2G4SA

Anomalous substructure of nbr1pb1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
AMEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Next to BRCA1 gene 1 protein
total genus 24
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2g4sA01
4K7SA 2MBOA 4NQKE 1WF9A 1YX5B 4W9LA 3RCZA 3A33B 2FUHB 2JUOA 4FN2A 1C1YB 2MSED 3NS8A 4DHZE 3B1LX 2LUEA 2LXAA 2ZPYA 2K6QA 3H7PA 1WH3A 4ANUA 1L7YA 2LWPA 4DDGD 2V1YA 4RM9A 3AU5A 2FAZA 3M63B 3DVGX 3VAWA 3T8MA 1P98A 1Q0WB 3ENEA 2C7MB 2KFKA 5E6NA 3RZFA 3AU4A 5LXHA 4KZ0A 4LDTD 2LVQA 2N9EB 2KVRA 2LGXA 2KANA 3KW5B 4G11A 5LLIA 1F9JA 4FBJB 1VD2A 2D3GA 2N7DA 2KQSA 3HIZA 2KTRB 2KLCA 1WXVA 4NNJB 3L54A 1NI2A 1E5WA 2KWVB 4BKSD 3ZDMC 4WWNA 2FIDA 2HD5B 4FADA 4NAWB 2MQJA 1GC6A 4BBNC 3DVGY 1WXAA 5JHBA 3APCA 5AZFA 1A5RA 2UWQA 3I3TB 3A4SC 4MELA 4XZ4A 4NY0A 3PT2B 5D2MB 4AJYB 2CS4A 4LDTB 3EFUA 4KZCA 2KO3A 3W1SA 3X23A 3LDZE 2I1KA 4CHKA 3OJ3A 1P9DU 4FHJA 5IA7A 1NBFC 3WAPA 4HLEA 2KFKB 4G0NB 3ALBA 3PHWB 4MM3A 4GSWA 3R7QA 5DPRA 4WWPA 2DZIA 3V6CB 2KKCA 4GDKA 1T0YA 1TGZB 2KXJA 2K6DB 4RMAA 1ZW7A 4WQOB 2LRWA 3UF8A 4NAWA 3OJ4B 1H8CA 3K9PB 4K7UA 3L0WB 2PE6B 2BGFA 4TUUA 1E8ZA 4GB9A 1WX7A 3ZRCA 3QAQA 2ZNVC 4AJWA 2DAJA 2V3SA 3H7SA 3QCAA 4TV3A 2GBKA 3N30A 3UIPB 4F7ZA 3DCGA 1V81A 3KYCD 5KHQA 1M94A 1Z5SB 3QC8B 4PYUA 1UD7A 2K25A 2IZVB 3PPAA 1RFAA 4AUQC 3ZLZA 4HDQA 5E6PA 2NR2A 1WYWB 2BWFA 3H6NA 3SD5A 2YLMA 1YQBA 4GDKB 2IY1B 2LRUA 2QHOA 4TQ1A 4N9F4 5GMVA 2UYZB 1WX8A 1WXMA 1V86A 2LJ5A 2AEHA 1UGMA 2KDBA 3ZNGC 3IG3A 2LZ6A 4IWOA 1RAXA 2WX0A 1ISNA 3KH0A 4K81A 3M62B 2DYBA 2M1MA 1BT0A 2KJRA 1X1MA 1V2YA 1ZGUB 2KTFA 3DBRI 3U8ZA 2MBQA 4MGYE 1SGHA 2LGYA 4E3CA 2CHXA 3ONSA 2G45B 3Q3FA 4FJVB 4MJSB 2Z59B 4A3OA 4EZKA 5L83A 4HK2A 4BBNF 2MP2A 2N4FA 4II2B 2NCNA 3PRZA 1HE8A 5D6JB 3R3MA 3T9LA 1WGHA 4YL8A 2L0TA 3APFA 4GMVA 2I1JA 1GC7A 3DBHI 3O65B 1E8XA 2DZMA 5CTRC 4ZRKA 2WYQA 3A9KA 5DPWA 4DHZB 1KJTA 4HDOA 3H7PB 4DHJB 2O2VB 2KHWB 1P1AA 2RSUA 1C3TA 3A9JA 3U30A 4EOYA 4ASWC 3WANA 2K8CA 1WRDB 4HPLB 1WI0A 4IW0A 1EF1A 2WWZA 2Y5BB 2ZNVB 3VH4B 4EUTA 5EDSA 4GU2A 1U4AA 1P3QU 1SIFA 2C7HA 3QQ8B 4RM8A 3VTVA 2KZRA 5JZEB 4GDLA 4FA6A 4KSKC 5AZGA 1S3SG 2XEWA 4W9FA 5C23A 2CHWA 1YIWA 3M95A 2J0KA 1UBQA 2ZZPB 2IO2B 4KIKA 5CHVC 3QHTA 2KMAA 4WAAA 3RD2A 3VH3B 3VVWB 3WA0A 4FLHA 2MA9B 1WR6E 2IY0B 3N3KB 4AP4C 1WR1A 4MH0E 4ZRIA 3JYUA 1I35A 1G6JA 1GUAB 2KD0A 1P0RA 1OTRB 2J0JA 2KMCA 2RGFA 3W1SC 1GG3A 3JW0X 3ZNHB 3DQVA 3ML8A 2C7NB 2IO1B 1UBIA 1WMHA 3VQIA 2KC2A 2JVCA 3WALA 5C1ZA 1YX6B 3V6EB 3WIMA 4GDLB 1YJ1A 4WJNA 4AWJA 2KN5A 2V4LA 3DVNU 3NZSA 3ZRFA 3KUZA 2EMSA 2ZJDA 3PLVA 1WGDA 4P7IA 3GOEA 3ZIMA 3AI5A 2JF5A 5L95C 2A5UA 4X57B 1EF5A 1EO6A 4URKA 1MG8A 2LD9A 3QK0A 4IWPA 1WE6A 3NZUA 5D7GA 3KVFB 4KSLC 3DOWA 2WX1A 2EKEC 4IM2A 1V9JA 2KJ6A 3PTFC 1R4MI 1TZ1A 2M17A 4A20A 1QZEA 1ZKHA 2M8SA 3RYTA 2N7EA 4ANWA 2NPTA 4AOFA 3C0RB 4PS7A 2N9XA 1UZXB 2HJ8A 2O6VB 3PVLA 4F8CB 1H4RA 2LI5A 2IO0B 3M3JA 2XK5A 4W9KA 1J19A 5DPSA 3S2AA 2JT4B 2K8BA 3HM3A 2ZVNA 2HE7A 3PV1A 3QJZA 3H9DA 5JH5C 1L2NA 1OQYA 2LASA 3L08A 2KK8A 3B0AA 3X0WA 3L16A 5DPTA 3R7RA 4XX5A 3ZNID 1WM3A 4I6NB 1OGWA 3RT3B 2MCNB 4K7WA 3ML9A 4NPNA 1I42A 1XT9B 4DXAB 4EZJA 4FHKA 1YD8U 2NPTB 2AL6A 1WGRA 2AWTA 2DYOA 2OJRA 2MLBA 3V60A 4W9EA 1LQBA 2ZEQA 3PSEB 3RZWC 2ASQA 3IFWB 1J8CA 4M0WB 4WJOA 3QWZB 2REXA 5J17A 1S1QB 2MBEA 3QARA 1E8WA 4IM3A 2R2OA 4G50A 2W9NA 1UELA 1WY8A 2ZCBA 5J18A 3SDLC 2DYMA 3L13A 3BY4B 5DCNA 3MJWA 2JPHA 4PS3A 2A4ZA 3VHTC 2KWUB 1PQSA 2GBJA 2OOBB 4CO7A 1WJNA 2VRRB 5IAAC 4FJYA 3OLMD 4GIVA 2BYFA 2RD0A 2KNBA 3CMMB 3R66C 1KOTA 1Q5WB 1WZ0A 1XQQA 2MRPA 3BINA 3A1QB 3AXCA 3UINB 4LJOB 3SU8X 2D11A 4FJZA 2PJHA 4ZYNA 4KIKB 3UQBA 1V5OA 2LVOA 2C5LC 4BFRA 1WJ4A 3RUIB 3NOBA 1Y8RC 4OVUA 4JL9A 4KV2A 4KDLB 2C9WB 3UIOB 1LFDA 1Q1OA 2PPHA 3APDA 3QIJA 3VTWA 2N9PC 2GBMA 4E71A 3WAOA 2BYEA 4M8NA 4EZLA 1WMHB 2ZPNA 4B9KA 2GOWA 1J0GA 3UGBB 2KLGA 2L3ZA 3KUCB 2JY6A 3K9OB 3PREA 4ZRJA 3VTUA 2MX2A 2MBBB 2J7QB 1Z2MA 1VCBA 3VFKA 3HK0A 3OAWA 5AZHA 4TQ0A 4MSQB 3DPDA 3VXWA 4W9CA 4W9DA 1K8RB 2JZZA 3PHXB 3ZW3A 2JRHA 3JSVB 4JGHB 1KLVA 3QX1A 1E90A 4PS8A 4HXDA 2BKFA 4DBGA 2DX5B 3A4RA 1RLFA 3VUYA 2G4SA 4DK5A 2GBNA 4HCPB 1EUVB 2LGDA 3JVZX 4TKNA 3PRMB 2D2QA 2NS5A 5HKHA 2XBBC 4E74A 1WE7A 1WX9A 4PYZA 3PLUA 2KWCA 4MDKE 5CHWA 3VUXA 2L05A 4NQLB 1TBEA 2Z0DB 3MHSD 3PZDA 4W9HA 5JHAA 2BWES 1WM2A 2B3AA 1WJ6A 2M4NA 4MJSA 3JSVA 4HWIB 2BYVE 4IC7B 3LJ3A 4BKGA 2G3QB 2JXXA 2MP2B 5G55A 3ZKJC 2DZKA 3NHEB 3UQAA 3DDCB 4A3PA 5LXIB 1NDDA 4KVGB 4LJPB 4ZDVA 3TL5A 4MSMB 4JIOU 2FCNA 1AARA 4WJQA 1IPGA 2DAFA 5CHFA 2KQ7A 4II3B 4J6IA 4XC2A 3ZTCA 3TCAA 2IBIB 3IHPC 2AL3A 2D10A 1LXDA 1R4NI 2IYDB 3NY5A 4W9GA 2IO3B 4G3XB 3CF6E 3RULA 2ZCCA 4IG7B 2JZ3B 1IYFA 3B08A 3ZNZB 5FR6A 5AEKB 4DHJD 4B6WA 3EECA 2L00B 2Z0EB 3U7DA 3V62A 4EKUA 2FNJB 4ANVA 1V80A 2LVPA 4W9IA 3ECIA 4DDID 5G2NA 4F1SA 2NVUI 1JRUA 1LM8B 1WGGA 2KDEB 2N1WA 2PEAA 5BO4B 1SE9A 2AYOB 3TJPA 2L76A 4HVBA 3ZDTA 1UH6A 1RRBA 3A9JB 4BOSC 1WFYA 2KTRA 1GJZA 3DVNV 1WJUA 4ICUA 4MEMA 3A1QA 2L0FA 3Q3JA 2CR5A 2NBVB 4B95A 3AULA 3L10B 4ICVA 3KUDB 3P2BA 2M0XA 2KX3A 3QA8A 2K1FA 2D07B 2EMTA 1D3ZA 2GMIC 4EFOA 1E7UA 1WIAA 5CX3A 4JQWC 3ZUNA 3DBSA 2JWZA 2DZJA 5D94A 3TIXA 2KOXA 2DENB 1FXTB 2CKHB 2BPSA 1E7VA 2KX0A 2KDIA 2PE9A 2KC1A 4IWQA 1E8YA 4HJKA 3EHVA 3DBLI 5E6OA 2C60A 3EC8A 2FCMA 4LCDE 4MGIE 4M8MA 4GN1A 4JLCA 3PS6A 3L17A 4NJ6A 4K1RB 4WWOA 3VDZA 2KFJA 5KHOA 3H1UA 3ZO5B 4BKSA 4IUMB 4MGKE 1V6EA 1KM7A 2NBWB 3SHQA 3D32A 2RR9A 4HPMB 1XD3B 4EEWA 3MTNB 3N32A 2CU1A 2KDFB 3W1YA 1TTNA 4MGZE 1WXSA 2JRIB 4KDIC 4GGQA 2L8JA 5TR5A 3KYDD 2BKRB 3TBLD 3IVFA 1V49A 3VUWA 1WZ3A 3ZTDA 2K8HA 3HM6X 4W9JA 2K39A 2MWSB 4CYEA 2R2QA 4BKTA 2XK5B 4OVVA 2NBUA 2N1VA 4DWFA 2FCQA 2O6VD 2FCSA 3CSFA 4GOCA 2BF8B 4FULA 2L7RA 1GNUA 4IM0A 3PGEA 4WJPA 1IP9A 1OEYJ 3V61A 2WDTB 3WAMA 5J2RA 2KJHB 2G4DB 2J0MA 2HTHA 2O6VA 2LXCA 2CHZA 2GBRA 3IBEA 3HHMA 4GXBA 2MBHA 2DHZA 4I6PA 3ZVVA 3CSTA 4ANXA 2FIFA 4NJ7A 2MW5A 1CMXB 1V5TA 2RPQA 3A9KB 1OEYA 3PRPB 2YVCA 4HCNB 4BOZB 1WGYA 3GZNI 2ZVOA 2O2VA 4I6LB 4BVUC 3TMPB
chains in the Genus database with same CATH superfamily
4W9LA 2JUOA 1C4PA 5BYQA 2MSED 3NS8A 3ETRA 2LXAA 3Q3NC 4ANUA 3AE7B 1RYJA 1DOIA 4RM9A 3AU5A 4ITKA 3RNBC 2KFKA 3DBHB 1V1PB 2LVQA 3KW5B 2LGXA 1T5XD 2N7DA 2KQSA 3AE9B 2KLCA 1NI2A 1E5WA 2BVCA 3I63C 3ZDMC 1HZ5A 2HD5B 1GC6A 2GB1A 5JHBA 3PT2B 4PK1A 2CS4A 1IBXA 4LNOA 3W1SA 2WXQA 3LDZE 1KRHA 1L4ZB 2VH2A 1NBFC 4HLEA 2BS3B 2EELA 2DZIA 3V6CB 4YTPB 2D5GA 1ET6A 4GB9A 2ZNVC 3RNCC 2DAJA 4TV3A 2GBKA 3N30A 4F7ZA 1V81A 1WWTA 3RMKC 5MPOA 2IZVB 4OZAA 3BWUD 3P4PB 4GDKB 2IY1B 3T3OA 2QHOA 1R7SA 4N9F4 1WX8A 2AQ1B 5EE0A 2GLSA 1N61A 3KH0A 2WXJA 1SBBB 2BS4B 1VDVA 3DBRI 2K9XA 4R3DA 3U8ZA 2MBQA 1SGHA 2LGYA 4E3CA 2HJ1A 3ZJTA 1JALA 1I4RA 1PDXA 1F1HA 4QAYA 2PMVA 4II2B 1DOYA 1WGHA 2I1JA 2WYQA 1PYWD 5FR3A 4DHZB 4DHJB 1T3QA 2O2VB 1FNWA 1AWDA 2M0AA 1SE3A 2K8CA 1WRDB 2PVGC 2Y5BB 3VH4B 5EDSA 1C4CA 3URYA 5AZGA 1ZP0B 3Q3OC 4TSSA 2G1EA 3NG0A 2ZZPB 2QC8A 4WAAA 3AMZA 3VVWB 2XN9C 2MA9B 4XE0A 3IAS1 2IY0B 1WR1A 2W82A 1P0RA 3JW0X 1MJDA 1UBIA 3AE1B 5AUKA 3V6EB 1YJ1A 4M02A 4WH4A 2V4LA 1C4AA 5E6JA 2WDQB 2JF5A 2WXNA 1FCCC 4URKA 2LD9A 3QK0A 4IWPA 2K0PA 4WAFA 4BAXA 2PIAA 2JU6X 2WDRB 2EKEC 3Q69A 3RYTA 4ANWA 4PT5A 1FMAD 1FRDA 3PVLA 4HEA1 1CQVA 2LI5A 1JCKB 4HKZE 1HXYD 4HPPA 5DPSA 2JT4B 2K8BA 3BVGA 2HE7A 3QJZA 3RNFC 3B0AA 3L16A 5DPTA 1UF0A 3R7RA 4XX5A 4I6NB 2MCNB 1YJIA 4DXAB 1I4GA 4FHKA 5BYSA 2NPTB 2AL6A 3RZWC 3IFWB 4M0WB 3W2DA 2REXA 5FKAC 4IM3A 2R2OA 1FEHA 5J18A 2KT7A 3BY4B 2HTME 2A4ZA 2OOBB 5IAAC 4B0MA 3R66C 3AXCA 3NVVA 1L6VA 1J7AA 1I4QA 4B0EA 4ZYNA 3UQBA 2WQYB 1WJ4A 1OQRA 3CWIA 2C9WB 3UIOB 2N9PC 2BYEA 3ZJVA 3NVWA 2ZPNA 1N6ZA 4HRSA 1N62A 3UGBB 3VTUA 3EFCA 2J7QB 3BK1A 1MFWA 4LK0M 4MSQB 1I7HA 5BMIA 2JRHA 1C9FA 4WURA 2BKFA 3A4RA 1RLFA 1E6EB 5IN7A 4DK5A 4HCPB 1EUVB 4TKNA 2D2QA 2NS5A 4A90A 4E74A 1WX9A 3NVZA 1A70A 4MDKE 4D2KA 4NQLB 4K3CA 3KWLA 1TYGB 2BWES 2RDGA 3BYYB 2VZKD 2BYVE 3Q8EA 3KQ4A 4BKGA 2G3QB 5G55A 1NYRA 4KVGB 2CJOA 2AQ2B 1IPGA 3Q14C 2KQ7A 4II3B 4XC2A 2MEKA 2IBIB 3IHPC 4W9GA 3VRBB 2L52A 2W3RA 1V80A 1WGKA 5G2NA 3VR8B 4F1SA 1YOVB 2LUMA 1WGGA 4RGOS 4DQOC 3J9CA 2L76A 2J4XA 1RRBA 1C78A 1GJZA 3GP7A 1HA5A 2L0FA 1L0XB 3L10B 3U7ZA 2AQ3B 3KUDB 1T0QC 1XLPA 2M0XA 3RPFC 1D3ZA 4EFOA 1WIAA 1E7UA 3LB8C 3ZUNA 3DBSA 2JWZA 2ONQA 2DENB 3WCQA 3FILB 2L83A 4DXFA 4LCDE 3DWGC 3L17A 2LHDA 4K1RB 3VDZA 2K3UA 2ON8A 2Q5WD 1KM7A 2WXRA 1C76A 4HPMB 1XD3B 2KDFB 3W1YA 3HUIA 1WXSA 4RNAA 2L8JA 1JROA 3TBLD 4NJCA 3I5JC 4W9JA 3AEEB 3N20C 4BKTA 2NBUA 2NMQA 4NAMA 3CSFA 2BF8B 2INNE 1I4XA 4P1CC 4WJPA 1EWYC 3V61A 1XCTL 5J2RA 2J0MA 2HTHA 2O6VA 2LXCA 3IBEA 1ZDVA 4GXBA 2N0SB 4ANXA 3NVYA 2MW5A 2QILA 2YVCA 3GZNI 4K7SA 4NQKE 1RWSA 3RCZA 3ZJUA 4IOIE 4FN2A 1C1YB 4DHZE 1VJKA 1Q10A 5C3JB 1L7YA 2LWPA 2V1YA 4P16A 3ZQ4A 3T8MA 1P98A 1Q0WB 1IGDA 4MT5A 3TUOA 3AU4A 4LDTD 3FC4A 2N9EB 5LLIA 2KANA 4FBJB 1F9JA 2WGSA 2D3GA 2KTRB 2QDFA 4NNJB 3L54A 2KWVB 4BKSD 4WWNA 1ENFA 2QMTA 4FADA 4NAWB 2WXHA 2MQJA 4BBNC 4L1BA 3APCA 4WQMA 1TIFA 2UWQA 1A5RA 5HG2A 4MELA 3EFUA 4JWSC 2KO3A 2I1KA 4CHKA 1SEBD 4FHJA 5IA7A 3PHWB 4LNIA 2WXKA 5DPRA 5GXGB 2KKCA 1JQ4A 3I9V1 2PLPA 3UF8A 1H8CA 4K7UA 4TUUA 2BT6A 1QOGA 1FIQA 1VZ6A 2V3SA 1QOBA 1VLBA 3QCAA 2KQ4X 3UIPB 3DCGA 1PGXA 3KYCD 5KHQA 2RPVA 4HDQA 2NR2A 1EU3A 5IO9A 1YQBA 1JWBD 1CJEA 5GMVA 1NYQA 2KDBA 2LJ5A 1UGMA 3IG3A 1HZ6A 2WX0A 1DYQA 2BTEA 2DYBA 2M1MA 2VZKB 1X1MA 3AH7A 1V2YA 4MGYE 2G45B 3Q3FA 4FJVB 3FAHA 2Z59B 3B2GA 1L4DB 5L83A 2D3CA 2N4FA 4ZRPA 3IT6B 1GB4A 3PRZA 4YL8A 4GMVA 3DBHI 1E8XA 1FNUA 4RF1A 4ZRKA 1IGCA 2E3TA 3A9KA 3H7PB 2KHWB 1C3TA 4EOYA 4ASWC 1WI0A 5H92C 4IW0A 2WWZA 2ZNVB 1U4AA 1P3QU 3AEGB 4RM8A 4FA6A 4KSKC 3HVZA 2XEWA 3ZYYX 3DBRB 5C23A 1YIWA 2IO2B 2L32A 1WR6E 1ACCA 3OG5A 4MH0E 4XWTA 4ZRIA 1I35A 1OTRB 3W1SC 1CK1A 3ZNHB 3DQVA 1DOXA 1WMHA 1YNTE 2JVCA 2Y5CA 1TT5B 3WALA 5C1ZA 2DBYA 1YX6B 4GDLB 4AWJA 1P7EA 3NZSA 3KUZA 2GI9A 3ZIMA 2A5UA 2MJEA 1EO6A 3NZUA 3T3NA 1JWUD 3KVFB 2CJNA 3W5UB 2QIEB 1PUTA 1FM0D 1K51A 1XLNA 1ZKHA 1C79A 2N7EA 4AOFA 1UZXB 3P42A 2XK5A 2L1AA 3H9DA 4RGNA 3MHZA 2MJDA 4NPNA 1D4BA 1WXQA 4WWMA 1YD8U 2K22A 2OJRA 3V60A 4W9EA 1GAQB 3QWZB 4YSXB 5J17A 1FNVA 2D3BA 2M56B 1WSPA 5BMHA 3AB5A 3L13A 1TS3A 3LXFA 3MJWA 2JPHA 4PS3A 2KWUB 1SE2A 1WJNA 4GIVA 2CU3A 2RD0A 1KOTA 1XQQA 4L2YA 4FXCA 3A1QB 4YWGG 3UINB 4LJOB 2KDMA 3B9JA 2LVOA 3DBLB 3RUIB 2SAKA 4RGMA 1Y8RC 1P7FA 2TSSA 1Q1OA 3VTWA 1NENB 4M8NA 1XEEA 4EZLA 4C7YA 2GOWA 1J0GA 2L3ZA 5LNK1 2MBBB 1VCBA 3OAWA 5AZHA 1FD6A 4JX1C 3PHXB 3BVMA 1B1ZA 3JSVB 3RNAC 3TEZA 1KLVA 4XDCA 1E90A 2OJWA 4DBGA 1N5WA 1TKGA 3VUYA 4KKJA 2ICIA 2WP9B 1TS5A 4PYZA 3VUXA 1TBEA 1AN8A 4LNKA 5JHAA 2Z8LA 3V3XA 3AE8B 3IXSA 1WM2A 2FUG1 4HWIB 3RNEC 3U2SC 1NDDA 2RMMA 4LJPB 4ZDVA 2FCNA 1AARA 4MH8A 4J6IA 1BXTA 3ZTCA 2NTTA 2KAJA 1FFUA 1TJEA 1TS4A 3NY5A 1JWSD 1VR9A 3RULA 4IG7B 1IYFA 3NRZA 5AEKB 4B6WA 2L00B 2Z0EB 4Q2JA 3U7DA 2LVPA 2NVUI 2KDEB 2N1WA 2PEAA 5BO4B 3UI3A 1SE9A 1B9RA 3ABVB 3ZDTA 3DVNV 1WJUA 3GE8C 2KACA 4ICUA 4MEMA 3Q3JA 4YTMB 1V97A 4B95A 4RCOA 4ICVA 1FO4A 3P2BA 2QEJC 2KX3A 2K1FA 2D07B 2EMTA 2GMIC 4M00A 2VH1A 3DWMA 1C77A 1FXTB 3ZXRA 2V3PA 2KC1A 1E8YA 2I2YA 5E6OA 2AX5A 1J7CA 4GN1A 1F52A 3H1UA 3ZO5B 2ZW1A 1V6EA 3MFGA 3D32A 2RR9A 2XNAC 3B2FA 4REZA 4N58A 4C4VB 4ZHOA 2JYTA 1RM6C 2M19A 4YSZB 3IVFA 3VUWA 1SJED 4CYEA 2FCQA 2O6VD 1YMHE 1TS2A 2ZW0A 3PGEA 1IP9A 1TY2A 1OEYJ 2WDTB 2KJHB 5IP4D 2CHZA 1OQQA 1VZ8A 2DHZA 1CMXB 1V5TA 1OEYA 3PRPB 4HCNB 3IT4B 2DWQA 2MBOA 1HTOA 3KWVA 4OW0A 2FUHB 1YN4A 3B1LX 1FFVA 4CQNA 2IPKD 2K6QA 3PZ8A 4XYCA 4DDGD 3TEYA 1IBXB 3M63B 3DVGX 3VAWA 1EWCA 3ENEA 2C7MB 2KWDA 5LXHA 4G11A 1VD2A 1UWXA 3HIZA 3RI7C 1WXVA 1SF0A 4N59A 1L5PA 3SR6A 3DVGY 3I3TB 5D2MB 4AJYB 2LGIA 1SIJA 4LDTB 4P1BC 1YN5A 4KZCA 3X23A 3P63A 2WHIA 1YQ4B 4BZAA 2KFKB 4G0NB 1F2RC 3R7QA 4MM3A 4GSWA 4GDKA 1T0YA 1TGZB 1N60A 2KXJA 4RMAA 4JPSA 2D3AA 4WQOB 2LRWA 3OJ4B 2BGFA 3ZRCA 1E8ZA 4AJWA 3H7SA 1JW9D 4KGTA 3SFEB 2JZPA 1Z5SB 4PYUA 2V0GA 1UD7A 2JSVX 2K25A 2FE8A 4AUQC 1RFAA 1JWMD 3H6NA 2YLMA 3R8BA 4K3BA 4TQ1A 4AS1A 1M4VA 2UYZB 1WXMA 1V86A 2AEHA 1PGBA 2LZ6A 5HI1A 4KGRA 1ISNA 1BT0A 2KJRA 3P1MA 3MP9A 1ZGUB 4YSYB 3ONSA 4MJSB 4EZKA 4A3OA 4HK2A 2MP2A 2NTSA 2NCNA 3R3MA 3T9LA 3C8YA 3APFA 3E56A 3O65B 1GC7A 3HRDD 2DZMA 5CTRC 4GLSC 1HQRD 1KJTA 4HDOA 2RSUA 2J52A 3P4SB 3L4PA 3WANA 4HPLB 1EF1A 4EUTA 2C7HA 3VTVA 5JZEB 4C7ZA 1ZXHA 1TKEA 5C2TB 1HTQA 2CHWA 3VRAB 1UBQA 1XF5L 1UUPA 3VH3B 3QHTA 2KMAA 3WA0A 4LLGM 4AP4C 3O13A 3JYUA 4AQ7A 2KD0A 2J0JA 4NZLB 2KMCA 1QLBB 2WXIA 1GG3A 2IO1B 1RFKA 2B76B 4WJNA 2LEKA 2KN5A 3ZXVA 3DVNU 3ZGZA 3ZRFA 2ZJDA 3PLVA 4P7IA 3GOEA 5L95C 1PGAA 4X57B 1EF5A 1WE6A 4L23A 2WXGA 4KSLC 4YT0B 2J42A 2KJ6A 3PTFC 1R4MI 1TZ1A 1WYGA 1L6UA 1QZEA 4A20A 2NPTA 3C0RB 2N9XA 3Q8CA 2O6VB 4F8CB 2LMCA 2SEBD 2LHEA 1J19A 2WS3B 3HM3A 3NZ3A 5JH5C 4JE3B 1L2NA 2WXFA 3L08A 4TMAB 3X0WA 3AE6B 3ZNID 1WM3A 4K7WA 3ML9A 4N6EB 4EZJA 4M01A 2DYOA 1MPEA 2MLBA 4ARCA 2R61A 4WJOA 4WIPA 1S1QB 1MHXA 3QARA 5HFYA 1WY8A 2ZCBA 4C80A 2JWUA 2DYMA 5DCNA 3P4RB 1STEA 2GBJA 4XDDA 2VRRB 4FJYA 3OLMD 2KNBA 3CMMB 4ARIA 1WZ0A 2MRPA 3BINA 1V1PA 5AUIA 3SU8X 3I57A 2D11A 2PJHA 1D5ZC 2BS2B 1V5OA 1K50A 1V1OA 4JL9A 2INDC 4KDLB 1LFDA 2PPHA 3QIJA 4E71A 2GBMA 2JYEA 3WAOA 4ACFA 2X8XX 3AE5B 2KLGA 5TSSA 5IOIA 3KUCB 2JY6A 3K9OB 4ZRJA 2FBWB 1Z2MA 1UWMA 1Y56A 1I4PA 2QJLA 4TQ0A 1IUEA 3VXWA 4W9DA 1D6EC 1K8RB 1E10A 2BBCA 4JGHB 4PS8A 2DX5B 2G4SA 1ESFA 2J53A 3Q6BA 1E0ZA 2GBNA 3JVZX 4ZRQA 4US8A 2XBBC 2EKIA 3PLUA 2KWCA 5CHWA 2I38A 1SXTA 3PZDA 4W9HA 1YN3A 5EE9A 2M4NA 2W55A 4XGAB 4IC7B 4A9AA 2IGDA 3UQAA 2DZKA 3NHEB 3DDCB 4A3PA 4HKQA 3TL5A 1ZOYB 4JIOU 4WJQA 2DAFA 3TCAA 1HEZE 2DNFA 2AL3A 2D10A 3EA6A 3DHGC 2IO3B 4G3XB 4M0WA 2ZCCA 2JZ3B 3AM9A 4LNFA 5FR6A 4EKUA 3V62A 3SFDB 1DGJA 4ANVA 4DDID 1OFFA 1PFDA 2AYOB 3FILA 2IDYA 3TJPA 4C56C 1UH6A 1WFYA 2KTRA 3OWEB 1VZ7A 1T0RC 3NS1A 2V9HA 4P6VF 3QA8A 1R4MB 3R2TA 3MC0B 1R4NB 4YXDB 2INPE 2KDIA 2PE9A 4IWQA 2IGHA 4HJKA 3EHVA 3DBLI 2C60A 4IDIA 4S17A 4M8MA 4JLCA 2KFJA 4LNNA 3Q8BA 4BKSA 2NBWB 4RF0A 4EEWA 1MI0A 3C19A 3MTNB 3N32A 1TTNA 4A55A 1KFYB 4MGZE 1QILA 4KDIC 3KYDD 2LGSA 3TEXA 1WZ3A 3ZTDA 2K8HA 3HM6X 2K39A 1KF6B 2XK5B 4UDUC 2FCSA 2G9HD 2GRIA 3P4QB 4JWUC 2V3NA 5IKCM 3WAMA 4A6QA 2G4DB 3AV8A 1D5XC 2GBRA 3VR9B 1XO3A 2MBHA 3ZVVA 3CSTA 4BOZB 1WGYA 2ZVOA 4W9KA 2O2VA 1QKZA 4I6LB 3IAM1 1WF9A 1QOAA 1YX5B 2WXOA 1ZUD2 3A33B 1JRPA 3EGRA 2N9KA 3EUB2 3CIRB 2LUEA 2ZPYA 3H7PA 1WH3A 4S0RA 3BK2A 2JX5A 1EU4A 2PW9A 2FAZA 1BUIC 3TSSA 2QSDA 5E6NA 3RZFA 4KZ0A 1MG4A 2KVRA 3HVDA 2H88B 1F2RI 2FIDA 1ZXIA 1F77A 1NVID 1WXAA 3AECB 5AZFA 3PO0A 3A4SC 4XZ4A 4NY0A 3LYYA 1GPXA 3RN9C 2X38A 1L0VB 3OJ3A 1P9DU 3WAPA 1K52A 3ALBA 1XLQA 2YEPF 4WWPA 1FXIA 3KLSX 5G5GA 2K6DB 2IJ0A 1ZW7A 2MH7A 3AE2B 4NAWA 3GE3C 2PVOD 3K9PB 3L0WB 3BYTB 4H2AA 2PE6B 1WX7A 3QAQA 3GS2A 1ROEA 5FK9C 1M94A 3QC8B 3PPAA 4YTNB 3ZLZA 5E6PA 1WYWB 2BWFA 3SD5A 1XXGA 2LRUA 3ZNGC 2LFIA 1XCQL 4IWOA 1RAXA 4K81A 3M62B 1GOZA 4A8XC 1AYFA 1UNSA 1FRRA 2KTFA 3TEWA 2KN4A 2BYTA 2CHXA 1ZPSA 4BBNF 1HE8A 1T0SC 1J7BA 5D6JB 1KLUD 5EE3A 2MHJA 2L0TA 2KYWA 5DPWA 2QCZA 1P1AA 2W3SA 3A9JA 3U30A 1LGRA 4GU2A 1SIFA 3QQ8B 1FXAA 2KZRA 1ZDXA 4GDLA 3GB1A 4OZCA 1S3SG 4W9FA 3BVZA 2J0KA 1FPYA 3M95A 4USAA 3N1YC 4KIKA 5CHVC 3RD2A 4FLHA 5BMGA 3N3KB 2YEPB 1NI3A 3NUHB 3H8HA 1QQRA 1G6JA 1GUAB 2RGFA 2WNMA 3ML8A 2C7NB 2JXTA 3VQIA 2KC2A 2RDBC 3WIMA 1TKYA 3AN1A 2BQQA 4KX6B 2EMSA 1WGDA 3AI5A 3AEDB 4C4VA 1KLGD 1NEKB 1MG8A 4RGTA 3RFZB 5D7GA 1E9MA 3DOWA 2WX1A 4IM2A 1V9JA 2M17A 1VRAB 2M8SA 4PS7A 5H8YE 1FCLA 2HJ8A 3SEBA 1H4RA 1WRIA 3V05A 3Q8FA 2IO0B 3M3JA 2Y5PA 4XWWA 3FKYA 3S2AA 2OHFA 3N9YC 1UGJA 2ZVNA 3E9SA 3PV1A 1KH0A 1OQYA 2LASA 2KK8A 4C00A 2W54A 1V8CA 1OGWA 4EE2A 3RT3B 1L0YB 1I42A 1XT9B 4MACA 2WXMA 2AWTA 1WGRA 2BW2A 3DHIC 4RFBA 1LQBA 1TY0A 2ZEQA 3PSEB 2ASQA 1J8CA 3MC8A 2PTLA 3DHHC 2MBEA 1E8WA 2H89B 4G50A 1QOFA 2W9NA 1UELA 4OVZA 3SDLC 1EM7A 3W5VB 2KVZA 3VHTC 4CO7A 1PQSA 2BB5A 2KMMA 5BYRA 4ZYSA 2BYFA 3AE4B 2BB6A 1E7PB 3R2IA 1Q5WB 4ZHPA 3PZ7A 4US9A 1MHHE 3BZDB 5D3IB 4FJZA 4KIKB 1K53A 4LTUA 2C5LC 4BFRA 3NOBA 4OVUA 1AW7A 2UU7A 4KV2A 4RH6A 3APDA 1SSNA 2HDEA 2IGGA 1WMHB 5D3DA 4B9KA 1N63A 4HROA 3PREA 1SB3C 2MX2A 3VFKA 3HK0A 1QF6A 3DPDA 4HJGE 3N1ZC 4W9CA 2JZZA 4KGSA 3ZW3A 2WU5B 1BMLC 3RNGC 3QX1A 4HXDA 2PKOA 5HHDG 2ACZB 1F0ZA 2LGDA 2OEDA 3PRMB 5HKHA 1WE7A 2L05A 3W9CB 2Z0DB 3MHSD 1N5XA 2B3AA 1WJ6A 4O1NA 4MJSA 3JSVA 1KTKA 3MC9A 3Q8AA 2E6XA 2Y3AA 3LJ3A 2JXXA 2MP2B 2RDHA 3Q2AC 3ZKJC 5LXIB 4MSMB 1TZOA 5CHFA 1LXDA 1R4NI 2IYDB 4KKIA 2K5PA 3N1XC 2DLBA 1QT9A 3CF6E 1ZE3D 3B08A 3ZNZB 1YJJA 4DHJD 2N7JA 3EECA 2FNJB 3U4EG 3AEBB 4W9IA 3ECIA 1JRUA 1LM8B 5JXVA 3BIID 4HVBA 1ET9A 3A9JB 4BOSC 1XLOA 2MJ3A 2WDVB 1MVKA 3A1QA 2CR5A 2NBVB 1SE4A 3AULA 2WLBA 5T8IA 5CX3A 3U52E 4JQWC 2DZJA 2JQRB 5D94A 3TIXA 2KOXA 2WXLA 2CKHB 5G5HA 3AEFB 2BPSA 1E7VA 4MM3B 2KX0A 1D5MC 1T6BX 4OZBA 3EC8A 2FCMA 4MGIE 3PS6A 4NJ6A 4WWOA 5KHOA 2WXPA 2V4IB 2LJIA 4IUMB 4MGKE 1JMLA 3SHQA 4DXGA 1CZPA 3GZNB 2CU1A 1GB1A 2JRIB 4GGQA 5EE1A 5TR5A 1LO5D 2BKRB 1V49A 3MJ5A 4ZOHC 2INCC 2MWSB 2R2QA 4DWFA 4OVVA 1YQ3B 2N1VA 4GOCA 4FULA 2L7RA 1GNUA 4IM0A 3AEAB 4OHJA 1JWAD 5I4DA 1SJHD 3HHMA 2N9LA 4IKGA 3Q3MC 4I6PA 2FIFA 3AE3B 4NJ7A 2RPQA 2WU2B 3A9KB 3NJTA 1I4HA 4J3OD 4BVUC 3TMPB
chains in the Genus database with same CATH topology
4K7SA 2MBOA 4NQKE 1WF9A 1YX5B 4W9LA 3RCZA 3A33B 2FUHB 2JUOA 4FN2A 1C1YB 2MSED 3NS8A 4DHZE 3B1LX 2LUEA 2LXAA 2ZPYA 2K6QA 3H7PA 1WH3A 4ANUA 1L7YA 2LWPA 4DDGD 2V1YA 4RM9A 3AU5A 2FAZA 3M63B 3DVGX 3VAWA 3T8MA 1P98A 1Q0WB 3ENEA 2C7MB 2KFKA 5E6NA 3RZFA 3AU4A 5LXHA 4KZ0A 4LDTD 2LVQA 2N9EB 2KVRA 2LGXA 2KANA 3KW5B 4G11A 5LLIA 1F9JA 4FBJB 1VD2A 2D3GA 2N7DA 2KQSA 3HIZA 2KTRB 2KLCA 1WXVA 4NNJB 3L54A 1NI2A 1E5WA 2KWVB 4BKSD 3ZDMC 4WWNA 2FIDA 2HD5B 4FADA 4NAWB 2MQJA 1GC6A 4BBNC 3DVGY 1WXAA 5JHBA 3APCA 5AZFA 1A5RA 2UWQA 3I3TB 3A4SC 4MELA 4XZ4A 4NY0A 3PT2B 5D2MB 4AJYB 2CS4A 4LDTB 3EFUA 4KZCA 2KO3A 3W1SA 3X23A 3LDZE 2I1KA 4CHKA 3OJ3A 1P9DU 4FHJA 5IA7A 1NBFC 3WAPA 4HLEA 2KFKB 4G0NB 3ALBA 3PHWB 4MM3A 4GSWA 3R7QA 5DPRA 4WWPA 2DZIA 3V6CB 2KKCA 4GDKA 1T0YA 1TGZB 2KXJA 2K6DB 4RMAA 1ZW7A 4WQOB 2LRWA 3UF8A 4NAWA 3OJ4B 1H8CA 3K9PB 4K7UA 3L0WB 2PE6B 2BGFA 4TUUA 1E8ZA 4GB9A 1WX7A 3ZRCA 3QAQA 2ZNVC 4AJWA 2DAJA 2V3SA 3H7SA 3QCAA 4TV3A 2GBKA 3N30A 3UIPB 4F7ZA 3DCGA 1V81A 3KYCD 5KHQA 1M94A 1Z5SB 3QC8B 4PYUA 1UD7A 2K25A 2IZVB 3PPAA 1RFAA 4AUQC 3ZLZA 4HDQA 5E6PA 2NR2A 1WYWB 2BWFA 3H6NA 3SD5A 2YLMA 1YQBA 4GDKB 2IY1B 2LRUA 2QHOA 4TQ1A 4N9F4 5GMVA 2UYZB 1WX8A 1WXMA 1V86A 2LJ5A 2AEHA 1UGMA 2KDBA 3ZNGC 3IG3A 2LZ6A 4IWOA 1RAXA 2WX0A 1ISNA 3KH0A 4K81A 3M62B 2DYBA 2M1MA 1BT0A 2KJRA 1X1MA 1V2YA 1ZGUB 2KTFA 3DBRI 3U8ZA 2MBQA 4MGYE 1SGHA 2LGYA 4E3CA 2CHXA 3ONSA 2G45B 3Q3FA 4FJVB 4MJSB 2Z59B 4A3OA 4EZKA 5L83A 4HK2A 4BBNF 2MP2A 2N4FA 4II2B 2NCNA 3PRZA 1HE8A 5D6JB 3R3MA 3T9LA 1WGHA 4YL8A 2L0TA 3APFA 4GMVA 2I1JA 1GC7A 3DBHI 3O65B 1E8XA 2DZMA 5CTRC 4ZRKA 2WYQA 3A9KA 5DPWA 4DHZB 1KJTA 4HDOA 3H7PB 4DHJB 2O2VB 2KHWB 1P1AA 2RSUA 1C3TA 3A9JA 3U30A 4EOYA 4ASWC 3WANA 2K8CA 1WRDB 4HPLB 1WI0A 4IW0A 1EF1A 2WWZA 2Y5BB 2ZNVB 3VH4B 4EUTA 5EDSA 4GU2A 1U4AA 1P3QU 1SIFA 2C7HA 3QQ8B 4RM8A 3VTVA 2KZRA 5JZEB 4GDLA 4FA6A 4KSKC 5AZGA 1S3SG 2XEWA 4W9FA 5C23A 2CHWA 1YIWA 3M95A 2J0KA 1UBQA 2ZZPB 2IO2B 4KIKA 5CHVC 3QHTA 2KMAA 4WAAA 3RD2A 3VH3B 3VVWB 3WA0A 4FLHA 2MA9B 1WR6E 2IY0B 3N3KB 4AP4C 1WR1A 4MH0E 4ZRIA 3JYUA 1I35A 1G6JA 1GUAB 2KD0A 1P0RA 1OTRB 2J0JA 2KMCA 2RGFA 3W1SC 1GG3A 3JW0X 3ZNHB 3DQVA 3ML8A 2C7NB 2IO1B 1UBIA 1WMHA 3VQIA 2KC2A 2JVCA 3WALA 5C1ZA 1YX6B 3V6EB 3WIMA 4GDLB 1YJ1A 4WJNA 4AWJA 2KN5A 2V4LA 3DVNU 3NZSA 3ZRFA 3KUZA 2EMSA 2ZJDA 3PLVA 1WGDA 4P7IA 3GOEA 3ZIMA 3AI5A 2JF5A 5L95C 2A5UA 4X57B 1EF5A 1EO6A 4URKA 1MG8A 2LD9A 3QK0A 4IWPA 1WE6A 3NZUA 5D7GA 3KVFB 4KSLC 3DOWA 2WX1A 2EKEC 4IM2A 1V9JA 2KJ6A 3PTFC 1R4MI 1TZ1A 2M17A 4A20A 1QZEA 1ZKHA 2M8SA 3RYTA 2N7EA 4ANWA 2NPTA 4AOFA 3C0RB 4PS7A 2N9XA 1UZXB 2HJ8A 2O6VB 3PVLA 4F8CB 1H4RA 2LI5A 2IO0B 3M3JA 2XK5A 4W9KA 1J19A 5DPSA 3S2AA 2JT4B 2K8BA 3HM3A 2ZVNA 2HE7A 3PV1A 3QJZA 3H9DA 5JH5C 1L2NA 1OQYA 2LASA 3L08A 2KK8A 3B0AA 3X0WA 3L16A 5DPTA 3R7RA 4XX5A 3ZNID 1WM3A 4I6NB 1OGWA 3RT3B 2MCNB 4K7WA 3ML9A 4NPNA 1I42A 1XT9B 4DXAB 4EZJA 4FHKA 1YD8U 2NPTB 2AL6A 1WGRA 2AWTA 2DYOA 2OJRA 2MLBA 3V60A 4W9EA 1LQBA 2ZEQA 3PSEB 3RZWC 2ASQA 3IFWB 1J8CA 4M0WB 4WJOA 3QWZB 2REXA 5J17A 1S1QB 2MBEA 3QARA 1E8WA 4IM3A 2R2OA 4G50A 2W9NA 1UELA 1WY8A 2ZCBA 5J18A 3SDLC 2DYMA 3L13A 3BY4B 5DCNA 3MJWA 2JPHA 4PS3A 2A4ZA 3VHTC 2KWUB 1PQSA 2GBJA 2OOBB 4CO7A 1WJNA 2VRRB 5IAAC 4FJYA 3OLMD 4GIVA 2BYFA 2RD0A 2KNBA 3CMMB 3R66C 1KOTA 1Q5WB 1WZ0A 1XQQA 2MRPA 3BINA 3A1QB 3AXCA 3UINB 4LJOB 3SU8X 2D11A 4FJZA 2PJHA 4ZYNA 4KIKB 3UQBA 1V5OA 2LVOA 2C5LC 4BFRA 1WJ4A 3RUIB 3NOBA 1Y8RC 4OVUA 4JL9A 4KV2A 4KDLB 2C9WB 3UIOB 1LFDA 1Q1OA 2PPHA 3APDA 3QIJA 3VTWA 2N9PC 2GBMA 4E71A 3WAOA 2BYEA 4M8NA 4EZLA 1WMHB 2ZPNA 4B9KA 2GOWA 1J0GA 3UGBB 2KLGA 2L3ZA 3KUCB 2JY6A 3K9OB 3PREA 4ZRJA 3VTUA 2MX2A 2MBBB 2J7QB 1Z2MA 1VCBA 3VFKA 3HK0A 3OAWA 5AZHA 4TQ0A 4MSQB 3DPDA 3VXWA 4W9CA 4W9DA 1K8RB 2JZZA 3PHXB 3ZW3A 2JRHA 3JSVB 4JGHB 1KLVA 3QX1A 1E90A 4PS8A 4HXDA 2BKFA 4DBGA 2DX5B 3A4RA 1RLFA 3VUYA 2G4SA 4DK5A 2GBNA 4HCPB 1EUVB 2LGDA 3JVZX 4TKNA 3PRMB 2D2QA 2NS5A 5HKHA 2XBBC 4E74A 1WE7A 1WX9A 4PYZA 3PLUA 2KWCA 4MDKE 5CHWA 3VUXA 2L05A 4NQLB 1TBEA 2Z0DB 3MHSD 3PZDA 4W9HA 5JHAA 2BWES 1WM2A 2B3AA 1WJ6A 2M4NA 4MJSA 3JSVA 4HWIB 2BYVE 4IC7B 3LJ3A 4BKGA 2G3QB 2JXXA 2MP2B 5G55A 3ZKJC 2DZKA 3NHEB 3UQAA 3DDCB 4A3PA 5LXIB 1NDDA 4KVGB 4LJPB 4ZDVA 3TL5A 4MSMB 4JIOU 2FCNA 1AARA 4WJQA 1IPGA 2DAFA 5CHFA 2KQ7A 4II3B 4J6IA 4XC2A 3ZTCA 3TCAA 2IBIB 3IHPC 2AL3A 2D10A 1LXDA 1R4NI 2IYDB 3NY5A 4W9GA 2IO3B 4G3XB 3CF6E 3RULA 2ZCCA 4IG7B 2JZ3B 1IYFA 3B08A 3ZNZB 5FR6A 5AEKB 4DHJD 4B6WA 3EECA 2L00B 2Z0EB 3U7DA 3V62A 4EKUA 2FNJB 4ANVA 1V80A 2LVPA 4W9IA 3ECIA 4DDID 5G2NA 4F1SA 2NVUI 1JRUA 1LM8B 1WGGA 2KDEB 2N1WA 2PEAA 5BO4B 1SE9A 2AYOB 3TJPA 2L76A 4HVBA 3ZDTA 1UH6A 1RRBA 3A9JB 4BOSC 1WFYA 2KTRA 1GJZA 3DVNV 1WJUA 4ICUA 4MEMA 3A1QA 2L0FA 3Q3JA 2CR5A 2NBVB 4B95A 3AULA 3L10B 4ICVA 3KUDB 3P2BA 2M0XA 2KX3A 3QA8A 2K1FA 2D07B 2EMTA 1D3ZA 2GMIC 4EFOA 1E7UA 1WIAA 5CX3A 4JQWC 3ZUNA 3DBSA 2JWZA 2DZJA 5D94A 3TIXA 2KOXA 2DENB 1FXTB 2CKHB 2BPSA 1E7VA 2KX0A 2KDIA 2PE9A 2KC1A 4IWQA 1E8YA 4HJKA 3EHVA 3DBLI 5E6OA 2C60A 3EC8A 2FCMA 4LCDE 4MGIE 4M8MA 4GN1A 4JLCA 3PS6A 3L17A 4NJ6A 4K1RB 4WWOA 3VDZA 2KFJA 5KHOA 3H1UA 3ZO5B 4BKSA 4IUMB 4MGKE 1V6EA 1KM7A 2NBWB 3SHQA 3D32A 2RR9A 4HPMB 1XD3B 4EEWA 3MTNB 3N32A 2CU1A 2KDFB 3W1YA 1TTNA 4MGZE 1WXSA 2JRIB 4KDIC 4GGQA 2L8JA 5TR5A 3KYDD 2BKRB 3TBLD 3IVFA 1V49A 3VUWA 1WZ3A 3ZTDA 2K8HA 3HM6X 4W9JA 2K39A 2MWSB 4CYEA 2R2QA 4BKTA 2XK5B 4OVVA 2NBUA 2N1VA 4DWFA 2FCQA 2O6VD 2FCSA 3CSFA 4GOCA 2BF8B 4FULA 2L7RA 1GNUA 4IM0A 3PGEA 4WJPA 1IP9A 1OEYJ 3V61A 2WDTB 3WAMA 5J2RA 2KJHB 2G4DB 2J0MA 2HTHA 2O6VA 2LXCA 2CHZA 2GBRA 3IBEA 3HHMA 4GXBA 2MBHA 2DHZA 4I6PA 3ZVVA 3CSTA 4ANXA 2FIFA 4NJ7A 2MW5A 1CMXB 1V5TA 2RPQA 3A9KB 1OEYA 3PRPB 2YVCA 4HCNB 4BOZB 1WGYA 3GZNI 2ZVOA 2O2VA 4I6LB 4BVUC 3TMPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7S A;  2MBO A;  4NQK E;  1WF9 A;  1YX5 B;  4W9L A;  3RCZ A;  3A33 B;  2FUH B;  2JUO A;  4FN2 A;  1C1Y B;  2MSE D;  3NS8 A;  4DHZ E;  3B1L X;  2LUE A;  2LXA A;  2ZPY A;  2K6Q A;  3H7P A;  1WH3 A;  4ANU A;  1L7Y A;  2LWP A;  4DDG D;  2V1Y A;  4RM9 A;  3AU5 A;  2FAZ A;  3M63 B;  3DVG X;  3VAW A;  3T8M A;  1P98 A;  1Q0W B;  3ENE A;  2C7M B;  2KFK A;  5E6N A;  3RZF A;  3AU4 A;  5LXH A;  4KZ0 A;  4LDT D;  2LVQ A;  2N9E B;  2KVR A;  2LGX A;  2KAN A;  3KW5 B;  4G11 A;  5LLI A;  1F9J A;  4FBJ B;  1VD2 A;  2D3G A;  2N7D A;  2KQS A;  3HIZ A;  2KTR B;  2KLC A;  1WXV A;  4NNJ B;  3L54 A;  1NI2 A;  1E5W A;  2KWV B;  4BKS D;  3ZDM C;  4WWN A;  2FID A;  2HD5 B;  4FAD A;  4NAW B;  2MQJ A;  1GC6 A;  4BBN C;  3DVG Y;  1WXA A;  5JHB A;  3APC A;  5AZF A;  1A5R A;  2UWQ A;  3I3T B;  3A4S C;  4MEL A;  4XZ4 A;  4NY0 A;  3PT2 B;  5D2M B;  4AJY B;  2CS4 A;  4LDT B;  3EFU A;  4KZC A;  2KO3 A;  3W1S A;  3X23 A;  3LDZ E;  2I1K A;  4CHK A;  3OJ3 A;  1P9D U;  4FHJ A;  5IA7 A;  1NBF C;  3WAP A;  4HLE A;  2KFK B;  4G0N B;  3ALB A;  3PHW B;  4MM3 A;  4GSW A;  3R7Q A;  5DPR A;  4WWP A;  2DZI A;  3V6C B;  2KKC A;  4GDK A;  1T0Y A;  1TGZ B;  2KXJ A;  2K6D B;  4RMA A;  1ZW7 A;  4WQO B;  2LRW A;  3UF8 A;  4NAW A;  3OJ4 B;  1H8C A;  3K9P B;  4K7U A;  3L0W B;  2PE6 B;  2BGF A;  4TUU A;  1E8Z A;  4GB9 A;  1WX7 A;  3ZRC A;  3QAQ A;  2ZNV C;  4AJW A;  2DAJ A;  2V3S A;  3H7S A;  3QCA A;  4TV3 A;  2GBK A;  3N30 A;  3UIP B;  4F7Z A;  3DCG A;  1V81 A;  3KYC D;  5KHQ A;  1M94 A;  1Z5S B;  3QC8 B;  4PYU A;  1UD7 A;  2K25 A;  2IZV B;  3PPA A;  1RFA A;  4AUQ C;  3ZLZ A;  4HDQ A;  5E6P A;  2NR2 A;  1WYW B;  2BWF A;  3H6N A;  3SD5 A;  2YLM A;  1YQB A;  4GDK B;  2IY1 B;  2LRU A;  2QHO A;  4TQ1 A;  4N9F 4;  5GMV A;  2UYZ B;  1WX8 A;  1WXM A;  1V86 A;  2LJ5 A;  2AEH A;  1UGM A;  2KDB A;  3ZNG C;  3IG3 A;  2LZ6 A;  4IWO A;  1RAX A;  2WX0 A;  1ISN A;  3KH0 A;  4K81 A;  3M62 B;  2DYB A;  2M1M A;  1BT0 A;  2KJR A;  1X1M A;  1V2Y A;  1ZGU B;  2KTF A;  3DBR I;  3U8Z A;  2MBQ A;  4MGY E;  1SGH A;  2LGY A;  4E3C A;  2CHX A;  3ONS A;  2G45 B;  3Q3F A;  4FJV B;  4MJS B;  2Z59 B;  4A3O A;  4EZK A;  5L83 A;  4HK2 A;  4BBN F;  2MP2 A;  2N4F A;  4II2 B;  2NCN A;  3PRZ A;  1HE8 A;  5D6J B;  3R3M A;  3T9L A;  1WGH A;  4YL8 A;  2L0T A;  3APF A;  4GMV A;  2I1J A;  1GC7 A;  3DBH I;  3O65 B;  1E8X A;  2DZM A;  5CTR C;  4ZRK A;  2WYQ A;  3A9K A;  5DPW A;  4DHZ B;  1KJT A;  4HDO A;  3H7P B;  4DHJ B;  2O2V B;  2KHW B;  1P1A A;  2RSU A;  1C3T A;  3A9J A;  3U30 A;  4EOY A;  4ASW C;  3WAN A;  2K8C A;  1WRD B;  4HPL B;  1WI0 A;  4IW0 A;  1EF1 A;  2WWZ A;  2Y5B B;  2ZNV B;  3VH4 B;  4EUT A;  5EDS A;  4GU2 A;  1U4A A;  1P3Q U;  1SIF A;  2C7H A;  3QQ8 B;  4RM8 A;  3VTV A;  2KZR A;  5JZE B;  4GDL A;  4FA6 A;  4KSK C;  5AZG A;  1S3S G;  2XEW A;  4W9F A;  5C23 A;  2CHW A;  1YIW A;  3M95 A;  2J0K A;  1UBQ A;  2ZZP B;  2IO2 B;  4KIK A;  5CHV C;  3QHT A;  2KMA A;  4WAA A;  3RD2 A;  3VH3 B;  3VVW B;  3WA0 A;  4FLH A;  2MA9 B;  1WR6 E;  2IY0 B;  3N3K B;  4AP4 C;  1WR1 A;  4MH0 E;  4ZRI A;  3JYU A;  1I35 A;  1G6J A;  1GUA B;  2KD0 A;  1P0R A;  1OTR B;  2J0J A;  2KMC A;  2RGF A;  3W1S C;  1GG3 A;  3JW0 X;  3ZNH B;  3DQV A;  3ML8 A;  2C7N B;  2IO1 B;  1UBI A;  1WMH A;  3VQI A;  2KC2 A;  2JVC A;  3WAL A;  5C1Z A;  1YX6 B;  3V6E B;  3WIM A;  4GDL B;  1YJ1 A;  4WJN A;  4AWJ A;  2KN5 A;  2V4L A;  3DVN U;  3NZS A;  3ZRF A;  3KUZ A;  2EMS A;  2ZJD A;  3PLV A;  1WGD A;  4P7I A;  3GOE A;  3ZIM A;  3AI5 A;  2JF5 A;  5L95 C;  2A5U A;  4X57 B;  1EF5 A;  1EO6 A;  4URK A;  1MG8 A;  2LD9 A;  3QK0 A;  4IWP A;  1WE6 A;  3NZU A;  5D7G A;  3KVF B;  4KSL C;  3DOW A;  2WX1 A;  2EKE C;  4IM2 A;  1V9J A;  2KJ6 A;  3PTF C;  1R4M I;  1TZ1 A;  2M17 A;  4A20 A;  1QZE A;  1ZKH A;  2M8S A;  3RYT A;  2N7E A;  4ANW A;  2NPT A;  4AOF A;  3C0R B;  4PS7 A;  2N9X A;  1UZX B;  2HJ8 A;  2O6V B;  3PVL A;  4F8C B;  1H4R A;  2LI5 A;  2IO0 B;  3M3J A;  2XK5 A;  4W9K A;  1J19 A;  5DPS A;  3S2A A;  2JT4 B;  2K8B A;  3HM3 A;  2ZVN A;  2HE7 A;  3PV1 A;  3QJZ A;  3H9D A;  5JH5 C;  1L2N A;  1OQY A;  2LAS A;  3L08 A;  2KK8 A;  3B0A A;  3X0W A;  3L16 A;  5DPT A;  3R7R A;  4XX5 A;  3ZNI D;  1WM3 A;  4I6N B;  1OGW A;  3RT3 B;  2MCN B;  4K7W A;  3ML9 A;  4NPN A;  1I42 A;  1XT9 B;  4DXA B;  4EZJ A;  4FHK A;  1YD8 U;  2NPT B;  2AL6 A;  1WGR A;  2AWT A;  2DYO A;  2OJR A;  2MLB A;  3V60 A;  4W9E A;  1LQB A;  2ZEQ A;  3PSE B;  3RZW C;  2ASQ A;  3IFW B;  1J8C A;  4M0W B;  4WJO A;  3QWZ B;  2REX A;  5J17 A;  1S1Q B;  2MBE A;  3QAR A;  1E8W A;  4IM3 A;  2R2O A;  4G50 A;  2W9N A;  1UEL A;  1WY8 A;  2ZCB A;  5J18 A;  3SDL C;  2DYM A;  3L13 A;  3BY4 B;  5DCN A;  3MJW A;  2JPH A;  4PS3 A;  2A4Z A;  3VHT C;  2KWU B;  1PQS A;  2GBJ A;  2OOB B;  4CO7 A;  1WJN A;  2VRR B;  5IAA C;  4FJY A;  3OLM D;  4GIV A;  2BYF A;  2RD0 A;  2KNB A;  3CMM B;  3R66 C;  1KOT A;  1Q5W B;  1WZ0 A;  1XQQ A;  2MRP A;  3BIN A;  3A1Q B;  3AXC A;  3UIN B;  4LJO B;  3SU8 X;  2D11 A;  4FJZ A;  2PJH A;  4ZYN A;  4KIK B;  3UQB A;  1V5O A;  2LVO A;  2C5L C;  4BFR A;  1WJ4 A;  3RUI B;  3NOB A;  1Y8R C;  4OVU A;  4JL9 A;  4KV2 A;  4KDL B;  2C9W B;  3UIO B;  1LFD A;  1Q1O A;  2PPH A;  3APD A;  3QIJ A;  3VTW A;  2N9P C;  2GBM A;  4E71 A;  3WAO A;  2BYE A;  4M8N A;  4EZL A;  1WMH B;  2ZPN A;  4B9K A;  2GOW A;  1J0G A;  3UGB B;  2KLG A;  2L3Z A;  3KUC B;  2JY6 A;  3K9O B;  3PRE A;  4ZRJ A;  3VTU A;  2MX2 A;  2MBB B;  2J7Q B;  1Z2M A;  1VCB A;  3VFK A;  3HK0 A;  3OAW A;  5AZH A;  4TQ0 A;  4MSQ B;  3DPD A;  3VXW A;  4W9C A;  4W9D A;  1K8R B;  2JZZ A;  3PHX B;  3ZW3 A;  2JRH A;  3JSV B;  4JGH B;  1KLV A;  3QX1 A;  1E90 A;  4PS8 A;  4HXD A;  2BKF A;  4DBG A;  2DX5 B;  3A4R A;  1RLF A;  3VUY A;  2G4S A;  4DK5 A;  2GBN A;  4HCP B;  1EUV B;  2LGD A;  3JVZ X;  4TKN A;  3PRM B;  2D2Q A;  2NS5 A;  5HKH A;  2XBB C;  4E74 A;  1WE7 A;  1WX9 A;  4PYZ A;  3PLU A;  2KWC A;  4MDK E;  5CHW A;  3VUX A;  2L05 A;  4NQL B;  1TBE A;  2Z0D B;  3MHS D;  3PZD A;  4W9H A;  5JHA A;  2BWE S;  1WM2 A;  2B3A A;  1WJ6 A;  2M4N A;  4MJS A;  3JSV A;  4HWI B;  2BYV E;  4IC7 B;  3LJ3 A;  4BKG A;  2G3Q B;  2JXX A;  2MP2 B;  5G55 A;  3ZKJ C;  2DZK A;  3NHE B;  3UQA A;  3DDC B;  4A3P A;  5LXI B;  1NDD A;  4KVG B;  4LJP B;  4ZDV A;  3TL5 A;  4MSM B;  4JIO U;  2FCN A;  1AAR A;  4WJQ A;  1IPG A;  2DAF A;  5CHF A;  2KQ7 A;  4II3 B;  4J6I A;  4XC2 A;  3ZTC A;  3TCA A;  2IBI B;  3IHP C;  2AL3 A;  2D10 A;  1LXD A;  1R4N I;  2IYD B;  3NY5 A;  4W9G A;  2IO3 B;  4G3X B;  3CF6 E;  3RUL A;  2ZCC A;  4IG7 B;  2JZ3 B;  1IYF A;  3B08 A;  3ZNZ B;  5FR6 A;  5AEK B;  4DHJ D;  4B6W A;  3EEC A;  2L00 B;  2Z0E B;  3U7D A;  3V62 A;  4EKU A;  2FNJ B;  4ANV A;  1V80 A;  2LVP A;  4W9I A;  3ECI A;  4DDI D;  5G2N A;  4F1S A;  2NVU I;  1JRU A;  1LM8 B;  1WGG A;  2KDE B;  2N1W A;  2PEA A;  5BO4 B;  1SE9 A;  2AYO B;  3TJP A;  2L76 A;  4HVB A;  3ZDT A;  1UH6 A;  1RRB A;  3A9J B;  4BOS C;  1WFY A;  2KTR A;  1GJZ A;  3DVN V;  1WJU A;  4ICU A;  4MEM A;  3A1Q A;  2L0F A;  3Q3J A;  2CR5 A;  2NBV B;  4B95 A;  3AUL A;  3L10 B;  4ICV A;  3KUD B;  3P2B A;  2M0X A;  2KX3 A;  3QA8 A;  2K1F A;  2D07 B;  2EMT A;  1D3Z A;  2GMI C;  4EFO A;  1E7U A;  1WIA A;  5CX3 A;  4JQW C;  3ZUN A;  3DBS A;  2JWZ A;  2DZJ A;  5D94 A;  3TIX A;  2KOX A;  2DEN B;  1FXT B;  2CKH B;  2BPS A;  1E7V A;  2KX0 A;  2KDI A;  2PE9 A;  2KC1 A;  4IWQ A;  1E8Y A;  4HJK A;  3EHV A;  3DBL I;  5E6O A;  2C60 A;  3EC8 A;  2FCM A;  4LCD E;  4MGI E;  4M8M A;  4GN1 A;  4JLC A;  3PS6 A;  3L17 A;  4NJ6 A;  4K1R B;  4WWO A;  3VDZ A;  2KFJ A;  5KHO A;  3H1U A;  3ZO5 B;  4BKS A;  4IUM B;  4MGK E;  1V6E A;  1KM7 A;  2NBW B;  3SHQ A;  3D32 A;  2RR9 A;  4HPM B;  1XD3 B;  4EEW A;  3MTN B;  3N32 A;  2CU1 A;  2KDF B;  3W1Y A;  1TTN A;  4MGZ E;  1WXS A;  2JRI B;  4KDI C;  4GGQ A;  2L8J A;  5TR5 A;  3KYD D;  2BKR B;  3TBL D;  3IVF A;  1V49 A;  3VUW A;  1WZ3 A;  3ZTD A;  2K8H A;  3HM6 X;  4W9J A;  2K39 A;  2MWS B;  4CYE A;  2R2Q A;  4BKT A;  2XK5 B;  4OVV A;  2NBU A;  2N1V A;  4DWF A;  2FCQ A;  2O6V D;  2FCS A;  3CSF A;  4GOC A;  2BF8 B;  4FUL A;  2L7R A;  1GNU A;  4IM0 A;  3PGE A;  4WJP A;  1IP9 A;  1OEY J;  3V61 A;  2WDT B;  3WAM A;  5J2R A;  2KJH B;  2G4D B;  2J0M A;  2HTH A;  2O6V A;  2LXC A;  2CHZ A;  2GBR A;  3IBE A;  3HHM A;  4GXB A;  2MBH A;  2DHZ A;  4I6P A;  3ZVV A;  3CST A;  4ANX A;  2FIF A;  4NJ7 A;  2MW5 A;  1CMX B;  1V5T A;  2RPQ A;  3A9K B;  1OEY A;  3PRP B;  2YVC A;  4HCN B;  4BOZ B;  1WGY A;  3GZN I;  2ZVO A;  2O2V A;  4I6L B;  4BVU C;  3TMP B; 
#chains in the Genus database with same CATH topology
 4W9L A;  2JUO A;  1C4P A;  5BYQ A;  2MSE D;  3NS8 A;  3ETR A;  2LXA A;  3Q3N C;  4ANU A;  3AE7 B;  1RYJ A;  1DOI A;  4RM9 A;  3AU5 A;  4ITK A;  3RNB C;  2KFK A;  3DBH B;  1V1P B;  2LVQ A;  3KW5 B;  2LGX A;  1T5X D;  2N7D A;  2KQS A;  3AE9 B;  2KLC A;  1NI2 A;  1E5W A;  2BVC A;  3I63 C;  3ZDM C;  1HZ5 A;  2HD5 B;  1GC6 A;  2GB1 A;  5JHB A;  3PT2 B;  4PK1 A;  2CS4 A;  1IBX A;  4LNO A;  3W1S A;  2WXQ A;  3LDZ E;  1KRH A;  1L4Z B;  2VH2 A;  1NBF C;  4HLE A;  2BS3 B;  2EEL A;  2DZI A;  3V6C B;  4YTP B;  2D5G A;  1ET6 A;  4GB9 A;  2ZNV C;  3RNC C;  2DAJ A;  4TV3 A;  2GBK A;  3N30 A;  4F7Z A;  1V81 A;  1WWT A;  3RMK C;  5MPO A;  2IZV B;  4OZA A;  3BWU D;  3P4P B;  4GDK B;  2IY1 B;  3T3O A;  2QHO A;  1R7S A;  4N9F 4;  1WX8 A;  2AQ1 B;  5EE0 A;  2GLS A;  1N61 A;  3KH0 A;  2WXJ A;  1SBB B;  2BS4 B;  1VDV A;  3DBR I;  2K9X A;  4R3D A;  3U8Z A;  2MBQ A;  1SGH A;  2LGY A;  4E3C A;  2HJ1 A;  3ZJT A;  1JAL A;  1I4R A;  1PDX A;  1F1H A;  4QAY A;  2PMV A;  4II2 B;  1DOY A;  1WGH A;  2I1J A;  2WYQ A;  1PYW D;  5FR3 A;  4DHZ B;  4DHJ B;  1T3Q A;  2O2V B;  1FNW A;  1AWD A;  2M0A A;  1SE3 A;  2K8C A;  1WRD B;  2PVG C;  2Y5B B;  3VH4 B;  5EDS A;  1C4C A;  3URY A;  5AZG A;  1ZP0 B;  3Q3O C;  4TSS A;  2G1E A;  3NG0 A;  2ZZP B;  2QC8 A;  4WAA A;  3AMZ A;  3VVW B;  2XN9 C;  2MA9 B;  4XE0 A;  3IAS 1;  2IY0 B;  1WR1 A;  2W82 A;  1P0R A;  3JW0 X;  1MJD A;  1UBI A;  3AE1 B;  5AUK A;  3V6E B;  1YJ1 A;  4M02 A;  4WH4 A;  2V4L A;  1C4A A;  5E6J A;  2WDQ B;  2JF5 A;  2WXN A;  1FCC C;  4URK A;  2LD9 A;  3QK0 A;  4IWP A;  2K0P A;  4WAF A;  4BAX A;  2PIA A;  2JU6 X;  2WDR B;  2EKE C;  3Q69 A;  3RYT A;  4ANW A;  4PT5 A;  1FMA D;  1FRD A;  3PVL A;  4HEA 1;  1CQV A;  2LI5 A;  1JCK B;  4HKZ E;  1HXY D;  4HPP A;  5DPS A;  2JT4 B;  2K8B A;  3BVG A;  2HE7 A;  3QJZ A;  3RNF C;  3B0A A;  3L16 A;  5DPT A;  1UF0 A;  3R7R A;  4XX5 A;  4I6N B;  2MCN B;  1YJI A;  4DXA B;  1I4G A;  4FHK A;  5BYS A;  2NPT B;  2AL6 A;  3RZW C;  3IFW B;  4M0W B;  3W2D A;  2REX A;  5FKA C;  4IM3 A;  2R2O A;  1FEH A;  5J18 A;  2KT7 A;  3BY4 B;  2HTM E;  2A4Z A;  2OOB B;  5IAA C;  4B0M A;  3R66 C;  3AXC A;  3NVV A;  1L6V A;  1J7A A;  1I4Q A;  4B0E A;  4ZYN A;  3UQB A;  2WQY B;  1WJ4 A;  1OQR A;  3CWI A;  2C9W B;  3UIO B;  2N9P C;  2BYE A;  3ZJV A;  3NVW A;  2ZPN A;  1N6Z A;  4HRS A;  1N62 A;  3UGB B;  3VTU A;  3EFC A;  2J7Q B;  3BK1 A;  1MFW A;  4LK0 M;  4MSQ B;  1I7H A;  5BMI A;  2JRH A;  1C9F A;  4WUR A;  2BKF A;  3A4R A;  1RLF A;  1E6E B;  5IN7 A;  4DK5 A;  4HCP B;  1EUV B;  4TKN A;  2D2Q A;  2NS5 A;  4A90 A;  4E74 A;  1WX9 A;  3NVZ A;  1A70 A;  4MDK E;  4D2K A;  4NQL B;  4K3C A;  3KWL A;  1TYG B;  2BWE S;  2RDG A;  3BYY B;  2VZK D;  2BYV E;  3Q8E A;  3KQ4 A;  4BKG A;  2G3Q B;  5G55 A;  1NYR A;  4KVG B;  2CJO A;  2AQ2 B;  1IPG A;  3Q14 C;  2KQ7 A;  4II3 B;  4XC2 A;  2MEK A;  2IBI B;  3IHP C;  4W9G A;  3VRB B;  2L52 A;  2W3R A;  1V80 A;  1WGK A;  5G2N A;  3VR8 B;  4F1S A;  1YOV B;  2LUM A;  1WGG A;  4RGO S;  4DQO C;  3J9C A;  2L76 A;  2J4X A;  1RRB A;  1C78 A;  1GJZ A;  3GP7 A;  1HA5 A;  2L0F A;  1L0X B;  3L10 B;  3U7Z A;  2AQ3 B;  3KUD B;  1T0Q C;  1XLP A;  2M0X A;  3RPF C;  1D3Z A;  4EFO A;  1WIA A;  1E7U A;  3LB8 C;  3ZUN A;  3DBS A;  2JWZ A;  2ONQ A;  2DEN B;  3WCQ A;  3FIL B;  2L83 A;  4DXF A;  4LCD E;  3DWG C;  3L17 A;  2LHD A;  4K1R B;  3VDZ A;  2K3U A;  2ON8 A;  2Q5W D;  1KM7 A;  2WXR A;  1C76 A;  4HPM B;  1XD3 B;  2KDF B;  3W1Y A;  3HUI A;  1WXS A;  4RNA A;  2L8J A;  1JRO A;  3TBL D;  4NJC A;  3I5J C;  4W9J A;  3AEE B;  3N20 C;  4BKT A;  2NBU A;  2NMQ A;  4NAM A;  3CSF A;  2BF8 B;  2INN E;  1I4X A;  4P1C C;  4WJP A;  1EWY C;  3V61 A;  1XCT L;  5J2R A;  2J0M A;  2HTH A;  2O6V A;  2LXC A;  3IBE A;  1ZDV A;  4GXB A;  2N0S B;  4ANX A;  3NVY A;  2MW5 A;  2QIL A;  2YVC A;  3GZN I;  4K7S A;  4NQK E;  1RWS A;  3RCZ A;  3ZJU A;  4IOI E;  4FN2 A;  1C1Y B;  4DHZ E;  1VJK A;  1Q10 A;  5C3J B;  1L7Y A;  2LWP A;  2V1Y A;  4P16 A;  3ZQ4 A;  3T8M A;  1P98 A;  1Q0W B;  1IGD A;  4MT5 A;  3TUO A;  3AU4 A;  4LDT D;  3FC4 A;  2N9E B;  5LLI A;  2KAN A;  4FBJ B;  1F9J A;  2WGS A;  2D3G A;  2KTR B;  2QDF A;  4NNJ B;  3L54 A;  2KWV B;  4BKS D;  4WWN A;  1ENF A;  2QMT A;  4FAD A;  4NAW B;  2WXH A;  2MQJ A;  4BBN C;  4L1B A;  3APC A;  4WQM A;  1TIF A;  2UWQ A;  1A5R A;  5HG2 A;  4MEL A;  3EFU A;  4JWS C;  2KO3 A;  2I1K A;  4CHK A;  1SEB D;  4FHJ A;  5IA7 A;  3PHW B;  4LNI A;  2WXK A;  5DPR A;  5GXG B;  2KKC A;  1JQ4 A;  3I9V 1;  2PLP A;  3UF8 A;  1H8C A;  4K7U A;  4TUU A;  2BT6 A;  1QOG A;  1FIQ A;  1VZ6 A;  2V3S A;  1QOB A;  1VLB A;  3QCA A;  2KQ4 X;  3UIP B;  3DCG A;  1PGX A;  3KYC D;  5KHQ A;  2RPV A;  4HDQ A;  2NR2 A;  1EU3 A;  5IO9 A;  1YQB A;  1JWB D;  1CJE A;  5GMV A;  1NYQ A;  2KDB A;  2LJ5 A;  1UGM A;  3IG3 A;  1HZ6 A;  2WX0 A;  1DYQ A;  2BTE A;  2DYB A;  2M1M A;  2VZK B;  1X1M A;  3AH7 A;  1V2Y A;  4MGY E;  2G45 B;  3Q3F A;  4FJV B;  3FAH A;  2Z59 B;  3B2G A;  1L4D B;  5L83 A;  2D3C A;  2N4F A;  4ZRP A;  3IT6 B;  1GB4 A;  3PRZ A;  4YL8 A;  4GMV A;  3DBH I;  1E8X A;  1FNU A;  4RF1 A;  4ZRK A;  1IGC A;  2E3T A;  3A9K A;  3H7P B;  2KHW B;  1C3T A;  4EOY A;  4ASW C;  1WI0 A;  5H92 C;  4IW0 A;  2WWZ A;  2ZNV B;  1U4A A;  1P3Q U;  3AEG B;  4RM8 A;  4FA6 A;  4KSK C;  3HVZ A;  2XEW A;  3ZYY X;  3DBR B;  5C23 A;  1YIW A;  2IO2 B;  2L32 A;  1WR6 E;  1ACC A;  3OG5 A;  4MH0 E;  4XWT A;  4ZRI A;  1I35 A;  1OTR B;  3W1S C;  1CK1 A;  3ZNH B;  3DQV A;  1DOX A;  1WMH A;  1YNT E;  2JVC A;  2Y5C A;  1TT5 B;  3WAL A;  5C1Z A;  2DBY A;  1YX6 B;  4GDL B;  4AWJ A;  1P7E A;  3NZS A;  3KUZ A;  2GI9 A;  3ZIM A;  2A5U A;  2MJE A;  1EO6 A;  3NZU A;  3T3N A;  1JWU D;  3KVF B;  2CJN A;  3W5U B;  2QIE B;  1PUT A;  1FM0 D;  1K51 A;  1XLN A;  1ZKH A;  1C79 A;  2N7E A;  4AOF A;  1UZX B;  3P42 A;  2XK5 A;  2L1A A;  3H9D A;  4RGN A;  3MHZ A;  2MJD A;  4NPN A;  1D4B A;  1WXQ A;  4WWM A;  1YD8 U;  2K22 A;  2OJR A;  3V60 A;  4W9E A;  1GAQ B;  3QWZ B;  4YSX B;  5J17 A;  1FNV A;  2D3B A;  2M56 B;  1WSP A;  5BMH A;  3AB5 A;  3L13 A;  1TS3 A;  3LXF A;  3MJW A;  2JPH A;  4PS3 A;  2KWU B;  1SE2 A;  1WJN A;  4GIV A;  2CU3 A;  2RD0 A;  1KOT A;  1XQQ A;  4L2Y A;  4FXC A;  3A1Q B;  4YWG G;  3UIN B;  4LJO B;  2KDM A;  3B9J A;  2LVO A;  3DBL B;  3RUI B;  2SAK A;  4RGM A;  1Y8R C;  1P7F A;  2TSS A;  1Q1O A;  3VTW A;  1NEN B;  4M8N A;  1XEE A;  4EZL A;  4C7Y A;  2GOW A;  1J0G A;  2L3Z A;  5LNK 1;  2MBB B;  1VCB A;  3OAW A;  5AZH A;  1FD6 A;  4JX1 C;  3PHX B;  3BVM A;  1B1Z A;  3JSV B;  3RNA C;  3TEZ A;  1KLV A;  4XDC A;  1E90 A;  2OJW A;  4DBG A;  1N5W A;  1TKG A;  3VUY A;  4KKJ A;  2ICI A;  2WP9 B;  1TS5 A;  4PYZ A;  3VUX A;  1TBE A;  1AN8 A;  4LNK A;  5JHA A;  2Z8L A;  3V3X A;  3AE8 B;  3IXS A;  1WM2 A;  2FUG 1;  4HWI B;  3RNE C;  3U2S C;  1NDD A;  2RMM A;  4LJP B;  4ZDV A;  2FCN A;  1AAR A;  4MH8 A;  4J6I A;  1BXT A;  3ZTC A;  2NTT A;  2KAJ A;  1FFU A;  1TJE A;  1TS4 A;  3NY5 A;  1JWS D;  1VR9 A;  3RUL A;  4IG7 B;  1IYF A;  3NRZ A;  5AEK B;  4B6W A;  2L00 B;  2Z0E B;  4Q2J A;  3U7D A;  2LVP A;  2NVU I;  2KDE B;  2N1W A;  2PEA A;  5BO4 B;  3UI3 A;  1SE9 A;  1B9R A;  3ABV B;  3ZDT A;  3DVN V;  1WJU A;  3GE8 C;  2KAC A;  4ICU A;  4MEM A;  3Q3J A;  4YTM B;  1V97 A;  4B95 A;  4RCO A;  4ICV A;  1FO4 A;  3P2B A;  2QEJ C;  2KX3 A;  2K1F A;  2D07 B;  2EMT A;  2GMI C;  4M00 A;  2VH1 A;  3DWM A;  1C77 A;  1FXT B;  3ZXR A;  2V3P A;  2KC1 A;  1E8Y A;  2I2Y A;  5E6O A;  2AX5 A;  1J7C A;  4GN1 A;  1F52 A;  3H1U A;  3ZO5 B;  2ZW1 A;  1V6E A;  3MFG A;  3D32 A;  2RR9 A;  2XNA C;  3B2F A;  4REZ A;  4N58 A;  4C4V B;  4ZHO A;  2JYT A;  1RM6 C;  2M19 A;  4YSZ B;  3IVF A;  3VUW A;  1SJE D;  4CYE A;  2FCQ A;  2O6V D;  1YMH E;  1TS2 A;  2ZW0 A;  3PGE A;  1IP9 A;  1TY2 A;  1OEY J;  2WDT B;  2KJH B;  5IP4 D;  2CHZ A;  1OQQ A;  1VZ8 A;  2DHZ A;  1CMX B;  1V5T A;  1OEY A;  3PRP B;  4HCN B;  3IT4 B;  2DWQ A;  2MBO A;  1HTO A;  3KWV A;  4OW0 A;  2FUH B;  1YN4 A;  3B1L X;  1FFV A;  4CQN A;  2IPK D;  2K6Q A;  3PZ8 A;  4XYC A;  4DDG D;  3TEY A;  1IBX B;  3M63 B;  3DVG X;  3VAW A;  1EWC A;  3ENE A;  2C7M B;  2KWD A;  5LXH A;  4G11 A;  1VD2 A;  1UWX A;  3HIZ A;  3RI7 C;  1WXV A;  1SF0 A;  4N59 A;  1L5P A;  3SR6 A;  3DVG Y;  3I3T B;  5D2M B;  4AJY B;  2LGI A;  1SIJ A;  4LDT B;  4P1B C;  1YN5 A;  4KZC A;  3X23 A;  3P63 A;  2WHI A;  1YQ4 B;  4BZA A;  2KFK B;  4G0N B;  1F2R C;  3R7Q A;  4MM3 A;  4GSW A;  4GDK A;  1T0Y A;  1TGZ B;  1N60 A;  2KXJ A;  4RMA A;  4JPS A;  2D3A A;  4WQO B;  2LRW A;  3OJ4 B;  2BGF A;  3ZRC A;  1E8Z A;  4AJW A;  3H7S A;  1JW9 D;  4KGT A;  3SFE B;  2JZP A;  1Z5S B;  4PYU A;  2V0G A;  1UD7 A;  2JSV X;  2K25 A;  2FE8 A;  4AUQ C;  1RFA A;  1JWM D;  3H6N A;  2YLM A;  3R8B A;  4K3B A;  4TQ1 A;  4AS1 A;  1M4V A;  2UYZ B;  1WXM A;  1V86 A;  2AEH A;  1PGB A;  2LZ6 A;  5HI1 A;  4KGR A;  1ISN A;  1BT0 A;  2KJR A;  3P1M A;  3MP9 A;  1ZGU B;  4YSY B;  3ONS A;  4MJS B;  4EZK A;  4A3O A;  4HK2 A;  2MP2 A;  2NTS A;  2NCN A;  3R3M A;  3T9L A;  3C8Y A;  3APF A;  3E56 A;  3O65 B;  1GC7 A;  3HRD D;  2DZM A;  5CTR C;  4GLS C;  1HQR D;  1KJT A;  4HDO A;  2RSU A;  2J52 A;  3P4S B;  3L4P A;  3WAN A;  4HPL B;  1EF1 A;  4EUT A;  2C7H A;  3VTV A;  5JZE B;  4C7Z A;  1ZXH A;  1TKE A;  5C2T B;  1HTQ A;  2CHW A;  3VRA B;  1UBQ A;  1XF5 L;  1UUP A;  3VH3 B;  3QHT A;  2KMA A;  3WA0 A;  4LLG M;  4AP4 C;  3O13 A;  3JYU A;  4AQ7 A;  2KD0 A;  2J0J A;  4NZL B;  2KMC A;  1QLB B;  2WXI A;  1GG3 A;  2IO1 B;  1RFK A;  2B76 B;  4WJN A;  2LEK A;  2KN5 A;  3ZXV A;  3DVN U;  3ZGZ A;  3ZRF A;  2ZJD A;  3PLV A;  4P7I A;  3GOE A;  5L95 C;  1PGA A;  4X57 B;  1EF5 A;  1WE6 A;  4L23 A;  2WXG A;  4KSL C;  4YT0 B;  2J42 A;  2KJ6 A;  3PTF C;  1R4M I;  1TZ1 A;  1WYG A;  1L6U A;  1QZE A;  4A20 A;  2NPT A;  3C0R B;  2N9X A;  3Q8C A;  2O6V B;  4F8C B;  2LMC A;  2SEB D;  2LHE A;  1J19 A;  2WS3 B;  3HM3 A;  3NZ3 A;  5JH5 C;  4JE3 B;  1L2N A;  2WXF A;  3L08 A;  4TMA B;  3X0W A;  3AE6 B;  3ZNI D;  1WM3 A;  4K7W A;  3ML9 A;  4N6E B;  4EZJ A;  4M01 A;  2DYO A;  1MPE A;  2MLB A;  4ARC A;  2R61 A;  4WJO A;  4WIP A;  1S1Q B;  1MHX A;  3QAR A;  5HFY A;  1WY8 A;  2ZCB A;  4C80 A;  2JWU A;  2DYM A;  5DCN A;  3P4R B;  1STE A;  2GBJ A;  4XDD A;  2VRR B;  4FJY A;  3OLM D;  2KNB A;  3CMM B;  4ARI A;  1WZ0 A;  2MRP A;  3BIN A;  1V1P A;  5AUI A;  3SU8 X;  3I57 A;  2D11 A;  2PJH A;  1D5Z C;  2BS2 B;  1V5O A;  1K50 A;  1V1O A;  4JL9 A;  2IND C;  4KDL B;  1LFD A;  2PPH A;  3QIJ A;  4E71 A;  2GBM A;  2JYE A;  3WAO A;  4ACF A;  2X8X X;  3AE5 B;  2KLG A;  5TSS A;  5IOI A;  3KUC B;  2JY6 A;  3K9O B;  4ZRJ A;  2FBW B;  1Z2M A;  1UWM A;  1Y56 A;  1I4P A;  2QJL A;  4TQ0 A;  1IUE A;  3VXW A;  4W9D A;  1D6E C;  1K8R B;  1E10 A;  2BBC A;  4JGH B;  4PS8 A;  2DX5 B;  2G4S A;  1ESF A;  2J53 A;  3Q6B A;  1E0Z A;  2GBN A;  3JVZ X;  4ZRQ A;  4US8 A;  2XBB C;  2EKI A;  3PLU A;  2KWC A;  5CHW A;  2I38 A;  1SXT A;  3PZD A;  4W9H A;  1YN3 A;  5EE9 A;  2M4N A;  2W55 A;  4XGA B;  4IC7 B;  4A9A A;  2IGD A;  3UQA A;  2DZK A;  3NHE B;  3DDC B;  4A3P A;  4HKQ A;  3TL5 A;  1ZOY B;  4JIO U;  4WJQ A;  2DAF A;  3TCA A;  1HEZ E;  2DNF A;  2AL3 A;  2D10 A;  3EA6 A;  3DHG C;  2IO3 B;  4G3X B;  4M0W A;  2ZCC A;  2JZ3 B;  3AM9 A;  4LNF A;  5FR6 A;  4EKU A;  3V62 A;  3SFD B;  1DGJ A;  4ANV A;  4DDI D;  1OFF A;  1PFD A;  2AYO B;  3FIL A;  2IDY A;  3TJP A;  4C56 C;  1UH6 A;  1WFY A;  2KTR A;  3OWE B;  1VZ7 A;  1T0R C;  3NS1 A;  2V9H A;  4P6V F;  3QA8 A;  1R4M B;  3R2T A;  3MC0 B;  1R4N B;  4YXD B;  2INP E;  2KDI A;  2PE9 A;  4IWQ A;  2IGH A;  4HJK A;  3EHV A;  3DBL I;  2C60 A;  4IDI A;  4S17 A;  4M8M A;  4JLC A;  2KFJ A;  4LNN A;  3Q8B A;  4BKS A;  2NBW B;  4RF0 A;  4EEW A;  1MI0 A;  3C19 A;  3MTN B;  3N32 A;  1TTN A;  4A55 A;  1KFY B;  4MGZ E;  1QIL A;  4KDI C;  3KYD D;  2LGS A;  3TEX A;  1WZ3 A;  3ZTD A;  2K8H A;  3HM6 X;  2K39 A;  1KF6 B;  2XK5 B;  4UDU C;  2FCS A;  2G9H D;  2GRI A;  3P4Q B;  4JWU C;  2V3N A;  5IKC M;  3WAM A;  4A6Q A;  2G4D B;  3AV8 A;  1D5X C;  2GBR A;  3VR9 B;  1XO3 A;  2MBH A;  3ZVV A;  3CST A;  4BOZ B;  1WGY A;  2ZVO A;  4W9K A;  2O2V A;  1QKZ A;  4I6L B;  3IAM 1;  1WF9 A;  1QOA A;  1YX5 B;  2WXO A;  1ZUD 2;  3A33 B;  1JRP A;  3EGR A;  2N9K A;  3EUB 2;  3CIR B;  2LUE A;  2ZPY A;  3H7P A;  1WH3 A;  4S0R A;  3BK2 A;  2JX5 A;  1EU4 A;  2PW9 A;  2FAZ A;  1BUI C;  3TSS A;  2QSD A;  5E6N A;  3RZF A;  4KZ0 A;  1MG4 A;  2KVR A;  3HVD A;  2H88 B;  1F2R I;  2FID A;  1ZXI A;  1F77 A;  1NVI D;  1WXA A;  3AEC B;  5AZF A;  3PO0 A;  3A4S C;  4XZ4 A;  4NY0 A;  3LYY A;  1GPX A;  3RN9 C;  2X38 A;  1L0V B;  3OJ3 A;  1P9D U;  3WAP A;  1K52 A;  3ALB A;  1XLQ A;  2YEP F;  4WWP A;  1FXI A;  3KLS X;  5G5G A;  2K6D B;  2IJ0 A;  1ZW7 A;  2MH7 A;  3AE2 B;  4NAW A;  3GE3 C;  2PVO D;  3K9P B;  3L0W B;  3BYT B;  4H2A A;  2PE6 B;  1WX7 A;  3QAQ A;  3GS2 A;  1ROE A;  5FK9 C;  1M94 A;  3QC8 B;  3PPA A;  4YTN B;  3ZLZ A;  5E6P A;  1WYW B;  2BWF A;  3SD5 A;  1XXG A;  2LRU A;  3ZNG C;  2LFI A;  1XCQ L;  4IWO A;  1RAX A;  4K81 A;  3M62 B;  1GOZ A;  4A8X C;  1AYF A;  1UNS A;  1FRR A;  2KTF A;  3TEW A;  2KN4 A;  2BYT A;  2CHX A;  1ZPS A;  4BBN F;  1HE8 A;  1T0S C;  1J7B A;  5D6J B;  1KLU D;  5EE3 A;  2MHJ A;  2L0T A;  2KYW A;  5DPW A;  2QCZ A;  1P1A A;  2W3S A;  3A9J A;  3U30 A;  1LGR A;  4GU2 A;  1SIF A;  3QQ8 B;  1FXA A;  2KZR A;  1ZDX A;  4GDL A;  3GB1 A;  4OZC A;  1S3S G;  4W9F A;  3BVZ A;  2J0K A;  1FPY A;  3M95 A;  4USA A;  3N1Y C;  4KIK A;  5CHV C;  3RD2 A;  4FLH A;  5BMG A;  3N3K B;  2YEP B;  1NI3 A;  3NUH B;  3H8H A;  1QQR A;  1G6J A;  1GUA B;  2RGF A;  2WNM A;  3ML8 A;  2C7N B;  2JXT A;  3VQI A;  2KC2 A;  2RDB C;  3WIM A;  1TKY A;  3AN1 A;  2BQQ A;  4KX6 B;  2EMS A;  1WGD A;  3AI5 A;  3AED B;  4C4V A;  1KLG D;  1NEK B;  1MG8 A;  4RGT A;  3RFZ B;  5D7G A;  1E9M A;  3DOW A;  2WX1 A;  4IM2 A;  1V9J A;  2M17 A;  1VRA B;  2M8S A;  4PS7 A;  5H8Y E;  1FCL A;  2HJ8 A;  3SEB A;  1H4R A;  1WRI A;  3V05 A;  3Q8F A;  2IO0 B;  3M3J A;  2Y5P A;  4XWW A;  3FKY A;  3S2A A;  2OHF A;  3N9Y C;  1UGJ A;  2ZVN A;  3E9S A;  3PV1 A;  1KH0 A;  1OQY A;  2LAS A;  2KK8 A;  4C00 A;  2W54 A;  1V8C A;  1OGW A;  4EE2 A;  3RT3 B;  1L0Y B;  1I42 A;  1XT9 B;  4MAC A;  2WXM A;  2AWT A;  1WGR A;  2BW2 A;  3DHI C;  4RFB A;  1LQB A;  1TY0 A;  2ZEQ A;  3PSE B;  2ASQ A;  1J8C A;  3MC8 A;  2PTL A;  3DHH C;  2MBE A;  1E8W A;  2H89 B;  4G50 A;  1QOF A;  2W9N A;  1UEL A;  4OVZ A;  3SDL C;  1EM7 A;  3W5V B;  2KVZ A;  3VHT C;  4CO7 A;  1PQS A;  2BB5 A;  2KMM A;  5BYR A;  4ZYS A;  2BYF A;  3AE4 B;  2BB6 A;  1E7P B;  3R2I A;  1Q5W B;  4ZHP A;  3PZ7 A;  4US9 A;  1MHH E;  3BZD B;  5D3I B;  4FJZ A;  4KIK B;  1K53 A;  4LTU A;  2C5L C;  4BFR A;  3NOB A;  4OVU A;  1AW7 A;  2UU7 A;  4KV2 A;  4RH6 A;  3APD A;  1SSN A;  2HDE A;  2IGG A;  1WMH B;  5D3D A;  4B9K A;  1N63 A;  4HRO A;  3PRE A;  1SB3 C;  2MX2 A;  3VFK A;  3HK0 A;  1QF6 A;  3DPD A;  4HJG E;  3N1Z C;  4W9C A;  2JZZ A;  4KGS A;  3ZW3 A;  2WU5 B;  1BML C;  3RNG C;  3QX1 A;  4HXD A;  2PKO A;  5HHD G;  2ACZ B;  1F0Z A;  2LGD A;  2OED A;  3PRM B;  5HKH A;  1WE7 A;  2L05 A;  3W9C B;  2Z0D B;  3MHS D;  1N5X A;  2B3A A;  1WJ6 A;  4O1N A;  4MJS A;  3JSV A;  1KTK A;  3MC9 A;  3Q8A A;  2E6X A;  2Y3A A;  3LJ3 A;  2JXX A;  2MP2 B;  2RDH A;  3Q2A C;  3ZKJ C;  5LXI B;  4MSM B;  1TZO A;  5CHF A;  1LXD A;  1R4N I;  2IYD B;  4KKI A;  2K5P A;  3N1X C;  2DLB A;  1QT9 A;  3CF6 E;  1ZE3 D;  3B08 A;  3ZNZ B;  1YJJ A;  4DHJ D;  2N7J A;  3EEC A;  2FNJ B;  3U4E G;  3AEB B;  4W9I A;  3ECI A;  1JRU A;  1LM8 B;  5JXV A;  3BII D;  4HVB A;  1ET9 A;  3A9J B;  4BOS C;  1XLO A;  2MJ3 A;  2WDV B;  1MVK A;  3A1Q A;  2CR5 A;  2NBV B;  1SE4 A;  3AUL A;  2WLB A;  5T8I A;  5CX3 A;  3U52 E;  4JQW C;  2DZJ A;  2JQR B;  5D94 A;  3TIX A;  2KOX A;  2WXL A;  2CKH B;  5G5H A;  3AEF B;  2BPS A;  1E7V A;  4MM3 B;  2KX0 A;  1D5M C;  1T6B X;  4OZB A;  3EC8 A;  2FCM A;  4MGI E;  3PS6 A;  4NJ6 A;  4WWO A;  5KHO A;  2WXP A;  2V4I B;  2LJI A;  4IUM B;  4MGK E;  1JML A;  3SHQ A;  4DXG A;  1CZP A;  3GZN B;  2CU1 A;  1GB1 A;  2JRI B;  4GGQ A;  5EE1 A;  5TR5 A;  1LO5 D;  2BKR B;  1V49 A;  3MJ5 A;  4ZOH C;  2INC C;  2MWS B;  2R2Q A;  4DWF A;  4OVV A;  1YQ3 B;  2N1V A;  4GOC A;  4FUL A;  2L7R A;  1GNU A;  4IM0 A;  3AEA B;  4OHJ A;  1JWA D;  5I4D A;  1SJH D;  3HHM A;  2N9L A;  4IKG A;  3Q3M C;  4I6P A;  2FIF A;  3AE3 B;  4NJ7 A;  2RPQ A;  2WU2 B;  3A9K B;  3NJT A;  1I4H A;  4J3O D;  4BVU C;  3TMP B; 
#chains in the Genus database with same CATH homology
 4K7S A;  2MBO A;  4NQK E;  1WF9 A;  1YX5 B;  4W9L A;  3RCZ A;  3A33 B;  2FUH B;  2JUO A;  4FN2 A;  1C1Y B;  2MSE D;  3NS8 A;  4DHZ E;  3B1L X;  2LUE A;  2LXA A;  2ZPY A;  2K6Q A;  3H7P A;  1WH3 A;  4ANU A;  1L7Y A;  2LWP A;  4DDG D;  2V1Y A;  4RM9 A;  3AU5 A;  2FAZ A;  3M63 B;  3DVG X;  3VAW A;  3T8M A;  1P98 A;  1Q0W B;  3ENE A;  2C7M B;  2KFK A;  5E6N A;  3RZF A;  3AU4 A;  5LXH A;  4KZ0 A;  4LDT D;  2LVQ A;  2N9E B;  2KVR A;  2LGX A;  2KAN A;  3KW5 B;  4G11 A;  5LLI A;  1F9J A;  4FBJ B;  1VD2 A;  2D3G A;  2N7D A;  2KQS A;  3HIZ A;  2KTR B;  2KLC A;  1WXV A;  4NNJ B;  3L54 A;  1NI2 A;  1E5W A;  2KWV B;  4BKS D;  3ZDM C;  4WWN A;  2FID A;  2HD5 B;  4FAD A;  4NAW B;  2MQJ A;  1GC6 A;  4BBN C;  3DVG Y;  1WXA A;  5JHB A;  3APC A;  5AZF A;  1A5R A;  2UWQ A;  3I3T B;  3A4S C;  4MEL A;  4XZ4 A;  4NY0 A;  3PT2 B;  5D2M B;  4AJY B;  2CS4 A;  4LDT B;  3EFU A;  4KZC A;  2KO3 A;  3W1S A;  3X23 A;  3LDZ E;  2I1K A;  4CHK A;  3OJ3 A;  1P9D U;  4FHJ A;  5IA7 A;  1NBF C;  3WAP A;  4HLE A;  2KFK B;  4G0N B;  3ALB A;  3PHW B;  4MM3 A;  4GSW A;  3R7Q A;  5DPR A;  4WWP A;  2DZI A;  3V6C B;  2KKC A;  4GDK A;  1T0Y A;  1TGZ B;  2KXJ A;  2K6D B;  4RMA A;  1ZW7 A;  4WQO B;  2LRW A;  3UF8 A;  4NAW A;  3OJ4 B;  1H8C A;  3K9P B;  4K7U A;  3L0W B;  2PE6 B;  2BGF A;  4TUU A;  1E8Z A;  4GB9 A;  1WX7 A;  3ZRC A;  3QAQ A;  2ZNV C;  4AJW A;  2DAJ A;  2V3S A;  3H7S A;  3QCA A;  4TV3 A;  2GBK A;  3N30 A;  3UIP B;  4F7Z A;  3DCG A;  1V81 A;  3KYC D;  5KHQ A;  1M94 A;  1Z5S B;  3QC8 B;  4PYU A;  1UD7 A;  2K25 A;  2IZV B;  3PPA A;  1RFA A;  4AUQ C;  3ZLZ A;  4HDQ A;  5E6P A;  2NR2 A;  1WYW B;  2BWF A;  3H6N A;  3SD5 A;  2YLM A;  1YQB A;  4GDK B;  2IY1 B;  2LRU A;  2QHO A;  4TQ1 A;  4N9F 4;  5GMV A;  2UYZ B;  1WX8 A;  1WXM A;  1V86 A;  2LJ5 A;  2AEH A;  1UGM A;  2KDB A;  3ZNG C;  3IG3 A;  2LZ6 A;  4IWO A;  1RAX A;  2WX0 A;  1ISN A;  3KH0 A;  4K81 A;  3M62 B;  2DYB A;  2M1M A;  1BT0 A;  2KJR A;  1X1M A;  1V2Y A;  1ZGU B;  2KTF A;  3DBR I;  3U8Z A;  2MBQ A;  4MGY E;  1SGH A;  2LGY A;  4E3C A;  2CHX A;  3ONS A;  2G45 B;  3Q3F A;  4FJV B;  4MJS B;  2Z59 B;  4A3O A;  4EZK A;  5L83 A;  4HK2 A;  4BBN F;  2MP2 A;  2N4F A;  4II2 B;  2NCN A;  3PRZ A;  1HE8 A;  5D6J B;  3R3M A;  3T9L A;  1WGH A;  4YL8 A;  2L0T A;  3APF A;  4GMV A;  2I1J A;  1GC7 A;  3DBH I;  3O65 B;  1E8X A;  2DZM A;  5CTR C;  4ZRK A;  2WYQ A;  3A9K A;  5DPW A;  4DHZ B;  1KJT A;  4HDO A;  3H7P B;  4DHJ B;  2O2V B;  2KHW B;  1P1A A;  2RSU A;  1C3T A;  3A9J A;  3U30 A;  4EOY A;  4ASW C;  3WAN A;  2K8C A;  1WRD B;  4HPL B;  1WI0 A;  4IW0 A;  1EF1 A;  2WWZ A;  2Y5B B;  2ZNV B;  3VH4 B;  4EUT A;  5EDS A;  4GU2 A;  1U4A A;  1P3Q U;  1SIF A;  2C7H A;  3QQ8 B;  4RM8 A;  3VTV A;  2KZR A;  5JZE B;  4GDL A;  4FA6 A;  4KSK C;  5AZG A;  1S3S G;  2XEW A;  4W9F A;  5C23 A;  2CHW A;  1YIW A;  3M95 A;  2J0K A;  1UBQ A;  2ZZP B;  2IO2 B;  4KIK A;  5CHV C;  3QHT A;  2KMA A;  4WAA A;  3RD2 A;  3VH3 B;  3VVW B;  3WA0 A;  4FLH A;  2MA9 B;  1WR6 E;  2IY0 B;  3N3K B;  4AP4 C;  1WR1 A;  4MH0 E;  4ZRI A;  3JYU A;  1I35 A;  1G6J A;  1GUA B;  2KD0 A;  1P0R A;  1OTR B;  2J0J A;  2KMC A;  2RGF A;  3W1S C;  1GG3 A;  3JW0 X;  3ZNH B;  3DQV A;  3ML8 A;  2C7N B;  2IO1 B;  1UBI A;  1WMH A;  3VQI A;  2KC2 A;  2JVC A;  3WAL A;  5C1Z A;  1YX6 B;  3V6E B;  3WIM A;  4GDL B;  1YJ1 A;  4WJN A;  4AWJ A;  2KN5 A;  2V4L A;  3DVN U;  3NZS A;  3ZRF A;  3KUZ A;  2EMS A;  2ZJD A;  3PLV A;  1WGD A;  4P7I A;  3GOE A;  3ZIM A;  3AI5 A;  2JF5 A;  5L95 C;  2A5U A;  4X57 B;  1EF5 A;  1EO6 A;  4URK A;  1MG8 A;  2LD9 A;  3QK0 A;  4IWP A;  1WE6 A;  3NZU A;  5D7G A;  3KVF B;  4KSL C;  3DOW A;  2WX1 A;  2EKE C;  4IM2 A;  1V9J A;  2KJ6 A;  3PTF C;  1R4M I;  1TZ1 A;  2M17 A;  4A20 A;  1QZE A;  1ZKH A;  2M8S A;  3RYT A;  2N7E A;  4ANW A;  2NPT A;  4AOF A;  3C0R B;  4PS7 A;  2N9X A;  1UZX B;  2HJ8 A;  2O6V B;  3PVL A;  4F8C B;  1H4R A;  2LI5 A;  2IO0 B;  3M3J A;  2XK5 A;  4W9K A;  1J19 A;  5DPS A;  3S2A A;  2JT4 B;  2K8B A;  3HM3 A;  2ZVN A;  2HE7 A;  3PV1 A;  3QJZ A;  3H9D A;  5JH5 C;  1L2N A;  1OQY A;  2LAS A;  3L08 A;  2KK8 A;  3B0A A;  3X0W A;  3L16 A;  5DPT A;  3R7R A;  4XX5 A;  3ZNI D;  1WM3 A;  4I6N B;  1OGW A;  3RT3 B;  2MCN B;  4K7W A;  3ML9 A;  4NPN A;  1I42 A;  1XT9 B;  4DXA B;  4EZJ A;  4FHK A;  1YD8 U;  2NPT B;  2AL6 A;  1WGR A;  2AWT A;  2DYO A;  2OJR A;  2MLB A;  3V60 A;  4W9E A;  1LQB A;  2ZEQ A;  3PSE B;  3RZW C;  2ASQ A;  3IFW B;  1J8C A;  4M0W B;  4WJO A;  3QWZ B;  2REX A;  5J17 A;  1S1Q B;  2MBE A;  3QAR A;  1E8W A;  4IM3 A;  2R2O A;  4G50 A;  2W9N A;  1UEL A;  1WY8 A;  2ZCB A;  5J18 A;  3SDL C;  2DYM A;  3L13 A;  3BY4 B;  5DCN A;  3MJW A;  2JPH A;  4PS3 A;  2A4Z A;  3VHT C;  2KWU B;  1PQS A;  2GBJ A;  2OOB B;  4CO7 A;  1WJN A;  2VRR B;  5IAA C;  4FJY A;  3OLM D;  4GIV A;  2BYF A;  2RD0 A;  2KNB A;  3CMM B;  3R66 C;  1KOT A;  1Q5W B;  1WZ0 A;  1XQQ A;  2MRP A;  3BIN A;  3A1Q B;  3AXC A;  3UIN B;  4LJO B;  3SU8 X;  2D11 A;  4FJZ A;  2PJH A;  4ZYN A;  4KIK B;  3UQB A;  1V5O A;  2LVO A;  2C5L C;  4BFR A;  1WJ4 A;  3RUI B;  3NOB A;  1Y8R C;  4OVU A;  4JL9 A;  4KV2 A;  4KDL B;  2C9W B;  3UIO B;  1LFD A;  1Q1O A;  2PPH A;  3APD A;  3QIJ A;  3VTW A;  2N9P C;  2GBM A;  4E71 A;  3WAO A;  2BYE A;  4M8N A;  4EZL A;  1WMH B;  2ZPN A;  4B9K A;  2GOW A;  1J0G A;  3UGB B;  2KLG A;  2L3Z A;  3KUC B;  2JY6 A;  3K9O B;  3PRE A;  4ZRJ A;  3VTU A;  2MX2 A;  2MBB B;  2J7Q B;  1Z2M A;  1VCB A;  3VFK A;  3HK0 A;  3OAW A;  5AZH A;  4TQ0 A;  4MSQ B;  3DPD A;  3VXW A;  4W9C A;  4W9D A;  1K8R B;  2JZZ A;  3PHX B;  3ZW3 A;  2JRH A;  3JSV B;  4JGH B;  1KLV A;  3QX1 A;  1E90 A;  4PS8 A;  4HXD A;  2BKF A;  4DBG A;  2DX5 B;  3A4R A;  1RLF A;  3VUY A;  2G4S A;  4DK5 A;  2GBN A;  4HCP B;  1EUV B;  2LGD A;  3JVZ X;  4TKN A;  3PRM B;  2D2Q A;  2NS5 A;  5HKH A;  2XBB C;  4E74 A;  1WE7 A;  1WX9 A;  4PYZ A;  3PLU A;  2KWC A;  4MDK E;  5CHW A;  3VUX A;  2L05 A;  4NQL B;  1TBE A;  2Z0D B;  3MHS D;  3PZD A;  4W9H A;  5JHA A;  2BWE S;  1WM2 A;  2B3A A;  1WJ6 A;  2M4N A;  4MJS A;  3JSV A;  4HWI B;  2BYV E;  4IC7 B;  3LJ3 A;  4BKG A;  2G3Q B;  2JXX A;  2MP2 B;  5G55 A;  3ZKJ C;  2DZK A;  3NHE B;  3UQA A;  3DDC B;  4A3P A;  5LXI B;  1NDD A;  4KVG B;  4LJP B;  4ZDV A;  3TL5 A;  4MSM B;  4JIO U;  2FCN A;  1AAR A;  4WJQ A;  1IPG A;  2DAF A;  5CHF A;  2KQ7 A;  4II3 B;  4J6I A;  4XC2 A;  3ZTC A;  3TCA A;  2IBI B;  3IHP C;  2AL3 A;  2D10 A;  1LXD A;  1R4N I;  2IYD B;  3NY5 A;  4W9G A;  2IO3 B;  4G3X B;  3CF6 E;  3RUL A;  2ZCC A;  4IG7 B;  2JZ3 B;  1IYF A;  3B08 A;  3ZNZ B;  5FR6 A;  5AEK B;  4DHJ D;  4B6W A;  3EEC A;  2L00 B;  2Z0E B;  3U7D A;  3V62 A;  4EKU A;  2FNJ B;  4ANV A;  1V80 A;  2LVP A;  4W9I A;  3ECI A;  4DDI D;  5G2N A;  4F1S A;  2NVU I;  1JRU A;  1LM8 B;  1WGG A;  2KDE B;  2N1W A;  2PEA A;  5BO4 B;  1SE9 A;  2AYO B;  3TJP A;  2L76 A;  4HVB A;  3ZDT A;  1UH6 A;  1RRB A;  3A9J B;  4BOS C;  1WFY A;  2KTR A;  1GJZ A;  3DVN V;  1WJU A;  4ICU A;  4MEM A;  3A1Q A;  2L0F A;  3Q3J A;  2CR5 A;  2NBV B;  4B95 A;  3AUL A;  3L10 B;  4ICV A;  3KUD B;  3P2B A;  2M0X A;  2KX3 A;  3QA8 A;  2K1F A;  2D07 B;  2EMT A;  1D3Z A;  2GMI C;  4EFO A;  1E7U A;  1WIA A;  5CX3 A;  4JQW C;  3ZUN A;  3DBS A;  2JWZ A;  2DZJ A;  5D94 A;  3TIX A;  2KOX A;  2DEN B;  1FXT B;  2CKH B;  2BPS A;  1E7V A;  2KX0 A;  2KDI A;  2PE9 A;  2KC1 A;  4IWQ A;  1E8Y A;  4HJK A;  3EHV A;  3DBL I;  5E6O A;  2C60 A;  3EC8 A;  2FCM A;  4LCD E;  4MGI E;  4M8M A;  4GN1 A;  4JLC A;  3PS6 A;  3L17 A;  4NJ6 A;  4K1R B;  4WWO A;  3VDZ A;  2KFJ A;  5KHO A;  3H1U A;  3ZO5 B;  4BKS A;  4IUM B;  4MGK E;  1V6E A;  1KM7 A;  2NBW B;  3SHQ A;  3D32 A;  2RR9 A;  4HPM B;  1XD3 B;  4EEW A;  3MTN B;  3N32 A;  2CU1 A;  2KDF B;  3W1Y A;  1TTN A;  4MGZ E;  1WXS A;  2JRI B;  4KDI C;  4GGQ A;  2L8J A;  5TR5 A;  3KYD D;  2BKR B;  3TBL D;  3IVF A;  1V49 A;  3VUW A;  1WZ3 A;  3ZTD A;  2K8H A;  3HM6 X;  4W9J A;  2K39 A;  2MWS B;  4CYE A;  2R2Q A;  4BKT A;  2XK5 B;  4OVV A;  2NBU A;  2N1V A;  4DWF A;  2FCQ A;  2O6V D;  2FCS A;  3CSF A;  4GOC A;  2BF8 B;  4FUL A;  2L7R A;  1GNU A;  4IM0 A;  3PGE A;  4WJP A;  1IP9 A;  1OEY J;  3V61 A;  2WDT B;  3WAM A;  5J2R A;  2KJH B;  2G4D B;  2J0M A;  2HTH A;  2O6V A;  2LXC A;  2CHZ A;  2GBR A;  3IBE A;  3HHM A;  4GXB A;  2MBH A;  2DHZ A;  4I6P A;  3ZVV A;  3CST A;  4ANX A;  2FIF A;  4NJ7 A;  2MW5 A;  1CMX B;  1V5T A;  2RPQ A;  3A9K B;  1OEY A;  3PRP B;  2YVC A;  4HCN B;  4BOZ B;  1WGY A;  3GZN I;  2ZVO A;  2O2V A;  4I6L B;  4BVU C;  3TMP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...