2G4SA

Anomalous substructure of nbr1pb1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
AMEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Next to BRCA1 gene 1 protein
total genus 24
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2g4sA01
1LFDA 1UBIA 4GB9A 5CX3A 3L13A 1WJ4A 4PS7A 4FA6A 4RM8A 2DZIA 3ML8A 3PTFC 2LGYA 1J8CA 3V60A 1RFAA 4M8NA 3WANA 2DYMA 2FCNA 4TKNA 1WF9A 2C9WB 4CYEA 4F1SA 1P98A 2RSUA 5CTRC 1E8ZA 3DQVA 2KQSA 2MBOA 4B95A 1WY8A 3RT3B 3QJZA 4EUTA 2UWQA 4ANVA 4HCNB 2FAZA 1WFYA 4IWPA 4GDLA 1LXDA 2ZZPB 3V61A 2N9PC 2J7QB 4BOSC 1MG8A 3KUZA 3VAWA 3KUDB 1V2YA 1I42A 1WYWB 5KHOA 3SHQA 3JSVB 2FCMA 2WWZA 2RR9A 2LRWA 2IY1B 4PYZA 3V6CB 3ZNHB 2IBIB 2LVOA 4K7UA 5JHAA 4JLCA 1EF5A 3H7PB 4I6PA 4OVUA 2JUOA 1G6JA 3BINA 1LM8B 2DX5B 2NBUA 2Z59B 4BKSA 1XD3B 2ZPYA 3NHEB 3A9KA 4WJNA 1WGGA 2IO2B 3VQIA 2GBKA 1WGRA 3HIZA 3B1LX 1UGMA 4E74A 1C3TA 2KO3A 2J0JA 3ZTCA 1WXMA 2IO3B 2MBQA 1T0YA 3RZWC 2KWVB 1QZEA 2L05A 3VUWA 2JZ3B 2KJ6A 4BFRA 4DHZB 2K8BA 2MSED 4FJYA 2MBEA 4FBJB 1V5TA 4HCPB 2LI5A 3M63B 2KDFB 4NNJB 2IZVB 4FULA 3PV1A 3ZIMA 2DZJA 2JRIB 3TL5A 2Y5BB 2KX3A 2ZEQA 3X0WA 4MM3A 1WMHB 1SE9A 2KDBA 2ZCBA 2V4LA 2FIDA 3H1UA 2KXJA 4DXAB 3KYDD 4HVBA 3PLVA 3SU8X 1TTNA 2L00B 2M0XA 4I6LB 4DDGD 2NBVB 3ZDMC 2JXXA 3WA0A 3KVFB 2WYQA 4GDKB 5C1ZA 1H4RA 2XK5B 3L10B 2JF5A 4GXBA 2KNBA 1Q5WB 4MDKE 2MP2B 5AZFA 4MJSA 3OLMD 2MBBB 3UIOB 5J18A 4JGHB 4BKGA 1V81A 3K9OB 4II3B 4LDTD 5TR5A 1S3SG 5E6OA 4W9IA 4EZJA 3TIXA 1KLVA 1WR1A 4M0WB 1P1AA 2HJ8A 3AI5A 3KW5B 1VD2A 1GC6A 2BYFA 4W9KA 2LRUA 2PPHA 5DCNA 2MW5A 4GIVA 3IHPC 4EOYA 2BPSA 3A1QA 3DVNV 3R7RA 4DK5A 1YX6B 2CHZA 2KWUB 2XEWA 3QARA 1U4AA 3JSVA 1L2NA 2NR2A 2OOBB 3CSFA 2KDIA 3H7PA 4F7ZA 5L83A 1KOTA 1WGYA 2D3GA 3H6NA 4G11A 4XC2A 2L0TA 3B0AA 1E7VA 3IVFA 3ZW3A 2HE7A 2KK8A 2MP2A 2MX2A 3IG3A 3RD2A 4FN2A 3RYTA 2KTRB 2O6VD 3UGBB 3Q3JA 2VRRB 3X23A 2ZVNA 4ANWA 4BOZB 3RZFA 5GMVA 2CS4A 1GJZA 4X57B 4MEMA 4MGIE 3DCGA 2UYZB 3PT2B 4EZLA 3TBLD 1L7YA 4HPMB 1WE7A 2KWCA 3L17A 4MSQB 2AEHA 5DPTA 4URKA 2O6VA 3HM6X 4GSWA 2LWPA 3P2BA 4AJWA 5DPWA 2N7DA 4XX5A 1I35A 1M94A 3L08A 3U8ZA 1E8YA 2KVRA 3KUCB 4N9F4 2RGFA 3Q3FA 2WX1A 3PLUA 4B6WA 3RUIB 4ASWC 4GN1A 2NS5A 4ZRIA 2J0KA 4A20A 3OJ3A 3VH4B 2DENB 2IYDB 2Z0EB 3DBHI 4WJPA 4A3OA 4DHJD 3A4SC 2KJRA 2KTRA 2KLCA 4PS8A 3LJ3A 2O2VB 2WX0A 3M62B 4I6NB 3R7QA 3WAOA 5FR6A 3UQBA 3NY5A 1E8WA 4FADA 5LXHA 4HDQA 2I1KA 2LGDA 3PS6A 3U30A 4AWJA 4CO7A 2DYOA 1EF1A 4E71A 2LD9A 5BO4B 2KC1A 4IUMB 2LXAA 2LJ5A 2K6DB 1V6EA 4ANXA 2FUHB 3PVLA 3VDZA 4IM0A 2KFKA 5JHBA 2DZKA 4HPLB 4HJKA 4LJPB 2ASQA 4KZ0A 2PEAA 3JVZX 3W1SA 2ZPNA 2JWZA 2ZCCA 2CHXA 4FJVB 4MGZE 1CMXB 2K25A 4HDOA 4W9DA 3R3MA 4EEWA 1WX7A 3DPDA 2C5LC 3IFWB 4IG7B 1WH3A 2I1JA 1ZW7A 4GGQA 1V80A 2C7NB 2IO0B 2MLBA 2NVUI 4YL8A 2IY0B 4MGKE 1ISNA 4KVGB 3W1SC 1V5OA 4WWOA 3GZNI 5D7GA 4HWIB 1WJUA 2B3AA 1ZGUB 1S1QB 3QCAA 1TBEA 3VXWA 2KHWB 1OEYA 3O65B 3QA8A 1WX8A 1HE8A 5DPRA 3B08A 3PHWB 1OQYA 2C60A 1WJ6A 3K9PB 2DAJA 2FNJB 2D07B 3HM3A 4FJZA 2JZZA 1WE6A 3ZKJC 1GC7A 3RULA 3APDA 3ONSA 4EKUA 4MGYE 4MJSB 4WWNA 2OJRA 2R2OA 1WGDA 3NS8A 2JRHA 3CSTA 3EECA 5CHFA 2N1VA 3MJWA 1WMHA 2KTFA 3AU4A 3V6EB 3PGEA 4KSKC 3BY4B 2FCQA 1OEYJ 3ECIA 2DAFA 2LUEA 2KFKB 3PPAA 5D94A 3A9JA 1Q1OA 1J19A 3EFUA 3PHXB 4PYUA 3WAPA 4MSMB 3ZO5B 3ZNGC 1E7UA 2EMSA 4K7WA 1E5WA 2BYVE 3ZRCA 2M17A 1WIAA 2D2QA 3EC8A 3A1QB 2LASA 4KDLB 4TV3A 2YVCA 2KN5A 4G0NB 3KH0A 2G3QB 3L16A 4FLHA 1Q0WB 4KZCA 2KC2A 2Z0DB 4WJQA 4AOFA 4BKTA 1J0GA 5LLIA 4NPNA 4EFOA 2CR5A 4CHKA 1WZ3A 4PS3A 4MH0E 4NY0A 5DPSA 2NPTA 2LVPA 2RPQA 2KQ7A 2QHOA 4AP4C 4K1RB 2DZMA 2KLGA 1YQBA 1SGHA 1KJTA 3IBEA 1GG3A 3M95A 1WM3A 3S2AA 2EKEC 1WX9A 4EZKA 3VVWB 2N9EB 3TCAA 3UIPB 2BF8B 5C23A 3NZSA 2N4FA 4RM9A 3JYUA 3SD5A 1UZXB 2HTHA 3UINB 5L95C 3PRPB 5JZEB 2BKRB 3UQAA 1GUAB 1K8RB 2GMIC 2L76A 2EMTA 1OGWA 2MA9B 3M3JA 2K8CA 1WZ0A 2O6VB 4ZRKA 1GNUA 1P9DU 1JRUA 3DVGX 2HD5B 3ZVVA 1H8CA 5AZHA 3VUXA 1D3ZA 1V86A 3WAMA 2PE9A 3T8MA 1LQBA 4IC7B 3DBRI 1WR6E 4AUQC 4MELA 2DYBA 3U7DA 3H9DA 3VTUA 2ZNVC 4IM3A 1OTRB 2C7MB 1WM2A 4M8MA 4AJYB 1NDDA 1NI2A 5AZGA 4LCDE 1RRBA 2KANA 1IPGA 3CMMB 4ICUA 3T9LA 5IAAC 2A5UA 2MRPA 4FHKA 3QHTA 4J6IA 3MHSD 3WALA 1KM7A 3VTVA 1BT0A 4ANUA 4WQOB 4XZ4A 2M4NA 3QK0A 3OJ4B 1WXVA 2BWES 2V3SA 3NOBA 4TUUA 5E6PA 4NQKE 4LDTB 2MQJA 3PRZA 4NQLB 5G2NA 2BWFA 2G45B 2MCNB 3ENEA 4JIOU 4NAWB 2C7HA 3ZDTA 2NPTB 3ZRFA 4GDKA 2ZNVB 2N1WA 2GBRA 2W9NA 4FHJA 3PZDA 4W9EA 3QC8B 4TQ1A 4W9GA 2REXA 1R4NI 4BVUC 2CKHB 2NCNA 3HK0A 3ML9A 2GBJA 5CHWA 2WDTB 2XK5A 2D11A 4TQ0A 5KHQA 5LXIB 2R2QA 3QAQA 3DVNU 3DVGY 3A9JB 4JL9A 3PRMB 3PREA 1V49A 1XQQA 1IYFA 3DBSA 1AARA 2AL6A 2KD0A 3N30A 2RD0A 1UD7A 2BGFA 2K1FA 2MBHA 2YLMA 2V1YA 3OAWA 4WWPA 2NBWB 1WGHA 2L8JA 1WI0A 3AU5A 4GU2A 1RAXA 4WAAA 2PE6B 3QWZB 2KFJA 4HK2A 4K7SA 4E3CA 2PJHA 3QQ8B 4P7IA 1C1YB 4IM2A 3W1YA 4DBGA 2KDEB 1TGZB 4II2B 1WXSA 2AYOB 2KKCA 2O2VA 3DBLI 4ZYNA 4BKSD 1VCBA 3ZNID 3PSEB 2FCSA 5D2MB 1UBQA 2IO1B 2LXCA 3ALBA 1SIFA 3I3TB 2K8HA 3R66C 3HHMA 4HXDA 3GOEA 3ZUNA 3A9KB 1F9JA 3N32A 2K6QA 5D6JB 2JPHA 1UELA 4W9JA 3QIJA 4GOCA 2JY6A 4HLEA 2L0FA 1UH6A 2LGXA 3ZTDA 2GBMA 3JW0X 2AL3A 4DHJB 2D10A 3VHTC 2CU1A 4KSLC 3V62A 2KJHB 3MTNB 3AULA 4A3PA 1PQSA 4KIKA 3DOWA 3L0WB 1Y8RC 4G50A 4DWFA 2KMCA 4K81A 4W9HA 4W9FA 3VFKA 2G4SA 4LJOB 4BBNF 5HKHA 3APCA 5J2RA 4W9CA 3C0RB 1X1MA 4B9KA 4BBNC 4IWQA 3LDZE 3SDLC 2G4DB 2GOWA 3TJPA 4IWOA 4NAWA 1XT9B 3A4RA 1ZKHA 1EUVB 2KOXA 4IW0A 1RLFA 4ZDVA 5EDSA 3N3KB 4JQWC 2JT4B 1YD8U 1A5RA 3D32A 3QX1A 4KV2A 2L7RA 3A33B 1Z5SB 1P3QU 3TMPB 4KDIC 2LZ6A 2DHZA 3CF6E 2KMAA 2FIFA 2N9XA 1E90A 4NJ7A 2A4ZA 5G55A 3VUYA 4F8CB 3NZUA 3ZLZA 2JVCA 4WJOA 1TZ1A 2AWTA 1V9JA 2ZVOA 5JH5C 3UF8A 5CHVC 3H7SA 2GBNA 3VH3B 2M8SA 3DDCB 3ZNZB 3KYCD 3EHVA 1WRDB 1E8XA 2KZRA 2KX0A 4DHZE 2M1MA 1YX5B 5E6NA 3APFA 4GMVA 4G3XB 2J0MA 2LVQA 1Z2MA 2N7EA 2MWSB 4DDID 3VTWA 4NJ6A 4ZRJA 3RCZA 4OVVA 4W9LA 1YJ1A 2BKFA 1NBFC 5J17A 1YIWA 2K39A 2XBBC 2CHWA 2ZJDA 4RMAA 1WXAA 1FXTB 3AXCA 2BYEA 4ICVA 2L3ZA 4KIKB 1R4MI 3WIMA 1P0RA 4GDLB 5AEKB 1IP9A 3L54A 1EO6A 5IA7A 1WJNA
chains in the Genus database with same CATH superfamily
5CX3A 4FA6A 4RM8A 2YEPB 2DZIA 3ML8A 1D4BA 3P63A 2K3UA 2DYMA 3N20C 5G5HA 2RSUA 3WCQA 1WY8A 3QJZA 1Q10A 4GDLA 1QKZA 2KN4A 1N61A 2N9PC 1TY0A 1JROA 2RR9A 1IBXB 2IBIB 2LVOA 4I6PA 4A9AA 4DXFA 1XD3B 3NHEB 3A9KA 4WJNA 2IO2B 3VQIA 1F52A 1C3TA 1WXMA 2I2YA 2IO3B 2MBQA 2KJ6A 3Q69A 1V5TA 4LNNA 4HROA 3ZIMA 2DZJA 3ZYYX 2ZEQA 3KWLA 2LEKA 1SE9A 5JXVA 3NVWA 2ZCBA 1OFFA 1A70A 2FIDA 2V4LA 2RDGA 3PLVA 2M0XA 4DDGD 2NBVB 2WXLA 2JXXA 3ZDMC 1HZ6A 4C4VA 1SJED 2JF5A 4S17A 1Q5WB 4MJSA 1VZ6A 3UIOB 3BVGA 1V81A 4II3B 1S3SG 4W9IA 2WXHA 4M0WB 4C00A 2HJ8A 1JWMD 4GIVA 2DNFA 2LHDA 4HEA1 1VDVA 3R7RA 3P4SB 1TS2A 3EFCA 3JSVA 4P6VF 2KDIA 2D3GA 1UGJA 1QOGA 4XC2A 3FKYA 1E7VA 3IT4B 4RGMA 3Q2AC 1CQVA 2MP2A 2KTRB 3UGBB 2ZVNA 4ANWA 1SE2A 1L6VA 2WXGA 4EZLA 5DPTA 4GSWA 2LWPA 3P2BA 3AB5A 1M94A 1KFYB 3BIID 3L08A 4A6QA 2DWQA 3PO0A 1I4GA 5GXGB 3AEEB 3PLUA 4B6WA 1E6EB 4ZHOA 4A20A 2DENB 4FXCA 2KTRA 3P4RB 3AE2B 1T0SC 1E8WA 1R4NB 4OVZA 1SXTA 4HDQA 2I1KA 3PS6A 2KC1A 4A8XC 4IUMB 1V1PA 1V6EA 2V0GA 2X38A 1IGDA 3VDZA 1HTOA 4IM0A 5JHBA 4HPLB 1TIFA 1JRPA 4LJPB 3SFEB 1FPYA 3JVZX 3W1SA 3FC4A 2ZPNA 2ZCCA 1FMAD 2WU2B 1CMXB 2GLSA 2K25A 3AEFB 1JALA 4EEWA 3IFWB 1J7BA 1GB1A 3Q14C 2IO0B 3C19A 2NVUI 2N7JA 5HI1A 2INDC 3W1SC 1V5OA 2ON8A 1PGAA 3GZNI 3E56A 2N0SB 2BYTA 1S1QB 3QA8A 3N1YC 3EUB2 5BMGA 3PHWB 4QAYA 3ZQ4A 2MJEA 3K9PB 3I5JC 2FNJB 1V8CA 3HM3A 1Y56A 2JZZA 1D6EC 1N5WA 5HFYA 3ONSA 4MGYE 1TT5B 2OJRA 2QEJC 2Y5PA 4IOIE 3RNGC 1HZ5A 1XCTL 1LO5D 2N1VA 1QT9A 3AE4B 2KTFA 1IBXA 3PGEA 4AS1A 3ECIA 4B0EA 1L6UA 3EFUA 4PYUA 2FE8A 4K7WA 2M17A 1YJIA 2Y5CA 1FRRA 2YVCA 2G3QB 2VZKD 2KC2A 1J0GA 1D5ZC 5LLIA 5DPSA 4NY0A 1DGJA 2QHOA 1NVID 4K1RB 2BB5A 1FNVA 1SGHA 2K22A 1QOFA 3IBEA 3S2AA 4M00A 3UIPB 1WWTA 2HTHA 3PRPB 5JZEB 2BKRB 3UQAA 2GMIC 2L76A 2EMTA 2MA9B 3M3JA 4XWTA 5H8YE 5LNK1 4RH6A 1JRUA 3ZVVA 5AZHA 3I57A 1D3ZA 3WAMA 3H8HA 3T8MA 3AH7A 4MELA 4NJCA 3VTUA 1JWBD 4LNOA 3TEWA 3MC0B 4ICUA 1KM7A 3VTVA 2WXOA 4ANUA 4XZ4A 2PIAA 2V3SA 3NOBA 1EU4A 2I38A 3PRZA 3ENEA 4JE3B 3ZRFA 4XYCA 2ZNVB 4W9EA 3ZJVA 2KT7A 3OWEB 1LGRA 2GB1A 1R4NI 1RM6C 2CKHB 2NCNA 4ZHPA 2Y3AA 3NJTA 5CHWA 2XK5A 4LNIA 4TQ0A 1AWDA 3QAQA 1TKEA 3A9JB 1XXGA 3RNEC 1OQQA 1UD7A 5D3IB 1J7CA 2V1YA 2NBWB 2WXKA 4Q2JA 2JXTA 2KFJA 3AEBB 2PJHA 3W5VB 4DBGA 2AYOB 4P1CC 4BKSD 3ALBA 4ARIA 2QJLA 1SIFA 2JYEA 2K8HA 3I3TB 3ZUNA 3N32A 2K6QA 4W9JA 3QIJA 2JY6A 4HLEA 2L0FA 3AE7B 1UH6A 3V3XA 2D10A 3MC8A 4KSLC 3L0WB 4G50A 2VZKB 2KMCA 4K81A 1T6BX 3KQ4A 2WS3B 5HKHA 1L0YB 3I63C 4L2YA 4BBNC 4IWQA 3LDZE 3SDLC 3U4EG 3A4RA 2E6XA 1ZKHA 1NYQA 2CJNA 4KGRA 2WQYB 3QX1A 3AM9A 2V9HA 4HJGE 3GE3C 2J42A 2DHZA 3CF6E 1YN3A 2WXJA 3B2GA 3VUYA 4F8CB 3ZLZA 1MG4A 4WJOA 4N58A 3T3OA 3I9V1 3RI7C 2IDYA 2SAKA 4YT0B 1WRDB 1E8XA 1WRIA 1K53A 2KZRA 4YTPB 4G3XB 2J0MA 3VTWA 4ZRJA 3NVYA 4OVVA 3U52E 1EM7A 3Q8AA 1YOVB 1NI3A 1YIWA 4MH8A 2BW2A 2CHWA 4RMAA 1FXTB 1R4MI 1P0RA 1AYFA 1JWUD 1L0XB 1WJNA 1UBIA 4GB9A 3L13A 1WJ4A 2KAJA 1RFAA 4M8NA 3WANA 2KQ4X 4TKNA 4F1SA 5CTRC 2MBOA 3B9JA 3O13A 4HCNB 1LXDA 2IGHA 3KUDB 1C4AA 1V2YA 5BMIA 1WYWB 2WWZA 2LRWA 1TJEA 3V6CB 1G6JA 1EF5A 3H7PB 2JUOA 2PVOD 3BINA 1LM8B 2NBUA 3HUIA 3RNFC 4AQ7A 1JWAD 5BMHA 1WGGA 3B1LX 4E74A 3ETRA 1FFUA 3RZWC 2L05A 4XE0A 4FBJB 4BFRA 2K8BA 2MSED 2KDFB 4NZLB 2IZVB 4FULA 2FBWB 3PV1A 2JRIB 3TL5A 3DBHB 5IOIA 4HVBA 3SU8X 1TTNA 2L00B 4I6LB 3U7ZA 4REZA 3WA0A 1ZXIA 3KVFB 1H4RA 2XK5B 3L10B 1T3QA 1XLQA 2KNBA 3OLMD 5J18A 4RCOA 5E6OA 3VRAB 1KLVA 2MHJA 1P1AA 4RF1A 2HDEA 4RF0A 2LRUA 3VR9B 2BPSA 3DVNV 2MJDA 2ONQA 3HVDA 4DK5A 2KWUB 5IO9A 3QARA 3EGRA 3H7PA 5L83A 3DHHC 1KOTA 3HVZA 2H89B 3MC9A 4IKGA 3B0AA 3ZW3A 2OJWA 4ZOHC 4YTNB 2HE7A 2KK8A 3IG3A 4C56C 3RD2A 2O6VD 2K9XA 2VRRB 1SF0A 5GMVA 1GJZA 4MEMA 4TSSA 2KACA 3PT2B 4HPMB 2KWCA 4URKA 2AEHA 2QIEB 1C9FA 3RNAC 2WX1A 1WSPA 2J0KA 4WIPA 3VH4B 1K52A 1XO3A 2IYDB 2Z0EB 4WJPA 2BQQA 2KJRA 4PS8A 3M62B 2WX0A 3WAOA 3UQBA 3NY5A 5LXHA 3U30A 5I4DA 4XWWA 2LXAA 2K6DB 1FFVA 2KYWA 1GOZA 3AE8B 4HJKA 2PKOA 4M01A 1MHXA 3P4PB 5TSSA 1QOBA 1R4MB 5HG2A 1SBBB 3R3MA 1WX7A 4K3CA 2I1JA 1V80A 1KRHA 1KTKA 2MLBA 4YL8A 3DBLB 1ISNA 4WWOA 3RMKC 3ZJUA 1WJUA 2B3AA 3QCAA 1TBEA 3VXWA 1OEYA 1EWYC 1RWSA 3TEZA 2D07B 2CJOA 4FJZA 3SR6A 1GC7A 3AEDB 1XLPA 3RULA 3BVZA 4WWNA 2R2OA 1PGBA 2JRHA 2AQ3B 1P7FA 1SIJA 2DLBA 3AU4A 4KSKC 1NENB 1FNUA 1OEYJ 2INNE 3A9JA 4MSMB 1N62A 3NVVA 2EMSA 1E5WA 3ZRCA 4YTMB 2D2QA 2LASA 1KLGD 2H88B 3BYTB 4TV3A 3MFGA 2MEKA 4D2KA 2M56B 3AE3B 4KZCA 2Z0DB 4WJQA 4BKTA 4NPNA 2JYTA 4CHKA 4EFOA 4MH0E 4UDUC 2RPQA 4AP4C 4JWUC 2EKEC 4EZKA 3EA6A 3TEYA 5AUKA 1UZXB 3GE8C 1PFDA 2LJIA 2KMMA 2INCC 2K8CA 1WZ0A 4PT5A 1GNUA 3DVGX 3RFZB 2HD5B 1ZUD2 1R7SA 3VUXA 1RYJA 3U7DA 4LLGM 2ZNVC 4KKIA 3FAHA 5C2TB 1CJEA 2C7MB 5H92C 4J3OD 3CMMB 3N9YC 5IAAC 2MRPA 4FHKA 3BYYB 3ABVB 4WQOB 1WXVA 4MM3B 2VH2A 1FD6A 4NQKE 5G2NA 4NQLB 2BWFA 2MCNB 5EE9A 2C7HA 2B76B 4C4VB 1FEHA 3PZ7A 2L1AA 2N1WA 2GBRA 2W9NA 1ZDXA 2Q5WD 4W9GA 1BMLC 2AX5A 2REXA 4BVUC 4GLSC 3HK0A 2JX5A 2WDTB 2D11A 3P1MA 4ZRPA 5KHQA 1DOXA 2R2QA 2L52A 5BYSA 2QILA 4CQNA 1IYFA 1V49A 3DBSA 4JX1C 1GB4A 1JQ4A 3R8BA 4N6EB 2BGFA 1TS4A 2YLMA 1QQRA 2L8JA 1WI0A 3AU5A 1RAXA 2G9HD 2PE6B 4K7SA 5EE3A 3QQ8B 2EKIA 4IM2A 2KDEB 3P4QB 2O2VA 2KKCA 3CWIA 3DBLI 3PSEB 4C80A 5D2MB 2LXCA 1YNTE 3AEGB 3A9KB 3W5UB 2JPHA 1UELA 4OZCA 1MPEA 4GOCA 1K50A 3ZTDA 3URYA 3VHTC 4RGOS 1ROEA 3V62A 3MTNB 3AULA 4RFBA 1PQSA 3R2IA 3FILB 4DWFA 4W9FA 3VFKA 2BT6A 4LJOB 4W9CA 4B9KA 5EE0A 2G4DB 4O1NA 1D5MC 3LXFA 3TJPA 2ZW1A 4NAWA 3RNCC 2KOXA 3DHGC 1NYRA 5EDSA 3N3KB 4JQWC 2L7RA 3A33B 1Z5SB 1P3QU 1PGXA 1N5XA 2LZ6A 1GAQB 2FIFA 2N9XA 3BK2A 1E10A 5G55A 3NZUA 2LGIA 2AWTA 1V9JA 2ZVOA 1I4PA 5D3DA 4OW0A 3ZNZB 3DDCB 3EHVA 4HRSA 3NS1A 5E6NA 3MJ5A 4GMVA 2LVQA 2N7EA 4DDID 1NBFC 2K39A 2XBBC 1VJKA 3FILA 2ZJDA 1ZP0B 1WXAA 2RDBC 2L3ZA 3WIMA 2WDRB 1XLOA 1PDXA 2ICIA 2LGYA 3V60A 3Q3MC 2FCNA 2C9WB 4CYEA 1P98A 1E8ZA 3DQVA 1HTQA 2HTME 3AMZA 2UWQA 4ANVA 4EUTA 2FAZA 1WFYA 4IWPA 2IGGA 2ZZPB 3LB8C 2J7QB 1MJDA 3KUZA 3VAWA 3JSVB 4PYZA 4LNKA 3ZNHB 5C3JB 5FR3A 4K7UA 5JHAA 3N1XC 1C4CA 2DX5B 2Z59B 2L32A 4BKSA 2MJ3A 4PK1A 2KO3A 2QC8A 4OHJA 3ZTCA 1N60A 1FM0D 3VUWA 1QZEA 4WQMA 2JZ3B 2PMVA 2WXIA 4FJYA 2LI5A 4NNJB 1J7AA 1WYGA 1YN5A 2IGDA 1N6ZA 2KX3A 3X0WA 4MM3A 3H1UA 4DXAB 3KYDD 3PZ8A 5IKCM 1K51A 3KLSX 2WYQA 5C1ZA 1C79A 4DXGA 1I4QA 2W82A 1STEA 5AZFA 2MBBB 1TS3A 2WHIA 3IAM1 3K9OB 4LDTD 2M0AA 3TIXA 4EZJA 2BS4B 1WR1A 2UU7A 3AI5A 3KW5B 1VD2A 4JPSA 2BYFA 2MW5A 3GP7A 3A1QA 1YX6B 2CHZA 2G1EA 4EE2A 1L2NA 2NR2A 1QILA 3Q3NC 3CSFA 4F7ZA 1WGYA 3KWVA 4G11A 2L0TA 3IVFA 1FRDA 1E9MA 4FN2A 3RYTA 5G5GA 1T5XD 4BOZB 1UWXA 3BWUD 4MGIE 1QF6A 1XF5L 1L7YA 3L17A 2WP9B 1SSNA 2O6VA 1C77A 4AJWA 5DPWA 2N7DA 5HHDG 3U2SC 1I35A 3U8ZA 2D5GA 3E9SA 1V1PB 2RGFA 2ZW0A 4ASWC 1ET9A 4GN1A 1BXTA 3OJ3A 1T0RC 4A3OA 2KLCA 3LJ3A 4C7ZA 5FR6A 3LYYA 2PVGC 4ITKA 2DYOA 4RGNA 1EF1A 4E71A 1N63A 2D3BA 2LJ5A 2FUHB 1C4PA 4H2AA 2GI9A 2KFKA 2DZKA 2ASQA 1HEZE 4KZ0A 4B0MA 2D3AA 2JZPA 4FJVB 4W9DA 3DPDA 4GGQA 3B2FA 2C7NB 3GS2A 4OZBA 4MGKE 2WXQA 5D7GA 2KHWB 2MH7A 4HPPA 3ZJTA 1WX8A 1HE8A 5DPRA 2C60A 4ACFA 1MVKA 2TSSA 2DAJA 2JQRB 1WE6A 4MJSB 4WURA 1WGDA 2QDFA 4TMAB 4BZAA 3MJWA 3AN1A 3MHZA 3V6EB 4A55A 2DAFA 2LUEA 3PPAA 5D94A 3PHXB 1J19A 3Q6BA 3WAPA 2WLBA 1T0QC 4ZRQA 2BYVE 3EC8A 3A1QB 1ZXHA 2KN5A 4G0NB 2FUG1 1KF6B 3L16A 3GZNB 3ZGZA 4AOFA 2CR5A 1WZ3A 4PS3A 2GRIA 2OEDA 2NPTA 2LVPA 2KQ7A 1MFWA 1UWMA 2WNMA 4NAMA 2KLGA 1YQBA 1YQ4B 1KJTA 1GG3A 3M95A 3VVWB 3TSSA 5C23A 3AECB 4MACA 3JYUA 4RM9A 3UINB 3NRZA 2W55A 5FKAC 4LNFA 1F2RI 4ZRKA 1YJJA 1SJHD 1ZPSA 1V86A 4KGSA 1VR9A 2PE9A 1LQBA 4IC7B 5MPOA 1WR6E 1GPXA 2DYBA 3H9DA 4IM3A 3CIRB 1NDDA 1FCLA 1IPGA 1TYGB 2XNAC 2L83A 1BT0A 1UUPA 3OJ4B 2BWES 5E6PA 4TUUA 1FXAA 4LDTB 1FO4A 4NAWB 2CU3A 4LK0M 3ZDTA 4GDKA 3PZDA 3AEAB 4TQ1A 3ML9A 1F0ZA 2M19A 2SEBD 5LXIB 3HRDD 1FNWA 3DVGY 2LMCA 4BAXA 4JL9A 2WDVB 3DWGC 3PRMB 3PREA 1EU3A 1AARA 2KD0A 1YQ3B 2RD0A 2MBHA 3OAWA 2OHFA 4WWPA 1WGHA 4WAAA 4GU2A 3QWZB 4E3CA 1JW9D 1MHHE 1C78A 2FCSA 3V05A 2N9LA 4HXDA 2WXPA 5D6JB 2R61A 3BZDB 3RN9C 4DHJB 2GBMA 3JW0X 1B1ZA 4P1BC 1P7EA 1Y8RC 2QMTA 4W9HA 4BBNF 1DOYA 2WXNA 1E0ZA 3APCA 1X1MA 3AE1B 4IWOA 4US9A 4RNAA 1EUVB 4IW0A 1RLFA 2JT4B 4KV2A 4XDCA 3TMPB 4KDIC 1ESFA 2KMAA 2A4ZA 4DQOC 3UI3A 5JH5C 1I4HA 2NTSA 3UF8A 2M8SA 2J52A 1YN4A 1CK1A 4K3BA 2KX0A 4DHZE 1L4ZB 2M1MA 3APFA 2MWSB 4M02A 3RCZA 4A90A 4W9LA 1YJ1A 5J17A 2WXRA 4ARCA 1TY2A 2BYEA 3AXCA 1IUEA 4GDLB 5AEKB 1LFDA 4PS7A 3PTFC 1JCKB 1F1HA 1J8CA 2KVZA 1WF9A 4B95A 2KQSA 2QSDA 5FK9C 3RT3B 3V61A 4BOSC 1MG8A 1D5XC 1I42A 1JMLA 5KHOA 3SHQA 5BYQA 2FCMA 2IY1B 2DBYA 2WXFA 4IDIA 3BK1A 4JLCA 4OVUA 2PTLA 1DYQA 1KLUD 3Q3OC 2BS2B 2WXMA 2ZPYA 1DOIA 2RPVA 2GBKA 3C8YA 1WGRA 3HIZA 4YWGG 1UGMA 2J0JA 3Q8BA 1TKGA 1HA5A 1T0YA 2KWVB 4DHZB 2MBEA 1V97A 3DWMA 3M63B 4HCPB 1XEEA 2W3SA 2Y5BB 1WMHB 2KDBA 2NTTA 2KXJA 4WH4A 2LUMA 4GDKB 1I7HA 2WU5B 2JWUA 4GXBA 2RMMA 4MDKE 2MP2B 4JGHB 4BKGA 5TR5A 1SEBD 3NVZA 4USAA 3J9CA 4N59A 1GC6A 4W9KA 2PPHA 3AE9B 5DCNA 3IHPC 4EOYA 1E7PB 1XLNA 2PLPA 2XEWA 4KX6B 1U4AA 1FIQA 2HJ1A 1L5PA 2IJ0A 2OOBB 3OG5A 1YMHE 3H6NA 1AN8A 4M0WA 2NMQA 2MX2A 3Q3JA 3X23A 1XCQL 1HXYD 3RZFA 2CS4A 4X57B 2E3TA 3DCGA 2UYZB 1TKYA 3TBLD 2Z8LA 1WE7A 4MSQB 4L1BA 3HM6X 4XX5A 4YSXB 2WGSA 3AE6B 1E8YA 2KVRA 3KUCB 4N9F4 1UF0A 3Q3FA 5IP4D 3RUIB 2NS5A 2V3NA 4ZRIA 3RPFC 3P42A 2V3PA 3DBHI 4DHJD 3A4SC 1VZ8A 2O2VB 1CZPA 4I6NB 3R7QA 2BB6A 3T3NA 5EE1A 3NZ3A 1WXQA 4FADA 2LGDA 4CO7A 4AWJA 1EWCA 2LD9A 2LFIA 5BO4B 2N9KA 1SB3C 4ANXA 3PVLA 2PEAA 3VR8B 2JWZA 2JSVX 2CHXA 4MGZE 2XN9C 4HDOA 3AV8A 4IG7B 2C5LC 2KDMA 1WH3A 1L0VB 1ZW7A 2IY0B 4KVGB 2ACZB 4KKJA 2BBCA 4HWIB 4C7YA 1ZGUB 4P16A 1UNSA 3O65B 4ZYSA 3B08A 1OQYA 4XGAB 1WJ6A 4OZAA 4MT5A 3ZKJC 3APDA 4EKUA 1ET6A 3NS8A 3EECA 3CSTA 3NG0A 5CHFA 1WMHA 1B9RA 3RNBC 3BY4B 2FCQA 2VH1A 2INPE 2KFKB 3IAS1 1Q1OA 4YXDB 3W2DA 1TS5A 3ZNGC 1E7UA 3ZO5B 3DHIC 1WIAA 1BUIC 1I4RA 4HKZE 1F2RC 2K0PA 1OQRA 4KDLB 4L23A 3KH0A 1FXIA 4FLHA 1Q0WB 2KWDA 3TEXA 3ZXRA 4YSYB 2LGSA 2DZMA 2V4IB 1MI0A 1ZOYB 1JWSD 5E6JA 1WM3A 1L4DB 1WX9A 2N9EB 3TCAA 2BF8B 3NZSA 1HQRD 2N4FA 3SD5A 5L95C 2WDQB 3L4PA 1V1OA 1GUAB 1K8RB 1OGWA 2O6VB 1P9DU 1H8CA 1ACCA 3TUOA 4S0RA 3AE5B 3DBRI 4XDDA 4US8A 1NEKB 4AUQC 2BS3B 2EELA 2W54A 1OTRB 4M8MA 1WM2A 4AJYB 1I4XA 1ZE3D 3NUHB 2BTEA 1NI2A 5AZGA 4LCDE 1RRBA 1SE4A 2KANA 3T9LA 2A5UA 5IN7A 2QCZA 1QOAA 3QHTA 4J6IA 3MHSD 1QLBB 3WALA 2M4NA 3IXSA 3MP9A 3QK0A 2MQJA 2G45B 4JIOU 2NPTB 4FHJA 3QC8B 3SEBA 1VZ7A 1VLBA 3BVMA 2GBJA 2RDHA 4HKQA 3GB1A 3N1ZC 4LTUA 3DVNU 1F77A 1C76A 1XQQA 2AL6A 2AQ1B 3IT6B 3N30A 3VRBB 2K1FA 4JWSC 1PYWD 1RFKA 4HK2A 2K5PA 5AUIA 4P7IA 1C1YB 3W1YA 2PW9A 4II2B 1TGZB 1WXSA 4YSZB 4ZYNA 1VCBA 3ZNID 1UBQA 2IO1B 1WGKA 1IGCA 3R66C 2AQ2B 3HHMA 3GOEA 4WWMA 1F9JA 4RGTA 2LGXA 4WAFA 2AL3A 2CU1A 1KH0A 2KJHB 4A3PA 4KIKA 3DOWA 3Q8CA 1PUTA 2G4SA 2J53A 1ZDVA 5J2RA 1TZOA 1FCCC 3C0RB 3Q8FA 2GOWA 1XT9B 5T8IA 2X8XX 4ZDVA 1YD8U 1A5RA 3D32A 3SFDB 4R3DA 2YEPF 1E90A 4NJ7A 1SE3A 3DBRB 2JVCA 1TZ1A 2J4XA 2LHEA 5CHVC 3H7SA 2GBNA 3VH3B 5BYRA 3KYCD 3Q8EA 2D3CA 1YX5B 1Z2MA 2BVCA 1ENFA 4NJ6A 3ZXVA 2BKFA 1VRAB 2JU6X 1AW7A 4KGTA 2W3RA 4ICVA 4KIKB 3W9CB 3R2TA 1M4VA 1IP9A 3L54A 1EO6A 5IA7A 2IPKD
chains in the Genus database with same CATH topology
1LFDA 1UBIA 4GB9A 5CX3A 3L13A 1WJ4A 4PS7A 4FA6A 4RM8A 2DZIA 3ML8A 3PTFC 2LGYA 1J8CA 3V60A 1RFAA 4M8NA 3WANA 2DYMA 2FCNA 4TKNA 1WF9A 2C9WB 4CYEA 4F1SA 1P98A 2RSUA 5CTRC 1E8ZA 3DQVA 2KQSA 2MBOA 4B95A 1WY8A 3RT3B 3QJZA 4EUTA 2UWQA 4ANVA 4HCNB 2FAZA 1WFYA 4IWPA 4GDLA 1LXDA 2ZZPB 3V61A 2N9PC 2J7QB 4BOSC 1MG8A 3KUZA 3VAWA 3KUDB 1V2YA 1I42A 1WYWB 5KHOA 3SHQA 3JSVB 2FCMA 2WWZA 2RR9A 2LRWA 2IY1B 4PYZA 3V6CB 3ZNHB 2IBIB 2LVOA 4K7UA 5JHAA 4JLCA 1EF5A 3H7PB 4I6PA 4OVUA 2JUOA 1G6JA 3BINA 1LM8B 2DX5B 2NBUA 2Z59B 4BKSA 1XD3B 2ZPYA 3NHEB 3A9KA 4WJNA 1WGGA 2IO2B 3VQIA 2GBKA 1WGRA 3HIZA 3B1LX 1UGMA 4E74A 1C3TA 2KO3A 2J0JA 3ZTCA 1WXMA 2IO3B 2MBQA 1T0YA 3RZWC 2KWVB 1QZEA 2L05A 3VUWA 2JZ3B 2KJ6A 4BFRA 4DHZB 2K8BA 2MSED 4FJYA 2MBEA 4FBJB 1V5TA 4HCPB 2LI5A 3M63B 2KDFB 4NNJB 2IZVB 4FULA 3PV1A 3ZIMA 2DZJA 2JRIB 3TL5A 2Y5BB 2KX3A 2ZEQA 3X0WA 4MM3A 1WMHB 1SE9A 2KDBA 2ZCBA 2V4LA 2FIDA 3H1UA 2KXJA 4DXAB 3KYDD 4HVBA 3PLVA 3SU8X 1TTNA 2L00B 2M0XA 4I6LB 4DDGD 2NBVB 3ZDMC 2JXXA 3WA0A 3KVFB 2WYQA 4GDKB 5C1ZA 1H4RA 2XK5B 3L10B 2JF5A 4GXBA 2KNBA 1Q5WB 4MDKE 2MP2B 5AZFA 4MJSA 3OLMD 2MBBB 3UIOB 5J18A 4JGHB 4BKGA 1V81A 3K9OB 4II3B 4LDTD 5TR5A 1S3SG 5E6OA 4W9IA 4EZJA 3TIXA 1KLVA 1WR1A 4M0WB 1P1AA 2HJ8A 3AI5A 3KW5B 1VD2A 1GC6A 2BYFA 4W9KA 2LRUA 2PPHA 5DCNA 2MW5A 4GIVA 3IHPC 4EOYA 2BPSA 3A1QA 3DVNV 3R7RA 4DK5A 1YX6B 2CHZA 2KWUB 2XEWA 3QARA 1U4AA 3JSVA 1L2NA 2NR2A 2OOBB 3CSFA 2KDIA 3H7PA 4F7ZA 5L83A 1KOTA 1WGYA 2D3GA 3H6NA 4G11A 4XC2A 2L0TA 3B0AA 1E7VA 3IVFA 3ZW3A 2HE7A 2KK8A 2MP2A 2MX2A 3IG3A 3RD2A 4FN2A 3RYTA 2KTRB 2O6VD 3UGBB 3Q3JA 2VRRB 3X23A 2ZVNA 4ANWA 4BOZB 3RZFA 5GMVA 2CS4A 1GJZA 4X57B 4MEMA 4MGIE 3DCGA 2UYZB 3PT2B 4EZLA 3TBLD 1L7YA 4HPMB 1WE7A 2KWCA 3L17A 4MSQB 2AEHA 5DPTA 4URKA 2O6VA 3HM6X 4GSWA 2LWPA 3P2BA 4AJWA 5DPWA 2N7DA 4XX5A 1I35A 1M94A 3L08A 3U8ZA 1E8YA 2KVRA 3KUCB 4N9F4 2RGFA 3Q3FA 2WX1A 3PLUA 4B6WA 3RUIB 4ASWC 4GN1A 2NS5A 4ZRIA 2J0KA 4A20A 3OJ3A 3VH4B 2DENB 2IYDB 2Z0EB 3DBHI 4WJPA 4A3OA 4DHJD 3A4SC 2KJRA 2KTRA 2KLCA 4PS8A 3LJ3A 2O2VB 2WX0A 3M62B 4I6NB 3R7QA 3WAOA 5FR6A 3UQBA 3NY5A 1E8WA 4FADA 5LXHA 4HDQA 2I1KA 2LGDA 3PS6A 3U30A 4AWJA 4CO7A 2DYOA 1EF1A 4E71A 2LD9A 5BO4B 2KC1A 4IUMB 2LXAA 2LJ5A 2K6DB 1V6EA 4ANXA 2FUHB 3PVLA 3VDZA 4IM0A 2KFKA 5JHBA 2DZKA 4HPLB 4HJKA 4LJPB 2ASQA 4KZ0A 2PEAA 3JVZX 3W1SA 2ZPNA 2JWZA 2ZCCA 2CHXA 4FJVB 4MGZE 1CMXB 2K25A 4HDOA 4W9DA 3R3MA 4EEWA 1WX7A 3DPDA 2C5LC 3IFWB 4IG7B 1WH3A 2I1JA 1ZW7A 4GGQA 1V80A 2C7NB 2IO0B 2MLBA 2NVUI 4YL8A 2IY0B 4MGKE 1ISNA 4KVGB 3W1SC 1V5OA 4WWOA 3GZNI 5D7GA 4HWIB 1WJUA 2B3AA 1ZGUB 1S1QB 3QCAA 1TBEA 3VXWA 2KHWB 1OEYA 3O65B 3QA8A 1WX8A 1HE8A 5DPRA 3B08A 3PHWB 1OQYA 2C60A 1WJ6A 3K9PB 2DAJA 2FNJB 2D07B 3HM3A 4FJZA 2JZZA 1WE6A 3ZKJC 1GC7A 3RULA 3APDA 3ONSA 4EKUA 4MGYE 4MJSB 4WWNA 2OJRA 2R2OA 1WGDA 3NS8A 2JRHA 3CSTA 3EECA 5CHFA 2N1VA 3MJWA 1WMHA 2KTFA 3AU4A 3V6EB 3PGEA 4KSKC 3BY4B 2FCQA 1OEYJ 3ECIA 2DAFA 2LUEA 2KFKB 3PPAA 5D94A 3A9JA 1Q1OA 1J19A 3EFUA 3PHXB 4PYUA 3WAPA 4MSMB 3ZO5B 3ZNGC 1E7UA 2EMSA 4K7WA 1E5WA 2BYVE 3ZRCA 2M17A 1WIAA 2D2QA 3EC8A 3A1QB 2LASA 4KDLB 4TV3A 2YVCA 2KN5A 4G0NB 3KH0A 2G3QB 3L16A 4FLHA 1Q0WB 4KZCA 2KC2A 2Z0DB 4WJQA 4AOFA 4BKTA 1J0GA 5LLIA 4NPNA 4EFOA 2CR5A 4CHKA 1WZ3A 4PS3A 4MH0E 4NY0A 5DPSA 2NPTA 2LVPA 2RPQA 2KQ7A 2QHOA 4AP4C 4K1RB 2DZMA 2KLGA 1YQBA 1SGHA 1KJTA 3IBEA 1GG3A 3M95A 1WM3A 3S2AA 2EKEC 1WX9A 4EZKA 3VVWB 2N9EB 3TCAA 3UIPB 2BF8B 5C23A 3NZSA 2N4FA 4RM9A 3JYUA 3SD5A 1UZXB 2HTHA 3UINB 5L95C 3PRPB 5JZEB 2BKRB 3UQAA 1GUAB 1K8RB 2GMIC 2L76A 2EMTA 1OGWA 2MA9B 3M3JA 2K8CA 1WZ0A 2O6VB 4ZRKA 1GNUA 1P9DU 1JRUA 3DVGX 2HD5B 3ZVVA 1H8CA 5AZHA 3VUXA 1D3ZA 1V86A 3WAMA 2PE9A 3T8MA 1LQBA 4IC7B 3DBRI 1WR6E 4AUQC 4MELA 2DYBA 3U7DA 3H9DA 3VTUA 2ZNVC 4IM3A 1OTRB 2C7MB 1WM2A 4M8MA 4AJYB 1NDDA 1NI2A 5AZGA 4LCDE 1RRBA 2KANA 1IPGA 3CMMB 4ICUA 3T9LA 5IAAC 2A5UA 2MRPA 4FHKA 3QHTA 4J6IA 3MHSD 3WALA 1KM7A 3VTVA 1BT0A 4ANUA 4WQOB 4XZ4A 2M4NA 3QK0A 3OJ4B 1WXVA 2BWES 2V3SA 3NOBA 4TUUA 5E6PA 4NQKE 4LDTB 2MQJA 3PRZA 4NQLB 5G2NA 2BWFA 2G45B 2MCNB 3ENEA 4JIOU 4NAWB 2C7HA 3ZDTA 2NPTB 3ZRFA 4GDKA 2ZNVB 2N1WA 2GBRA 2W9NA 4FHJA 3PZDA 4W9EA 3QC8B 4TQ1A 4W9GA 2REXA 1R4NI 4BVUC 2CKHB 2NCNA 3HK0A 3ML9A 2GBJA 5CHWA 2WDTB 2XK5A 2D11A 4TQ0A 5KHQA 5LXIB 2R2QA 3QAQA 3DVNU 3DVGY 3A9JB 4JL9A 3PRMB 3PREA 1V49A 1XQQA 1IYFA 3DBSA 1AARA 2AL6A 2KD0A 3N30A 2RD0A 1UD7A 2BGFA 2K1FA 2MBHA 2YLMA 2V1YA 3OAWA 4WWPA 2NBWB 1WGHA 2L8JA 1WI0A 3AU5A 4GU2A 1RAXA 4WAAA 2PE6B 3QWZB 2KFJA 4HK2A 4K7SA 4E3CA 2PJHA 3QQ8B 4P7IA 1C1YB 4IM2A 3W1YA 4DBGA 2KDEB 1TGZB 4II2B 1WXSA 2AYOB 2KKCA 2O2VA 3DBLI 4ZYNA 4BKSD 1VCBA 3ZNID 3PSEB 2FCSA 5D2MB 1UBQA 2IO1B 2LXCA 3ALBA 1SIFA 3I3TB 2K8HA 3R66C 3HHMA 4HXDA 3GOEA 3ZUNA 3A9KB 1F9JA 3N32A 2K6QA 5D6JB 2JPHA 1UELA 4W9JA 3QIJA 4GOCA 2JY6A 4HLEA 2L0FA 1UH6A 2LGXA 3ZTDA 2GBMA 3JW0X 2AL3A 4DHJB 2D10A 3VHTC 2CU1A 4KSLC 3V62A 2KJHB 3MTNB 3AULA 4A3PA 1PQSA 4KIKA 3DOWA 3L0WB 1Y8RC 4G50A 4DWFA 2KMCA 4K81A 4W9HA 4W9FA 3VFKA 2G4SA 4LJOB 4BBNF 5HKHA 3APCA 5J2RA 4W9CA 3C0RB 1X1MA 4B9KA 4BBNC 4IWQA 3LDZE 3SDLC 2G4DB 2GOWA 3TJPA 4IWOA 4NAWA 1XT9B 3A4RA 1ZKHA 1EUVB 2KOXA 4IW0A 1RLFA 4ZDVA 5EDSA 3N3KB 4JQWC 2JT4B 1YD8U 1A5RA 3D32A 3QX1A 4KV2A 2L7RA 3A33B 1Z5SB 1P3QU 3TMPB 4KDIC 2LZ6A 2DHZA 3CF6E 2KMAA 2FIFA 2N9XA 1E90A 4NJ7A 2A4ZA 5G55A 3VUYA 4F8CB 3NZUA 3ZLZA 2JVCA 4WJOA 1TZ1A 2AWTA 1V9JA 2ZVOA 5JH5C 3UF8A 5CHVC 3H7SA 2GBNA 3VH3B 2M8SA 3DDCB 3ZNZB 3KYCD 3EHVA 1WRDB 1E8XA 2KZRA 2KX0A 4DHZE 2M1MA 1YX5B 5E6NA 3APFA 4GMVA 4G3XB 2J0MA 2LVQA 1Z2MA 2N7EA 2MWSB 4DDID 3VTWA 4NJ6A 4ZRJA 3RCZA 4OVVA 4W9LA 1YJ1A 2BKFA 1NBFC 5J17A 1YIWA 2K39A 2XBBC 2CHWA 2ZJDA 4RMAA 1WXAA 1FXTB 3AXCA 2BYEA 4ICVA 2L3ZA 4KIKB 1R4MI 3WIMA 1P0RA 4GDLB 5AEKB 1IP9A 3L54A 1EO6A 5IA7A 1WJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LFD A;  1UBI A;  4GB9 A;  5CX3 A;  3L13 A;  1WJ4 A;  4PS7 A;  4FA6 A;  4RM8 A;  2DZI A;  3ML8 A;  3PTF C;  2LGY A;  1J8C A;  3V60 A;  1RFA A;  4M8N A;  3WAN A;  2DYM A;  2FCN A;  4TKN A;  1WF9 A;  2C9W B;  4CYE A;  4F1S A;  1P98 A;  2RSU A;  5CTR C;  1E8Z A;  3DQV A;  2KQS A;  2MBO A;  4B95 A;  1WY8 A;  3RT3 B;  3QJZ A;  4EUT A;  2UWQ A;  4ANV A;  4HCN B;  2FAZ A;  1WFY A;  4IWP A;  4GDL A;  1LXD A;  2ZZP B;  3V61 A;  2N9P C;  2J7Q B;  4BOS C;  1MG8 A;  3KUZ A;  3VAW A;  3KUD B;  1V2Y A;  1I42 A;  1WYW B;  5KHO A;  3SHQ A;  3JSV B;  2FCM A;  2WWZ A;  2RR9 A;  2LRW A;  2IY1 B;  4PYZ A;  3V6C B;  3ZNH B;  2IBI B;  2LVO A;  4K7U A;  5JHA A;  4JLC A;  1EF5 A;  3H7P B;  4I6P A;  4OVU A;  2JUO A;  1G6J A;  3BIN A;  1LM8 B;  2DX5 B;  2NBU A;  2Z59 B;  4BKS A;  1XD3 B;  2ZPY A;  3NHE B;  3A9K A;  4WJN A;  1WGG A;  2IO2 B;  3VQI A;  2GBK A;  1WGR A;  3HIZ A;  3B1L X;  1UGM A;  4E74 A;  1C3T A;  2KO3 A;  2J0J A;  3ZTC A;  1WXM A;  2IO3 B;  2MBQ A;  1T0Y A;  3RZW C;  2KWV B;  1QZE A;  2L05 A;  3VUW A;  2JZ3 B;  2KJ6 A;  4BFR A;  4DHZ B;  2K8B A;  2MSE D;  4FJY A;  2MBE A;  4FBJ B;  1V5T A;  4HCP B;  2LI5 A;  3M63 B;  2KDF B;  4NNJ B;  2IZV B;  4FUL A;  3PV1 A;  3ZIM A;  2DZJ A;  2JRI B;  3TL5 A;  2Y5B B;  2KX3 A;  2ZEQ A;  3X0W A;  4MM3 A;  1WMH B;  1SE9 A;  2KDB A;  2ZCB A;  2V4L A;  2FID A;  3H1U A;  2KXJ A;  4DXA B;  3KYD D;  4HVB A;  3PLV A;  3SU8 X;  1TTN A;  2L00 B;  2M0X A;  4I6L B;  4DDG D;  2NBV B;  3ZDM C;  2JXX A;  3WA0 A;  3KVF B;  2WYQ A;  4GDK B;  5C1Z A;  1H4R A;  2XK5 B;  3L10 B;  2JF5 A;  4GXB A;  2KNB A;  1Q5W B;  4MDK E;  2MP2 B;  5AZF A;  4MJS A;  3OLM D;  2MBB B;  3UIO B;  5J18 A;  4JGH B;  4BKG A;  1V81 A;  3K9O B;  4II3 B;  4LDT D;  5TR5 A;  1S3S G;  5E6O A;  4W9I A;  4EZJ A;  3TIX A;  1KLV A;  1WR1 A;  4M0W B;  1P1A A;  2HJ8 A;  3AI5 A;  3KW5 B;  1VD2 A;  1GC6 A;  2BYF A;  4W9K A;  2LRU A;  2PPH A;  5DCN A;  2MW5 A;  4GIV A;  3IHP C;  4EOY A;  2BPS A;  3A1Q A;  3DVN V;  3R7R A;  4DK5 A;  1YX6 B;  2CHZ A;  2KWU B;  2XEW A;  3QAR A;  1U4A A;  3JSV A;  1L2N A;  2NR2 A;  2OOB B;  3CSF A;  2KDI A;  3H7P A;  4F7Z A;  5L83 A;  1KOT A;  1WGY A;  2D3G A;  3H6N A;  4G11 A;  4XC2 A;  2L0T A;  3B0A A;  1E7V A;  3IVF A;  3ZW3 A;  2HE7 A;  2KK8 A;  2MP2 A;  2MX2 A;  3IG3 A;  3RD2 A;  4FN2 A;  3RYT A;  2KTR B;  2O6V D;  3UGB B;  3Q3J A;  2VRR B;  3X23 A;  2ZVN A;  4ANW A;  4BOZ B;  3RZF A;  5GMV A;  2CS4 A;  1GJZ A;  4X57 B;  4MEM A;  4MGI E;  3DCG A;  2UYZ B;  3PT2 B;  4EZL A;  3TBL D;  1L7Y A;  4HPM B;  1WE7 A;  2KWC A;  3L17 A;  4MSQ B;  2AEH A;  5DPT A;  4URK A;  2O6V A;  3HM6 X;  4GSW A;  2LWP A;  3P2B A;  4AJW A;  5DPW A;  2N7D A;  4XX5 A;  1I35 A;  1M94 A;  3L08 A;  3U8Z A;  1E8Y A;  2KVR A;  3KUC B;  4N9F 4;  2RGF A;  3Q3F A;  2WX1 A;  3PLU A;  4B6W A;  3RUI B;  4ASW C;  4GN1 A;  2NS5 A;  4ZRI A;  2J0K A;  4A20 A;  3OJ3 A;  3VH4 B;  2DEN B;  2IYD B;  2Z0E B;  3DBH I;  4WJP A;  4A3O A;  4DHJ D;  3A4S C;  2KJR A;  2KTR A;  2KLC A;  4PS8 A;  3LJ3 A;  2O2V B;  2WX0 A;  3M62 B;  4I6N B;  3R7Q A;  3WAO A;  5FR6 A;  3UQB A;  3NY5 A;  1E8W A;  4FAD A;  5LXH A;  4HDQ A;  2I1K A;  2LGD A;  3PS6 A;  3U30 A;  4AWJ A;  4CO7 A;  2DYO A;  1EF1 A;  4E71 A;  2LD9 A;  5BO4 B;  2KC1 A;  4IUM B;  2LXA A;  2LJ5 A;  2K6D B;  1V6E A;  4ANX A;  2FUH B;  3PVL A;  3VDZ A;  4IM0 A;  2KFK A;  5JHB A;  2DZK A;  4HPL B;  4HJK A;  4LJP B;  2ASQ A;  4KZ0 A;  2PEA A;  3JVZ X;  3W1S A;  2ZPN A;  2JWZ A;  2ZCC A;  2CHX A;  4FJV B;  4MGZ E;  1CMX B;  2K25 A;  4HDO A;  4W9D A;  3R3M A;  4EEW A;  1WX7 A;  3DPD A;  2C5L C;  3IFW B;  4IG7 B;  1WH3 A;  2I1J A;  1ZW7 A;  4GGQ A;  1V80 A;  2C7N B;  2IO0 B;  2MLB A;  2NVU I;  4YL8 A;  2IY0 B;  4MGK E;  1ISN A;  4KVG B;  3W1S C;  1V5O A;  4WWO A;  3GZN I;  5D7G A;  4HWI B;  1WJU A;  2B3A A;  1ZGU B;  1S1Q B;  3QCA A;  1TBE A;  3VXW A;  2KHW B;  1OEY A;  3O65 B;  3QA8 A;  1WX8 A;  1HE8 A;  5DPR A;  3B08 A;  3PHW B;  1OQY A;  2C60 A;  1WJ6 A;  3K9P B;  2DAJ A;  2FNJ B;  2D07 B;  3HM3 A;  4FJZ A;  2JZZ A;  1WE6 A;  3ZKJ C;  1GC7 A;  3RUL A;  3APD A;  3ONS A;  4EKU A;  4MGY E;  4MJS B;  4WWN A;  2OJR A;  2R2O A;  1WGD A;  3NS8 A;  2JRH A;  3CST A;  3EEC A;  5CHF A;  2N1V A;  3MJW A;  1WMH A;  2KTF A;  3AU4 A;  3V6E B;  3PGE A;  4KSK C;  3BY4 B;  2FCQ A;  1OEY J;  3ECI A;  2DAF A;  2LUE A;  2KFK B;  3PPA A;  5D94 A;  3A9J A;  1Q1O A;  1J19 A;  3EFU A;  3PHX B;  4PYU A;  3WAP A;  4MSM B;  3ZO5 B;  3ZNG C;  1E7U A;  2EMS A;  4K7W A;  1E5W A;  2BYV E;  3ZRC A;  2M17 A;  1WIA A;  2D2Q A;  3EC8 A;  3A1Q B;  2LAS A;  4KDL B;  4TV3 A;  2YVC A;  2KN5 A;  4G0N B;  3KH0 A;  2G3Q B;  3L16 A;  4FLH A;  1Q0W B;  4KZC A;  2KC2 A;  2Z0D B;  4WJQ A;  4AOF A;  4BKT A;  1J0G A;  5LLI A;  4NPN A;  4EFO A;  2CR5 A;  4CHK A;  1WZ3 A;  4PS3 A;  4MH0 E;  4NY0 A;  5DPS A;  2NPT A;  2LVP A;  2RPQ A;  2KQ7 A;  2QHO A;  4AP4 C;  4K1R B;  2DZM A;  2KLG A;  1YQB A;  1SGH A;  1KJT A;  3IBE A;  1GG3 A;  3M95 A;  1WM3 A;  3S2A A;  2EKE C;  1WX9 A;  4EZK A;  3VVW B;  2N9E B;  3TCA A;  3UIP B;  2BF8 B;  5C23 A;  3NZS A;  2N4F A;  4RM9 A;  3JYU A;  3SD5 A;  1UZX B;  2HTH A;  3UIN B;  5L95 C;  3PRP B;  5JZE B;  2BKR B;  3UQA A;  1GUA B;  1K8R B;  2GMI C;  2L76 A;  2EMT A;  1OGW A;  2MA9 B;  3M3J A;  2K8C A;  1WZ0 A;  2O6V B;  4ZRK A;  1GNU A;  1P9D U;  1JRU A;  3DVG X;  2HD5 B;  3ZVV A;  1H8C A;  5AZH A;  3VUX A;  1D3Z A;  1V86 A;  3WAM A;  2PE9 A;  3T8M A;  1LQB A;  4IC7 B;  3DBR I;  1WR6 E;  4AUQ C;  4MEL A;  2DYB A;  3U7D A;  3H9D A;  3VTU A;  2ZNV C;  4IM3 A;  1OTR B;  2C7M B;  1WM2 A;  4M8M A;  4AJY B;  1NDD A;  1NI2 A;  5AZG A;  4LCD E;  1RRB A;  2KAN A;  1IPG A;  3CMM B;  4ICU A;  3T9L A;  5IAA C;  2A5U A;  2MRP A;  4FHK A;  3QHT A;  4J6I A;  3MHS D;  3WAL A;  1KM7 A;  3VTV A;  1BT0 A;  4ANU A;  4WQO B;  4XZ4 A;  2M4N A;  3QK0 A;  3OJ4 B;  1WXV A;  2BWE S;  2V3S A;  3NOB A;  4TUU A;  5E6P A;  4NQK E;  4LDT B;  2MQJ A;  3PRZ A;  4NQL B;  5G2N A;  2BWF A;  2G45 B;  2MCN B;  3ENE A;  4JIO U;  4NAW B;  2C7H A;  3ZDT A;  2NPT B;  3ZRF A;  4GDK A;  2ZNV B;  2N1W A;  2GBR A;  2W9N A;  4FHJ A;  3PZD A;  4W9E A;  3QC8 B;  4TQ1 A;  4W9G A;  2REX A;  1R4N I;  4BVU C;  2CKH B;  2NCN A;  3HK0 A;  3ML9 A;  2GBJ A;  5CHW A;  2WDT B;  2XK5 A;  2D11 A;  4TQ0 A;  5KHQ A;  5LXI B;  2R2Q A;  3QAQ A;  3DVN U;  3DVG Y;  3A9J B;  4JL9 A;  3PRM B;  3PRE A;  1V49 A;  1XQQ A;  1IYF A;  3DBS A;  1AAR A;  2AL6 A;  2KD0 A;  3N30 A;  2RD0 A;  1UD7 A;  2BGF A;  2K1F A;  2MBH A;  2YLM A;  2V1Y A;  3OAW A;  4WWP A;  2NBW B;  1WGH A;  2L8J A;  1WI0 A;  3AU5 A;  4GU2 A;  1RAX A;  4WAA A;  2PE6 B;  3QWZ B;  2KFJ A;  4HK2 A;  4K7S A;  4E3C A;  2PJH A;  3QQ8 B;  4P7I A;  1C1Y B;  4IM2 A;  3W1Y A;  4DBG A;  2KDE B;  1TGZ B;  4II2 B;  1WXS A;  2AYO B;  2KKC A;  2O2V A;  3DBL I;  4ZYN A;  4BKS D;  1VCB A;  3ZNI D;  3PSE B;  2FCS A;  5D2M B;  1UBQ A;  2IO1 B;  2LXC A;  3ALB A;  1SIF A;  3I3T B;  2K8H A;  3R66 C;  3HHM A;  4HXD A;  3GOE A;  3ZUN A;  3A9K B;  1F9J A;  3N32 A;  2K6Q A;  5D6J B;  2JPH A;  1UEL A;  4W9J A;  3QIJ A;  4GOC A;  2JY6 A;  4HLE A;  2L0F A;  1UH6 A;  2LGX A;  3ZTD A;  2GBM A;  3JW0 X;  2AL3 A;  4DHJ B;  2D10 A;  3VHT C;  2CU1 A;  4KSL C;  3V62 A;  2KJH B;  3MTN B;  3AUL A;  4A3P A;  1PQS A;  4KIK A;  3DOW A;  3L0W B;  1Y8R C;  4G50 A;  4DWF A;  2KMC A;  4K81 A;  4W9H A;  4W9F A;  3VFK A;  2G4S A;  4LJO B;  4BBN F;  5HKH A;  3APC A;  5J2R A;  4W9C A;  3C0R B;  1X1M A;  4B9K A;  4BBN C;  4IWQ A;  3LDZ E;  3SDL C;  2G4D B;  2GOW A;  3TJP A;  4IWO A;  4NAW A;  1XT9 B;  3A4R A;  1ZKH A;  1EUV B;  2KOX A;  4IW0 A;  1RLF A;  4ZDV A;  5EDS A;  3N3K B;  4JQW C;  2JT4 B;  1YD8 U;  1A5R A;  3D32 A;  3QX1 A;  4KV2 A;  2L7R A;  3A33 B;  1Z5S B;  1P3Q U;  3TMP B;  4KDI C;  2LZ6 A;  2DHZ A;  3CF6 E;  2KMA A;  2FIF A;  2N9X A;  1E90 A;  4NJ7 A;  2A4Z A;  5G55 A;  3VUY A;  4F8C B;  3NZU A;  3ZLZ A;  2JVC A;  4WJO A;  1TZ1 A;  2AWT A;  1V9J A;  2ZVO A;  5JH5 C;  3UF8 A;  5CHV C;  3H7S A;  2GBN A;  3VH3 B;  2M8S A;  3DDC B;  3ZNZ B;  3KYC D;  3EHV A;  1WRD B;  1E8X A;  2KZR A;  2KX0 A;  4DHZ E;  2M1M A;  1YX5 B;  5E6N A;  3APF A;  4GMV A;  4G3X B;  2J0M A;  2LVQ A;  1Z2M A;  2N7E A;  2MWS B;  4DDI D;  3VTW A;  4NJ6 A;  4ZRJ A;  3RCZ A;  4OVV A;  4W9L A;  1YJ1 A;  2BKF A;  1NBF C;  5J17 A;  1YIW A;  2K39 A;  2XBB C;  2CHW A;  2ZJD A;  4RMA A;  1WXA A;  1FXT B;  3AXC A;  2BYE A;  4ICV A;  2L3Z A;  4KIK B;  1R4M I;  3WIM A;  1P0R A;  4GDL B;  5AEK B;  1IP9 A;  3L54 A;  1EO6 A;  5IA7 A;  1WJN A; 
#chains in the Genus database with same CATH topology
 5CX3 A;  4FA6 A;  4RM8 A;  2YEP B;  2DZI A;  3ML8 A;  1D4B A;  3P63 A;  2K3U A;  2DYM A;  3N20 C;  5G5H A;  2RSU A;  3WCQ A;  1WY8 A;  3QJZ A;  1Q10 A;  4GDL A;  1QKZ A;  2KN4 A;  1N61 A;  2N9P C;  1TY0 A;  1JRO A;  2RR9 A;  1IBX B;  2IBI B;  2LVO A;  4I6P A;  4A9A A;  4DXF A;  1XD3 B;  3NHE B;  3A9K A;  4WJN A;  2IO2 B;  3VQI A;  1F52 A;  1C3T A;  1WXM A;  2I2Y A;  2IO3 B;  2MBQ A;  2KJ6 A;  3Q69 A;  1V5T A;  4LNN A;  4HRO A;  3ZIM A;  2DZJ A;  3ZYY X;  2ZEQ A;  3KWL A;  2LEK A;  1SE9 A;  5JXV A;  3NVW A;  2ZCB A;  1OFF A;  1A70 A;  2FID A;  2V4L A;  2RDG A;  3PLV A;  2M0X A;  4DDG D;  2NBV B;  2WXL A;  2JXX A;  3ZDM C;  1HZ6 A;  4C4V A;  1SJE D;  2JF5 A;  4S17 A;  1Q5W B;  4MJS A;  1VZ6 A;  3UIO B;  3BVG A;  1V81 A;  4II3 B;  1S3S G;  4W9I A;  2WXH A;  4M0W B;  4C00 A;  2HJ8 A;  1JWM D;  4GIV A;  2DNF A;  2LHD A;  4HEA 1;  1VDV A;  3R7R A;  3P4S B;  1TS2 A;  3EFC A;  3JSV A;  4P6V F;  2KDI A;  2D3G A;  1UGJ A;  1QOG A;  4XC2 A;  3FKY A;  1E7V A;  3IT4 B;  4RGM A;  3Q2A C;  1CQV A;  2MP2 A;  2KTR B;  3UGB B;  2ZVN A;  4ANW A;  1SE2 A;  1L6V A;  2WXG A;  4EZL A;  5DPT A;  4GSW A;  2LWP A;  3P2B A;  3AB5 A;  1M94 A;  1KFY B;  3BII D;  3L08 A;  4A6Q A;  2DWQ A;  3PO0 A;  1I4G A;  5GXG B;  3AEE B;  3PLU A;  4B6W A;  1E6E B;  4ZHO A;  4A20 A;  2DEN B;  4FXC A;  2KTR A;  3P4R B;  3AE2 B;  1T0S C;  1E8W A;  1R4N B;  4OVZ A;  1SXT A;  4HDQ A;  2I1K A;  3PS6 A;  2KC1 A;  4A8X C;  4IUM B;  1V1P A;  1V6E A;  2V0G A;  2X38 A;  1IGD A;  3VDZ A;  1HTO A;  4IM0 A;  5JHB A;  4HPL B;  1TIF A;  1JRP A;  4LJP B;  3SFE B;  1FPY A;  3JVZ X;  3W1S A;  3FC4 A;  2ZPN A;  2ZCC A;  1FMA D;  2WU2 B;  1CMX B;  2GLS A;  2K25 A;  3AEF B;  1JAL A;  4EEW A;  3IFW B;  1J7B A;  1GB1 A;  3Q14 C;  2IO0 B;  3C19 A;  2NVU I;  2N7J A;  5HI1 A;  2IND C;  3W1S C;  1V5O A;  2ON8 A;  1PGA A;  3GZN I;  3E56 A;  2N0S B;  2BYT A;  1S1Q B;  3QA8 A;  3N1Y C;  3EUB 2;  5BMG A;  3PHW B;  4QAY A;  3ZQ4 A;  2MJE A;  3K9P B;  3I5J C;  2FNJ B;  1V8C A;  3HM3 A;  1Y56 A;  2JZZ A;  1D6E C;  1N5W A;  5HFY A;  3ONS A;  4MGY E;  1TT5 B;  2OJR A;  2QEJ C;  2Y5P A;  4IOI E;  3RNG C;  1HZ5 A;  1XCT L;  1LO5 D;  2N1V A;  1QT9 A;  3AE4 B;  2KTF A;  1IBX A;  3PGE A;  4AS1 A;  3ECI A;  4B0E A;  1L6U A;  3EFU A;  4PYU A;  2FE8 A;  4K7W A;  2M17 A;  1YJI A;  2Y5C A;  1FRR A;  2YVC A;  2G3Q B;  2VZK D;  2KC2 A;  1J0G A;  1D5Z C;  5LLI A;  5DPS A;  4NY0 A;  1DGJ A;  2QHO A;  1NVI D;  4K1R B;  2BB5 A;  1FNV A;  1SGH A;  2K22 A;  1QOF A;  3IBE A;  3S2A A;  4M00 A;  3UIP B;  1WWT A;  2HTH A;  3PRP B;  5JZE B;  2BKR B;  3UQA A;  2GMI C;  2L76 A;  2EMT A;  2MA9 B;  3M3J A;  4XWT A;  5H8Y E;  5LNK 1;  4RH6 A;  1JRU A;  3ZVV A;  5AZH A;  3I57 A;  1D3Z A;  3WAM A;  3H8H A;  3T8M A;  3AH7 A;  4MEL A;  4NJC A;  3VTU A;  1JWB D;  4LNO A;  3TEW A;  3MC0 B;  4ICU A;  1KM7 A;  3VTV A;  2WXO A;  4ANU A;  4XZ4 A;  2PIA A;  2V3S A;  3NOB A;  1EU4 A;  2I38 A;  3PRZ A;  3ENE A;  4JE3 B;  3ZRF A;  4XYC A;  2ZNV B;  4W9E A;  3ZJV A;  2KT7 A;  3OWE B;  1LGR A;  2GB1 A;  1R4N I;  1RM6 C;  2CKH B;  2NCN A;  4ZHP A;  2Y3A A;  3NJT A;  5CHW A;  2XK5 A;  4LNI A;  4TQ0 A;  1AWD A;  3QAQ A;  1TKE A;  3A9J B;  1XXG A;  3RNE C;  1OQQ A;  1UD7 A;  5D3I B;  1J7C A;  2V1Y A;  2NBW B;  2WXK A;  4Q2J A;  2JXT A;  2KFJ A;  3AEB B;  2PJH A;  3W5V B;  4DBG A;  2AYO B;  4P1C C;  4BKS D;  3ALB A;  4ARI A;  2QJL A;  1SIF A;  2JYE A;  2K8H A;  3I3T B;  3ZUN A;  3N32 A;  2K6Q A;  4W9J A;  3QIJ A;  2JY6 A;  4HLE A;  2L0F A;  3AE7 B;  1UH6 A;  3V3X A;  2D10 A;  3MC8 A;  4KSL C;  3L0W B;  4G50 A;  2VZK B;  2KMC A;  4K81 A;  1T6B X;  3KQ4 A;  2WS3 B;  5HKH A;  1L0Y B;  3I63 C;  4L2Y A;  4BBN C;  4IWQ A;  3LDZ E;  3SDL C;  3U4E G;  3A4R A;  2E6X A;  1ZKH A;  1NYQ A;  2CJN A;  4KGR A;  2WQY B;  3QX1 A;  3AM9 A;  2V9H A;  4HJG E;  3GE3 C;  2J42 A;  2DHZ A;  3CF6 E;  1YN3 A;  2WXJ A;  3B2G A;  3VUY A;  4F8C B;  3ZLZ A;  1MG4 A;  4WJO A;  4N58 A;  3T3O A;  3I9V 1;  3RI7 C;  2IDY A;  2SAK A;  4YT0 B;  1WRD B;  1E8X A;  1WRI A;  1K53 A;  2KZR A;  4YTP B;  4G3X B;  2J0M A;  3VTW A;  4ZRJ A;  3NVY A;  4OVV A;  3U52 E;  1EM7 A;  3Q8A A;  1YOV B;  1NI3 A;  1YIW A;  4MH8 A;  2BW2 A;  2CHW A;  4RMA A;  1FXT B;  1R4M I;  1P0R A;  1AYF A;  1JWU D;  1L0X B;  1WJN A;  1UBI A;  4GB9 A;  3L13 A;  1WJ4 A;  2KAJ A;  1RFA A;  4M8N A;  3WAN A;  2KQ4 X;  4TKN A;  4F1S A;  5CTR C;  2MBO A;  3B9J A;  3O13 A;  4HCN B;  1LXD A;  2IGH A;  3KUD B;  1C4A A;  1V2Y A;  5BMI A;  1WYW B;  2WWZ A;  2LRW A;  1TJE A;  3V6C B;  1G6J A;  1EF5 A;  3H7P B;  2JUO A;  2PVO D;  3BIN A;  1LM8 B;  2NBU A;  3HUI A;  3RNF C;  4AQ7 A;  1JWA D;  5BMH A;  1WGG A;  3B1L X;  4E74 A;  3ETR A;  1FFU A;  3RZW C;  2L05 A;  4XE0 A;  4FBJ B;  4BFR A;  2K8B A;  2MSE D;  2KDF B;  4NZL B;  2IZV B;  4FUL A;  2FBW B;  3PV1 A;  2JRI B;  3TL5 A;  3DBH B;  5IOI A;  4HVB A;  3SU8 X;  1TTN A;  2L00 B;  4I6L B;  3U7Z A;  4REZ A;  3WA0 A;  1ZXI A;  3KVF B;  1H4R A;  2XK5 B;  3L10 B;  1T3Q A;  1XLQ A;  2KNB A;  3OLM D;  5J18 A;  4RCO A;  5E6O A;  3VRA B;  1KLV A;  2MHJ A;  1P1A A;  4RF1 A;  2HDE A;  4RF0 A;  2LRU A;  3VR9 B;  2BPS A;  3DVN V;  2MJD A;  2ONQ A;  3HVD A;  4DK5 A;  2KWU B;  5IO9 A;  3QAR A;  3EGR A;  3H7P A;  5L83 A;  3DHH C;  1KOT A;  3HVZ A;  2H89 B;  3MC9 A;  4IKG A;  3B0A A;  3ZW3 A;  2OJW A;  4ZOH C;  4YTN B;  2HE7 A;  2KK8 A;  3IG3 A;  4C56 C;  3RD2 A;  2O6V D;  2K9X A;  2VRR B;  1SF0 A;  5GMV A;  1GJZ A;  4MEM A;  4TSS A;  2KAC A;  3PT2 B;  4HPM B;  2KWC A;  4URK A;  2AEH A;  2QIE B;  1C9F A;  3RNA C;  2WX1 A;  1WSP A;  2J0K A;  4WIP A;  3VH4 B;  1K52 A;  1XO3 A;  2IYD B;  2Z0E B;  4WJP A;  2BQQ A;  2KJR A;  4PS8 A;  3M62 B;  2WX0 A;  3WAO A;  3UQB A;  3NY5 A;  5LXH A;  3U30 A;  5I4D A;  4XWW A;  2LXA A;  2K6D B;  1FFV A;  2KYW A;  1GOZ A;  3AE8 B;  4HJK A;  2PKO A;  4M01 A;  1MHX A;  3P4P B;  5TSS A;  1QOB A;  1R4M B;  5HG2 A;  1SBB B;  3R3M A;  1WX7 A;  4K3C A;  2I1J A;  1V80 A;  1KRH A;  1KTK A;  2MLB A;  4YL8 A;  3DBL B;  1ISN A;  4WWO A;  3RMK C;  3ZJU A;  1WJU A;  2B3A A;  3QCA A;  1TBE A;  3VXW A;  1OEY A;  1EWY C;  1RWS A;  3TEZ A;  2D07 B;  2CJO A;  4FJZ A;  3SR6 A;  1GC7 A;  3AED B;  1XLP A;  3RUL A;  3BVZ A;  4WWN A;  2R2O A;  1PGB A;  2JRH A;  2AQ3 B;  1P7F A;  1SIJ A;  2DLB A;  3AU4 A;  4KSK C;  1NEN B;  1FNU A;  1OEY J;  2INN E;  3A9J A;  4MSM B;  1N62 A;  3NVV A;  2EMS A;  1E5W A;  3ZRC A;  4YTM B;  2D2Q A;  2LAS A;  1KLG D;  2H88 B;  3BYT B;  4TV3 A;  3MFG A;  2MEK A;  4D2K A;  2M56 B;  3AE3 B;  4KZC A;  2Z0D B;  4WJQ A;  4BKT A;  4NPN A;  2JYT A;  4CHK A;  4EFO A;  4MH0 E;  4UDU C;  2RPQ A;  4AP4 C;  4JWU C;  2EKE C;  4EZK A;  3EA6 A;  3TEY A;  5AUK A;  1UZX B;  3GE8 C;  1PFD A;  2LJI A;  2KMM A;  2INC C;  2K8C A;  1WZ0 A;  4PT5 A;  1GNU A;  3DVG X;  3RFZ B;  2HD5 B;  1ZUD 2;  1R7S A;  3VUX A;  1RYJ A;  3U7D A;  4LLG M;  2ZNV C;  4KKI A;  3FAH A;  5C2T B;  1CJE A;  2C7M B;  5H92 C;  4J3O D;  3CMM B;  3N9Y C;  5IAA C;  2MRP A;  4FHK A;  3BYY B;  3ABV B;  4WQO B;  1WXV A;  4MM3 B;  2VH2 A;  1FD6 A;  4NQK E;  5G2N A;  4NQL B;  2BWF A;  2MCN B;  5EE9 A;  2C7H A;  2B76 B;  4C4V B;  1FEH A;  3PZ7 A;  2L1A A;  2N1W A;  2GBR A;  2W9N A;  1ZDX A;  2Q5W D;  4W9G A;  1BML C;  2AX5 A;  2REX A;  4BVU C;  4GLS C;  3HK0 A;  2JX5 A;  2WDT B;  2D11 A;  3P1M A;  4ZRP A;  5KHQ A;  1DOX A;  2R2Q A;  2L52 A;  5BYS A;  2QIL A;  4CQN A;  1IYF A;  1V49 A;  3DBS A;  4JX1 C;  1GB4 A;  1JQ4 A;  3R8B A;  4N6E B;  2BGF A;  1TS4 A;  2YLM A;  1QQR A;  2L8J A;  1WI0 A;  3AU5 A;  1RAX A;  2G9H D;  2PE6 B;  4K7S A;  5EE3 A;  3QQ8 B;  2EKI A;  4IM2 A;  2KDE B;  3P4Q B;  2O2V A;  2KKC A;  3CWI A;  3DBL I;  3PSE B;  4C80 A;  5D2M B;  2LXC A;  1YNT E;  3AEG B;  3A9K B;  3W5U B;  2JPH A;  1UEL A;  4OZC A;  1MPE A;  4GOC A;  1K50 A;  3ZTD A;  3URY A;  3VHT C;  4RGO S;  1ROE A;  3V62 A;  3MTN B;  3AUL A;  4RFB A;  1PQS A;  3R2I A;  3FIL B;  4DWF A;  4W9F A;  3VFK A;  2BT6 A;  4LJO B;  4W9C A;  4B9K A;  5EE0 A;  2G4D B;  4O1N A;  1D5M C;  3LXF A;  3TJP A;  2ZW1 A;  4NAW A;  3RNC C;  2KOX A;  3DHG C;  1NYR A;  5EDS A;  3N3K B;  4JQW C;  2L7R A;  3A33 B;  1Z5S B;  1P3Q U;  1PGX A;  1N5X A;  2LZ6 A;  1GAQ B;  2FIF A;  2N9X A;  3BK2 A;  1E10 A;  5G55 A;  3NZU A;  2LGI A;  2AWT A;  1V9J A;  2ZVO A;  1I4P A;  5D3D A;  4OW0 A;  3ZNZ B;  3DDC B;  3EHV A;  4HRS A;  3NS1 A;  5E6N A;  3MJ5 A;  4GMV A;  2LVQ A;  2N7E A;  4DDI D;  1NBF C;  2K39 A;  2XBB C;  1VJK A;  3FIL A;  2ZJD A;  1ZP0 B;  1WXA A;  2RDB C;  2L3Z A;  3WIM A;  2WDR B;  1XLO A;  1PDX A;  2ICI A;  2LGY A;  3V60 A;  3Q3M C;  2FCN A;  2C9W B;  4CYE A;  1P98 A;  1E8Z A;  3DQV A;  1HTQ A;  2HTM E;  3AMZ A;  2UWQ A;  4ANV A;  4EUT A;  2FAZ A;  1WFY A;  4IWP A;  2IGG A;  2ZZP B;  3LB8 C;  2J7Q B;  1MJD A;  3KUZ A;  3VAW A;  3JSV B;  4PYZ A;  4LNK A;  3ZNH B;  5C3J B;  5FR3 A;  4K7U A;  5JHA A;  3N1X C;  1C4C A;  2DX5 B;  2Z59 B;  2L32 A;  4BKS A;  2MJ3 A;  4PK1 A;  2KO3 A;  2QC8 A;  4OHJ A;  3ZTC A;  1N60 A;  1FM0 D;  3VUW A;  1QZE A;  4WQM A;  2JZ3 B;  2PMV A;  2WXI A;  4FJY A;  2LI5 A;  4NNJ B;  1J7A A;  1WYG A;  1YN5 A;  2IGD A;  1N6Z A;  2KX3 A;  3X0W A;  4MM3 A;  3H1U A;  4DXA B;  3KYD D;  3PZ8 A;  5IKC M;  1K51 A;  3KLS X;  2WYQ A;  5C1Z A;  1C79 A;  4DXG A;  1I4Q A;  2W82 A;  1STE A;  5AZF A;  2MBB B;  1TS3 A;  2WHI A;  3IAM 1;  3K9O B;  4LDT D;  2M0A A;  3TIX A;  4EZJ A;  2BS4 B;  1WR1 A;  2UU7 A;  3AI5 A;  3KW5 B;  1VD2 A;  4JPS A;  2BYF A;  2MW5 A;  3GP7 A;  3A1Q A;  1YX6 B;  2CHZ A;  2G1E A;  4EE2 A;  1L2N A;  2NR2 A;  1QIL A;  3Q3N C;  3CSF A;  4F7Z A;  1WGY A;  3KWV A;  4G11 A;  2L0T A;  3IVF A;  1FRD A;  1E9M A;  4FN2 A;  3RYT A;  5G5G A;  1T5X D;  4BOZ B;  1UWX A;  3BWU D;  4MGI E;  1QF6 A;  1XF5 L;  1L7Y A;  3L17 A;  2WP9 B;  1SSN A;  2O6V A;  1C77 A;  4AJW A;  5DPW A;  2N7D A;  5HHD G;  3U2S C;  1I35 A;  3U8Z A;  2D5G A;  3E9S A;  1V1P B;  2RGF A;  2ZW0 A;  4ASW C;  1ET9 A;  4GN1 A;  1BXT A;  3OJ3 A;  1T0R C;  4A3O A;  2KLC A;  3LJ3 A;  4C7Z A;  5FR6 A;  3LYY A;  2PVG C;  4ITK A;  2DYO A;  4RGN A;  1EF1 A;  4E71 A;  1N63 A;  2D3B A;  2LJ5 A;  2FUH B;  1C4P A;  4H2A A;  2GI9 A;  2KFK A;  2DZK A;  2ASQ A;  1HEZ E;  4KZ0 A;  4B0M A;  2D3A A;  2JZP A;  4FJV B;  4W9D A;  3DPD A;  4GGQ A;  3B2F A;  2C7N B;  3GS2 A;  4OZB A;  4MGK E;  2WXQ A;  5D7G A;  2KHW B;  2MH7 A;  4HPP A;  3ZJT A;  1WX8 A;  1HE8 A;  5DPR A;  2C60 A;  4ACF A;  1MVK A;  2TSS A;  2DAJ A;  2JQR B;  1WE6 A;  4MJS B;  4WUR A;  1WGD A;  2QDF A;  4TMA B;  4BZA A;  3MJW A;  3AN1 A;  3MHZ A;  3V6E B;  4A55 A;  2DAF A;  2LUE A;  3PPA A;  5D94 A;  3PHX B;  1J19 A;  3Q6B A;  3WAP A;  2WLB A;  1T0Q C;  4ZRQ A;  2BYV E;  3EC8 A;  3A1Q B;  1ZXH A;  2KN5 A;  4G0N B;  2FUG 1;  1KF6 B;  3L16 A;  3GZN B;  3ZGZ A;  4AOF A;  2CR5 A;  1WZ3 A;  4PS3 A;  2GRI A;  2OED A;  2NPT A;  2LVP A;  2KQ7 A;  1MFW A;  1UWM A;  2WNM A;  4NAM A;  2KLG A;  1YQB A;  1YQ4 B;  1KJT A;  1GG3 A;  3M95 A;  3VVW B;  3TSS A;  5C23 A;  3AEC B;  4MAC A;  3JYU A;  4RM9 A;  3UIN B;  3NRZ A;  2W55 A;  5FKA C;  4LNF A;  1F2R I;  4ZRK A;  1YJJ A;  1SJH D;  1ZPS A;  1V86 A;  4KGS A;  1VR9 A;  2PE9 A;  1LQB A;  4IC7 B;  5MPO A;  1WR6 E;  1GPX A;  2DYB A;  3H9D A;  4IM3 A;  3CIR B;  1NDD A;  1FCL A;  1IPG A;  1TYG B;  2XNA C;  2L83 A;  1BT0 A;  1UUP A;  3OJ4 B;  2BWE S;  5E6P A;  4TUU A;  1FXA A;  4LDT B;  1FO4 A;  4NAW B;  2CU3 A;  4LK0 M;  3ZDT A;  4GDK A;  3PZD A;  3AEA B;  4TQ1 A;  3ML9 A;  1F0Z A;  2M19 A;  2SEB D;  5LXI B;  3HRD D;  1FNW A;  3DVG Y;  2LMC A;  4BAX A;  4JL9 A;  2WDV B;  3DWG C;  3PRM B;  3PRE A;  1EU3 A;  1AAR A;  2KD0 A;  1YQ3 B;  2RD0 A;  2MBH A;  3OAW A;  2OHF A;  4WWP A;  1WGH A;  4WAA A;  4GU2 A;  3QWZ B;  4E3C A;  1JW9 D;  1MHH E;  1C78 A;  2FCS A;  3V05 A;  2N9L A;  4HXD A;  2WXP A;  5D6J B;  2R61 A;  3BZD B;  3RN9 C;  4DHJ B;  2GBM A;  3JW0 X;  1B1Z A;  4P1B C;  1P7E A;  1Y8R C;  2QMT A;  4W9H A;  4BBN F;  1DOY A;  2WXN A;  1E0Z A;  3APC A;  1X1M A;  3AE1 B;  4IWO A;  4US9 A;  4RNA A;  1EUV B;  4IW0 A;  1RLF A;  2JT4 B;  4KV2 A;  4XDC A;  3TMP B;  4KDI C;  1ESF A;  2KMA A;  2A4Z A;  4DQO C;  3UI3 A;  5JH5 C;  1I4H A;  2NTS A;  3UF8 A;  2M8S A;  2J52 A;  1YN4 A;  1CK1 A;  4K3B A;  2KX0 A;  4DHZ E;  1L4Z B;  2M1M A;  3APF A;  2MWS B;  4M02 A;  3RCZ A;  4A90 A;  4W9L A;  1YJ1 A;  5J17 A;  2WXR A;  4ARC A;  1TY2 A;  2BYE A;  3AXC A;  1IUE A;  4GDL B;  5AEK B;  1LFD A;  4PS7 A;  3PTF C;  1JCK B;  1F1H A;  1J8C A;  2KVZ A;  1WF9 A;  4B95 A;  2KQS A;  2QSD A;  5FK9 C;  3RT3 B;  3V61 A;  4BOS C;  1MG8 A;  1D5X C;  1I42 A;  1JML A;  5KHO A;  3SHQ A;  5BYQ A;  2FCM A;  2IY1 B;  2DBY A;  2WXF A;  4IDI A;  3BK1 A;  4JLC A;  4OVU A;  2PTL A;  1DYQ A;  1KLU D;  3Q3O C;  2BS2 B;  2WXM A;  2ZPY A;  1DOI A;  2RPV A;  2GBK A;  3C8Y A;  1WGR A;  3HIZ A;  4YWG G;  1UGM A;  2J0J A;  3Q8B A;  1TKG A;  1HA5 A;  1T0Y A;  2KWV B;  4DHZ B;  2MBE A;  1V97 A;  3DWM A;  3M63 B;  4HCP B;  1XEE A;  2W3S A;  2Y5B B;  1WMH B;  2KDB A;  2NTT A;  2KXJ A;  4WH4 A;  2LUM A;  4GDK B;  1I7H A;  2WU5 B;  2JWU A;  4GXB A;  2RMM A;  4MDK E;  2MP2 B;  4JGH B;  4BKG A;  5TR5 A;  1SEB D;  3NVZ A;  4USA A;  3J9C A;  4N59 A;  1GC6 A;  4W9K A;  2PPH A;  3AE9 B;  5DCN A;  3IHP C;  4EOY A;  1E7P B;  1XLN A;  2PLP A;  2XEW A;  4KX6 B;  1U4A A;  1FIQ A;  2HJ1 A;  1L5P A;  2IJ0 A;  2OOB B;  3OG5 A;  1YMH E;  3H6N A;  1AN8 A;  4M0W A;  2NMQ A;  2MX2 A;  3Q3J A;  3X23 A;  1XCQ L;  1HXY D;  3RZF A;  2CS4 A;  4X57 B;  2E3T A;  3DCG A;  2UYZ B;  1TKY A;  3TBL D;  2Z8L A;  1WE7 A;  4MSQ B;  4L1B A;  3HM6 X;  4XX5 A;  4YSX B;  2WGS A;  3AE6 B;  1E8Y A;  2KVR A;  3KUC B;  4N9F 4;  1UF0 A;  3Q3F A;  5IP4 D;  3RUI B;  2NS5 A;  2V3N A;  4ZRI A;  3RPF C;  3P42 A;  2V3P A;  3DBH I;  4DHJ D;  3A4S C;  1VZ8 A;  2O2V B;  1CZP A;  4I6N B;  3R7Q A;  2BB6 A;  3T3N A;  5EE1 A;  3NZ3 A;  1WXQ A;  4FAD A;  2LGD A;  4CO7 A;  4AWJ A;  1EWC A;  2LD9 A;  2LFI A;  5BO4 B;  2N9K A;  1SB3 C;  4ANX A;  3PVL A;  2PEA A;  3VR8 B;  2JWZ A;  2JSV X;  2CHX A;  4MGZ E;  2XN9 C;  4HDO A;  3AV8 A;  4IG7 B;  2C5L C;  2KDM A;  1WH3 A;  1L0V B;  1ZW7 A;  2IY0 B;  4KVG B;  2ACZ B;  4KKJ A;  2BBC A;  4HWI B;  4C7Y A;  1ZGU B;  4P16 A;  1UNS A;  3O65 B;  4ZYS A;  3B08 A;  1OQY A;  4XGA B;  1WJ6 A;  4OZA A;  4MT5 A;  3ZKJ C;  3APD A;  4EKU A;  1ET6 A;  3NS8 A;  3EEC A;  3CST A;  3NG0 A;  5CHF A;  1WMH A;  1B9R A;  3RNB C;  3BY4 B;  2FCQ A;  2VH1 A;  2INP E;  2KFK B;  3IAS 1;  1Q1O A;  4YXD B;  3W2D A;  1TS5 A;  3ZNG C;  1E7U A;  3ZO5 B;  3DHI C;  1WIA A;  1BUI C;  1I4R A;  4HKZ E;  1F2R C;  2K0P A;  1OQR A;  4KDL B;  4L23 A;  3KH0 A;  1FXI A;  4FLH A;  1Q0W B;  2KWD A;  3TEX A;  3ZXR A;  4YSY B;  2LGS A;  2DZM A;  2V4I B;  1MI0 A;  1ZOY B;  1JWS D;  5E6J A;  1WM3 A;  1L4D B;  1WX9 A;  2N9E B;  3TCA A;  2BF8 B;  3NZS A;  1HQR D;  2N4F A;  3SD5 A;  5L95 C;  2WDQ B;  3L4P A;  1V1O A;  1GUA B;  1K8R B;  1OGW A;  2O6V B;  1P9D U;  1H8C A;  1ACC A;  3TUO A;  4S0R A;  3AE5 B;  3DBR I;  4XDD A;  4US8 A;  1NEK B;  4AUQ C;  2BS3 B;  2EEL A;  2W54 A;  1OTR B;  4M8M A;  1WM2 A;  4AJY B;  1I4X A;  1ZE3 D;  3NUH B;  2BTE A;  1NI2 A;  5AZG A;  4LCD E;  1RRB A;  1SE4 A;  2KAN A;  3T9L A;  2A5U A;  5IN7 A;  2QCZ A;  1QOA A;  3QHT A;  4J6I A;  3MHS D;  1QLB B;  3WAL A;  2M4N A;  3IXS A;  3MP9 A;  3QK0 A;  2MQJ A;  2G45 B;  4JIO U;  2NPT B;  4FHJ A;  3QC8 B;  3SEB A;  1VZ7 A;  1VLB A;  3BVM A;  2GBJ A;  2RDH A;  4HKQ A;  3GB1 A;  3N1Z C;  4LTU A;  3DVN U;  1F77 A;  1C76 A;  1XQQ A;  2AL6 A;  2AQ1 B;  3IT6 B;  3N30 A;  3VRB B;  2K1F A;  4JWS C;  1PYW D;  1RFK A;  4HK2 A;  2K5P A;  5AUI A;  4P7I A;  1C1Y B;  3W1Y A;  2PW9 A;  4II2 B;  1TGZ B;  1WXS A;  4YSZ B;  4ZYN A;  1VCB A;  3ZNI D;  1UBQ A;  2IO1 B;  1WGK A;  1IGC A;  3R66 C;  2AQ2 B;  3HHM A;  3GOE A;  4WWM A;  1F9J A;  4RGT A;  2LGX A;  4WAF A;  2AL3 A;  2CU1 A;  1KH0 A;  2KJH B;  4A3P A;  4KIK A;  3DOW A;  3Q8C A;  1PUT A;  2G4S A;  2J53 A;  1ZDV A;  5J2R A;  1TZO A;  1FCC C;  3C0R B;  3Q8F A;  2GOW A;  1XT9 B;  5T8I A;  2X8X X;  4ZDV A;  1YD8 U;  1A5R A;  3D32 A;  3SFD B;  4R3D A;  2YEP F;  1E90 A;  4NJ7 A;  1SE3 A;  3DBR B;  2JVC A;  1TZ1 A;  2J4X A;  2LHE A;  5CHV C;  3H7S A;  2GBN A;  3VH3 B;  5BYR A;  3KYC D;  3Q8E A;  2D3C A;  1YX5 B;  1Z2M A;  2BVC A;  1ENF A;  4NJ6 A;  3ZXV A;  2BKF A;  1VRA B;  2JU6 X;  1AW7 A;  4KGT A;  2W3R A;  4ICV A;  4KIK B;  3W9C B;  3R2T A;  1M4V A;  1IP9 A;  3L54 A;  1EO6 A;  5IA7 A;  2IPK D; 
#chains in the Genus database with same CATH homology
 1LFD A;  1UBI A;  4GB9 A;  5CX3 A;  3L13 A;  1WJ4 A;  4PS7 A;  4FA6 A;  4RM8 A;  2DZI A;  3ML8 A;  3PTF C;  2LGY A;  1J8C A;  3V60 A;  1RFA A;  4M8N A;  3WAN A;  2DYM A;  2FCN A;  4TKN A;  1WF9 A;  2C9W B;  4CYE A;  4F1S A;  1P98 A;  2RSU A;  5CTR C;  1E8Z A;  3DQV A;  2KQS A;  2MBO A;  4B95 A;  1WY8 A;  3RT3 B;  3QJZ A;  4EUT A;  2UWQ A;  4ANV A;  4HCN B;  2FAZ A;  1WFY A;  4IWP A;  4GDL A;  1LXD A;  2ZZP B;  3V61 A;  2N9P C;  2J7Q B;  4BOS C;  1MG8 A;  3KUZ A;  3VAW A;  3KUD B;  1V2Y A;  1I42 A;  1WYW B;  5KHO A;  3SHQ A;  3JSV B;  2FCM A;  2WWZ A;  2RR9 A;  2LRW A;  2IY1 B;  4PYZ A;  3V6C B;  3ZNH B;  2IBI B;  2LVO A;  4K7U A;  5JHA A;  4JLC A;  1EF5 A;  3H7P B;  4I6P A;  4OVU A;  2JUO A;  1G6J A;  3BIN A;  1LM8 B;  2DX5 B;  2NBU A;  2Z59 B;  4BKS A;  1XD3 B;  2ZPY A;  3NHE B;  3A9K A;  4WJN A;  1WGG A;  2IO2 B;  3VQI A;  2GBK A;  1WGR A;  3HIZ A;  3B1L X;  1UGM A;  4E74 A;  1C3T A;  2KO3 A;  2J0J A;  3ZTC A;  1WXM A;  2IO3 B;  2MBQ A;  1T0Y A;  3RZW C;  2KWV B;  1QZE A;  2L05 A;  3VUW A;  2JZ3 B;  2KJ6 A;  4BFR A;  4DHZ B;  2K8B A;  2MSE D;  4FJY A;  2MBE A;  4FBJ B;  1V5T A;  4HCP B;  2LI5 A;  3M63 B;  2KDF B;  4NNJ B;  2IZV B;  4FUL A;  3PV1 A;  3ZIM A;  2DZJ A;  2JRI B;  3TL5 A;  2Y5B B;  2KX3 A;  2ZEQ A;  3X0W A;  4MM3 A;  1WMH B;  1SE9 A;  2KDB A;  2ZCB A;  2V4L A;  2FID A;  3H1U A;  2KXJ A;  4DXA B;  3KYD D;  4HVB A;  3PLV A;  3SU8 X;  1TTN A;  2L00 B;  2M0X A;  4I6L B;  4DDG D;  2NBV B;  3ZDM C;  2JXX A;  3WA0 A;  3KVF B;  2WYQ A;  4GDK B;  5C1Z A;  1H4R A;  2XK5 B;  3L10 B;  2JF5 A;  4GXB A;  2KNB A;  1Q5W B;  4MDK E;  2MP2 B;  5AZF A;  4MJS A;  3OLM D;  2MBB B;  3UIO B;  5J18 A;  4JGH B;  4BKG A;  1V81 A;  3K9O B;  4II3 B;  4LDT D;  5TR5 A;  1S3S G;  5E6O A;  4W9I A;  4EZJ A;  3TIX A;  1KLV A;  1WR1 A;  4M0W B;  1P1A A;  2HJ8 A;  3AI5 A;  3KW5 B;  1VD2 A;  1GC6 A;  2BYF A;  4W9K A;  2LRU A;  2PPH A;  5DCN A;  2MW5 A;  4GIV A;  3IHP C;  4EOY A;  2BPS A;  3A1Q A;  3DVN V;  3R7R A;  4DK5 A;  1YX6 B;  2CHZ A;  2KWU B;  2XEW A;  3QAR A;  1U4A A;  3JSV A;  1L2N A;  2NR2 A;  2OOB B;  3CSF A;  2KDI A;  3H7P A;  4F7Z A;  5L83 A;  1KOT A;  1WGY A;  2D3G A;  3H6N A;  4G11 A;  4XC2 A;  2L0T A;  3B0A A;  1E7V A;  3IVF A;  3ZW3 A;  2HE7 A;  2KK8 A;  2MP2 A;  2MX2 A;  3IG3 A;  3RD2 A;  4FN2 A;  3RYT A;  2KTR B;  2O6V D;  3UGB B;  3Q3J A;  2VRR B;  3X23 A;  2ZVN A;  4ANW A;  4BOZ B;  3RZF A;  5GMV A;  2CS4 A;  1GJZ A;  4X57 B;  4MEM A;  4MGI E;  3DCG A;  2UYZ B;  3PT2 B;  4EZL A;  3TBL D;  1L7Y A;  4HPM B;  1WE7 A;  2KWC A;  3L17 A;  4MSQ B;  2AEH A;  5DPT A;  4URK A;  2O6V A;  3HM6 X;  4GSW A;  2LWP A;  3P2B A;  4AJW A;  5DPW A;  2N7D A;  4XX5 A;  1I35 A;  1M94 A;  3L08 A;  3U8Z A;  1E8Y A;  2KVR A;  3KUC B;  4N9F 4;  2RGF A;  3Q3F A;  2WX1 A;  3PLU A;  4B6W A;  3RUI B;  4ASW C;  4GN1 A;  2NS5 A;  4ZRI A;  2J0K A;  4A20 A;  3OJ3 A;  3VH4 B;  2DEN B;  2IYD B;  2Z0E B;  3DBH I;  4WJP A;  4A3O A;  4DHJ D;  3A4S C;  2KJR A;  2KTR A;  2KLC A;  4PS8 A;  3LJ3 A;  2O2V B;  2WX0 A;  3M62 B;  4I6N B;  3R7Q A;  3WAO A;  5FR6 A;  3UQB A;  3NY5 A;  1E8W A;  4FAD A;  5LXH A;  4HDQ A;  2I1K A;  2LGD A;  3PS6 A;  3U30 A;  4AWJ A;  4CO7 A;  2DYO A;  1EF1 A;  4E71 A;  2LD9 A;  5BO4 B;  2KC1 A;  4IUM B;  2LXA A;  2LJ5 A;  2K6D B;  1V6E A;  4ANX A;  2FUH B;  3PVL A;  3VDZ A;  4IM0 A;  2KFK A;  5JHB A;  2DZK A;  4HPL B;  4HJK A;  4LJP B;  2ASQ A;  4KZ0 A;  2PEA A;  3JVZ X;  3W1S A;  2ZPN A;  2JWZ A;  2ZCC A;  2CHX A;  4FJV B;  4MGZ E;  1CMX B;  2K25 A;  4HDO A;  4W9D A;  3R3M A;  4EEW A;  1WX7 A;  3DPD A;  2C5L C;  3IFW B;  4IG7 B;  1WH3 A;  2I1J A;  1ZW7 A;  4GGQ A;  1V80 A;  2C7N B;  2IO0 B;  2MLB A;  2NVU I;  4YL8 A;  2IY0 B;  4MGK E;  1ISN A;  4KVG B;  3W1S C;  1V5O A;  4WWO A;  3GZN I;  5D7G A;  4HWI B;  1WJU A;  2B3A A;  1ZGU B;  1S1Q B;  3QCA A;  1TBE A;  3VXW A;  2KHW B;  1OEY A;  3O65 B;  3QA8 A;  1WX8 A;  1HE8 A;  5DPR A;  3B08 A;  3PHW B;  1OQY A;  2C60 A;  1WJ6 A;  3K9P B;  2DAJ A;  2FNJ B;  2D07 B;  3HM3 A;  4FJZ A;  2JZZ A;  1WE6 A;  3ZKJ C;  1GC7 A;  3RUL A;  3APD A;  3ONS A;  4EKU A;  4MGY E;  4MJS B;  4WWN A;  2OJR A;  2R2O A;  1WGD A;  3NS8 A;  2JRH A;  3CST A;  3EEC A;  5CHF A;  2N1V A;  3MJW A;  1WMH A;  2KTF A;  3AU4 A;  3V6E B;  3PGE A;  4KSK C;  3BY4 B;  2FCQ A;  1OEY J;  3ECI A;  2DAF A;  2LUE A;  2KFK B;  3PPA A;  5D94 A;  3A9J A;  1Q1O A;  1J19 A;  3EFU A;  3PHX B;  4PYU A;  3WAP A;  4MSM B;  3ZO5 B;  3ZNG C;  1E7U A;  2EMS A;  4K7W A;  1E5W A;  2BYV E;  3ZRC A;  2M17 A;  1WIA A;  2D2Q A;  3EC8 A;  3A1Q B;  2LAS A;  4KDL B;  4TV3 A;  2YVC A;  2KN5 A;  4G0N B;  3KH0 A;  2G3Q B;  3L16 A;  4FLH A;  1Q0W B;  4KZC A;  2KC2 A;  2Z0D B;  4WJQ A;  4AOF A;  4BKT A;  1J0G A;  5LLI A;  4NPN A;  4EFO A;  2CR5 A;  4CHK A;  1WZ3 A;  4PS3 A;  4MH0 E;  4NY0 A;  5DPS A;  2NPT A;  2LVP A;  2RPQ A;  2KQ7 A;  2QHO A;  4AP4 C;  4K1R B;  2DZM A;  2KLG A;  1YQB A;  1SGH A;  1KJT A;  3IBE A;  1GG3 A;  3M95 A;  1WM3 A;  3S2A A;  2EKE C;  1WX9 A;  4EZK A;  3VVW B;  2N9E B;  3TCA A;  3UIP B;  2BF8 B;  5C23 A;  3NZS A;  2N4F A;  4RM9 A;  3JYU A;  3SD5 A;  1UZX B;  2HTH A;  3UIN B;  5L95 C;  3PRP B;  5JZE B;  2BKR B;  3UQA A;  1GUA B;  1K8R B;  2GMI C;  2L76 A;  2EMT A;  1OGW A;  2MA9 B;  3M3J A;  2K8C A;  1WZ0 A;  2O6V B;  4ZRK A;  1GNU A;  1P9D U;  1JRU A;  3DVG X;  2HD5 B;  3ZVV A;  1H8C A;  5AZH A;  3VUX A;  1D3Z A;  1V86 A;  3WAM A;  2PE9 A;  3T8M A;  1LQB A;  4IC7 B;  3DBR I;  1WR6 E;  4AUQ C;  4MEL A;  2DYB A;  3U7D A;  3H9D A;  3VTU A;  2ZNV C;  4IM3 A;  1OTR B;  2C7M B;  1WM2 A;  4M8M A;  4AJY B;  1NDD A;  1NI2 A;  5AZG A;  4LCD E;  1RRB A;  2KAN A;  1IPG A;  3CMM B;  4ICU A;  3T9L A;  5IAA C;  2A5U A;  2MRP A;  4FHK A;  3QHT A;  4J6I A;  3MHS D;  3WAL A;  1KM7 A;  3VTV A;  1BT0 A;  4ANU A;  4WQO B;  4XZ4 A;  2M4N A;  3QK0 A;  3OJ4 B;  1WXV A;  2BWE S;  2V3S A;  3NOB A;  4TUU A;  5E6P A;  4NQK E;  4LDT B;  2MQJ A;  3PRZ A;  4NQL B;  5G2N A;  2BWF A;  2G45 B;  2MCN B;  3ENE A;  4JIO U;  4NAW B;  2C7H A;  3ZDT A;  2NPT B;  3ZRF A;  4GDK A;  2ZNV B;  2N1W A;  2GBR A;  2W9N A;  4FHJ A;  3PZD A;  4W9E A;  3QC8 B;  4TQ1 A;  4W9G A;  2REX A;  1R4N I;  4BVU C;  2CKH B;  2NCN A;  3HK0 A;  3ML9 A;  2GBJ A;  5CHW A;  2WDT B;  2XK5 A;  2D11 A;  4TQ0 A;  5KHQ A;  5LXI B;  2R2Q A;  3QAQ A;  3DVN U;  3DVG Y;  3A9J B;  4JL9 A;  3PRM B;  3PRE A;  1V49 A;  1XQQ A;  1IYF A;  3DBS A;  1AAR A;  2AL6 A;  2KD0 A;  3N30 A;  2RD0 A;  1UD7 A;  2BGF A;  2K1F A;  2MBH A;  2YLM A;  2V1Y A;  3OAW A;  4WWP A;  2NBW B;  1WGH A;  2L8J A;  1WI0 A;  3AU5 A;  4GU2 A;  1RAX A;  4WAA A;  2PE6 B;  3QWZ B;  2KFJ A;  4HK2 A;  4K7S A;  4E3C A;  2PJH A;  3QQ8 B;  4P7I A;  1C1Y B;  4IM2 A;  3W1Y A;  4DBG A;  2KDE B;  1TGZ B;  4II2 B;  1WXS A;  2AYO B;  2KKC A;  2O2V A;  3DBL I;  4ZYN A;  4BKS D;  1VCB A;  3ZNI D;  3PSE B;  2FCS A;  5D2M B;  1UBQ A;  2IO1 B;  2LXC A;  3ALB A;  1SIF A;  3I3T B;  2K8H A;  3R66 C;  3HHM A;  4HXD A;  3GOE A;  3ZUN A;  3A9K B;  1F9J A;  3N32 A;  2K6Q A;  5D6J B;  2JPH A;  1UEL A;  4W9J A;  3QIJ A;  4GOC A;  2JY6 A;  4HLE A;  2L0F A;  1UH6 A;  2LGX A;  3ZTD A;  2GBM A;  3JW0 X;  2AL3 A;  4DHJ B;  2D10 A;  3VHT C;  2CU1 A;  4KSL C;  3V62 A;  2KJH B;  3MTN B;  3AUL A;  4A3P A;  1PQS A;  4KIK A;  3DOW A;  3L0W B;  1Y8R C;  4G50 A;  4DWF A;  2KMC A;  4K81 A;  4W9H A;  4W9F A;  3VFK A;  2G4S A;  4LJO B;  4BBN F;  5HKH A;  3APC A;  5J2R A;  4W9C A;  3C0R B;  1X1M A;  4B9K A;  4BBN C;  4IWQ A;  3LDZ E;  3SDL C;  2G4D B;  2GOW A;  3TJP A;  4IWO A;  4NAW A;  1XT9 B;  3A4R A;  1ZKH A;  1EUV B;  2KOX A;  4IW0 A;  1RLF A;  4ZDV A;  5EDS A;  3N3K B;  4JQW C;  2JT4 B;  1YD8 U;  1A5R A;  3D32 A;  3QX1 A;  4KV2 A;  2L7R A;  3A33 B;  1Z5S B;  1P3Q U;  3TMP B;  4KDI C;  2LZ6 A;  2DHZ A;  3CF6 E;  2KMA A;  2FIF A;  2N9X A;  1E90 A;  4NJ7 A;  2A4Z A;  5G55 A;  3VUY A;  4F8C B;  3NZU A;  3ZLZ A;  2JVC A;  4WJO A;  1TZ1 A;  2AWT A;  1V9J A;  2ZVO A;  5JH5 C;  3UF8 A;  5CHV C;  3H7S A;  2GBN A;  3VH3 B;  2M8S A;  3DDC B;  3ZNZ B;  3KYC D;  3EHV A;  1WRD B;  1E8X A;  2KZR A;  2KX0 A;  4DHZ E;  2M1M A;  1YX5 B;  5E6N A;  3APF A;  4GMV A;  4G3X B;  2J0M A;  2LVQ A;  1Z2M A;  2N7E A;  2MWS B;  4DDI D;  3VTW A;  4NJ6 A;  4ZRJ A;  3RCZ A;  4OVV A;  4W9L A;  1YJ1 A;  2BKF A;  1NBF C;  5J17 A;  1YIW A;  2K39 A;  2XBB C;  2CHW A;  2ZJD A;  4RMA A;  1WXA A;  1FXT B;  3AXC A;  2BYE A;  4ICV A;  2L3Z A;  4KIK B;  1R4M I;  3WIM A;  1P0R A;  4GDL B;  5AEK B;  1IP9 A;  3L54 A;  1EO6 A;  5IA7 A;  1WJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...