2G4SA

Anomalous substructure of nbr1pb1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
AMEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Next to BRCA1 gene 1 protein
total genus 24
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2g4sA01
1WYWB 4KIKA 4NPNA 2MA9B 3V6EB 1LXDA 1Z5SB 3UGBB 3PREA 4LCDE 1TBEA 4BVUC 1WJ6A 2KANA 4KZCA 3SHQA 1K8RB 3OLMD 1GNUA 2MBOA 4W9LA 4K7SA 4HWIB 2N1WA 2WWZA 2N9XA 4E74A 1L7YA 5DPRA 5FR6A 4HK2A 2BKFA 5JZEB 2KJRA 2C9WB 5IAAC 3O65B 3TBLD 4GDKB 4MJSB 4HCNB 1WGGA 3H1UA 1WZ0A 3A9KA 1LFDA 2KX3A 2MSED 1GUAB 5TR5A 1OEYA 2KFKA 4GSWA 2KJ6A 4K7WA 3UQAA 3JSVB 2D11A 5DPSA 3R66C 3ZNID 2KFJA 1ZGUB 2BF8B 3C0RB 2JVCA 4G50A 2LZ6A 2HTHA 3Q3FA 1P1AA 1OQYA 2HD5B 1G6JA 2CHZA 4FJZA 4W9KA 4F1SA 2CHWA 2CHXA 1V49A 4IW0A 4KZ0A 1GJZA 2G4DB 3N30A 1WGDA 3ALBA 2I1KA 4M0WB 3B1LX 5AZGA 4NQLB 3RZFA 2KDBA 2KNBA 4FBJB 5KHQA 4RM8A 3W1YA 4ZYNA 1YX6B 3QQ8B 3HM3A 2K1FA 1IPGA 2M17A 4RMAA 3PHWB 2ZNVC 3PRPB 1GC7A 2FNJB 2N9EB 3PVLA 1E5WA 3ZDTA 1EO6A 4MEMA 4TUUA 3ZUNA 3UIPB 4FA6A 2K6DB 2DZKA 3APDA 3CSTA 3M3JA 3P2BA 2KLGA 3PRZA 2FIFA 3A4RA 4HPLB 1UBQA 3KVFB 4IM2A 1WJNA 3R7QA 2K39A 2YVCA 4MGIE 2YLMA 4GOCA 1C3TA 3NOBA 2DYBA 3PSEB 2MX2A 2EMTA 3NS8A 4II2B 3VQIA 3ZNZB 3ZVVA 2WX0A 2XEWA 2KOXA 1UD7A 4MSQB 4FULA 5CHFA 3PS6A 4ANXA 3X23A 1V81A 2DAJA 1AARA 4WWOA 1E7UA 1KOTA 4KSLC 2C7MB 3A4SC 5HKHA 2LUEA 2LWPA 3DDCB 4A3PA 3QIJA 2CKHB 2KFKB 4W9DA 4KSKC 3VH4B 3UF8A 2KWCA 2MP2B 1RAXA 3L54A 2DYOA 1GC6A 3VUXA 4MSMB 2JPHA 2XK5A 4ICVA 5JH5C 2KVRA 5CX3A 4URKA 1I42A 2DZJA 2KJHB 3PPAA 2HJ8A 2KXJA 3HK0A 3TIXA 5LLIA 3U30A 1R4NI 1T0YA 2KQ7A 2N7EA 3JSVA 4MH0E 3ZIMA 3RZWC 5CHWA 5J18A 3ZDMC 4ICUA 3QAQA 4MM3A 3N3KB 3ECIA 4TV3A 3AULA 4NJ7A 1LM8B 3VAWA 3PZDA 2MWSB 3AI5A 2LGDA 1S1QB 2DZMA 1JRUA 1J19A 1RFAA 3VTUA 2IBIB 2KMCA 2N9PC 1E90A 4WAAA 2BYEA 2LGYA 4AUQC 3R3MA 4EOYA 4GDLB 1YX5B 2K25A 3H7PB 2OJRA 3ONSA 3H9DA 1WGYA 3B0AA 2GBRA 3VH3B 2AWTA 4WJOA 2KN5A 3V60A 1YIWA 4EZKA 3KUDB 4I6NB 1WY8A 5J2RA 2MP2A 4LJOB 3LJ3A 3UIOB 1I35A 1WF9A 2M4NA 5KHOA 1P3QU 3VFKA 2Y5BB 3ZNGC 2V1YA 4A3OA 2CR5A 1UBIA 3LDZE 2MLBA 1TTNA 1WX9A 1WH3A 2LXCA 4KDIC 4W9IA 3RYTA 3ZTCA 3ZNHB 1KLVA 1VD2A 1XQQA 1NI2A 2DX5B 3W1SA 3PLVA 4GIVA 1XT9B 3ZW3A 2LRWA 4AJWA 4B95A 2N4FA 3A33B 3MTNB 2FCMA 1WMHB 3NY5A 3PLUA 2PPHA 2GBKA 5AZHA 3VHTC 3QK0A 4TQ1A 3RCZA 3VDZA 4F8CB 3ZO5B 1H4RA 1WXSA 4FHJA 4ZRIA 1P98A 4W9EA 3WAMA 2KTRA 2XBBC 1QZEA 1E8WA 4XC2A 3MHSD 5D94A 2AYOB 2C60A 4GDLA 4KVGB 5JHBA 2L76A 1WM2A 2LI5A 1WE6A 1L2NA 1TGZB 4WWNA 3L10B 2ZVNA 4DHZE 2KHWB 4K1RB 2KMAA 2RD0A 3DVNU 4J6IA 2Z59B 4FJVB 4OVUA 3EHVA 2ZPNA 5DPTA 3QJZA 4G3XB 2D2QA 3S2AA 3NHEB 4HDOA 1Y8RC 3ML9A 4JGHB 4NY0A 2NPTB 3H6NA 2J0MA 1P9DU 2M1MA 3HM6X 4ANVA 1E8XA 2MBBB 3IBEA 2L00B 5DCNA 4ASWC 2AL3A 1ISNA 2DYMA 4GXBA 1NBFC 2BGFA 1EUVB 2GOWA 2MBHA 1IP9A 4FHKA 4NAWA 3RUIB 3APCA 2JF5A 1Z2MA 3QCAA 2KLCA 2AL6A 4ANUA 2JUOA 4TQ0A 1RRBA 4CO7A 4MELA 4MGKE 2KKCA 1YQBA 2IO3B 2PE6B 3H7SA 4G11A 1P0RA 2DENB 2JWZA 2GBJA 3IG3A 2O6VB 4IM0A 4OVVA 2IYDB 2L7RA 2ZJDA 2FCNA 4K81A 4TKNA 3UQBA 1WRDB 2BKRB 2L0TA 1X1MA 5C1ZA 3V62A 3PV1A 4A20A 4ZDVA 3DBRI 2UYZB 4IWQA 4BBNF 3V61A 1UZXB 5CHVC 3KYDD 3WAOA 2L05A 3JW0X 5JHAA 5LXIB 1WX8A 4XX5A 3QWZB 2LRUA 4MJSA 3A9JB 3H7PA 2B3AA 3ENEA 4ZRKA 1E8YA 3ZLZA 3VTWA 2KQSA 1WX7A 3PGEA 3TJPA 1WJUA 2IZVB 4F7ZA 4HLEA 4AP4C 2BWES 3DVNV 4JIOU 4NQKE 4W9GA 3DQVA 3HIZA 2R2QA 3KYCD 2REXA 2WX1A 4DBGA 3EC8A 2ASQA 3UINB 1IYFA 4PYZA 2QHOA 1WGHA 1C1YB 4LDTB 3DBSA 2LJ5A 2NCNA 2IO2B 2NR2A 2PE9A 2ZCCA 1WR1A 4GDKA 1WXVA 2RPQA 1XD3B 2ZCBA 3BY4B 4EEWA 4HVBA 3DCGA 4P7IA 2Z0DB 2IY0B 3SDLC 1ZW7A 1KM7A 3ZTDA 4BKTA 4E3CA 1YJ1A 2KDFB 4IG7B 1V6EA 2C7NB 3QA8A 4YL8A 2FIDA 2VRRB 4II3B 1WZ3A 2JY6A 3DVGX 3PHXB 3VUWA 3L13A 2LGXA 3KUZA 2HE7A 4KIKB 4HDQA 1UELA 2MBQA 1ZKHA 1WJ4A 3GZNI 5C23A 1VCBA 1SGHA 2KDEB 3Q3JA 3PRMB 3AXCA 4CYEA 2O6VA 3EFUA 2K8HA 2MQJA 3JYUA 2MBEA 3RULA 3GOEA 1PQSA 2C7HA 2NBWB 3EECA 5AEKB 2FCQA 4DHJD 3DOWA 1KJTA 2GMIC 2LXAA 4PS3A 3KW5B 3IFWB 4I6PA 4B9KA 4HPMB 3VUYA 2NPTA 3M62B 4KDLB 4WJNA 3ZRCA 5IA7A 3QARA 4NAWB 4PS7A 2A4ZA 3VVWB 2DZIA 2I1JA 1E7VA 2KD0A 3A9JA 3A9KB 4AOFA 1J8CA 4WJQA 3TL5A 2IO1B 2A5UA 1TZ1A 5E6PA 3DBHI 2FCSA 2BPSA 2G4SA 1EF5A 1UGMA 4BBNC 1R4MI 4IWOA 2L0FA 2J0KA 3JVZX 3KUCB 4X57B 1U4AA 2V4LA 5L83A 2MCNB 4GB9A 2W9NA 3ZKJC 1WR6E 3R7RA 2BYFA 4GU2A 4HJKA 4NJ6A 4WJPA 2NBVB 4MDKE 2LVPA 2N1VA 2C5LC 3RD2A 2L8JA 2UWQA 4DXAB 5D6JB 3I3TB 1WGRA 2KC2A 2KZRA 4GGQA 4DDID 2K8BA 1H8CA 2JZZA 3W1SC 3MJWA 2KX0A 4RM9A 1YD8U 3L16A 2KC1A 1V2YA 2J0JA 3VTVA 4KV2A 2JZ3B 3KH0A 3WANA 2KTFA 3CMMB 2RGFA 5DPWA 4MGZE 2JXXA 1WXMA 3PT2B 2G45B 2V3SA 4PYUA 1GG3A 1V80A 2BYVE 2D3GA 2IY1B 3ML8A 4IC7B 5BO4B 4ANWA 2WYQA 2RR9A 1V86A 2LASA 3TCAA 2DAFA 5EDSA 2WDTB 3WIMA 3NZSA 1J0GA 5D2MB 5G55A 3U8ZA 4EKUA 4WWPA 3QHTA 1V9JA 2JRIB 1LQBA 2K6QA 2KWUB 3PTFC 2ZZPB 3T8MA 5AZFA 4B6WA 3WAPA 1NDDA 2IO0B 4LDTD 2N7DA 4BFRA 3N32A 1EF1A 4MGYE 5D7GA 2PJHA 2K8CA 4BOZB 3L17A 4W9HA 3DVGY 4W9CA 1MG8A 2DHZA 3A1QB 4HXDA 4CHKA 2ZVOA 2FUHB 2ZPYA 4IUMB 2KWVB 3DPDA 4DK5A 4GN1A 5E6OA 4DWFA 1OGWA 2R2OA 5G2NA 1A5RA 5J17A 4K7UA 2AEHA 1UH6A 5CTRC 3CSFA 4BKSA 2EMSA 2GBMA 3HHMA 3L08A 2CU1A 2LVOA 2J7QB 1CMXB 5LXHA 2CS4A 2L3ZA 4JLCA 4W9JA 4IM3A 3M63B 2ZNVB 1S3SG 4GMVA 4BKSD 3OJ4B 3U7DA 1V5TA 1HE8A 3WALA 2D10A 1SE9A 3APFA 3B08A 1M94A 2KK8A 3QC8B 4HCPB 3IHPC 1D3ZA 1BT0A 4AJYB 1WFYA 4I6LB 3NZUA 4DDGD 2JRHA 2O2VB 4ZRJA 3V6CB 2FAZA 4AWJA 4FADA 2RSUA 3D32A 3BINA 3WA0A 1FXTB 3ZRFA 2NBUA 2O6VD 3TMPB 2KTRB 3M95A 3X0WA 2G3QB 1Q5WB 4EUTA 4EZLA 2BWFA 3K9PB 4FLHA 2JT4B 4G0NB 4EFOA 1F9JA 4DHJB 2GBNA 4N9F4 2OOBB 5GMVA 1SIFA 4W9FA 2MRPA 1E8ZA 3SD5A 4M8MA 4LJPB 1OTRB 3OJ3A 2M0XA 3K9OB 4FJYA 4NNJB 3OAWA 4WQOB 4E71A 4DHZB 2NS5A 3A1QA 4BOSC 4EZJA 2KO3A 4XZ4A 1WE7A 4JQWC 5L95C 1WI0A 4JL9A 3T9LA 1Q0WB 4PS8A 3DBLI 3L0WB 1Q1OA 1WMHA 3VXWA 4BKGA 3AU4A 5E6NA 1V5OA 1RLFA 1WXAA 2EKEC 2KDIA 2O2VA 1WM3A 3AU5A 4FN2A 2Z0EB 1WIAA 1OEYJ 4M8NA 3SU8X 2D07B 4IWPA 3IVFA 3RT3B 2LVQA 2NVUI 2XK5B 3CF6E 3QX1A 2ZEQA 2M8SA 2LD9A 2MW5A 2PEAA
chains in the Genus database with same CATH superfamily
4BVUC 4HKQA 4KZCA 1K8RB 1OQRA 1SE4A 2WWZA 5DPRA 5FR6A 5JZEB 2KJRA 2C9WB 4XDDA 4ACFA 5HHDG 3O65B 3ZJVA 3TBLD 1PUTA 4GDKB 4HCNB 3H1UA 1WZ0A 2EELA 3A9KA 2MSED 1GUAB 1NVID 5TR5A 2QSDA 1WXQA 2IGGA 2J53A 2JYTA 3ZNID 2KFJA 2BF8B 3C0RB 2JVCA 3BIID 3IXSA 2HTHA 4C7ZA 1K52A 1OQYA 2HD5B 2CHZA 4FJZA 4F1SA 4RFBA 2CHWA 4NQLB 2KNBA 3Q3OC 3W1YA 1YX6B 1GPXA 2KVZA 2K1FA 3PHWB 3LYYA 3RMKC 4TUUA 3UIPB 3CSTA 2KLGA 3RNAC 4XE0A 1WJNA 1C9FA 4N59A 3NOBA 2DYBA 3PSEB 1F0ZA 3ZNZB 3ZVVA 4MSQB 4FULA 4ANXA 1V81A 4WWOA 3QIJA 2KWCA 1RAXA 2L52A 3VUXA 4MSMB 3R8BA 2DZJA 1JWBD 1JW9D 3HK0A 2KQ7A 3Q3NC 2PVOD 3W5UB 4OZBA 3N3KB 4TV3A 1GB4A 1C78A 2DZMA 3SEBA 2KMCA 1L0XB 1L0VB 2OJRA 3IT6B 3B0AA 4EZKA 1YIWA 2WXHA 3NG0A 2MP2A 2BBCA 3UIOB 4DXGA 4FXCA 3GP7A 1P3QU 2V1YA 3ZNHB 4KDIC 2LXCA 1SXTA 1N63A 4YTNB 1NI2A 3KWLA 2VH1A 1FXIA 4GIVA 4MH8A 4AJWA 4B95A 5GXGB 3VHTC 3RCZA 4F8CB 3Q14C 3ZO5B 1H4RA 3FILB 4FHJA 4W9EA 1QZEA 1E8WA 1PDXA 1DOIA 2VH2A 1L2NA 1TGZB 1DOYA 3NVYA 2Z59B 2VZKD 2M19A 2RDGA 4ANVA 3P42A 2WS3B 1NBFC 1IP9A 4FHKA 1IGCA 4M02A 4K3BA 2JUOA 1V1OA 3HRDD 1T3QA 2DBYA 3RNFC 3CWIA 2KKCA 5H8YE 2PE6B 1UF0A 1P0RA 2DENB 3IG3A 4IM0A 1YN3A 4C7YA 1IBXB 2I38A 1VZ6A 3KLSX 4A20A 1HEZE 3V61A 5CHVC 4PK1A 3KYDD 4KKJA 1E9MA 4MJSA 3A9JB 2Y5CA 3ENEA 3ZLZA 3DWMA 2BS3B 1WJUA 4A9AA 1FMAD 2IZVB 4HLEA 1N5XA 3DQVA 3HIZA 2GI9A 5BYQA 4DBGA 2ASQA 1EU4A 3AEAB 3BVZA 1L6UA 3DBSA 1WXVA 4P7IA 2X38A 1JALA 1KM7A 1XCQL 1TZOA 4BKTA 4E3CA 2KDFB 3LB8C 2C7NB 2VRRB 1HZ5A 3DVGX 3Q8EA 2PW9A 2LGXA 1E6EB 2HE7A 1YQ4B 4C56C 4HDQA 2MBQA 5C23A 3OG5A 2QJLA 4KGRA 3I63C 4CYEA 2O6VA 4ZRQA 2WGSA 3RULA 1YN4A 2NBWB 5AEKB 3BK2A 4RH6A 2LXAA 3IFWB 4I6PA 3VUYA 2QEJC 5IA7A 2K22A 3VVWB 1UNSA 1D6EC 2E3TA 2IJ0A 3TEYA 2V3NA 1FRDA 4BAXA 1R4MI 1Y56A 2J0KA 1F2RI 2L0FA 4X57B 2V4LA 2MCNB 2W9NA 1VJKA 2BYFA 4GU2A 4MM3B 4MT5A 2J52A 2C5LC 2L8JA 4K3CA 1JMLA 4DXAB 2JZPA 5D6JB 1JCKB 4GGQA 1I4HA 3W1SC 2KX0A 1MG4A 4KV2A 2JZ3B 3CMMB 2RGFA 5DPWA 2JXXA 3PT2B 4PYUA 1F1HA 2D3GA 2IY1B 2D5GA 2LASA 3BZDB 3TCAA 5EDSA 1ZDVA 1WGKA 4REZA 1SF0A 4HKZE 1EWYC 3WAPA 2IO0B 1FM0D 2N7DA 4BFRA 2PJHA 3A1QB 2DHZA 2FUHB 2ZPYA 3NRZA 4DK5A 4GN1A 4DWFA 5G2NA 1FO4A 3R2TA 5J17A 3CSFA 2J7QB 1CMXB 5LXHA 3AE7B 2CS4A 4W9JA 1TS3A 4JLCA 2LHDA 2PTLA 1VR9A 4GMVA 3U7DA 1HE8A 3B08A 3QC8B 3IT4B 4P16A 1D3ZA 4HEA1 3VR9B 2JRHA 3V6CB 2FAZA 4JE3B 2BYTA 3NZ3A 2KTRB 3M95A 2OEDA 1Q5WB 1QOBA 2MJ3A 4EUTA 3ZXRA 1FPYA 3VR8B 2WXMA 1E8ZA 2MJEA 1VLBA 3A1QA 2INDC 4WIPA 4JL9A 1Q1OA 2KT7A 1CK1A 3C8YA 1EM7A 2KDIA 3AU5A 1WM3A 3ZXVA 1WIAA 2ONQA 4M01A 2LVQA 3CF6E 2MW5A 4NPNA 2EKIA 2MA9B 1TBEA 5C3JB 3SHQA 1GNUA 3RNEC 1TY0A 3BVGA 2N9XA 3MC0B 1N62A 4ARCA 3KWVA 5IAAC 3TSSA 1T6BX 1I4GA 1TS5A 2AQ1B 3U52E 1V1PB 2WXOA 3UQAA 3AE8B 3R66C 2X8XX 1ZGUB 3Q3FA 1P1AA 1G6JA 2KWDA 2G4DB 1WGDA 3B1LX 1N61A 2CJOA 3RZFA 2BS4B 2KDBA 4FBJB 4RM8A 4ZYNA 1FRRA 1WYGA 4LLGM 2DWQA 3PRPB 2N9EB 2WU5B 1EO6A 2LGSA 4FA6A 2K6DB 2WLBA 3BYYB 4OVZA 3P2BA 4HPLB 4IM2A 1WWTA 2YVCA 1C3TA 2V4IB 1F77A 2EMTA 3NS8A 3AE5B 2WX0A 3H8HA 1KOTA 2JX5A 4KSLC 3DDCB 4W9DA 4KSKC 2DYOA 4ICVA 2WNMA 2KVRA 4CQNA 3U30A 3NUHB 1R4NI 1T0YA 3MC9A 4MH0E 2WP9B 3ZDMC 1NYQA 3VRBB 1WRIA 3PZDA 4ARIA 1FNVA 2LGDA 3VTUA 2IBIB 2N9PC 1E90A 3EUB2 1ZOYB 3R3MA 2K25A 3I57A 4B0MA 3H9DA 3VH3B 4WJOA 3KUDB 1WY8A 2NMQA 4LJOB 1WF9A 4WWMA 2J42A 2Y5BB 3LXFA 2W3SA 2CR5A 4A3OA 2MLBA 1WX9A 1WH3A 1KLVA 4W9IA 1XQQA 2DX5B 3PLVA 4S17A 1XT9B 1JWAD 1C4CA 2N4FA 2BT6A 2PPHA 2GBKA 4YTPB 5AZHA 4TQ1A 1C76A 1WXSA 1YJJA 4ZRIA 1P98A 3MHSD 2L76A 5IN7A 2RDHA 4WWNA 1J7CA 4YXDB 4DHZE 2KHWB 2RD0A 1TKEA 1J7AA 4FJVB 4OVUA 3EHVA 1VZ8A 4G3XB 5D3IB 1QF6A 3NHEB 3ML9A 3C19A 2GRIA 4TSSA 5DCNA 2BGFA 3Q8FA 1BUIC 1L6VA 4NAWA 1JQ4A 2JF5A 3ZJUA 2KLCA 2AL6A 5FKAC 4TQ0A 1RRBA 2KQ4X 2IO3B 3BWUD 3NJTA 2JWZA 4LTUA 2GBJA 2WXKA 4OVVA 2IYDB 2ZJDA 1WRDB 1X1MA 3Q8AA 3V62A 4YSYB 2D3CA 1ZUD2 2WXFA 4XWWA 2N9KA 2YEPF 4P1BC 1E8YA 5T8IA 4OHJA 3VTWA 3FKYA 3TJPA 3DWGC 4F7ZA 3AE6B 3DVNV 3WCQA 1CJEA 2R2QA 2XN9C 2REXA 2WX1A 3GS2A 1K53A 2LJ5A 2PE9A 2ZCCA 3AH7A 2RPQA 2HJ1A 2AQ3B 1ZW7A 1YJ1A 3DBRB 3QA8A 2FIDA 1WZ3A 3TEXA 3VUWA 1XLNA 5BMHA 1ZKHA 1ZXHA 4YSXB 2W54A 4LNKA 3EFUA 2WXGA 2K8HA 2MQJA 2MBEA 1SIJA 4JPSA 2C7HA 2LJIA 1V97A 3EECA 2GMIC 4Q2JA 4PS3A 1KH0A 3M62B 4KDLB 4NAWB 4PS7A 2DZIA 2I1JA 2BTEA 1TJEA 4IDIA 1FCLA 2KD0A 3A9JA 3A9KB 4AOFA 1YN5A 2A5UA 1R4MB 4J3OD 2G4SA 4IWOA 1U4AA 5I4DA 5L83A 4USAA 4AQ7A 1IGDA 2IPKD 3ZKJC 1IBXA 4N58A 4YTMB 2RMMA 2NBVB 2D3BA 1DOXA 3HVZA 2UWQA 3AV8A 1F2RC 1SEBD 1RWSA 1XO3A 4NZLB 1WGRA 4ZHOA 3MJ5A 2KC2A 2WQYB 2K8BA 4LK0M 3MJWA 3NS1A 3L16A 3AEEB 2QCZA 3KH0A 1AN8A 3WANA 1MFWA 4MGZE 3Q8BA 1GG3A 2XNAC 4A90A 3ML8A 4ANWA 2WYQA 2DAFA 2SAKA 5D2MB 4EKUA 4WWPA 5TSSA 3QHTA 2JRIB 1LQBA 4ZRPA 3PTFC 4ITKA 4LDTD 1EF1A 2V9HA 1QKZA 4RGMA 2WXQA 3L17A 4W9CA 1MG8A 4CHKA 4IUMB 1ENFA 1OGWA 5IKCM 1JWUD 4BKSA 2EMSA 3L08A 3HHMA 3RNGC 2L3ZA 1HTQA 1MHHE 2DNFA 4IM3A 3M63B 1S3SG 4TMAB 2JU6X 2UU7A 1QLBB 3APFA 1M94A 4HCPB 3AEFB 4WQMA 3MP9A 4AWJA 2RSUA 3BINA 2ZW1A 1FXTB 4M0WA 4JWUC 2O6VD 3ZRFA 2W3RA 2FUG1 2G3QB 2WXLA 1RFKA 4EZLA 3Q2AC 1TY2A 3AN1A 4G0NB 1F9JA 2OOBB 5GMVA 1GB1A 2WU2B 1UUPA 2MRPA 4M00A 4M8MA 5BYSA 3PO0A 3AE2B 4LJPB 1OTRB 3OJ3A 4WQOB 2NS5A 4EZJA 3O13A 3AE9B 4XGAB 1WI0A 1TS2A 3DBLI 3VXWA 1WMHA 1TYGB 4RF0A 5E6NA 1V5OA 1RLFA 4DXFA 3T3NA 2I2YA 2Z0EB 2JSVX 1OEYJ 1D5XC 3IVFA 2NVUI 2XK5B 4PT5A 5G5GA 2BQQA 2PVGC 1WYWB 1XLOA 4KIKA 1LXDA 1Z5SB 3UGBB 1EU3A 4LCDE 1WJ6A 1N60A 2KANA 2WXIA 2N1WA 1E10A 1TT5B 3TUOA 4E74A 4HK2A 2BS2B 4D2KA 1V8CA 1ROEA 4KKIA 3AECB 1OEYA 1JROA 1VZ7A 4GSWA 3FC4A 4K7WA 1GAQB 5DPSA 4G50A 2Q5WD 4W9KA 5EE9A 3Q8CA 4ZYSA 2V0GA 2CHXA 4IW0A 4KZ0A 3B2GA 2N9LA 1QOGA 3ALBA 2I1KA 1N5WA 5AZGA 3PZ7A 5KHQA 3QQ8B 2KYWA 3AE3B 3HM3A 1RM6C 3FILA 2LUMA 1E5WA 4KGSA 4MEMA 1L0YB 1PGAA 2H88B 1YJIA 1P7FA 3M3JA 2OHFA 2GB1A 1FNUA 2FIFA 3PRZA 1UBQA 3KVFB 3R7QA 5JXVA 4WH4A 2MX2A 4II2B 2XEWA 5CHFA 3HVDA 3X23A 2R61A 1E7UA 3ETRA 4B0EA 2FE8A 5HKHA 2LUEA 2LWPA 2WDVB 4A3PA 2KFKB 2KMMA 3VH4B 4DQOC 4GLSC 1I42A 2KJHB 3PPAA 3P1MA 2HJ8A 3MFGA 1ZP0B 1I4PA 1FXAA 5EE3A 2N7EA 1RYJA 1HTOA 3JSVA 3ZIMA 5J18A 4MM3A 3ECIA 3AULA 4RGTA 3ZJTA 1LM8B 3AI5A 1S1QB 1J19A 4HRSA 4HPPA 4WAAA 2BYEA 4AUQC 4EOYA 4GDLB 3ONSA 1WGYA 1TS4A 2KN5A 3V60A 2Y5PA 4I6NB 5J2RA 3LJ3A 1ZPSA 1FIQA 3RN9C 1R7SA 2M4NA 3VFKA 3ZNGC 3EFCA 1B9RA 3LDZE 1TTNA 3ZTCA 3W1SA 3AEGB 3GZNB 2KACA 3MTNB 3ZQ4A 3PLUA 3I5JC 3VDZA 2PIAA 3B2FA 3ZGZA 3DHIC 3AMZA 2XBBC 2Y3AA 5D94A 2C60A 4GDLA 5JHBA 1TKGA 2INPE 3OWEB 1M4VA 1WE6A 1T0SC 4K1RB 2KMAA 3DVNU 2FBWB 2N0SB 4J6IA 2GLSA 1XF5L 2CJNA 3QJZA 4HDOA 1Y8RC 3H6NA 1P9DU 5H92C 2M1MA 2N7JA 2TSSA 2MBBB 3IBEA 2L00B 1FFUA 1D5MC 1JWSD 5HFYA 1ISNA 3P4RB 2GOWA 1EUVB 3GE8C 2QIEB 3RUIB 3APCA 3PZ8A 4ANUA 1ET9A 1HZ6A 4G11A 4C4VB 1XLQA 4HJGE 3U7ZA 1FD6A 2FCNA 1C79A 4K81A 4KX6B 3ZYYX 4TKNA 3UQBA 5FR3A 1SE2A 4RNAA 5C1ZA 2UYZB 4IWQA 3URYA 2H89B 4BBNF 1LO5D 3WAOA 2BVCA 2L05A 3JW0X 5JHAA 1WX8A 4XX5A 5E6JA 3QWZB 2INCC 3Q69A 3H7PA 3VRAB 3TEWA 4ZRKA 5IO9A 4XDCA 3PGEA 2BW2A 4AP4C 4W9GA 4NQKE 2OJWA 4YWGG 3V05A 2LMCA 3UI3A 3UINB 2WDRB 2G1EA 4PYZA 2QHOA 1WGHA 1C1YB 2NCNA 1WR1A 1SBBB 3BY4B 2ZCBA 4HVBA 2IY0B 4US9A 3SDLC 1QQRA 4IG7B 2M0AA 4YL8A 2JY6A 3PHXB 1BMLC 3L4PA 4KIKB 1UELA 1WJ4A 3GZNI 2JQRB 1L4DB 1C4PA 2KDEB 3Q3JA 3PRMB 1ACCA 2CU3A 3AB5A 3JYUA 3GOEA 1PQSA 2FCQA 3DOWA 2NPTA 4WJNA 3ZRCA 3QARA 3KQ4A 2PKOA 2A4ZA 1HXYD 5G5HA 1AWDA 2G9HD 4WJQA 3TL5A 2IO1B 1TZ1A 2J4XA 3MHZA 2FCSA 2BPSA 3DBHB 2V3PA 3JVZX 4BZAA 3KUCB 3FAHA 1D4BA 2IGHA 1WR6E 3R7RA 2LVPA 2N1VA 1B1ZA 1AYFA 1KF6B 4H2AA 5BMGA 2KZRA 4DDID 2HDEA 2W55A 1YD8U 2KC1A 1L4ZB 1GOZA 4NJCA 2LGIA 1WXMA 2G45B 2V3SA 1V80A 1LGRA 1Q10A 1ET6A 3RNCC 4HROA 1N6ZA 2PLPA 3Q6BA 2RR9A 1V86A 4QAYA 2WDTB 2MJDA 5G55A 2KWUB 2ZZPB 5AZFA 1NDDA 1J7BA 3N32A 5D7GA 4MGYE 2K8CA 4BOZB 3DVGY 4HXDA 2ZVOA 1F52A 2KWVB 4A55A 2R2OA 1A5RA 4K7UA 2AEHA 5CTRC 2CU1A 1HQRD 2LVOA 1MI0A 1QOFA 2ZNVB 1T0RC 1EWCA 3IHPC 1WFYA 2O2VB 4RGOS 4ZRJA 3WA0A 3D32A 2JXTA 3AEDB 2NBUA 3TMPB 2BB5A 1VDVA 1T0QC 4FLHA 2JT4B 4EFOA 2GBNA 3CIRB 1SIFA 1V1PA 4W9FA 1PYWD 5LNK1 4FJYA 4NNJB 1FCCC 3OAWA 4E71A 4DHZB 1ZDXA 1QILA 1DYQA 4BOSC 2KO3A 1L5PA 4XZ4A 1YQ3B 1WE7A 1NEKB 4JQWC 3T9LA 1Q0WB 3L0WB 3MC8A 2WXRA 3RFZB 1WXAA 2EKEC 2O2VA 4O1NA 1JRPA 3RT3B 3QX1A 2ZEQA 2M8SA 2JWUA 4L1BA 3V6EB 2LFIA 5C2TB 3PREA 5HG2A 3OLMD 5IOIA 2ZW0A 2MBOA 4W9LA 4K7SA 4HWIB 1I4XA 1IUEA 4IKGA 1L7YA 4LNFA 2BKFA 1UGJA 1I4RA 4MJSB 1WGGA 3NVWA 1LFDA 2KX3A 3Q3MC 2WXNA 1ZXIA 2KFKA 2KJ6A 2MHJA 1D5ZC 4RCOA 3JSVB 2D11A 2WHIA 3HUIA 3BYTB 2LZ6A 3E9SA 1GJZA 1V49A 3N30A 4M0WB 2ON8A 1I7HA 1STEA 2L32A 3P4SB 4A8XC 2QDFA 2WXJA 1PGBA 3RI7C 1IPGA 2M17A 4RMAA 2ZNVC 1GC7A 2FNJB 3PVLA 1SSNA 3ZDTA 3W2DA 4LNIA 3ZUNA 2KAJA 2DZKA 3APDA 3B9JA 1TIFA 4C80A 3A4RA 1YNTE 2K39A 4MGIE 1XXGA 2YLMA 4GOCA 5D3DA 3VQIA 4XYCA 3AE1B 2KOXA 1UD7A 1MPEA 3EGRA 3PS6A 2DAJA 1AARA 1NENB 2C7MB 3A4SC 5MPOA 2CKHB 2E6XA 3UF8A 2MP2B 3L54A 3N1YC 2NTTA 3NVZA 4IOIE 1GC6A 3AM9A 2JPHA 2XK5A 5JH5C 5CX3A 4URKA 2KXJA 1SE3A 2M56B 3TIXA 3NVVA 5LLIA 3IAM1 1K50A 3RZWC 5CHWA 4ICUA 3QAQA 1E7PB 2W82A 4NJ7A 3VAWA 2MWSB 1JRUA 1A70A 1RFAA 3E56A 2LGYA 3AE4B 2QC8A 1YX5B 3H7PB 1C77A 2GBRA 2AWTA 2LEKA 1SB3C 2QILA 3ABVB 5IP4D 5AUIA 1I35A 1FEHA 5KHOA 1MJDA 1UBIA 3RYTA 1VD2A 4XWTA 3ZW3A 2LRWA 1YMHE 2L1AA 4UDUC 3A33B 2FCMA 1WMHB 3NY5A 4RF1A 3QK0A 4YT0B 5BYRA 3WAMA 2KTRA 2DLBA 4XC2A 1WSPA 3P4PB 2AYOB 4KVGB 4P6VF 2LI5A 1WM2A 3L10B 5HI1A 1MHXA 2B76B 2ZVNA 4OW0A 1YOVB 4RGNA 2ZPNA 5DPTA 4JX1C 2D2QA 3S2AA 1T5XD 4JGHB 1CZPA 2AX5A 3DHHC 4NY0A 2NPTB 3RPFC 4C00A 2J0MA 4ZOHC 3N9YC 3U4EG 3HM6X 3RNBC 1E8XA 1VRAB 4ASWC 2AL3A 2DYMA 4GXBA 2WDQB 2MBHA 1Z2MA 2RPVA 3QCAA 4CO7A 4LNNA 4MELA 4MGKE 2SEBD 2JYEA 1YQBA 3H7SA 5AUKA 4C4VA 2O6VB 2L7RA 4R3DA 4MACA 2BKRB 2L0TA 4US8A 3PV1A 2MH7A 4ZDVA 3DBRI 1UZXB 1ZE3D 3SR6A 5LXIB 3V3XA 2LRUA 3R2IA 2B3AA 4LNOA 1NYRA 2VZKB 2KQSA 1WX7A 2K9XA 1FNWA 2BWES 4JIOU 4JWSC 3TEZA 3KYCD 2IGDA 3EC8A 1FFVA 1IYFA 1NI3A 2K3UA 4L2YA 3P63A 1UWMA 4LDTB 2IO2B 2NR2A 4GDKA 1MVKA 1XD3B 4EEWA 3DCGA 2Z0DB 2QMTA 3ZTDA 1KLGD 5EE0A 1V6EA 4II3B 3EA6A 3L13A 3KUZA 3P4QB 1VCBA 1AW7A 1SGHA 3AXCA 1JWMD 1KRHA 1ESFA 4DHJD 1KJTA 1I4QA 3KW5B 4B9KA 4HPMB 3GE3C 1C4AA 3T3OA 2Z8LA 1E7VA 1KFYB 3DBLB 1J8CA 4WURA 5FK9C 3IAS1 3N20C 5E6PA 2NTSA 1DGJA 3DBHI 1EF5A 1UGMA 4BBNC 2IDYA 4GB9A 3SFDB 1K51A 2L83A 4HJKA 4NJ6A 4WJPA 4MDKE 4L23A 3RD2A 3W5VB 1BXTA 3I3TB 1H8CA 2JZZA 2RDBC 4RM9A 1XCTL 4P1CC 1V2YA 4NAMA 2J0JA 3VTVA 1P7EA 2KTFA 4KGTA 1OQQA 2BYVE 4IC7B 4OZAA 5BO4B 2INNE 1R4NB 3N1ZC 4WAFA 3WIMA 3NZSA 1J0GA 3U8ZA 1QOAA 1SJHD 1V9JA 3DHGC 2K6QA 1HA5A 3T8MA 4B6WA 2ICIA 1XEEA 4ZHPA 4A6QA 4S0RA 1SJED 2YEPB 4W9HA 1E0ZA 3DPDA 5E6OA 2BB6A 1UWXA 1UH6A 2KDMA 2GBMA 2MEKA 3BVMA 4BKSD 3N1XC 3OJ4B 1V5TA 3WALA 2D10A 1KTKA 1SE9A 3AEBB 3I9V1 2KK8A 1PFDA 2WXPA 4OZCA 1BT0A 3GB1A 4AJYB 4I6LB 3NZUA 3U2SC 4DDGD 1TKYA 4N6EB 4FADA 1PGXA 2K5PA 2AQ2B 2HTME 3X0WA 1OFFA 1CQVA 2BWFA 3K9PB 5BMIA 4DHJB 4N9F4 3W9CB 3J9CA 2ACZB 3SD5A 2M0XA 3K9OB 4EE2A 3BK1A 4AS1A 1XLPA 2KN4A 3SFEB 2LHEA 1QT9A 2K0PA 1KLUD 5L95C 4PS8A 5EE1A 4BKGA 3AU4A 4FN2A 2PMVA 4M8NA 3SU8X 2D3AA 4YSZB 2D07B 4IWPA 2LD9A 2PEAA
chains in the Genus database with same CATH topology
1WYWB 4KIKA 4NPNA 2MA9B 3V6EB 1LXDA 1Z5SB 3UGBB 3PREA 4LCDE 1TBEA 4BVUC 1WJ6A 2KANA 4KZCA 3SHQA 1K8RB 3OLMD 1GNUA 2MBOA 4W9LA 4K7SA 4HWIB 2N1WA 2WWZA 2N9XA 4E74A 1L7YA 5DPRA 5FR6A 4HK2A 2BKFA 5JZEB 2KJRA 2C9WB 5IAAC 3O65B 3TBLD 4GDKB 4MJSB 4HCNB 1WGGA 3H1UA 1WZ0A 3A9KA 1LFDA 2KX3A 2MSED 1GUAB 5TR5A 1OEYA 2KFKA 4GSWA 2KJ6A 4K7WA 3UQAA 3JSVB 2D11A 5DPSA 3R66C 3ZNID 2KFJA 1ZGUB 2BF8B 3C0RB 2JVCA 4G50A 2LZ6A 2HTHA 3Q3FA 1P1AA 1OQYA 2HD5B 1G6JA 2CHZA 4FJZA 4W9KA 4F1SA 2CHWA 2CHXA 1V49A 4IW0A 4KZ0A 1GJZA 2G4DB 3N30A 1WGDA 3ALBA 2I1KA 4M0WB 3B1LX 5AZGA 4NQLB 3RZFA 2KDBA 2KNBA 4FBJB 5KHQA 4RM8A 3W1YA 4ZYNA 1YX6B 3QQ8B 3HM3A 2K1FA 1IPGA 2M17A 4RMAA 3PHWB 2ZNVC 3PRPB 1GC7A 2FNJB 2N9EB 3PVLA 1E5WA 3ZDTA 1EO6A 4MEMA 4TUUA 3ZUNA 3UIPB 4FA6A 2K6DB 2DZKA 3APDA 3CSTA 3M3JA 3P2BA 2KLGA 3PRZA 2FIFA 3A4RA 4HPLB 1UBQA 3KVFB 4IM2A 1WJNA 3R7QA 2K39A 2YVCA 4MGIE 2YLMA 4GOCA 1C3TA 3NOBA 2DYBA 3PSEB 2MX2A 2EMTA 3NS8A 4II2B 3VQIA 3ZNZB 3ZVVA 2WX0A 2XEWA 2KOXA 1UD7A 4MSQB 4FULA 5CHFA 3PS6A 4ANXA 3X23A 1V81A 2DAJA 1AARA 4WWOA 1E7UA 1KOTA 4KSLC 2C7MB 3A4SC 5HKHA 2LUEA 2LWPA 3DDCB 4A3PA 3QIJA 2CKHB 2KFKB 4W9DA 4KSKC 3VH4B 3UF8A 2KWCA 2MP2B 1RAXA 3L54A 2DYOA 1GC6A 3VUXA 4MSMB 2JPHA 2XK5A 4ICVA 5JH5C 2KVRA 5CX3A 4URKA 1I42A 2DZJA 2KJHB 3PPAA 2HJ8A 2KXJA 3HK0A 3TIXA 5LLIA 3U30A 1R4NI 1T0YA 2KQ7A 2N7EA 3JSVA 4MH0E 3ZIMA 3RZWC 5CHWA 5J18A 3ZDMC 4ICUA 3QAQA 4MM3A 3N3KB 3ECIA 4TV3A 3AULA 4NJ7A 1LM8B 3VAWA 3PZDA 2MWSB 3AI5A 2LGDA 1S1QB 2DZMA 1JRUA 1J19A 1RFAA 3VTUA 2IBIB 2KMCA 2N9PC 1E90A 4WAAA 2BYEA 2LGYA 4AUQC 3R3MA 4EOYA 4GDLB 1YX5B 2K25A 3H7PB 2OJRA 3ONSA 3H9DA 1WGYA 3B0AA 2GBRA 3VH3B 2AWTA 4WJOA 2KN5A 3V60A 1YIWA 4EZKA 3KUDB 4I6NB 1WY8A 5J2RA 2MP2A 4LJOB 3LJ3A 3UIOB 1I35A 1WF9A 2M4NA 5KHOA 1P3QU 3VFKA 2Y5BB 3ZNGC 2V1YA 4A3OA 2CR5A 1UBIA 3LDZE 2MLBA 1TTNA 1WX9A 1WH3A 2LXCA 4KDIC 4W9IA 3RYTA 3ZTCA 3ZNHB 1KLVA 1VD2A 1XQQA 1NI2A 2DX5B 3W1SA 3PLVA 4GIVA 1XT9B 3ZW3A 2LRWA 4AJWA 4B95A 2N4FA 3A33B 3MTNB 2FCMA 1WMHB 3NY5A 3PLUA 2PPHA 2GBKA 5AZHA 3VHTC 3QK0A 4TQ1A 3RCZA 3VDZA 4F8CB 3ZO5B 1H4RA 1WXSA 4FHJA 4ZRIA 1P98A 4W9EA 3WAMA 2KTRA 2XBBC 1QZEA 1E8WA 4XC2A 3MHSD 5D94A 2AYOB 2C60A 4GDLA 4KVGB 5JHBA 2L76A 1WM2A 2LI5A 1WE6A 1L2NA 1TGZB 4WWNA 3L10B 2ZVNA 4DHZE 2KHWB 4K1RB 2KMAA 2RD0A 3DVNU 4J6IA 2Z59B 4FJVB 4OVUA 3EHVA 2ZPNA 5DPTA 3QJZA 4G3XB 2D2QA 3S2AA 3NHEB 4HDOA 1Y8RC 3ML9A 4JGHB 4NY0A 2NPTB 3H6NA 2J0MA 1P9DU 2M1MA 3HM6X 4ANVA 1E8XA 2MBBB 3IBEA 2L00B 5DCNA 4ASWC 2AL3A 1ISNA 2DYMA 4GXBA 1NBFC 2BGFA 1EUVB 2GOWA 2MBHA 1IP9A 4FHKA 4NAWA 3RUIB 3APCA 2JF5A 1Z2MA 3QCAA 2KLCA 2AL6A 4ANUA 2JUOA 4TQ0A 1RRBA 4CO7A 4MELA 4MGKE 2KKCA 1YQBA 2IO3B 2PE6B 3H7SA 4G11A 1P0RA 2DENB 2JWZA 2GBJA 3IG3A 2O6VB 4IM0A 4OVVA 2IYDB 2L7RA 2ZJDA 2FCNA 4K81A 4TKNA 3UQBA 1WRDB 2BKRB 2L0TA 1X1MA 5C1ZA 3V62A 3PV1A 4A20A 4ZDVA 3DBRI 2UYZB 4IWQA 4BBNF 3V61A 1UZXB 5CHVC 3KYDD 3WAOA 2L05A 3JW0X 5JHAA 5LXIB 1WX8A 4XX5A 3QWZB 2LRUA 4MJSA 3A9JB 3H7PA 2B3AA 3ENEA 4ZRKA 1E8YA 3ZLZA 3VTWA 2KQSA 1WX7A 3PGEA 3TJPA 1WJUA 2IZVB 4F7ZA 4HLEA 4AP4C 2BWES 3DVNV 4JIOU 4NQKE 4W9GA 3DQVA 3HIZA 2R2QA 3KYCD 2REXA 2WX1A 4DBGA 3EC8A 2ASQA 3UINB 1IYFA 4PYZA 2QHOA 1WGHA 1C1YB 4LDTB 3DBSA 2LJ5A 2NCNA 2IO2B 2NR2A 2PE9A 2ZCCA 1WR1A 4GDKA 1WXVA 2RPQA 1XD3B 2ZCBA 3BY4B 4EEWA 4HVBA 3DCGA 4P7IA 2Z0DB 2IY0B 3SDLC 1ZW7A 1KM7A 3ZTDA 4BKTA 4E3CA 1YJ1A 2KDFB 4IG7B 1V6EA 2C7NB 3QA8A 4YL8A 2FIDA 2VRRB 4II3B 1WZ3A 2JY6A 3DVGX 3PHXB 3VUWA 3L13A 2LGXA 3KUZA 2HE7A 4KIKB 4HDQA 1UELA 2MBQA 1ZKHA 1WJ4A 3GZNI 5C23A 1VCBA 1SGHA 2KDEB 3Q3JA 3PRMB 3AXCA 4CYEA 2O6VA 3EFUA 2K8HA 2MQJA 3JYUA 2MBEA 3RULA 3GOEA 1PQSA 2C7HA 2NBWB 3EECA 5AEKB 2FCQA 4DHJD 3DOWA 1KJTA 2GMIC 2LXAA 4PS3A 3KW5B 3IFWB 4I6PA 4B9KA 4HPMB 3VUYA 2NPTA 3M62B 4KDLB 4WJNA 3ZRCA 5IA7A 3QARA 4NAWB 4PS7A 2A4ZA 3VVWB 2DZIA 2I1JA 1E7VA 2KD0A 3A9JA 3A9KB 4AOFA 1J8CA 4WJQA 3TL5A 2IO1B 2A5UA 1TZ1A 5E6PA 3DBHI 2FCSA 2BPSA 2G4SA 1EF5A 1UGMA 4BBNC 1R4MI 4IWOA 2L0FA 2J0KA 3JVZX 3KUCB 4X57B 1U4AA 2V4LA 5L83A 2MCNB 4GB9A 2W9NA 3ZKJC 1WR6E 3R7RA 2BYFA 4GU2A 4HJKA 4NJ6A 4WJPA 2NBVB 4MDKE 2LVPA 2N1VA 2C5LC 3RD2A 2L8JA 2UWQA 4DXAB 5D6JB 3I3TB 1WGRA 2KC2A 2KZRA 4GGQA 4DDID 2K8BA 1H8CA 2JZZA 3W1SC 3MJWA 2KX0A 4RM9A 1YD8U 3L16A 2KC1A 1V2YA 2J0JA 3VTVA 4KV2A 2JZ3B 3KH0A 3WANA 2KTFA 3CMMB 2RGFA 5DPWA 4MGZE 2JXXA 1WXMA 3PT2B 2G45B 2V3SA 4PYUA 1GG3A 1V80A 2BYVE 2D3GA 2IY1B 3ML8A 4IC7B 5BO4B 4ANWA 2WYQA 2RR9A 1V86A 2LASA 3TCAA 2DAFA 5EDSA 2WDTB 3WIMA 3NZSA 1J0GA 5D2MB 5G55A 3U8ZA 4EKUA 4WWPA 3QHTA 1V9JA 2JRIB 1LQBA 2K6QA 2KWUB 3PTFC 2ZZPB 3T8MA 5AZFA 4B6WA 3WAPA 1NDDA 2IO0B 4LDTD 2N7DA 4BFRA 3N32A 1EF1A 4MGYE 5D7GA 2PJHA 2K8CA 4BOZB 3L17A 4W9HA 3DVGY 4W9CA 1MG8A 2DHZA 3A1QB 4HXDA 4CHKA 2ZVOA 2FUHB 2ZPYA 4IUMB 2KWVB 3DPDA 4DK5A 4GN1A 5E6OA 4DWFA 1OGWA 2R2OA 5G2NA 1A5RA 5J17A 4K7UA 2AEHA 1UH6A 5CTRC 3CSFA 4BKSA 2EMSA 2GBMA 3HHMA 3L08A 2CU1A 2LVOA 2J7QB 1CMXB 5LXHA 2CS4A 2L3ZA 4JLCA 4W9JA 4IM3A 3M63B 2ZNVB 1S3SG 4GMVA 4BKSD 3OJ4B 3U7DA 1V5TA 1HE8A 3WALA 2D10A 1SE9A 3APFA 3B08A 1M94A 2KK8A 3QC8B 4HCPB 3IHPC 1D3ZA 1BT0A 4AJYB 1WFYA 4I6LB 3NZUA 4DDGD 2JRHA 2O2VB 4ZRJA 3V6CB 2FAZA 4AWJA 4FADA 2RSUA 3D32A 3BINA 3WA0A 1FXTB 3ZRFA 2NBUA 2O6VD 3TMPB 2KTRB 3M95A 3X0WA 2G3QB 1Q5WB 4EUTA 4EZLA 2BWFA 3K9PB 4FLHA 2JT4B 4G0NB 4EFOA 1F9JA 4DHJB 2GBNA 4N9F4 2OOBB 5GMVA 1SIFA 4W9FA 2MRPA 1E8ZA 3SD5A 4M8MA 4LJPB 1OTRB 3OJ3A 2M0XA 3K9OB 4FJYA 4NNJB 3OAWA 4WQOB 4E71A 4DHZB 2NS5A 3A1QA 4BOSC 4EZJA 2KO3A 4XZ4A 1WE7A 4JQWC 5L95C 1WI0A 4JL9A 3T9LA 1Q0WB 4PS8A 3DBLI 3L0WB 1Q1OA 1WMHA 3VXWA 4BKGA 3AU4A 5E6NA 1V5OA 1RLFA 1WXAA 2EKEC 2KDIA 2O2VA 1WM3A 3AU5A 4FN2A 2Z0EB 1WIAA 1OEYJ 4M8NA 3SU8X 2D07B 4IWPA 3IVFA 3RT3B 2LVQA 2NVUI 2XK5B 3CF6E 3QX1A 2ZEQA 2M8SA 2LD9A 2MW5A 2PEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYW B;  4KIK A;  4NPN A;  2MA9 B;  3V6E B;  1LXD A;  1Z5S B;  3UGB B;  3PRE A;  4LCD E;  1TBE A;  4BVU C;  1WJ6 A;  2KAN A;  4KZC A;  3SHQ A;  1K8R B;  3OLM D;  1GNU A;  2MBO A;  4W9L A;  4K7S A;  4HWI B;  2N1W A;  2WWZ A;  2N9X A;  4E74 A;  1L7Y A;  5DPR A;  5FR6 A;  4HK2 A;  2BKF A;  5JZE B;  2KJR A;  2C9W B;  5IAA C;  3O65 B;  3TBL D;  4GDK B;  4MJS B;  4HCN B;  1WGG A;  3H1U A;  1WZ0 A;  3A9K A;  1LFD A;  2KX3 A;  2MSE D;  1GUA B;  5TR5 A;  1OEY A;  2KFK A;  4GSW A;  2KJ6 A;  4K7W A;  3UQA A;  3JSV B;  2D11 A;  5DPS A;  3R66 C;  3ZNI D;  2KFJ A;  1ZGU B;  2BF8 B;  3C0R B;  2JVC A;  4G50 A;  2LZ6 A;  2HTH A;  3Q3F A;  1P1A A;  1OQY A;  2HD5 B;  1G6J A;  2CHZ A;  4FJZ A;  4W9K A;  4F1S A;  2CHW A;  2CHX A;  1V49 A;  4IW0 A;  4KZ0 A;  1GJZ A;  2G4D B;  3N30 A;  1WGD A;  3ALB A;  2I1K A;  4M0W B;  3B1L X;  5AZG A;  4NQL B;  3RZF A;  2KDB A;  2KNB A;  4FBJ B;  5KHQ A;  4RM8 A;  3W1Y A;  4ZYN A;  1YX6 B;  3QQ8 B;  3HM3 A;  2K1F A;  1IPG A;  2M17 A;  4RMA A;  3PHW B;  2ZNV C;  3PRP B;  1GC7 A;  2FNJ B;  2N9E B;  3PVL A;  1E5W A;  3ZDT A;  1EO6 A;  4MEM A;  4TUU A;  3ZUN A;  3UIP B;  4FA6 A;  2K6D B;  2DZK A;  3APD A;  3CST A;  3M3J A;  3P2B A;  2KLG A;  3PRZ A;  2FIF A;  3A4R A;  4HPL B;  1UBQ A;  3KVF B;  4IM2 A;  1WJN A;  3R7Q A;  2K39 A;  2YVC A;  4MGI E;  2YLM A;  4GOC A;  1C3T A;  3NOB A;  2DYB A;  3PSE B;  2MX2 A;  2EMT A;  3NS8 A;  4II2 B;  3VQI A;  3ZNZ B;  3ZVV A;  2WX0 A;  2XEW A;  2KOX A;  1UD7 A;  4MSQ B;  4FUL A;  5CHF A;  3PS6 A;  4ANX A;  3X23 A;  1V81 A;  2DAJ A;  1AAR A;  4WWO A;  1E7U A;  1KOT A;  4KSL C;  2C7M B;  3A4S C;  5HKH A;  2LUE A;  2LWP A;  3DDC B;  4A3P A;  3QIJ A;  2CKH B;  2KFK B;  4W9D A;  4KSK C;  3VH4 B;  3UF8 A;  2KWC A;  2MP2 B;  1RAX A;  3L54 A;  2DYO A;  1GC6 A;  3VUX A;  4MSM B;  2JPH A;  2XK5 A;  4ICV A;  5JH5 C;  2KVR A;  5CX3 A;  4URK A;  1I42 A;  2DZJ A;  2KJH B;  3PPA A;  2HJ8 A;  2KXJ A;  3HK0 A;  3TIX A;  5LLI A;  3U30 A;  1R4N I;  1T0Y A;  2KQ7 A;  2N7E A;  3JSV A;  4MH0 E;  3ZIM A;  3RZW C;  5CHW A;  5J18 A;  3ZDM C;  4ICU A;  3QAQ A;  4MM3 A;  3N3K B;  3ECI A;  4TV3 A;  3AUL A;  4NJ7 A;  1LM8 B;  3VAW A;  3PZD A;  2MWS B;  3AI5 A;  2LGD A;  1S1Q B;  2DZM A;  1JRU A;  1J19 A;  1RFA A;  3VTU A;  2IBI B;  2KMC A;  2N9P C;  1E90 A;  4WAA A;  2BYE A;  2LGY A;  4AUQ C;  3R3M A;  4EOY A;  4GDL B;  1YX5 B;  2K25 A;  3H7P B;  2OJR A;  3ONS A;  3H9D A;  1WGY A;  3B0A A;  2GBR A;  3VH3 B;  2AWT A;  4WJO A;  2KN5 A;  3V60 A;  1YIW A;  4EZK A;  3KUD B;  4I6N B;  1WY8 A;  5J2R A;  2MP2 A;  4LJO B;  3LJ3 A;  3UIO B;  1I35 A;  1WF9 A;  2M4N A;  5KHO A;  1P3Q U;  3VFK A;  2Y5B B;  3ZNG C;  2V1Y A;  4A3O A;  2CR5 A;  1UBI A;  3LDZ E;  2MLB A;  1TTN A;  1WX9 A;  1WH3 A;  2LXC A;  4KDI C;  4W9I A;  3RYT A;  3ZTC A;  3ZNH B;  1KLV A;  1VD2 A;  1XQQ A;  1NI2 A;  2DX5 B;  3W1S A;  3PLV A;  4GIV A;  1XT9 B;  3ZW3 A;  2LRW A;  4AJW A;  4B95 A;  2N4F A;  3A33 B;  3MTN B;  2FCM A;  1WMH B;  3NY5 A;  3PLU A;  2PPH A;  2GBK A;  5AZH A;  3VHT C;  3QK0 A;  4TQ1 A;  3RCZ A;  3VDZ A;  4F8C B;  3ZO5 B;  1H4R A;  1WXS A;  4FHJ A;  4ZRI A;  1P98 A;  4W9E A;  3WAM A;  2KTR A;  2XBB C;  1QZE A;  1E8W A;  4XC2 A;  3MHS D;  5D94 A;  2AYO B;  2C60 A;  4GDL A;  4KVG B;  5JHB A;  2L76 A;  1WM2 A;  2LI5 A;  1WE6 A;  1L2N A;  1TGZ B;  4WWN A;  3L10 B;  2ZVN A;  4DHZ E;  2KHW B;  4K1R B;  2KMA A;  2RD0 A;  3DVN U;  4J6I A;  2Z59 B;  4FJV B;  4OVU A;  3EHV A;  2ZPN A;  5DPT A;  3QJZ A;  4G3X B;  2D2Q A;  3S2A A;  3NHE B;  4HDO A;  1Y8R C;  3ML9 A;  4JGH B;  4NY0 A;  2NPT B;  3H6N A;  2J0M A;  1P9D U;  2M1M A;  3HM6 X;  4ANV A;  1E8X A;  2MBB B;  3IBE A;  2L00 B;  5DCN A;  4ASW C;  2AL3 A;  1ISN A;  2DYM A;  4GXB A;  1NBF C;  2BGF A;  1EUV B;  2GOW A;  2MBH A;  1IP9 A;  4FHK A;  4NAW A;  3RUI B;  3APC A;  2JF5 A;  1Z2M A;  3QCA A;  2KLC A;  2AL6 A;  4ANU A;  2JUO A;  4TQ0 A;  1RRB A;  4CO7 A;  4MEL A;  4MGK E;  2KKC A;  1YQB A;  2IO3 B;  2PE6 B;  3H7S A;  4G11 A;  1P0R A;  2DEN B;  2JWZ A;  2GBJ A;  3IG3 A;  2O6V B;  4IM0 A;  4OVV A;  2IYD B;  2L7R A;  2ZJD A;  2FCN A;  4K81 A;  4TKN A;  3UQB A;  1WRD B;  2BKR B;  2L0T A;  1X1M A;  5C1Z A;  3V62 A;  3PV1 A;  4A20 A;  4ZDV A;  3DBR I;  2UYZ B;  4IWQ A;  4BBN F;  3V61 A;  1UZX B;  5CHV C;  3KYD D;  3WAO A;  2L05 A;  3JW0 X;  5JHA A;  5LXI B;  1WX8 A;  4XX5 A;  3QWZ B;  2LRU A;  4MJS A;  3A9J B;  3H7P A;  2B3A A;  3ENE A;  4ZRK A;  1E8Y A;  3ZLZ A;  3VTW A;  2KQS A;  1WX7 A;  3PGE A;  3TJP A;  1WJU A;  2IZV B;  4F7Z A;  4HLE A;  4AP4 C;  2BWE S;  3DVN V;  4JIO U;  4NQK E;  4W9G A;  3DQV A;  3HIZ A;  2R2Q A;  3KYC D;  2REX A;  2WX1 A;  4DBG A;  3EC8 A;  2ASQ A;  3UIN B;  1IYF A;  4PYZ A;  2QHO A;  1WGH A;  1C1Y B;  4LDT B;  3DBS A;  2LJ5 A;  2NCN A;  2IO2 B;  2NR2 A;  2PE9 A;  2ZCC A;  1WR1 A;  4GDK A;  1WXV A;  2RPQ A;  1XD3 B;  2ZCB A;  3BY4 B;  4EEW A;  4HVB A;  3DCG A;  4P7I A;  2Z0D B;  2IY0 B;  3SDL C;  1ZW7 A;  1KM7 A;  3ZTD A;  4BKT A;  4E3C A;  1YJ1 A;  2KDF B;  4IG7 B;  1V6E A;  2C7N B;  3QA8 A;  4YL8 A;  2FID A;  2VRR B;  4II3 B;  1WZ3 A;  2JY6 A;  3DVG X;  3PHX B;  3VUW A;  3L13 A;  2LGX A;  3KUZ A;  2HE7 A;  4KIK B;  4HDQ A;  1UEL A;  2MBQ A;  1ZKH A;  1WJ4 A;  3GZN I;  5C23 A;  1VCB A;  1SGH A;  2KDE B;  3Q3J A;  3PRM B;  3AXC A;  4CYE A;  2O6V A;  3EFU A;  2K8H A;  2MQJ A;  3JYU A;  2MBE A;  3RUL A;  3GOE A;  1PQS A;  2C7H A;  2NBW B;  3EEC A;  5AEK B;  2FCQ A;  4DHJ D;  3DOW A;  1KJT A;  2GMI C;  2LXA A;  4PS3 A;  3KW5 B;  3IFW B;  4I6P A;  4B9K A;  4HPM B;  3VUY A;  2NPT A;  3M62 B;  4KDL B;  4WJN A;  3ZRC A;  5IA7 A;  3QAR A;  4NAW B;  4PS7 A;  2A4Z A;  3VVW B;  2DZI A;  2I1J A;  1E7V A;  2KD0 A;  3A9J A;  3A9K B;  4AOF A;  1J8C A;  4WJQ A;  3TL5 A;  2IO1 B;  2A5U A;  1TZ1 A;  5E6P A;  3DBH I;  2FCS A;  2BPS A;  2G4S A;  1EF5 A;  1UGM A;  4BBN C;  1R4M I;  4IWO A;  2L0F A;  2J0K A;  3JVZ X;  3KUC B;  4X57 B;  1U4A A;  2V4L A;  5L83 A;  2MCN B;  4GB9 A;  2W9N A;  3ZKJ C;  1WR6 E;  3R7R A;  2BYF A;  4GU2 A;  4HJK A;  4NJ6 A;  4WJP A;  2NBV B;  4MDK E;  2LVP A;  2N1V A;  2C5L C;  3RD2 A;  2L8J A;  2UWQ A;  4DXA B;  5D6J B;  3I3T B;  1WGR A;  2KC2 A;  2KZR A;  4GGQ A;  4DDI D;  2K8B A;  1H8C A;  2JZZ A;  3W1S C;  3MJW A;  2KX0 A;  4RM9 A;  1YD8 U;  3L16 A;  2KC1 A;  1V2Y A;  2J0J A;  3VTV A;  4KV2 A;  2JZ3 B;  3KH0 A;  3WAN A;  2KTF A;  3CMM B;  2RGF A;  5DPW A;  4MGZ E;  2JXX A;  1WXM A;  3PT2 B;  2G45 B;  2V3S A;  4PYU A;  1GG3 A;  1V80 A;  2BYV E;  2D3G A;  2IY1 B;  3ML8 A;  4IC7 B;  5BO4 B;  4ANW A;  2WYQ A;  2RR9 A;  1V86 A;  2LAS A;  3TCA A;  2DAF A;  5EDS A;  2WDT B;  3WIM A;  3NZS A;  1J0G A;  5D2M B;  5G55 A;  3U8Z A;  4EKU A;  4WWP A;  3QHT A;  1V9J A;  2JRI B;  1LQB A;  2K6Q A;  2KWU B;  3PTF C;  2ZZP B;  3T8M A;  5AZF A;  4B6W A;  3WAP A;  1NDD A;  2IO0 B;  4LDT D;  2N7D A;  4BFR A;  3N32 A;  1EF1 A;  4MGY E;  5D7G A;  2PJH A;  2K8C A;  4BOZ B;  3L17 A;  4W9H A;  3DVG Y;  4W9C A;  1MG8 A;  2DHZ A;  3A1Q B;  4HXD A;  4CHK A;  2ZVO A;  2FUH B;  2ZPY A;  4IUM B;  2KWV B;  3DPD A;  4DK5 A;  4GN1 A;  5E6O A;  4DWF A;  1OGW A;  2R2O A;  5G2N A;  1A5R A;  5J17 A;  4K7U A;  2AEH A;  1UH6 A;  5CTR C;  3CSF A;  4BKS A;  2EMS A;  2GBM A;  3HHM A;  3L08 A;  2CU1 A;  2LVO A;  2J7Q B;  1CMX B;  5LXH A;  2CS4 A;  2L3Z A;  4JLC A;  4W9J A;  4IM3 A;  3M63 B;  2ZNV B;  1S3S G;  4GMV A;  4BKS D;  3OJ4 B;  3U7D A;  1V5T A;  1HE8 A;  3WAL A;  2D10 A;  1SE9 A;  3APF A;  3B08 A;  1M94 A;  2KK8 A;  3QC8 B;  4HCP B;  3IHP C;  1D3Z A;  1BT0 A;  4AJY B;  1WFY A;  4I6L B;  3NZU A;  4DDG D;  2JRH A;  2O2V B;  4ZRJ A;  3V6C B;  2FAZ A;  4AWJ A;  4FAD A;  2RSU A;  3D32 A;  3BIN A;  3WA0 A;  1FXT B;  3ZRF A;  2NBU A;  2O6V D;  3TMP B;  2KTR B;  3M95 A;  3X0W A;  2G3Q B;  1Q5W B;  4EUT A;  4EZL A;  2BWF A;  3K9P B;  4FLH A;  2JT4 B;  4G0N B;  4EFO A;  1F9J A;  4DHJ B;  2GBN A;  4N9F 4;  2OOB B;  5GMV A;  1SIF A;  4W9F A;  2MRP A;  1E8Z A;  3SD5 A;  4M8M A;  4LJP B;  1OTR B;  3OJ3 A;  2M0X A;  3K9O B;  4FJY A;  4NNJ B;  3OAW A;  4WQO B;  4E71 A;  4DHZ B;  2NS5 A;  3A1Q A;  4BOS C;  4EZJ A;  2KO3 A;  4XZ4 A;  1WE7 A;  4JQW C;  5L95 C;  1WI0 A;  4JL9 A;  3T9L A;  1Q0W B;  4PS8 A;  3DBL I;  3L0W B;  1Q1O A;  1WMH A;  3VXW A;  4BKG A;  3AU4 A;  5E6N A;  1V5O A;  1RLF A;  1WXA A;  2EKE C;  2KDI A;  2O2V A;  1WM3 A;  3AU5 A;  4FN2 A;  2Z0E B;  1WIA A;  1OEY J;  4M8N A;  3SU8 X;  2D07 B;  4IWP A;  3IVF A;  3RT3 B;  2LVQ A;  2NVU I;  2XK5 B;  3CF6 E;  3QX1 A;  2ZEQ A;  2M8S A;  2LD9 A;  2MW5 A;  2PEA A; 
#chains in the Genus database with same CATH topology
 4BVU C;  4HKQ A;  4KZC A;  1K8R B;  1OQR A;  1SE4 A;  2WWZ A;  5DPR A;  5FR6 A;  5JZE B;  2KJR A;  2C9W B;  4XDD A;  4ACF A;  5HHD G;  3O65 B;  3ZJV A;  3TBL D;  1PUT A;  4GDK B;  4HCN B;  3H1U A;  1WZ0 A;  2EEL A;  3A9K A;  2MSE D;  1GUA B;  1NVI D;  5TR5 A;  2QSD A;  1WXQ A;  2IGG A;  2J53 A;  2JYT A;  3ZNI D;  2KFJ A;  2BF8 B;  3C0R B;  2JVC A;  3BII D;  3IXS A;  2HTH A;  4C7Z A;  1K52 A;  1OQY A;  2HD5 B;  2CHZ A;  4FJZ A;  4F1S A;  4RFB A;  2CHW A;  4NQL B;  2KNB A;  3Q3O C;  3W1Y A;  1YX6 B;  1GPX A;  2KVZ A;  2K1F A;  3PHW B;  3LYY A;  3RMK C;  4TUU A;  3UIP B;  3CST A;  2KLG A;  3RNA C;  4XE0 A;  1WJN A;  1C9F A;  4N59 A;  3NOB A;  2DYB A;  3PSE B;  1F0Z A;  3ZNZ B;  3ZVV A;  4MSQ B;  4FUL A;  4ANX A;  1V81 A;  4WWO A;  3QIJ A;  2KWC A;  1RAX A;  2L52 A;  3VUX A;  4MSM B;  3R8B A;  2DZJ A;  1JWB D;  1JW9 D;  3HK0 A;  2KQ7 A;  3Q3N C;  2PVO D;  3W5U B;  4OZB A;  3N3K B;  4TV3 A;  1GB4 A;  1C78 A;  2DZM A;  3SEB A;  2KMC A;  1L0X B;  1L0V B;  2OJR A;  3IT6 B;  3B0A A;  4EZK A;  1YIW A;  2WXH A;  3NG0 A;  2MP2 A;  2BBC A;  3UIO B;  4DXG A;  4FXC A;  3GP7 A;  1P3Q U;  2V1Y A;  3ZNH B;  4KDI C;  2LXC A;  1SXT A;  1N63 A;  4YTN B;  1NI2 A;  3KWL A;  2VH1 A;  1FXI A;  4GIV A;  4MH8 A;  4AJW A;  4B95 A;  5GXG B;  3VHT C;  3RCZ A;  4F8C B;  3Q14 C;  3ZO5 B;  1H4R A;  3FIL B;  4FHJ A;  4W9E A;  1QZE A;  1E8W A;  1PDX A;  1DOI A;  2VH2 A;  1L2N A;  1TGZ B;  1DOY A;  3NVY A;  2Z59 B;  2VZK D;  2M19 A;  2RDG A;  4ANV A;  3P42 A;  2WS3 B;  1NBF C;  1IP9 A;  4FHK A;  1IGC A;  4M02 A;  4K3B A;  2JUO A;  1V1O A;  3HRD D;  1T3Q A;  2DBY A;  3RNF C;  3CWI A;  2KKC A;  5H8Y E;  2PE6 B;  1UF0 A;  1P0R A;  2DEN B;  3IG3 A;  4IM0 A;  1YN3 A;  4C7Y A;  1IBX B;  2I38 A;  1VZ6 A;  3KLS X;  4A20 A;  1HEZ E;  3V61 A;  5CHV C;  4PK1 A;  3KYD D;  4KKJ A;  1E9M A;  4MJS A;  3A9J B;  2Y5C A;  3ENE A;  3ZLZ A;  3DWM A;  2BS3 B;  1WJU A;  4A9A A;  1FMA D;  2IZV B;  4HLE A;  1N5X A;  3DQV A;  3HIZ A;  2GI9 A;  5BYQ A;  4DBG A;  2ASQ A;  1EU4 A;  3AEA B;  3BVZ A;  1L6U A;  3DBS A;  1WXV A;  4P7I A;  2X38 A;  1JAL A;  1KM7 A;  1XCQ L;  1TZO A;  4BKT A;  4E3C A;  2KDF B;  3LB8 C;  2C7N B;  2VRR B;  1HZ5 A;  3DVG X;  3Q8E A;  2PW9 A;  2LGX A;  1E6E B;  2HE7 A;  1YQ4 B;  4C56 C;  4HDQ A;  2MBQ A;  5C23 A;  3OG5 A;  2QJL A;  4KGR A;  3I63 C;  4CYE A;  2O6V A;  4ZRQ A;  2WGS A;  3RUL A;  1YN4 A;  2NBW B;  5AEK B;  3BK2 A;  4RH6 A;  2LXA A;  3IFW B;  4I6P A;  3VUY A;  2QEJ C;  5IA7 A;  2K22 A;  3VVW B;  1UNS A;  1D6E C;  2E3T A;  2IJ0 A;  3TEY A;  2V3N A;  1FRD A;  4BAX A;  1R4M I;  1Y56 A;  2J0K A;  1F2R I;  2L0F A;  4X57 B;  2V4L A;  2MCN B;  2W9N A;  1VJK A;  2BYF A;  4GU2 A;  4MM3 B;  4MT5 A;  2J52 A;  2C5L C;  2L8J A;  4K3C A;  1JML A;  4DXA B;  2JZP A;  5D6J B;  1JCK B;  4GGQ A;  1I4H A;  3W1S C;  2KX0 A;  1MG4 A;  4KV2 A;  2JZ3 B;  3CMM B;  2RGF A;  5DPW A;  2JXX A;  3PT2 B;  4PYU A;  1F1H A;  2D3G A;  2IY1 B;  2D5G A;  2LAS A;  3BZD B;  3TCA A;  5EDS A;  1ZDV A;  1WGK A;  4REZ A;  1SF0 A;  4HKZ E;  1EWY C;  3WAP A;  2IO0 B;  1FM0 D;  2N7D A;  4BFR A;  2PJH A;  3A1Q B;  2DHZ A;  2FUH B;  2ZPY A;  3NRZ A;  4DK5 A;  4GN1 A;  4DWF A;  5G2N A;  1FO4 A;  3R2T A;  5J17 A;  3CSF A;  2J7Q B;  1CMX B;  5LXH A;  3AE7 B;  2CS4 A;  4W9J A;  1TS3 A;  4JLC A;  2LHD A;  2PTL A;  1VR9 A;  4GMV A;  3U7D A;  1HE8 A;  3B08 A;  3QC8 B;  3IT4 B;  4P16 A;  1D3Z A;  4HEA 1;  3VR9 B;  2JRH A;  3V6C B;  2FAZ A;  4JE3 B;  2BYT A;  3NZ3 A;  2KTR B;  3M95 A;  2OED A;  1Q5W B;  1QOB A;  2MJ3 A;  4EUT A;  3ZXR A;  1FPY A;  3VR8 B;  2WXM A;  1E8Z A;  2MJE A;  1VLB A;  3A1Q A;  2IND C;  4WIP A;  4JL9 A;  1Q1O A;  2KT7 A;  1CK1 A;  3C8Y A;  1EM7 A;  2KDI A;  3AU5 A;  1WM3 A;  3ZXV A;  1WIA A;  2ONQ A;  4M01 A;  2LVQ A;  3CF6 E;  2MW5 A;  4NPN A;  2EKI A;  2MA9 B;  1TBE A;  5C3J B;  3SHQ A;  1GNU A;  3RNE C;  1TY0 A;  3BVG A;  2N9X A;  3MC0 B;  1N62 A;  4ARC A;  3KWV A;  5IAA C;  3TSS A;  1T6B X;  1I4G A;  1TS5 A;  2AQ1 B;  3U52 E;  1V1P B;  2WXO A;  3UQA A;  3AE8 B;  3R66 C;  2X8X X;  1ZGU B;  3Q3F A;  1P1A A;  1G6J A;  2KWD A;  2G4D B;  1WGD A;  3B1L X;  1N61 A;  2CJO A;  3RZF A;  2BS4 B;  2KDB A;  4FBJ B;  4RM8 A;  4ZYN A;  1FRR A;  1WYG A;  4LLG M;  2DWQ A;  3PRP B;  2N9E B;  2WU5 B;  1EO6 A;  2LGS A;  4FA6 A;  2K6D B;  2WLB A;  3BYY B;  4OVZ A;  3P2B A;  4HPL B;  4IM2 A;  1WWT A;  2YVC A;  1C3T A;  2V4I B;  1F77 A;  2EMT A;  3NS8 A;  3AE5 B;  2WX0 A;  3H8H A;  1KOT A;  2JX5 A;  4KSL C;  3DDC B;  4W9D A;  4KSK C;  2DYO A;  4ICV A;  2WNM A;  2KVR A;  4CQN A;  3U30 A;  3NUH B;  1R4N I;  1T0Y A;  3MC9 A;  4MH0 E;  2WP9 B;  3ZDM C;  1NYQ A;  3VRB B;  1WRI A;  3PZD A;  4ARI A;  1FNV A;  2LGD A;  3VTU A;  2IBI B;  2N9P C;  1E90 A;  3EUB 2;  1ZOY B;  3R3M A;  2K25 A;  3I57 A;  4B0M A;  3H9D A;  3VH3 B;  4WJO A;  3KUD B;  1WY8 A;  2NMQ A;  4LJO B;  1WF9 A;  4WWM A;  2J42 A;  2Y5B B;  3LXF A;  2W3S A;  2CR5 A;  4A3O A;  2MLB A;  1WX9 A;  1WH3 A;  1KLV A;  4W9I A;  1XQQ A;  2DX5 B;  3PLV A;  4S17 A;  1XT9 B;  1JWA D;  1C4C A;  2N4F A;  2BT6 A;  2PPH A;  2GBK A;  4YTP B;  5AZH A;  4TQ1 A;  1C76 A;  1WXS A;  1YJJ A;  4ZRI A;  1P98 A;  3MHS D;  2L76 A;  5IN7 A;  2RDH A;  4WWN A;  1J7C A;  4YXD B;  4DHZ E;  2KHW B;  2RD0 A;  1TKE A;  1J7A A;  4FJV B;  4OVU A;  3EHV A;  1VZ8 A;  4G3X B;  5D3I B;  1QF6 A;  3NHE B;  3ML9 A;  3C19 A;  2GRI A;  4TSS A;  5DCN A;  2BGF A;  3Q8F A;  1BUI C;  1L6V A;  4NAW A;  1JQ4 A;  2JF5 A;  3ZJU A;  2KLC A;  2AL6 A;  5FKA C;  4TQ0 A;  1RRB A;  2KQ4 X;  2IO3 B;  3BWU D;  3NJT A;  2JWZ A;  4LTU A;  2GBJ A;  2WXK A;  4OVV A;  2IYD B;  2ZJD A;  1WRD B;  1X1M A;  3Q8A A;  3V62 A;  4YSY B;  2D3C A;  1ZUD 2;  2WXF A;  4XWW A;  2N9K A;  2YEP F;  4P1B C;  1E8Y A;  5T8I A;  4OHJ A;  3VTW A;  3FKY A;  3TJP A;  3DWG C;  4F7Z A;  3AE6 B;  3DVN V;  3WCQ A;  1CJE A;  2R2Q A;  2XN9 C;  2REX A;  2WX1 A;  3GS2 A;  1K53 A;  2LJ5 A;  2PE9 A;  2ZCC A;  3AH7 A;  2RPQ A;  2HJ1 A;  2AQ3 B;  1ZW7 A;  1YJ1 A;  3DBR B;  3QA8 A;  2FID A;  1WZ3 A;  3TEX A;  3VUW A;  1XLN A;  5BMH A;  1ZKH A;  1ZXH A;  4YSX B;  2W54 A;  4LNK A;  3EFU A;  2WXG A;  2K8H A;  2MQJ A;  2MBE A;  1SIJ A;  4JPS A;  2C7H A;  2LJI A;  1V97 A;  3EEC A;  2GMI C;  4Q2J A;  4PS3 A;  1KH0 A;  3M62 B;  4KDL B;  4NAW B;  4PS7 A;  2DZI A;  2I1J A;  2BTE A;  1TJE A;  4IDI A;  1FCL A;  2KD0 A;  3A9J A;  3A9K B;  4AOF A;  1YN5 A;  2A5U A;  1R4M B;  4J3O D;  2G4S A;  4IWO A;  1U4A A;  5I4D A;  5L83 A;  4USA A;  4AQ7 A;  1IGD A;  2IPK D;  3ZKJ C;  1IBX A;  4N58 A;  4YTM B;  2RMM A;  2NBV B;  2D3B A;  1DOX A;  3HVZ A;  2UWQ A;  3AV8 A;  1F2R C;  1SEB D;  1RWS A;  1XO3 A;  4NZL B;  1WGR A;  4ZHO A;  3MJ5 A;  2KC2 A;  2WQY B;  2K8B A;  4LK0 M;  3MJW A;  3NS1 A;  3L16 A;  3AEE B;  2QCZ A;  3KH0 A;  1AN8 A;  3WAN A;  1MFW A;  4MGZ E;  3Q8B A;  1GG3 A;  2XNA C;  4A90 A;  3ML8 A;  4ANW A;  2WYQ A;  2DAF A;  2SAK A;  5D2M B;  4EKU A;  4WWP A;  5TSS A;  3QHT A;  2JRI B;  1LQB A;  4ZRP A;  3PTF C;  4ITK A;  4LDT D;  1EF1 A;  2V9H A;  1QKZ A;  4RGM A;  2WXQ A;  3L17 A;  4W9C A;  1MG8 A;  4CHK A;  4IUM B;  1ENF A;  1OGW A;  5IKC M;  1JWU D;  4BKS A;  2EMS A;  3L08 A;  3HHM A;  3RNG C;  2L3Z A;  1HTQ A;  1MHH E;  2DNF A;  4IM3 A;  3M63 B;  1S3S G;  4TMA B;  2JU6 X;  2UU7 A;  1QLB B;  3APF A;  1M94 A;  4HCP B;  3AEF B;  4WQM A;  3MP9 A;  4AWJ A;  2RSU A;  3BIN A;  2ZW1 A;  1FXT B;  4M0W A;  4JWU C;  2O6V D;  3ZRF A;  2W3R A;  2FUG 1;  2G3Q B;  2WXL A;  1RFK A;  4EZL A;  3Q2A C;  1TY2 A;  3AN1 A;  4G0N B;  1F9J A;  2OOB B;  5GMV A;  1GB1 A;  2WU2 B;  1UUP A;  2MRP A;  4M00 A;  4M8M A;  5BYS A;  3PO0 A;  3AE2 B;  4LJP B;  1OTR B;  3OJ3 A;  4WQO B;  2NS5 A;  4EZJ A;  3O13 A;  3AE9 B;  4XGA B;  1WI0 A;  1TS2 A;  3DBL I;  3VXW A;  1WMH A;  1TYG B;  4RF0 A;  5E6N A;  1V5O A;  1RLF A;  4DXF A;  3T3N A;  2I2Y A;  2Z0E B;  2JSV X;  1OEY J;  1D5X C;  3IVF A;  2NVU I;  2XK5 B;  4PT5 A;  5G5G A;  2BQQ A;  2PVG C;  1WYW B;  1XLO A;  4KIK A;  1LXD A;  1Z5S B;  3UGB B;  1EU3 A;  4LCD E;  1WJ6 A;  1N60 A;  2KAN A;  2WXI A;  2N1W A;  1E10 A;  1TT5 B;  3TUO A;  4E74 A;  4HK2 A;  2BS2 B;  4D2K A;  1V8C A;  1ROE A;  4KKI A;  3AEC B;  1OEY A;  1JRO A;  1VZ7 A;  4GSW A;  3FC4 A;  4K7W A;  1GAQ B;  5DPS A;  4G50 A;  2Q5W D;  4W9K A;  5EE9 A;  3Q8C A;  4ZYS A;  2V0G A;  2CHX A;  4IW0 A;  4KZ0 A;  3B2G A;  2N9L A;  1QOG A;  3ALB A;  2I1K A;  1N5W A;  5AZG A;  3PZ7 A;  5KHQ A;  3QQ8 B;  2KYW A;  3AE3 B;  3HM3 A;  1RM6 C;  3FIL A;  2LUM A;  1E5W A;  4KGS A;  4MEM A;  1L0Y B;  1PGA A;  2H88 B;  1YJI A;  1P7F A;  3M3J A;  2OHF A;  2GB1 A;  1FNU A;  2FIF A;  3PRZ A;  1UBQ A;  3KVF B;  3R7Q A;  5JXV A;  4WH4 A;  2MX2 A;  4II2 B;  2XEW A;  5CHF A;  3HVD A;  3X23 A;  2R61 A;  1E7U A;  3ETR A;  4B0E A;  2FE8 A;  5HKH A;  2LUE A;  2LWP A;  2WDV B;  4A3P A;  2KFK B;  2KMM A;  3VH4 B;  4DQO C;  4GLS C;  1I42 A;  2KJH B;  3PPA A;  3P1M A;  2HJ8 A;  3MFG A;  1ZP0 B;  1I4P A;  1FXA A;  5EE3 A;  2N7E A;  1RYJ A;  1HTO A;  3JSV A;  3ZIM A;  5J18 A;  4MM3 A;  3ECI A;  3AUL A;  4RGT A;  3ZJT A;  1LM8 B;  3AI5 A;  1S1Q B;  1J19 A;  4HRS A;  4HPP A;  4WAA A;  2BYE A;  4AUQ C;  4EOY A;  4GDL B;  3ONS A;  1WGY A;  1TS4 A;  2KN5 A;  3V60 A;  2Y5P A;  4I6N B;  5J2R A;  3LJ3 A;  1ZPS A;  1FIQ A;  3RN9 C;  1R7S A;  2M4N A;  3VFK A;  3ZNG C;  3EFC A;  1B9R A;  3LDZ E;  1TTN A;  3ZTC A;  3W1S A;  3AEG B;  3GZN B;  2KAC A;  3MTN B;  3ZQ4 A;  3PLU A;  3I5J C;  3VDZ A;  2PIA A;  3B2F A;  3ZGZ A;  3DHI C;  3AMZ A;  2XBB C;  2Y3A A;  5D94 A;  2C60 A;  4GDL A;  5JHB A;  1TKG A;  2INP E;  3OWE B;  1M4V A;  1WE6 A;  1T0S C;  4K1R B;  2KMA A;  3DVN U;  2FBW B;  2N0S B;  4J6I A;  2GLS A;  1XF5 L;  2CJN A;  3QJZ A;  4HDO A;  1Y8R C;  3H6N A;  1P9D U;  5H92 C;  2M1M A;  2N7J A;  2TSS A;  2MBB B;  3IBE A;  2L00 B;  1FFU A;  1D5M C;  1JWS D;  5HFY A;  1ISN A;  3P4R B;  2GOW A;  1EUV B;  3GE8 C;  2QIE B;  3RUI B;  3APC A;  3PZ8 A;  4ANU A;  1ET9 A;  1HZ6 A;  4G11 A;  4C4V B;  1XLQ A;  4HJG E;  3U7Z A;  1FD6 A;  2FCN A;  1C79 A;  4K81 A;  4KX6 B;  3ZYY X;  4TKN A;  3UQB A;  5FR3 A;  1SE2 A;  4RNA A;  5C1Z A;  2UYZ B;  4IWQ A;  3URY A;  2H89 B;  4BBN F;  1LO5 D;  3WAO A;  2BVC A;  2L05 A;  3JW0 X;  5JHA A;  1WX8 A;  4XX5 A;  5E6J A;  3QWZ B;  2INC C;  3Q69 A;  3H7P A;  3VRA B;  3TEW A;  4ZRK A;  5IO9 A;  4XDC A;  3PGE A;  2BW2 A;  4AP4 C;  4W9G A;  4NQK E;  2OJW A;  4YWG G;  3V05 A;  2LMC A;  3UI3 A;  3UIN B;  2WDR B;  2G1E A;  4PYZ A;  2QHO A;  1WGH A;  1C1Y B;  2NCN A;  1WR1 A;  1SBB B;  3BY4 B;  2ZCB A;  4HVB A;  2IY0 B;  4US9 A;  3SDL C;  1QQR A;  4IG7 B;  2M0A A;  4YL8 A;  2JY6 A;  3PHX B;  1BML C;  3L4P A;  4KIK B;  1UEL A;  1WJ4 A;  3GZN I;  2JQR B;  1L4D B;  1C4P A;  2KDE B;  3Q3J A;  3PRM B;  1ACC A;  2CU3 A;  3AB5 A;  3JYU A;  3GOE A;  1PQS A;  2FCQ A;  3DOW A;  2NPT A;  4WJN A;  3ZRC A;  3QAR A;  3KQ4 A;  2PKO A;  2A4Z A;  1HXY D;  5G5H A;  1AWD A;  2G9H D;  4WJQ A;  3TL5 A;  2IO1 B;  1TZ1 A;  2J4X A;  3MHZ A;  2FCS A;  2BPS A;  3DBH B;  2V3P A;  3JVZ X;  4BZA A;  3KUC B;  3FAH A;  1D4B A;  2IGH A;  1WR6 E;  3R7R A;  2LVP A;  2N1V A;  1B1Z A;  1AYF A;  1KF6 B;  4H2A A;  5BMG A;  2KZR A;  4DDI D;  2HDE A;  2W55 A;  1YD8 U;  2KC1 A;  1L4Z B;  1GOZ A;  4NJC A;  2LGI A;  1WXM A;  2G45 B;  2V3S A;  1V80 A;  1LGR A;  1Q10 A;  1ET6 A;  3RNC C;  4HRO A;  1N6Z A;  2PLP A;  3Q6B A;  2RR9 A;  1V86 A;  4QAY A;  2WDT B;  2MJD A;  5G55 A;  2KWU B;  2ZZP B;  5AZF A;  1NDD A;  1J7B A;  3N32 A;  5D7G A;  4MGY E;  2K8C A;  4BOZ B;  3DVG Y;  4HXD A;  2ZVO A;  1F52 A;  2KWV B;  4A55 A;  2R2O A;  1A5R A;  4K7U A;  2AEH A;  5CTR C;  2CU1 A;  1HQR D;  2LVO A;  1MI0 A;  1QOF A;  2ZNV B;  1T0R C;  1EWC A;  3IHP C;  1WFY A;  2O2V B;  4RGO S;  4ZRJ A;  3WA0 A;  3D32 A;  2JXT A;  3AED B;  2NBU A;  3TMP B;  2BB5 A;  1VDV A;  1T0Q C;  4FLH A;  2JT4 B;  4EFO A;  2GBN A;  3CIR B;  1SIF A;  1V1P A;  4W9F A;  1PYW D;  5LNK 1;  4FJY A;  4NNJ B;  1FCC C;  3OAW A;  4E71 A;  4DHZ B;  1ZDX A;  1QIL A;  1DYQ A;  4BOS C;  2KO3 A;  1L5P A;  4XZ4 A;  1YQ3 B;  1WE7 A;  1NEK B;  4JQW C;  3T9L A;  1Q0W B;  3L0W B;  3MC8 A;  2WXR A;  3RFZ B;  1WXA A;  2EKE C;  2O2V A;  4O1N A;  1JRP A;  3RT3 B;  3QX1 A;  2ZEQ A;  2M8S A;  2JWU A;  4L1B A;  3V6E B;  2LFI A;  5C2T B;  3PRE A;  5HG2 A;  3OLM D;  5IOI A;  2ZW0 A;  2MBO A;  4W9L A;  4K7S A;  4HWI B;  1I4X A;  1IUE A;  4IKG A;  1L7Y A;  4LNF A;  2BKF A;  1UGJ A;  1I4R A;  4MJS B;  1WGG A;  3NVW A;  1LFD A;  2KX3 A;  3Q3M C;  2WXN A;  1ZXI A;  2KFK A;  2KJ6 A;  2MHJ A;  1D5Z C;  4RCO A;  3JSV B;  2D11 A;  2WHI A;  3HUI A;  3BYT B;  2LZ6 A;  3E9S A;  1GJZ A;  1V49 A;  3N30 A;  4M0W B;  2ON8 A;  1I7H A;  1STE A;  2L32 A;  3P4S B;  4A8X C;  2QDF A;  2WXJ A;  1PGB A;  3RI7 C;  1IPG A;  2M17 A;  4RMA A;  2ZNV C;  1GC7 A;  2FNJ B;  3PVL A;  1SSN A;  3ZDT A;  3W2D A;  4LNI A;  3ZUN A;  2KAJ A;  2DZK A;  3APD A;  3B9J A;  1TIF A;  4C80 A;  3A4R A;  1YNT E;  2K39 A;  4MGI E;  1XXG A;  2YLM A;  4GOC A;  5D3D A;  3VQI A;  4XYC A;  3AE1 B;  2KOX A;  1UD7 A;  1MPE A;  3EGR A;  3PS6 A;  2DAJ A;  1AAR A;  1NEN B;  2C7M B;  3A4S C;  5MPO A;  2CKH B;  2E6X A;  3UF8 A;  2MP2 B;  3L54 A;  3N1Y C;  2NTT A;  3NVZ A;  4IOI E;  1GC6 A;  3AM9 A;  2JPH A;  2XK5 A;  5JH5 C;  5CX3 A;  4URK A;  2KXJ A;  1SE3 A;  2M56 B;  3TIX A;  3NVV A;  5LLI A;  3IAM 1;  1K50 A;  3RZW C;  5CHW A;  4ICU A;  3QAQ A;  1E7P B;  2W82 A;  4NJ7 A;  3VAW A;  2MWS B;  1JRU A;  1A70 A;  1RFA A;  3E56 A;  2LGY A;  3AE4 B;  2QC8 A;  1YX5 B;  3H7P B;  1C77 A;  2GBR A;  2AWT A;  2LEK A;  1SB3 C;  2QIL A;  3ABV B;  5IP4 D;  5AUI A;  1I35 A;  1FEH A;  5KHO A;  1MJD A;  1UBI A;  3RYT A;  1VD2 A;  4XWT A;  3ZW3 A;  2LRW A;  1YMH E;  2L1A A;  4UDU C;  3A33 B;  2FCM A;  1WMH B;  3NY5 A;  4RF1 A;  3QK0 A;  4YT0 B;  5BYR A;  3WAM A;  2KTR A;  2DLB A;  4XC2 A;  1WSP A;  3P4P B;  2AYO B;  4KVG B;  4P6V F;  2LI5 A;  1WM2 A;  3L10 B;  5HI1 A;  1MHX A;  2B76 B;  2ZVN A;  4OW0 A;  1YOV B;  4RGN A;  2ZPN A;  5DPT A;  4JX1 C;  2D2Q A;  3S2A A;  1T5X D;  4JGH B;  1CZP A;  2AX5 A;  3DHH C;  4NY0 A;  2NPT B;  3RPF C;  4C00 A;  2J0M A;  4ZOH C;  3N9Y C;  3U4E G;  3HM6 X;  3RNB C;  1E8X A;  1VRA B;  4ASW C;  2AL3 A;  2DYM A;  4GXB A;  2WDQ B;  2MBH A;  1Z2M A;  2RPV A;  3QCA A;  4CO7 A;  4LNN A;  4MEL A;  4MGK E;  2SEB D;  2JYE A;  1YQB A;  3H7S A;  5AUK A;  4C4V A;  2O6V B;  2L7R A;  4R3D A;  4MAC A;  2BKR B;  2L0T A;  4US8 A;  3PV1 A;  2MH7 A;  4ZDV A;  3DBR I;  1UZX B;  1ZE3 D;  3SR6 A;  5LXI B;  3V3X A;  2LRU A;  3R2I A;  2B3A A;  4LNO A;  1NYR A;  2VZK B;  2KQS A;  1WX7 A;  2K9X A;  1FNW A;  2BWE S;  4JIO U;  4JWS C;  3TEZ A;  3KYC D;  2IGD A;  3EC8 A;  1FFV A;  1IYF A;  1NI3 A;  2K3U A;  4L2Y A;  3P63 A;  1UWM A;  4LDT B;  2IO2 B;  2NR2 A;  4GDK A;  1MVK A;  1XD3 B;  4EEW A;  3DCG A;  2Z0D B;  2QMT A;  3ZTD A;  1KLG D;  5EE0 A;  1V6E A;  4II3 B;  3EA6 A;  3L13 A;  3KUZ A;  3P4Q B;  1VCB A;  1AW7 A;  1SGH A;  3AXC A;  1JWM D;  1KRH A;  1ESF A;  4DHJ D;  1KJT A;  1I4Q A;  3KW5 B;  4B9K A;  4HPM B;  3GE3 C;  1C4A A;  3T3O A;  2Z8L A;  1E7V A;  1KFY B;  3DBL B;  1J8C A;  4WUR A;  5FK9 C;  3IAS 1;  3N20 C;  5E6P A;  2NTS A;  1DGJ A;  3DBH I;  1EF5 A;  1UGM A;  4BBN C;  2IDY A;  4GB9 A;  3SFD B;  1K51 A;  2L83 A;  4HJK A;  4NJ6 A;  4WJP A;  4MDK E;  4L23 A;  3RD2 A;  3W5V B;  1BXT A;  3I3T B;  1H8C A;  2JZZ A;  2RDB C;  4RM9 A;  1XCT L;  4P1C C;  1V2Y A;  4NAM A;  2J0J A;  3VTV A;  1P7E A;  2KTF A;  4KGT A;  1OQQ A;  2BYV E;  4IC7 B;  4OZA A;  5BO4 B;  2INN E;  1R4N B;  3N1Z C;  4WAF A;  3WIM A;  3NZS A;  1J0G A;  3U8Z A;  1QOA A;  1SJH D;  1V9J A;  3DHG C;  2K6Q A;  1HA5 A;  3T8M A;  4B6W A;  2ICI A;  1XEE A;  4ZHP A;  4A6Q A;  4S0R A;  1SJE D;  2YEP B;  4W9H A;  1E0Z A;  3DPD A;  5E6O A;  2BB6 A;  1UWX A;  1UH6 A;  2KDM A;  2GBM A;  2MEK A;  3BVM A;  4BKS D;  3N1X C;  3OJ4 B;  1V5T A;  3WAL A;  2D10 A;  1KTK A;  1SE9 A;  3AEB B;  3I9V 1;  2KK8 A;  1PFD A;  2WXP A;  4OZC A;  1BT0 A;  3GB1 A;  4AJY B;  4I6L B;  3NZU A;  3U2S C;  4DDG D;  1TKY A;  4N6E B;  4FAD A;  1PGX A;  2K5P A;  2AQ2 B;  2HTM E;  3X0W A;  1OFF A;  1CQV A;  2BWF A;  3K9P B;  5BMI A;  4DHJ B;  4N9F 4;  3W9C B;  3J9C A;  2ACZ B;  3SD5 A;  2M0X A;  3K9O B;  4EE2 A;  3BK1 A;  4AS1 A;  1XLP A;  2KN4 A;  3SFE B;  2LHE A;  1QT9 A;  2K0P A;  1KLU D;  5L95 C;  4PS8 A;  5EE1 A;  4BKG A;  3AU4 A;  4FN2 A;  2PMV A;  4M8N A;  3SU8 X;  2D3A A;  4YSZ B;  2D07 B;  4IWP A;  2LD9 A;  2PEA A; 
#chains in the Genus database with same CATH homology
 1WYW B;  4KIK A;  4NPN A;  2MA9 B;  3V6E B;  1LXD A;  1Z5S B;  3UGB B;  3PRE A;  4LCD E;  1TBE A;  4BVU C;  1WJ6 A;  2KAN A;  4KZC A;  3SHQ A;  1K8R B;  3OLM D;  1GNU A;  2MBO A;  4W9L A;  4K7S A;  4HWI B;  2N1W A;  2WWZ A;  2N9X A;  4E74 A;  1L7Y A;  5DPR A;  5FR6 A;  4HK2 A;  2BKF A;  5JZE B;  2KJR A;  2C9W B;  5IAA C;  3O65 B;  3TBL D;  4GDK B;  4MJS B;  4HCN B;  1WGG A;  3H1U A;  1WZ0 A;  3A9K A;  1LFD A;  2KX3 A;  2MSE D;  1GUA B;  5TR5 A;  1OEY A;  2KFK A;  4GSW A;  2KJ6 A;  4K7W A;  3UQA A;  3JSV B;  2D11 A;  5DPS A;  3R66 C;  3ZNI D;  2KFJ A;  1ZGU B;  2BF8 B;  3C0R B;  2JVC A;  4G50 A;  2LZ6 A;  2HTH A;  3Q3F A;  1P1A A;  1OQY A;  2HD5 B;  1G6J A;  2CHZ A;  4FJZ A;  4W9K A;  4F1S A;  2CHW A;  2CHX A;  1V49 A;  4IW0 A;  4KZ0 A;  1GJZ A;  2G4D B;  3N30 A;  1WGD A;  3ALB A;  2I1K A;  4M0W B;  3B1L X;  5AZG A;  4NQL B;  3RZF A;  2KDB A;  2KNB A;  4FBJ B;  5KHQ A;  4RM8 A;  3W1Y A;  4ZYN A;  1YX6 B;  3QQ8 B;  3HM3 A;  2K1F A;  1IPG A;  2M17 A;  4RMA A;  3PHW B;  2ZNV C;  3PRP B;  1GC7 A;  2FNJ B;  2N9E B;  3PVL A;  1E5W A;  3ZDT A;  1EO6 A;  4MEM A;  4TUU A;  3ZUN A;  3UIP B;  4FA6 A;  2K6D B;  2DZK A;  3APD A;  3CST A;  3M3J A;  3P2B A;  2KLG A;  3PRZ A;  2FIF A;  3A4R A;  4HPL B;  1UBQ A;  3KVF B;  4IM2 A;  1WJN A;  3R7Q A;  2K39 A;  2YVC A;  4MGI E;  2YLM A;  4GOC A;  1C3T A;  3NOB A;  2DYB A;  3PSE B;  2MX2 A;  2EMT A;  3NS8 A;  4II2 B;  3VQI A;  3ZNZ B;  3ZVV A;  2WX0 A;  2XEW A;  2KOX A;  1UD7 A;  4MSQ B;  4FUL A;  5CHF A;  3PS6 A;  4ANX A;  3X23 A;  1V81 A;  2DAJ A;  1AAR A;  4WWO A;  1E7U A;  1KOT A;  4KSL C;  2C7M B;  3A4S C;  5HKH A;  2LUE A;  2LWP A;  3DDC B;  4A3P A;  3QIJ A;  2CKH B;  2KFK B;  4W9D A;  4KSK C;  3VH4 B;  3UF8 A;  2KWC A;  2MP2 B;  1RAX A;  3L54 A;  2DYO A;  1GC6 A;  3VUX A;  4MSM B;  2JPH A;  2XK5 A;  4ICV A;  5JH5 C;  2KVR A;  5CX3 A;  4URK A;  1I42 A;  2DZJ A;  2KJH B;  3PPA A;  2HJ8 A;  2KXJ A;  3HK0 A;  3TIX A;  5LLI A;  3U30 A;  1R4N I;  1T0Y A;  2KQ7 A;  2N7E A;  3JSV A;  4MH0 E;  3ZIM A;  3RZW C;  5CHW A;  5J18 A;  3ZDM C;  4ICU A;  3QAQ A;  4MM3 A;  3N3K B;  3ECI A;  4TV3 A;  3AUL A;  4NJ7 A;  1LM8 B;  3VAW A;  3PZD A;  2MWS B;  3AI5 A;  2LGD A;  1S1Q B;  2DZM A;  1JRU A;  1J19 A;  1RFA A;  3VTU A;  2IBI B;  2KMC A;  2N9P C;  1E90 A;  4WAA A;  2BYE A;  2LGY A;  4AUQ C;  3R3M A;  4EOY A;  4GDL B;  1YX5 B;  2K25 A;  3H7P B;  2OJR A;  3ONS A;  3H9D A;  1WGY A;  3B0A A;  2GBR A;  3VH3 B;  2AWT A;  4WJO A;  2KN5 A;  3V60 A;  1YIW A;  4EZK A;  3KUD B;  4I6N B;  1WY8 A;  5J2R A;  2MP2 A;  4LJO B;  3LJ3 A;  3UIO B;  1I35 A;  1WF9 A;  2M4N A;  5KHO A;  1P3Q U;  3VFK A;  2Y5B B;  3ZNG C;  2V1Y A;  4A3O A;  2CR5 A;  1UBI A;  3LDZ E;  2MLB A;  1TTN A;  1WX9 A;  1WH3 A;  2LXC A;  4KDI C;  4W9I A;  3RYT A;  3ZTC A;  3ZNH B;  1KLV A;  1VD2 A;  1XQQ A;  1NI2 A;  2DX5 B;  3W1S A;  3PLV A;  4GIV A;  1XT9 B;  3ZW3 A;  2LRW A;  4AJW A;  4B95 A;  2N4F A;  3A33 B;  3MTN B;  2FCM A;  1WMH B;  3NY5 A;  3PLU A;  2PPH A;  2GBK A;  5AZH A;  3VHT C;  3QK0 A;  4TQ1 A;  3RCZ A;  3VDZ A;  4F8C B;  3ZO5 B;  1H4R A;  1WXS A;  4FHJ A;  4ZRI A;  1P98 A;  4W9E A;  3WAM A;  2KTR A;  2XBB C;  1QZE A;  1E8W A;  4XC2 A;  3MHS D;  5D94 A;  2AYO B;  2C60 A;  4GDL A;  4KVG B;  5JHB A;  2L76 A;  1WM2 A;  2LI5 A;  1WE6 A;  1L2N A;  1TGZ B;  4WWN A;  3L10 B;  2ZVN A;  4DHZ E;  2KHW B;  4K1R B;  2KMA A;  2RD0 A;  3DVN U;  4J6I A;  2Z59 B;  4FJV B;  4OVU A;  3EHV A;  2ZPN A;  5DPT A;  3QJZ A;  4G3X B;  2D2Q A;  3S2A A;  3NHE B;  4HDO A;  1Y8R C;  3ML9 A;  4JGH B;  4NY0 A;  2NPT B;  3H6N A;  2J0M A;  1P9D U;  2M1M A;  3HM6 X;  4ANV A;  1E8X A;  2MBB B;  3IBE A;  2L00 B;  5DCN A;  4ASW C;  2AL3 A;  1ISN A;  2DYM A;  4GXB A;  1NBF C;  2BGF A;  1EUV B;  2GOW A;  2MBH A;  1IP9 A;  4FHK A;  4NAW A;  3RUI B;  3APC A;  2JF5 A;  1Z2M A;  3QCA A;  2KLC A;  2AL6 A;  4ANU A;  2JUO A;  4TQ0 A;  1RRB A;  4CO7 A;  4MEL A;  4MGK E;  2KKC A;  1YQB A;  2IO3 B;  2PE6 B;  3H7S A;  4G11 A;  1P0R A;  2DEN B;  2JWZ A;  2GBJ A;  3IG3 A;  2O6V B;  4IM0 A;  4OVV A;  2IYD B;  2L7R A;  2ZJD A;  2FCN A;  4K81 A;  4TKN A;  3UQB A;  1WRD B;  2BKR B;  2L0T A;  1X1M A;  5C1Z A;  3V62 A;  3PV1 A;  4A20 A;  4ZDV A;  3DBR I;  2UYZ B;  4IWQ A;  4BBN F;  3V61 A;  1UZX B;  5CHV C;  3KYD D;  3WAO A;  2L05 A;  3JW0 X;  5JHA A;  5LXI B;  1WX8 A;  4XX5 A;  3QWZ B;  2LRU A;  4MJS A;  3A9J B;  3H7P A;  2B3A A;  3ENE A;  4ZRK A;  1E8Y A;  3ZLZ A;  3VTW A;  2KQS A;  1WX7 A;  3PGE A;  3TJP A;  1WJU A;  2IZV B;  4F7Z A;  4HLE A;  4AP4 C;  2BWE S;  3DVN V;  4JIO U;  4NQK E;  4W9G A;  3DQV A;  3HIZ A;  2R2Q A;  3KYC D;  2REX A;  2WX1 A;  4DBG A;  3EC8 A;  2ASQ A;  3UIN B;  1IYF A;  4PYZ A;  2QHO A;  1WGH A;  1C1Y B;  4LDT B;  3DBS A;  2LJ5 A;  2NCN A;  2IO2 B;  2NR2 A;  2PE9 A;  2ZCC A;  1WR1 A;  4GDK A;  1WXV A;  2RPQ A;  1XD3 B;  2ZCB A;  3BY4 B;  4EEW A;  4HVB A;  3DCG A;  4P7I A;  2Z0D B;  2IY0 B;  3SDL C;  1ZW7 A;  1KM7 A;  3ZTD A;  4BKT A;  4E3C A;  1YJ1 A;  2KDF B;  4IG7 B;  1V6E A;  2C7N B;  3QA8 A;  4YL8 A;  2FID A;  2VRR B;  4II3 B;  1WZ3 A;  2JY6 A;  3DVG X;  3PHX B;  3VUW A;  3L13 A;  2LGX A;  3KUZ A;  2HE7 A;  4KIK B;  4HDQ A;  1UEL A;  2MBQ A;  1ZKH A;  1WJ4 A;  3GZN I;  5C23 A;  1VCB A;  1SGH A;  2KDE B;  3Q3J A;  3PRM B;  3AXC A;  4CYE A;  2O6V A;  3EFU A;  2K8H A;  2MQJ A;  3JYU A;  2MBE A;  3RUL A;  3GOE A;  1PQS A;  2C7H A;  2NBW B;  3EEC A;  5AEK B;  2FCQ A;  4DHJ D;  3DOW A;  1KJT A;  2GMI C;  2LXA A;  4PS3 A;  3KW5 B;  3IFW B;  4I6P A;  4B9K A;  4HPM B;  3VUY A;  2NPT A;  3M62 B;  4KDL B;  4WJN A;  3ZRC A;  5IA7 A;  3QAR A;  4NAW B;  4PS7 A;  2A4Z A;  3VVW B;  2DZI A;  2I1J A;  1E7V A;  2KD0 A;  3A9J A;  3A9K B;  4AOF A;  1J8C A;  4WJQ A;  3TL5 A;  2IO1 B;  2A5U A;  1TZ1 A;  5E6P A;  3DBH I;  2FCS A;  2BPS A;  2G4S A;  1EF5 A;  1UGM A;  4BBN C;  1R4M I;  4IWO A;  2L0F A;  2J0K A;  3JVZ X;  3KUC B;  4X57 B;  1U4A A;  2V4L A;  5L83 A;  2MCN B;  4GB9 A;  2W9N A;  3ZKJ C;  1WR6 E;  3R7R A;  2BYF A;  4GU2 A;  4HJK A;  4NJ6 A;  4WJP A;  2NBV B;  4MDK E;  2LVP A;  2N1V A;  2C5L C;  3RD2 A;  2L8J A;  2UWQ A;  4DXA B;  5D6J B;  3I3T B;  1WGR A;  2KC2 A;  2KZR A;  4GGQ A;  4DDI D;  2K8B A;  1H8C A;  2JZZ A;  3W1S C;  3MJW A;  2KX0 A;  4RM9 A;  1YD8 U;  3L16 A;  2KC1 A;  1V2Y A;  2J0J A;  3VTV A;  4KV2 A;  2JZ3 B;  3KH0 A;  3WAN A;  2KTF A;  3CMM B;  2RGF A;  5DPW A;  4MGZ E;  2JXX A;  1WXM A;  3PT2 B;  2G45 B;  2V3S A;  4PYU A;  1GG3 A;  1V80 A;  2BYV E;  2D3G A;  2IY1 B;  3ML8 A;  4IC7 B;  5BO4 B;  4ANW A;  2WYQ A;  2RR9 A;  1V86 A;  2LAS A;  3TCA A;  2DAF A;  5EDS A;  2WDT B;  3WIM A;  3NZS A;  1J0G A;  5D2M B;  5G55 A;  3U8Z A;  4EKU A;  4WWP A;  3QHT A;  1V9J A;  2JRI B;  1LQB A;  2K6Q A;  2KWU B;  3PTF C;  2ZZP B;  3T8M A;  5AZF A;  4B6W A;  3WAP A;  1NDD A;  2IO0 B;  4LDT D;  2N7D A;  4BFR A;  3N32 A;  1EF1 A;  4MGY E;  5D7G A;  2PJH A;  2K8C A;  4BOZ B;  3L17 A;  4W9H A;  3DVG Y;  4W9C A;  1MG8 A;  2DHZ A;  3A1Q B;  4HXD A;  4CHK A;  2ZVO A;  2FUH B;  2ZPY A;  4IUM B;  2KWV B;  3DPD A;  4DK5 A;  4GN1 A;  5E6O A;  4DWF A;  1OGW A;  2R2O A;  5G2N A;  1A5R A;  5J17 A;  4K7U A;  2AEH A;  1UH6 A;  5CTR C;  3CSF A;  4BKS A;  2EMS A;  2GBM A;  3HHM A;  3L08 A;  2CU1 A;  2LVO A;  2J7Q B;  1CMX B;  5LXH A;  2CS4 A;  2L3Z A;  4JLC A;  4W9J A;  4IM3 A;  3M63 B;  2ZNV B;  1S3S G;  4GMV A;  4BKS D;  3OJ4 B;  3U7D A;  1V5T A;  1HE8 A;  3WAL A;  2D10 A;  1SE9 A;  3APF A;  3B08 A;  1M94 A;  2KK8 A;  3QC8 B;  4HCP B;  3IHP C;  1D3Z A;  1BT0 A;  4AJY B;  1WFY A;  4I6L B;  3NZU A;  4DDG D;  2JRH A;  2O2V B;  4ZRJ A;  3V6C B;  2FAZ A;  4AWJ A;  4FAD A;  2RSU A;  3D32 A;  3BIN A;  3WA0 A;  1FXT B;  3ZRF A;  2NBU A;  2O6V D;  3TMP B;  2KTR B;  3M95 A;  3X0W A;  2G3Q B;  1Q5W B;  4EUT A;  4EZL A;  2BWF A;  3K9P B;  4FLH A;  2JT4 B;  4G0N B;  4EFO A;  1F9J A;  4DHJ B;  2GBN A;  4N9F 4;  2OOB B;  5GMV A;  1SIF A;  4W9F A;  2MRP A;  1E8Z A;  3SD5 A;  4M8M A;  4LJP B;  1OTR B;  3OJ3 A;  2M0X A;  3K9O B;  4FJY A;  4NNJ B;  3OAW A;  4WQO B;  4E71 A;  4DHZ B;  2NS5 A;  3A1Q A;  4BOS C;  4EZJ A;  2KO3 A;  4XZ4 A;  1WE7 A;  4JQW C;  5L95 C;  1WI0 A;  4JL9 A;  3T9L A;  1Q0W B;  4PS8 A;  3DBL I;  3L0W B;  1Q1O A;  1WMH A;  3VXW A;  4BKG A;  3AU4 A;  5E6N A;  1V5O A;  1RLF A;  1WXA A;  2EKE C;  2KDI A;  2O2V A;  1WM3 A;  3AU5 A;  4FN2 A;  2Z0E B;  1WIA A;  1OEY J;  4M8N A;  3SU8 X;  2D07 B;  4IWP A;  3IVF A;  3RT3 B;  2LVQ A;  2NVU I;  2XK5 B;  3CF6 E;  3QX1 A;  2ZEQ A;  2M8S A;  2LD9 A;  2MW5 A;  2PEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...