5EPOA 4EA8A 2JFNA 1DJNA 1T8PA 2CXOA 1O08A 3I3OA 1OH6A 2JGRA 3T34A 7ABPA 1BHJA 3H13A 5C53B 5K0NA 4GH5A 4MUYA 1Q2XA 1EQ2A 1G291 1CY1A 4F0JA 2QXTA 3EXHB 4JYPA 3AVWA 1YQQA 1V8FA 2QMUA 3M4YA 4MQFA 1KE2A 3BIXA 3STXA 4L75A 2DGDA 3OM8A 3PL5A 3RVKA 2ZSHA 1IUPA 3RARA 3VMMA 3OEHA 1MC8A 3OM1A 1TCBA 3KR0A 4RMGA 3ZK9A 1W49A 4FT2A 5C9ZA 1C0EA 2C58A 1GA4A 3OJOA 3P0JA 3RT9A 2YV3A 3H5NA 3OKCA 1EAMA 2WUDA 4AWBA 5A9TA 2R4QA 3B70A 3D9QX 4PG4A 1GA1A 4O4JB 3OQPA 3J80A 5IAAA 1ZGCA 5KVCA 3O1LA 3SQWA 1T5HX 3EOBI 3EXIA 3L4EA 3GA0A 1OSNA 3OZGA 3MT0A 2DFTA 4DYVA 1L7VC 4TWAA 4UFNA 4W8GA 1AQNA 1P0PA 2L42A 3HLYA 4TOIA 4JI6B 3CG4A 4P4TA 1HO3A 1ZW6A 3T54A 3C1UA 4RTPA 1NQTA 1QO0D 3PGA1 3VDNB 1JEQA 2Q6VA 5EWJB 2IFTA 2BDTA 4H1HA 2P11A 1J39A 2AI3A 2C83A 3EUEA 3ETLA 4MWSA 5FTNA 1ZHHA 4HYQA 3UPUA 3B6IA 1NFQA 3LXXA 1NXOA 1YRBA 4NYMQ 4F91B 3ZN2A 4DPLA 1MQ9A 2P75A 1ZN8A 3DE6X 3GZ4A 4H17A 1LLCA 3IR6A 1QE0A 2O2EA 4DRYA 4UU7A 1A8SA 1U1IA 1C3LA 1ZG3A 1FE8A 2W93A 1E59A 5F77A 5BXQC 4FBGA 4BLOA 5HIJA 2O7VA 3BTVA 4PQEA 4WW0A 2VP6A 4E5SA 3R7LA 3O2JA 2HHAA 1Z82A 4BLPA 1KBQA 1CB7A 5L4SA 1CRQA 4WZAA 3ZTTA 1P3Y1 4P4UA 3CZ9A 4OQFA 2XSZA 4CMJA 4MWBA 1U1GA 4RTJA 4HY3A 3K09C 2HC9A 1G8SA 1Z88A 2ILVA 3ZU4A 4CRWB 1H6AA 3WGQA 4RZQA 4BO1A 4CCYA 3R9XB 5FPYA 3VKHA 3RBZA 2OAQ1 4KFUA 2VHEA 1RJFA 2ECFA 3I09A 4F9GA 3IBCA 3TRKA 2NT3A 4JENA 2HF9A 4XA8A 3U56A 4YAFA 1NONA 1R8XA 4IG4A 1ZESA 1PR6A 2BM0A 3CKKA 1ICIA 3BCHA 4EY3A 4ARIA 2WYHA 4EKEA 1U4SA 1JJVA 2AFHB 3UO8B 4LGYA 4IDNA 2Q3HA 5DHPA 2HQ1A 2Z3WA 3DMHA 4ZEWA 4N3NA 1T6ZA 2X3UA 1P6UA 4OYYA 1ZEMA 5F3DA 4TYWA 3VO8A 5K3AA 3G17A 1N8KA 1P0QA 2C3UA 4KSCA 1U9ZA 1CJSA 2Q1TA 4DT1A 1Q6ZA 1UK8A 4ZJZA 4K6HA 2HIMA 4M9RA 1F12A 3SS7X 2PWAA 4BX8A 1CF4A 1KBOA 2VZLA 5DM0A 4IS2A 4H9GA 3V9PA 4U2FA 5AK4A 4LOIA 1VKRA 2VTKA 5C8YF 3UWDA 5CA1F 4Z2AA 4L7VA 1WNTA 4PCLA 4RTQA 1P4JA 6LDHA 1J09A 2W0MA 1DBWA 3T1NA 1QH1B 4IJ5A 4XWOA 3FGOA 4Y2TA 2N1MA 4R7GA 4YAUA 4FNOA 4I5GA 3JR7A 3PWZA 1I5RA 1CUAA 1UPCA 3I6BA 4N8DA 3TSYA 5L7TA 3PHHA 2ZAIA 4QQ8A 2FN8A 4NOJA 2WUFA 5TVGA 1SXGA 4OTZA 5BW5A 2MWMA 3TNJA 3TNFA 4J0EA 4CKEB 4KW7A 4A1OA 2J0SA 2RC5A 5T7BA 1HA3A 4HNSA 3MINA 4W5HA 4GR5A 2YFYA 5HE9A 2AFHA 1CERA 4MV3A 2XCTB 1CSEE 2YJ4A 5LN1A 3NJ4A 4QDXA 3WSWA 2QVGA 3GI1A 1SUCA 1JKJA 3AF4A 3FMFA 4B3IA 1IN7A 4KPEC 5A3VA 4AMBA 1OLXA 2A5JA 2PSSA 4DA4A 4X66B 3D0OA 1B00A 1M7HA 1DO0A 2GZDA 4TV9B 1KYIA 2C4NA 1TLLA 5G3ZA 3I45A 4HNQA 2IXGA 3V1LA 1TFRA 2AWNA 2CXPA 1O0BA 1SCAA 1S8OA 1M1YB 2X41A 1FCJA 2DPLA 1TI7A 1CNFA 1UKZA 3PDHA 2V7EA 3Q6NA 3FTQA 4N6NA 5DWDA 3S28A 4M0MA 4DCCA 2VUIB 1V2HE 1G2PA 1C41A 1Y6ZA 3C4JA 4D3DA 1FTQA 3OI7A 4DE5A 1ZR2A 2FUG1 4M1TA 3SC2A 1F5SA 5JSZB 3OX2A 2OD9A 2FNAA 2YOHA 1ETHA 4KUHA 1MPXA 4I9GA 3OCVA 5E8RA 1QHEA 3V46A 2EDCA 1YZNA 4F5WA 1X2EA 3ZE6A 2AOUB 2ORYA 2V7WA 2XEDA 2EKPA 2JLSA 2E85A 1WCIB 2NSJA 3VDXA 3T15A 2UZAA 1H94A 3Q8KA 1QZZA 2D2XA 4RE5A 3FOAA 4RX1A 5EXEA 7REQA 5JXJA 3WAJA 1MIHA 1DT5A 5TV2A 5ITSA 3FIJA 4ZYZA 3KT3A 4PVCA 1JMYA 2DMRA 2I9PA 2G76A 3MRVA 4WXYB 1C9KA 2I3GA 3JQFA 5JS2A 1ZA1A 3OQ6A 4ZTZB 5B3JA 2QRVA 1EWVA 4M1YA 1II9A 3RSOA 2PU5A 2XADA 2Y27A 4RA6A 3HB7A 1MTOA 5C8ZA 3QXCA 3MD9A 4DUZB 5FBWB 3BDIA 5D3KA 1TOAA 2BRUA 1M33A 2I7DA 2V65A 2EQ5A 5H3LA 3THOA 4E5NA 2FGKA 3TG8A 3TUZC 1ML3A 3DLIA 4QOHA 3OURA 1KERA 2CDNA 4HXYA 3SSOA 3UMBA 4Y2JA 4X92A 1EMDA 3EC1A 1RWXA 4E6PA 2QPLA 2C04A 2YKGA 2ADOA 4F60A 3FLAA 4BQFA 1H5NA 4XDHA 3KPJA 2FFAA 2BGIA 2REOA 4NY1A 4COOA 3B60A 3FWKA 2AYZA 4PPYA 4Q47A 3FZYA 5K2MA 3VSCA 1BNCA 4WE3A 2XH8A 3TMKA 2XKAA 4NENA 4TWJA 4BMYA 3HXQA 1YRLA 3O83A 3V1TC 3WA7A 1ZJ4A 1LNZA 1ODSA 4I9UA 2J1LA 1SG6A 3QE4A 1QRRA 1U0JA 1EFKA 3PFKA 3E1GA 5ALFA 5KOHA 3EPKA 3AUAA 1ZMTA 1IWBB 4M36A 1HL3A 4DJAA 1JWLA 2QPOA 1T26A 1BVHA 2DBRA 5CA0B 1PT5A 5HCUA 3W6NA 1U7TA 3QEMB 4U2GA 3V3TA 3I5XA 2PV0A 3ZUGA 3WJ1A 3P26A 4CBVA 4NFYA 1JFSA 4K0RA 2IEIA 3LX5A 4HC4A 5EERA 1VE9A 4ZAGA 4ZVKA 3GQBA 2OGSA 5CLFA 1KK0A 5AW0A 3HDHA 2B34A 4RM3A 4D9BA 3H5RA 5DM70 2X4GA 2D8MA 2NSDA 2X0JA 3NNDA 3P2IA 4LVCA 2HQSA 3TVYA 4KPGA 3F49S 1XZQA 1GRVA 2ZP1A 2JIDA 4AJHA 4D5EA 4MA4A 2ZUBA 4FNAA 4H7JA 4HOYA 5I9TA 4HDCA 3O95A 3W8FA 3RRXA 2FK8A 4DDTA 3GHHA 3W5CA 3HHEA 1HOTA 3QM1A 1F1JA 3H2IA 3OIGA 3VNBA 5BUCA 3GY0A 2CN1A 3BN3A 2CGEA 3GUHA 3RC1A 3ZDCA 2CLIB 3ZR4B 4UC0A 4MV8A 5GZ3A 2PPLA 2G36A 3A2NA 2NADA 3LDAA 4E21A 3KT0A 1QYDA 4MKHA 1DAMA 2IKSA 3E1KA 1XRNA 3R20A 4ISCA 3BK2A 1X13A 4N0PA 2ZUDA 4CQJA 3HKCA 4AI6A 1LNQA 3W5HA 5HJ7A 4HGZA 2FX5A 4WA7A 5IYZF 3WOHA 4E4TA 2B9VA 3BFPA 4WVFA 5EE3A 1I6WA 2FW8A 2FJ0A 1PYGA 2JHCA 5CHYA 1YACA 3GUZA 1C4WA 4MYTA 3THSA 3SSAA 1FDIA 3MWEA 4BVGA 4QVKA 4IFBA 4AIRA 2HK6A 3OG9A 2ETVA 2CLOB 1SA0A 2EX0A 2AN5A 3D4OA 4NBSA 2B25A 4MA5A 4E7OA 1XL1A 5JS6A 1EXDA 1VHQA 5BNZA 5D00A 5G2OA 3CNOA 1GYQA 1O9HA 1XTPA 3IEMA 5BMVB 1KI3A 2Z8YM 3PB3A 4GPD1 3WBBA 2GXAA 1Y34E 3KQTA 4MQFB 2BGMA 2GXQA 2JJ1A 5IJ9A 4YLEA 4KQHA 5H16A 1SRQA 3LC2O 2HDWA 4UBOA 4PIVA 2GPWA 4HDKB 3NDPA 1QHHB 2W4MA 4P1ZA 5A4AA 5JPDA 1SHJA 3SX0A 1KDOA 1Y3AA 1GG5A 1NOKA 5KNBA 4IQFA 5B2EA 1X8XA 1L8QA 2NUTB 3CGWA 5LR6A 3C6KA 1FJHA 2XHZA 2W42A 4K6MA 1E1CA 3CWZA 3G3EA 3CSUA 2WHXA 2JLWA 3IAM6 4DTCA 3RB8A 4YRMA 1EVJA 3SQXA 2JRLA 2P0AA 3TJRA 4H27A 4AB1A 3L7JA 2XIJA 1QR2A 1DX4A 1ZK2A 3EMKA 2FPPA 3AXSA 3A9UA 4CM8B 3WMFA 4YAOA 2X6TA 3IGFA 2OYSA 1ZSVA 3KJZA 4PS0A 4BLSA 3ANXA 4FM9A 4DSTA 4M0LA 1KMHB 3H1TA 1AB5A 1O97C 1J20A 2QAGC 4WIAA 3ZXIA 1GPLA 3HFSA 5FORA 4DPMA 4F4HA 1BEEA 2WHYA 2AUTA 4RVSA 3PQDA 3P52A 3V8BA 4AMGA 4OLAA 6REQA 4H1UA 1QGED 2Q4TA 5CT8A 2ACEA 4W5NA 4ZOLA 4CIYA 4I6EA 1O89A 5LC1A 2AK2A 1WZEA 4I7EA 5KSPA 2V7QA 1K8XB 4ALMA 3PXGA 7ADHA 1SXQA 2P1RA 1V96A 2NZXA 1G5PA 1P72A 2XUOA 1BYUA 2DY1A 3QBEA 4K26A 3L4BC 2GNAA 2B1QA 5KYXB 2EARA 2OCKA 1IB6A 1W59A 2DVMA 3G88A 4GPAA 4RGVA 2YHIB 4S05A 3DV9A 4J1SA 1O95A 1R8SA 2HLDD 4PTLA 4YJ2F 2O6LA 4WLNA 1KEKA 3NMUF 4GSLA 2ZAOA 1M8KA 4UU8A 1Q1ZA 1OAKA 4PZEA 4YP6A 2IYUA 3QUCA 4YECA 2C8LA 4KMRA 4CIAA 4ZAFA 4P3KA 1QTQA 1LY1A 1NSYA 1P7CA 2A57A 4F3NA 1QZXA 2PLRA 3C7DB 1IK6A 1HTBA 4GI5A 4GPEA 1GQRA 3BIWA 4HEJA 1XZNA 4JWTA 1VSVA 4G0OA 1PZXA 3GA7A 3B8EA 4OQ4A 3T1VA 1GGJA 5JSFA 1UKCA 3OQNA 4P3YA 3TQOA 1E3SA 4KXUA 4RCYA 3LL7A 4CG3A 3R40A 3BBPA 3OE1A 1RRCA 1V43A 2QL6A 3COYA 1ODIA 2PCLA 1F8FA 1PR3A 1Q12A 3EY9A 2IBMA 4QXRA 4QL3A 4C89A 3VU1A 2QTHA 1KS2A 1M75A 2BFAA 1Y5RA 3KBOA 3AOEC 3OZIA 4HI0E 4I8XA 3MSXA 2JLAA 1DL5A 2JFOA 4WA8A 1PSWA 2I2BA 4MW6A 4EATA 3L82B 3R41A 4X6UA 4ZOLF 3Q2OA 2D2EA 1HV8A 3DT8A 1QYWA 3AETB 4NMWA 5BY2A 4DMMA 2R7LA 2D06A 3N76A 1W73A 1Z4OA 2Q3JA 2HU7A 2WZDA 1R5OA 1A9QA 1UBGA 4H4DA 4MUKA 1OT3A 1BRMA 2JIOA 5DWQA 3ZNNA 1FUEA 2RHTA 2QD5A 1EIWA 3LMKA 2R00A 4OHOA 2FE1A 4AZ0A 1TFUA 4U6SA 3TQCA 2CNWD 4NFHA 2I3ZA 2R6DA 1I4DD 3B1YA 2QNBA 4MIKA 4R01A 1V11B 3EPJA 1NW5A 3X1WA 2V97A 4WBNA 4RXMA 3OIUA 2FDRA 5DOZA 1Z75A 3EXHC 1A9PA 3C1AA 3IBYA 4PHHA 3BORA 5KZMB 5AIAA 2VCYA 1XXHA 2C9BA 2UYOA 3MAGA 5E9JA 1OTHA 2YXNA 4BO8A 5FUWA 5TMPA 2NPFA 3F3YA 3FCYA 4FFOA 3OCWA 4DB2A 3P97A 4P7FA 3UHFA 3UT0A 2W2LA 3K3PA 3SQLA 3DEFA 2DR2A 3KD3A 2R1TA 1Z6TA 2Q9BA 4RPIA 1YVDA 4AJIA 1QV6A 1TK3A 3FE2A 4M60A 2H17A 3WISA 2RG1A 4ARCA 1P7YA 1DCFA 1P61B 4G8DA 4L8YA 3T6KA 1L4GA 1UJNA 4E22A 4X60A 4YMTA 4Q3AA 3PPWA 1KKMA 5CG2A 3OQMA 2X9QA 2AD1A 1YL6A 4FZJA 1PR0A 3JASA 5L3ZA 5HS6A 3WKCA 4Z4HA 4OLJA 4F4IA 4D8VA 5IXSA 1NM5A 3AONB 3ANTA 1ML4A 2EWMA 1DCKA 1ESMA 1IHDA 1GSIA 2Z58A 1YZLA 4HTAA 5A7HA 3WL3A 4DRXA 1W36C 2ENWA 1WCV1 1HEYA 1G9XA 2AF4C 3IV9A 1Q15A 1E5XA 1DBPA 1N9GA 3QVTA 1Q21A 2GPYA 1E3WA 3GPLA 1QMGA 1IYZA 3BK1A 3HCWA 1Z0UA 2J3DA 3ED5A 4PG7A 1W0CA 4E6EA 1PRYA 5F33A 5KX5A 3NU1A 1UT6A 2P0YA 1RQPA 5B1IA 2QZJA 5FBHA 1L7PA 1V5GA 4QUEA 5EZ6B 3WMEA 4MRSA 3H9JA 2INGX 3H5AA 1KETA 2AOTB 4KNWA 2GK6A 3L8YA 1H6DA 3ORQA 3HKDA 3LRPA 2B4RO 4FYKA 4IJ6A 4MWCA 4F7DA 1C1DA 2AQHA 5JCJA 5HKKD 3FRJA 4DV6B 2W2QA 1ZJZA 4PIPA 5TQ2B 4XOIA 2JD2A 3U13A 2UUBB 3ZIAA 4J4BA 3KVRA 1P75A 1N2XA 2FA9A 1Q7BA 1I2CA 2BAGA 2Z04A 3CZ4A 3TZCA 4YV0A 4YCAA 1X1SA 2F9LA 2G0AA 3CLSC 3FDZB 3DXXA 2K4MA 2XTMA 4I50A 1YS4A 4A8HA 2NU8B 1TVKB 1U99A 2GJKA 4R7TA 4ZVQA 1DAPA 1BQ3A 2PZBA 3JU3A 2CT8A 5ANRB 4Q7QA 3MJFA 5HYVA 4OP1A 3L06A 1Z4LA 4TTJA 2R86A 3UGQA 4D46A 4DM7A 3EDCA 3N6VA 3NYRA 5ELMA 1E3IA 4Q9LA 4AWAA 4DQXA 3LV8A 2HPHA 3MYRA 2EBWA 3ZG6A 4CEJA 4CV0A 1Q0UA 4RVCA 3FPBA 1UANA 3HI6A 1VHLA 1RD4A 3VC3A 1LBTA 4B3RB 1VMEA 1E8NA 1QIHA 2Y1DA 3DZHA 3KSUA 3NBMA 4L5CA 1AS0A 5FULA 3TLGA 4D0LB 4PR0A 5F1OA 1HDIA 3WIUA 1VRWA 5DTIA 4HQNA 4DIBA 4AKSA 1VJ1A 5BVHB 2P2DA 1K63A 3QVLA 4JLUA 4WOBA 1NMEA 2H9YA 3BXFA 4EFMA 1BE8A 2AN4A 4BBJA 1O58A 4R3NA 5ALZA 1SC4A 2W6ID 4EA6A 4NV3A 4EJ2A 2PUHA 1X80A 3GG9A 3IE2A 5IJZA 3VBEA 3W9UA 4MV1A 1OC2A 3NWOA 1KJ8A 5B53A 2PUBA 2ODBA 1VOTA 4ETIA 2I6FA 2X8BA 5BUSA 2P9HA 3TDMA 4X00A 3DUFA 4YRLA 4JJ6A 5FNVA 5JYDA 1JEYB 2FDCA 2RHRA 2VBFA 5DHTA 5HDBB 1RRFA 2RGEA 3A4LA 4HWKA 1ZK4A 2DM6A 4B80A 2YMMA 3ROQA 4QO7A 5FTLA 3WDKA 3OE7D 1YA6A 1OFVA 5HTOA 1NHGA 2A0XA 2GEJA 3CH5A 3E27A 4GRAA 5ICSA 1R7RA 1T6XA 1YKFA 1OBOA 5K01A 1ATZA 1L5OA 1UDCA 1X77A 2ZAMA 4EBBA 3EGWA 2G17A 2J9FA 3QU5A 3RVJA 1EJ0A 3UMJA 3CZRA 1EFRD 5L3RA 4EHAA 1JR4A 5AKLA 4XFJA 3EVCA 2O3SA 2QRJA 1BVYF 4IQ0A 5EMKA 4BB0A 3GARA 4W9RA 4ZA2A 3P9PA 3SXUB 5ALUA 1QANA 4MAFA 1WW8A 3W77A 2O3TA 3EF3A 4YRBA 2P2SA 2FPMA 2FU5C 5KPDA 3E5MA 3R77A 5A04A 4PLVA 4BUZA 4JI8B 2O1XA 1G5TA 2R8BA 3CLTD 2YRXA 3AR9A 4N1AA 4YP7A 3ZGOA 2FXVA 1NYLA 1MB3A 2QM7A 2WD7A 2YZ7A 3QK7A 3ETNA 5TMBA 2VP3A 4KDFA 5A1TA 3TKAA 4DPKA 2EKLA 5LLDA 4JT9A 3M89A 3T7DA 1LFDB 4KMOA 3HBMA 3AEUA 3VZPA 2C54A 1CUIA 1NV9A 1Q3HA 4ODIA 3MG9A 2CDBA 5E1DA 2WJ4A 3AUUA 1ORTA 4V2IA 5FNVB 4EF6A 4IF4A 3CLUD 1JEYA 4YRSA 3MJDA 4BMVA 4Q4JA 1MAVA 4GZLA 5IC6A 2FWJA 5K4HA 4KO8A 1T0PA 1OAOA 1DO8A 2V9ZA 1WD7A 4L4YA 4UAJA 3UKDA 1RHUA 2WK1A 1V9CA 4J3JA 1E77A 2O50A 1NTRA 2AW5A 2G1AA 2A9KA 3A0UA 5C81A 4ND2A 1Z17A 2R65A 4EK9A 3GELA 2I8AA 1X14A 3C5VA 5I9IA 2WJ6A 4FFRA 1RDFA 1OTXA 1EZZA 1AKYA 4N7RA 4P6VF 3UICA 1UT5A 4Z0PA 1BDJA 3PWTA 4LI0A 3TH5A 3M6VA 3AG6A 4GPTA 1ENPA 1ENOA 1H9BA 1TTQB 2A4MA 2E2WA 2QLJA 2XQVA 4EFKA 3HKEA 3V4RA 2NGRA 3G2KA 1XZLA 3GLKA 1SG0A 1OVGA 5ECYA 3GB9A 3NPMA 1G1AA 1XNQB 1N9ZA 3MBKA 3A1CA 4L4UA 2XMCA 5KJEA 1VE5A 1SOMA 3LAWA 2GN2A 3CG0A 3MGCA 2PWYA 2O5CA 3IR7A 4HSEA 3IBTA 1VQ1A 2C84A 1ZD1A 4ESEA 4UATA 5LP6C 1OA0A 5EFZA 4HUTA 1CUZA 1Q14A 3RTCA 1GAQA 5KTNA 1W0KD 4FK8A 1KQOA 3DHWC 5EXXA 4EFNA 4EAQA 3T41A 3TCKA 2E82A 2GN8A 3PX3A 5C5DA 3ND7A 4OKIA 1M2VA 3TWOA 3NTXA 1N2JA 2ZUSA 3OZBA 4LWOA 5AIBA 3PRJA 2O3RA 1A88A 1E2BA 1QONA 3O8DA 2ORWA 4KUEA 4CM8A 3GQVA 1T3TA 1PBNA 1J2EA 2PD3A 4UHFA 4GP9A 4AUNA 1ZL2A 4MDFA 3HEBA 5GJWC 2IKQA 5DBHX 5DNUA 2FJPA 2SKDA 4UJ5A 4WFQA 4DR6B 3BFKA 1PLKA 2D8AA 2ADMA 3UJBA 4ND7A 3KAPA 3L6CA 2ATIA 4TN5A 2RGRA 3WIEA 2Q5JA 5IZCA 3PKIA 2G63A 4RD2A 4TYPA 2EP5A 3THXA 4B3MB 1WCXA 1ZHFA 4D4HA 2O8CA 3TVTA 2BD0A 1B0ZA 3COVA 4HQRA 4N8EA 4YTEA 1KI1A 2ZZKA 3MK31 3RWOA 1UAGA 3UYLA 1WDLA 3EFHA 3UOGA 3GLSA 3AJ8A 3F9CA 1N3IA 3KVYA 2YXLA 1JKJB 2ZJ4A 2G82A 5I7HA 1SXHA 2WUVA 3HNOA 1NZJA 3T38A 5M29A 3LIIA 4XH9B 5CVEA 2JVIA 1DBIA 3I2JA 2FPWA 2IOYA 2PT7A 3S1AA 1FL9A 4EHKA 5K0SA 2YJGA 5EIHA 4FJ1A 2NXEA 2A14A 3I04M 4JOCA 2R6ZA 4N82A 2Q9UA 1TADA 1VLZA 4CKEA 1D2EA 1KFCB 1IONA 1LBIA 1UH5A 2QP3A 4MWGA 5DK6A 5ULLA 1H8HA 4P3NA 4P83A 4Z7NB 3JSAA 3OQVA 4OIMA 4AJ9A 1C4XA 1MKYA 2Z6AA 3Q8MA 1M83A 2BEWB 1HQYE 3T1OA 2WZBA 4AZVA 1WUYA 1LRKA 1U3TA 1R6XA 3Q2IA 4JS0A 3SAJA 3JAMA 2E1RA 4JLBA 4HWGA 1SCUB 3UMVA 5FNVF 5DJ5A 2GZAA 4FR5A 5H1YA 3AIMA 2ZSEA 3WMXA 1OXMA 3HV0A 2B21A 1Q7CA 5I9NA 1ORDA 3F8WA 3BB1A 4HAYA 2XWPA 4O29A 5A7FA 3IP9A 3BTUA 3QXGA 3A3PA 1YT5A 2RGYA 3DZBA 2GM3A 2XUIA 2Q1UA 2IPMA 3BWMA 5IKEA 3ZD9A 4L78A 1NVVR 3RIEA 4GDFA 3U3KA 1TRHA 1CUSA 3VZSA 1P33A 4KZPA 4Z8YA 1FS4A 2FWNA 4RV4A 2RB4A 4JT2A 4CM9A 4ZCPA 1M76A 1D1TA 2H4WA 5HM8A 2X9NA 4NR0A 1L3BA 5H9VA 4HG2A 3RC9A 3NP7A 1CK4A 3B9BA 1E2KA 4R1UA 5FWYB 3ILHA 2QQFA 2JH8A 3L4BA 1W47A 4MB2A 1G0NA 1G7RA 3GUUA 3JVEA 2ZRBA 4V2UA 4LF6B 4HDRA 4DBLC 3T9CA 4KSYA 5EHGA 4L50A 2JKYA 1NLZA 4FFMA 2G72A 2Z43A 3TXAA 2YY7A 3FYUA 3MIIA 4ZI5A 2H8KA 1P0IA 2HMUA 4L5IA 1PT9A 2JGJA 2I34A 3LHFA 3V4SA 3LBAA 2ZI5A 2W48A 4MEJA 3WJ2A 3JD1A 4I4TF 2GDJA 2GESA 4OHBA 4RDCA 5ALHA 2C2HA 3DHNA 1VIMA 2Q3EA 5JALA 4JV5B 3M3DA 3IX7A 4H08A 3CF0A 5DWVA 4FILA 1KBZA 1QZ3A 2X23A 1GQSA 4FD3A 4BIMA 4ZYLA 3E8MA 4U3JA 1QR6A 3AJRA 5I4IA 3VR6A 2XB8A 2G28A 3CLRC 3WLSA 4FYVA 5ALYA 4NCIA 5LVAA 4H0FA 4UM7A 3AINA 3B1JA 1XCGB 4KQJA 3OX4A 1CUXA 5AMXA 1E3JA 2Y1LA 4NVRA 4DXDA 1W7AA 1H1LA 4KWIA 5TQ0B 5LMCA 3VZDA 1YRWA 1VHJA 3AI7A 3V1UA 3ZBTA 2H29A 4GI2A 1KJNA 2H7YA 1TECE 4IZ6A 3WLOA 4A4DA 4EHIA 1GGFA 1BFKA 4MVJD 3UB2A 4D9MA 2I9KA 1NPDA 3MBOA 4WOPA 1C3OB 1NVMB 1YULA 2H9IA 1PJTA 2ONZA 1X7GA 1XCPA 2YZGA 3HKDB 4GD3Q 4HGPA 4MRVA 5A71A 3UAVA 3QITA 2V7UA 2VJOA 1NR7A 5BRNA 3ZKWA 2ZXUA 3NXKA 3U6BA 1Z5ZA 2PH1A 2FZ5A 3TIIA 4GBMA 3C7TA 4EPVA 1J2JA 4EQZA 2XBLA 2QPAA 3AFOA 4JSRA 4NMXB 4PLPA 5D3QA 4Y2XA 3KOUA 5LQCA 3VPAA 1KYYA 3NHJA 1XOIA 1YE5A 3U3ZA 1CYDA 1T6NA 2WI8A 1L3CA 3O21A 2TS1A 2N47A 1YQ9A 2YUTA 4HRYA 2IPOA 2P2LA 1MX9A 1SD1A 2W11A 4DA9A 3L6EA 2P6RA 2WR8A 2LKCA 4WADA 1WOMA 2HA6A 4R0MA 4BKPA 1SBIA 3OZ7A 2QSJA 1DXQA 1DBRA 3GXOA 3PPYA 5KJ1A 1IHPA 5ELXA 5FFFA 4C0QC 5BWMA 4OLBA 2RGXA 3VR4H 1HUQA 3OZUA 4MIOA 1LW7A 2FWBA 2HY7A 2WABA 4YRQA 3K6SA 2VNSA 2ZQZA 3TZEA 3RPEA 5IHPA 3NJ8A 1RU3A 3BFVA 2G9RA 1WP4A 3IP1A 2VXYA 4HH4A 1QP7A 1G6KA 1GPWB 4NABA 3C2QA 4BNVA 1Y1LA 5JFOA 2IYTA 4B48A 4UTZA 4WKNA 4KO3S 5CH8A 2BDEA 4H7IA 4EPXA 1V5WA 4Z6KA 4AG3A 1AQUA 2IYXA 2IGTA 3DUFB 3KD2A 4G4SP 3U4DA 1T4GA 3INNA 1GPDG 3IQFA 4XM1A 4CTNA 3AL0C 1AKVA 4TYYA 1ETUA 1JF8A 4K40A 2YVLA 4MLDA 2O52A 2D1QA 5KQGA 3LOUA 4XTRA 2G25A 3BGIA 5FTKA 4ANFA 5IVHA 5CH5A 1A9XA 3LFTA 4J76A 1N5KA 4ZZ3A 1CRZA 4Z1MA 3SYMA 2HD4A 5AXAA 3UT6A 5E6UA 4ABYA 5C1BA 1MU0A 3GLHE 4N0MA 3EXIB 1YZYA 2GCIA 5HIMA 1BMFA 4KXLA 1UINA 5L7YA 4CEHA 1A72A 3VR5A 4C7VA 4ENTA 3IEPA 4XUGB 4YI5A 4C0XA 4AM8A 5F3WB 4B3XA 2QT9A 4HWPA 4QTUB 3WVNA 2GAOA 2HLPA 3H11B 1RTKA 2JCVA 3G2NA 4ITUA 3L7OA 1Z8NA 5JQGA 1OZHA 1OXSC 1XJQA 1YB7A 1GVNB 1ZIOA 1WSWA 2XJ9A 4BDTA 1DKOA 1SAYA 3PPXA 4QA9A 3IAS1 2JAPA 4KR0A 2O07A 3LF2A 1SNYA 2Z4SA 4QVIA 3KPVA 1KK3A 3F97A 4Y2YA 1X39A 1ZRHA 2QDXA 1YS1X 3K92A 3CXUA 5ICFA 1QU3A 4B6EA 3VAYA 3OY2A 4XQGA 4DYDA 3GT7A 1AXRA 5AQ1A 1F3LA 2GLXA 3BH7A 4FCTA 3LX6A 4YQYA 3TCNA 5AH0A 2YWEA 4TKVA 5FEUA 1PQPA 2CV1A 2Q2NA 1CE8A 2XWBF 1CLUA 1WQ3A 4IZHA 2VJKA 2BMWA 5EVCA 5K51A 3B7PA 4WECA 1AN9A 1KE1A 2OWEA 4MZDA 1FP6A 4C4ZA 3SQNA 5JEEA 3VNUA 3GRRA 4JBNA 2WU3A 4B7XA 4OHMA 3UV3A 1PNQA 2EZ9A 1ZOOA 5IT9A 3Q3IA 4LUCA 3N2EA 2I33A 3LYLA 3AJ9A 4KI0A 3KLOA 1X7WB 4BUCA 1EDZA 2JFGA 1G9SA 1C80A 1XZFA 2V3WA 3C24A 4JHXA 4RKRA 3WL7A 4BTEA 4GPIB 2J41A 1RQ2A 1SOAA 3QOYA 4YO7A 3FHLA 4MRAA 5T4EA 1UJBA 5IP5A 3E9YA 3QWBA 1AKWA 2ZT8A 2V58A 4J1NA 4Q1EA 5SY6A 4TLEA 1HNXB 3H2GA 2HB6A 3WK5A 4HEA1 1UC8A 2GN1A 3IO3A 3BWYA 1ID1A 3RTBA 3DNPA 3KUKA 5H4HA 4M88A 4LS3A 5LIRA 2GDZA 2XE7A 2XF2A 1W6UA 2ZTMA 3LG2A 3VKFA 1GUDA 4EO7A 1JVNA 5TIIA 3HU2A 3HJNA 1VPVA 4RKFA 1NOIA 3NTUA 5C1OA 3NTVA 1T9CA 4MB0A 1NG9A 1H8ED 3G82C 3WLIA 3PEEA 1VKOA 4G9BA 3RC7A 1U5BB 4M4SA 3SK0A 4BNNA 3DLCA 4MO9A 4RJJA 1KNQA 3QI7A 2O3QA 3DZ8A 1UPXA 2OV1A 3UUWA 4R1NA 5KMGA 3S40A 1X8LA 2F8LA 1U7WA 1FFGA 1OWMA 2HHHB 2CCGA 2F2TA 3LY8A 2WIGA 5CIQA 2HUNA 5CLLA 4Q3KA 1DKNA 2MMCA 1W5EA 2XQIA 1U28A 6YASA 3NWBA 4KVZA 3AM3A 1T5SA 1Z0ZA 4N48A 5AD1A 5EHQA 5BYKA 1BIFA 3RYHA 4W4TA 1D04A 3I2HA 1WW3A 3UT5B 1NQUA 1TM3E 5IH3A 2GAJA 3VOTA 4BFUA 3B3QA 2C95A 5EPEA 3U4CA 2XUDA 5JQGF 3G7UA 4ZEVA 1YRQA 3DB1A 4LDPA 1N32B 3DAHA 1V11A 4M1WA 2J3KA 1FMTA 1F38A 5H83A 3RVRA 4HGQA 4ZWNA 4WN9A 4D56A 2I7XA 2WHQA 1LEHA 3FWZA 1NJGA 1E0SA 2QV0A 3IDFA 2PTHA 1RKQA 4UULA 2F8TA 1Z73A 2WD9A 1OZFA 1F3OA 3GPCA 4BKOA 1JHRA 3JAKA 3RYCB 3U7HB 1X7DA 3BJRA 2X42A 1OD6A 1AM4D 1PQWA 1ZD3A 2GK3A 2AGVA 4XQ0A 2ZUTA 4CMKA 5L3SA 4G26A 4GLFA 5B4TA 1RZRD 1XQ9A 2GSWA 5K4AA 1PFUA 1PWYE 2D7JA 4ON9A 1BMQA 1MA0A 4Q1AA 3QEAZ 3AUJB 1GGHA 1ZJ5A 2RBKA 3WGKA 3NP9A 1VMAA 2VLBA 4B4OA 2QN7A 3LYAA 3M82A 3R3ZA 2HMTA 4M9QA 2IELA 3A04A 1BA3A 3L6OO 2IL1A 1W85A 3STUA 2AZDA 3WQQA 4X3PA 1WKCA 2M32A 1RWPA 4HO1X 4KH1A 3C3PA 3PC4A 4LJYA 4BBZA 4KNYA 1HDCA 4EGSA 2XRYA 1RT9A 3EVDA 2GBGA 5CCXA 3BD9A 1EFVB 1YFLA 3ONEA 3K4HA 5I8ZA 1G8KA 5K05A 4AJOA 3GYGA 3Q0TA 3U9TA 3CF4A 4MV6A 1KL7A 3SIXA 1NUHA 2CK3D 1GAXA 3K0EA 2XNSA 5EMJA 1QHYA 4JUCA 2GK4A 4I4CA 4OQXA 4DCNA 1FTYA 1B93A 2DLDA 1KZ1A 1UBHS 2ZBPA 1UBUS 1IQ0A 3K09A 3KLMX 4NEGA 5G0SA 3ZGXA 5PGMA 1ZIPA 3L6RA 3EB9A 3PEFA 1KP9A 1MB4A 3WFZA 2RHJA 4BWFB 3F74A 2JFFA 3CR8A 5E9QA 1DRJA 5DYTA 2ZSIA 3UMFA 2BUAA 5EE1A 5I4KA 3BF7A 2X4DA 4H0CA 1L7AA 3D8SA 3LFHA 4E14A 4GMDA 5EG5A 1EJ6A 1JQ5A 3AEQA 4WXHA 5HWSA 3NEJA 2YV2A 5AJVB 4DEXA 3QPUA 2GYYA 5DXAA 5EHNA 1MJGA 2VTBA 5J5VA 4TQAA 5KO2A 3VNQA 3BD7A 1PEKE 2BR5A 2O05A 3J81k 3LI2A 4LC0A 2TSYB 4V3BA 3UG7A 1M6EX 3R9KA 1FPMA 1FNMA 2VKTA 2XI4A 1YQEA 2Y67A 3CUYA 2GBPA 3P2JA 4KIWA 3RU7A 3C3YA 3NBKA 4FX2A 1SQFA 2VIIA 4RCVA 2J9XB 3RS0A 3WRWA 3CRVA 1TZ2A 3RHSA 3I5YA 4CQLA 1HX7A 1OHHD 1B41A 2C1ZA 4G0YA 4DCOA 1AN0A 3TW6A 1WCWA 2Z5VA 1XMQB 1I33A 1A9OA 3N7UA 4Q3CA 5DNWA 2WJAA 4EI9A 2WM3A 2YZNA 4FDAA 4FOSA 1JA9A 1OXTA 1ACLA 3WV5A 3A2MA 3A1VA 4QTYA 2ORVA 1YDEA 5KWJA 4FDLA 3TD6A 4PHTA 2OCAA 4OXKA 4RAOA 5JRJA 3H8SA 3IDSA 4URYR 3OIFA 1OGJA 2W6JD 5BVGA 5KEIA 2DXIA 3K70D 3M6LA 2R4UA 1M34A 2C2BA 4RQAA 1DMRA 1VECA 2DTDA 1H6BA 3HJHA 2GZMA 1EX9A 1T0BA 1G3IA 1WULS 2YTZA 3H1EA 4ILEA 1SOWA 2H85A 4LZAA 3ZXXA 1AU9A 1CT9A 3GXBA 3ODPA 4FEYA 4U7JA 4H4CA 3H19A 4F3CA 4JLWA 1HDGO 2OGUA 3FZQA 4Q6WA 2D2VA 1T1JA 1UKYA 2WG1A 2XCRB 1O6CA 2C2KA 3UWKA 3UGKA 3GMSA 4PTZA 3TRHA 3AR6A 2IYNA 1IJKA 1ZRMA 1DXHA 4EG3A 1BE0A 3SM9A 2ZSDA 5ECWA 2J6CA 3IE0A 2GCOA 1L1QA 4JMPA 2VRBA 1E2HA 5ICCA 2R85A 1X1TA 4AJEA 5JQWA 1SXIA 4BNMA 2WYOA 4DMFA 3I53A 1L5NA 4A26A 1OAOC 1LPMA 3PGXA 2BGWA 1PD1A 2RKWA 1EGAA 3ZDQA 2Q27A 3BXGA 5FUQA 2F4NA 2NVUA 1KPGA 2EHJA 1VYHA 3DV0A 4ZCSA 3MTBA 1Q83A 3MFQA 2VBGA 4MA0A 4UEQA 1RYFA 1ZKDA 4L5YA 2FPLA 1SVNA 1XAJA 1SQSA 3JYQA 1R12A 3IA7A 3MTGA 4NU6A 4GC9A 2YCBA 5A06A 3PX7A 2NUBA 1RR6A 1QYXA 3SXUA 2W22A 4NCHA 4EDFA 1FJ2A 2O0HA 4KQIA 3TZLA 2NSLA 3QLUA 4LJSA 2VHWA 3EG9B 1KSFX 1E2MA 3QH4A 2B61A 2PMEA 3PFNA 4J9VA 3G2JA 1E2DA 4QPPA 1PSDA 3WGGA 4CLXA 2OZLB 1I4LD 3NOVA 2IEGA 4EG1A 4ABTA 4R1MA 3W2EA 1U0HC 3SE7A 4E5PA 2BEVB 4Z3DA 3KXIA 3OD1A 3D4BA 2PXCA 1RYBA 2XE8A 2B1RA 3OETA 3SY8A 3R5SA 2LCFA 3CCFA 3O47A 4ZMBA 3MCAA 4X45A 1JWBB 5CPFA 1UBRS 2O3UA 3I23A 5D1HA 1UF9A 3BQMB 5B1DA 4AUKA 4DG8A 4A36A 4DQKA 4H6XA 3BCUA 4RIEA 4RPLA 1ZXXA 1FP4A 4MGHA 3SZOA 1AMUA 2PGXA 1A5BB 5D5HA 3EQ6A 5K8TA 4PICA 3KYJB 4XUCA 3I39X 5B37A 4KLAA 2X3YA 2OHIA 5AYVA 1QKJA 3PYLA 3SG0A 3L0YA 5K3EA 1ZH8A 4P92A 3IKVA 4PZZA 5AKXA 1ESNA 5K3FB 2VFAA 1AA9A 2DP4E 2G9VA 1Y3HA 2PANA 4JOQA 4EKYA 1Q3KA 5AESA 2A5LA 3HYSA 4C7OA 1ULTA 3RADC 1LDNA 4JB8A 5EWLA 2DQSA 3GG2A 3EG9A 3WO1A 5HIIA 3LC7O 2EJBA 3GU3A 3R5HA 2JCGA 1GY8A 1SN7A 3EXFB 5KOHB 2JGNA 1GT6A 2D5CA 4HT3B 1D4FA 4RK1A 3V4ZA 2JBHA 1F5NA 1IN4A 1M54A 1CUGA 3D4IA 5B6JA 1IZZA 1I1HA 5EIEA 3CT4A 1AMNA 4H15A 1DAKA 1DQRA 2QN8A 2FMFA 2ES4A 4FPXA 5E7MA 2N3ZA 4MI6A 4YQZA 2HSZA 4MGEA 4MKIA 3WG9A 4BMPB 2DHQA 1ZRSA 2QTFA 3SNHA 3GQBB 1OYVA 2OO5C 4NP6A 4ZDKA 3THYB 1PNVA 1TJPB 2WP0A 4HMPA 1ZC3A 2QLMA 3PPIA 4GE3A 4LNHA 1MXHA 1KY5A 4S1PA 5HQJA 3SJAA 5KOJB 1M2EA 2ODWA 3JQAB 1RLTA 2I2WA 4ITRC 4N7MA 4Z86A 5SY9A 3UHAA 3ZE9A 2JLBA 2DFNA 1CY8A 2VEOA 1BH2A 3H5WA 3HVJA 4FFBA 4EECA 1AXGA 4IOKA 4JEHA 1ZRNA 3GEMA 5BQ3A 4IDCA 1HT1E 3LP5A 1WVGA 4TPKA 1TKBA 2CV2A 1V3QE 1YC2A 3QPVA 3V1NA 2H8GA 1GPBA 1P7WA 4PQFA 3FPSA 3EBLA 3OKAA 3KYCA 4WLUA 4AXXA 3FR7A 4O4HF 5ALSA 4B1FA 4KR6A 4LJLA 3SR4A 3E70C 5F2KA 1SVOA 3VTZA 3KVVA 3DAFA 3OJLA 4ZTUB 1PDWA 3HRIA 3FOCA 1H2FA 3DO6A 2JC3A 4P0TA 4PO8A 2NAFA 4PZYA 1NRIA 1U2DA 2AKYA 3D2AA 2X0DA 3H16A 5IDVA 1JN0A 1QGUB 3OQIB 4H16A 4YAGA 4ZN6A 1H2YA 1Q95A 1X7WA 2ZB7A 3QVXA 1P2BA 1U9YA 2Q5HA 3MUFA 4N5HX 4TXNA 3TB6A 3KWMA 1DQNA 1K8RA 1MO6A 1EB9A 3D64A 3G23A 2QG4A 4OY3A 4IUDS 2OYRA 3R4VA 4TZ0A 2NMVA 3M6FA 1C3EA 1GUAA 5DPMA 2J5BA 1UXHA 3E2IA 1R6AA 4OMCA 5IEJA 1AV6A 1FK8A 1GNVA 5DM2A 4I8DA 1Y8RB 4OL9A 3TO5A 1V9SA 1OYYA 5F4ZA 1EVLA 2WUEA 3S7TA 5B36A 3QW2A 4D3XA 4IIXA 3BL5A 1MF7A 1KMHA 4N65A 4L8VA 1YS2X 2C4KA 1NM5C 2X6QA 3AFMA 5TT0A 4KYVA 3WXMA 1P5HA 2AQKA 5LUAA 2RJNA 1IAVA 4X8LA 2B1JA 3GP3A 3W3AH 4X1YB 1WB9A 3CB2A 2E4YA 3NCTA 1WSDA 2DT8A 3G5LA 1I4EB 2Q4DA 2IGBA 2WMOB 4IEIA 2CCKA 2F9FA 3EVFA 4ZVNA 2EJVA 3U48A 4YRTA 2R47A 1E1DA 4EJSB 2BGJA 3UK1A 3GMDA 3M81A 1UFRA 5EUBA 2RD2A 5JAMA 1SVUA 2QZPA 4ZCLA 1XNHA 3DVQX 3QX9A 3KLBA 1A04A 2YWDA 1SXPA 2G1PA 4L4ZA 1W85B 1M0TA 5JSHA 4JT8A 1T3SA 2DFLA 3F6RA 2YMLA 5CVVA 1DBQA 1D6JA 2RAVA 3EGOA 1D3AA 3OLYA 4RZIA 4D80A 1XAHA 2A4KA 4Q01A 4XB1A 5AVSA 1HSZA 1IOZA 2FUKA 2OZKA 4DREA 3LCVB 4V0SA 5TGZA 4QNMA 2FQWA 1EK0A 1HPLA 1ULHA 1Y8RA 4HV4A 3M1YA 1Z6YA 3H2YA 3ZZ1A 5JR3A 1T8WA 2E4VA 3ROMA 3B85A 2BE9A 2ZJ3A 1SVMA 2LD4A 1JWAB 2VYCA 2XGMA 2OHVA 2GR9A 3EVNA 3IYLW 2ZRLA 3PCXA 5LMUB 5DE3A 1P91A 3VPDA 3EW7A 4ZZ0A 3P1JA 3NUZA 2QSUA 1NUAA 2DQZA 4G56A 1ISIA 1YDHA 2H3EA 2C1EA 3ELUA 4ND8A 4WOJA 4A0FA 2F55A 2HSEA 1SCDA 2CXQA 3EARA 4RJ2A 2YWGA 3T7RA 1M1NA 3FPGA 4W82A 3TI9A 5LNK6 3E2PA 3KG2A 2RH4A 4OFXA 4QTTB 1SXJB 4L57A 1TT7A 1SU8A 4TSFA 3WWDA 3OSUA 2YHSA 5CXQA 4NE7A 4BV8A 5E2BA 1YRHA 1Z36A 3DA8A 3ZCSA 5KU1A 1PWZA 2P40A 2YHBA 5KC8A 4FOOA 1BU8A 2G5TA 1J9GA 1G8JA 4AKIA 2X6RA 1H42A 1DEHA 3F73A 3LUJA 4FXPA 1RJGA 2LRHA 1GOTA 3D7NA 3PNMA 4MCAA 5EMNA 4YNBA 4ARBA 5AUPB 3M5PA 3FIUA 3IKMB 3OZRA 1LSJA 4MS1A 2CDCA 1NATA 1ONSA 3EF1A 1M5RA 3DAOA 2Q9CA 1ISMA 4BDSA 2CBGA 2I2XB 1ZCAA 2CNNA 1JPUA 1RQRA 2IODA 3BC1A 2ZEJA 4FKZA 4TMZA 1U3VA 4NOLA 1PTKA 1MJHA 2WIKA 4KLNA 2B1IA 1Z34A 1JDPA 2ZRKA 3QVOA 4ZCQA 2FOLA 3D6JA 4HR7A 2JLQA 3G0GA 2VHXA 5JY1A 2RAUA 2FLKA 6NULA 3H4TA 3B1XA 1NAHA 1VGRA 2Z5LA 2VP5A 5JBNA 1FQOA 4L28A 1P1FA 3F5DA 4LECA 3ZBQA 2FZGA 3VR4D 2D54A 2VJBA 3PPVA 3I9KA 2N75A 3NC0C 3KTAB 1S4MA 1EX6A 4QQFA 4AKGA 3O8LA 2C0CA 2AFIE 2X1VA 3CEMA 1L7RA 4JBGA 4BFTA 1V3VA 1GRNA 2Y1XA 2YS7A 4B82A 4F86A 1NF2A 4JI0B 1H2AS 4DQUA 4EHBA 2XZDA 1VC2A 1JFLA 4RYLA 1XVIA 3O9VA 1U31A 2NV2B 4ARUA 1ZONA 5H70A 3I1YA 3VHLB 2VDVE 4RA9B 2PL5A 4BV2A 3DKIA 3LFUA 3SX4A 4GC5A 2EV9A 2REXB 3NDIA 1EDBA 3KKPA 4XIFA 2O2GA 4ZMSA