2G4SA

Anomalous substructure of nbr1pb1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
AMEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Next to BRCA1 gene 1 protein
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 24
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2g4sA01
3PREA 1P1AA 1ZKHA 2J0KA 4FLHA 2ZVNA 3VUWA 4EZJA 4PYZA 1UGMA 1I42A 4FN2A 3WAMA 2FAZA 1SE9A 1RAXA 3NHEB 4M8NA 3TJPA 2J7QB 4NJ6A 4IG7B 2JXXA 2KDBA 3O65B 3CF6E 4KZ0A 1WM2A 1WZ3A 3M62B 2BPSA 2D11A 2IO1B 3A9JA 2RPQA 3VHTC 4EZKA 2RR9A 2Y5BB 3WALA 1WM3A 2RD0A 1UBQA 4W9GA 1R4NI 3A33B 2RSUA 2A5UA 4HK2A 2JF5A 2JVCA 2N1VA 3MHSD 2M4NA 4MJSA 2LVPA 3OLMD 4HDQA 4MEMA 1WR6E 2D10A 4E71A 3JSVB 2C7NB 2KLGA 3DVNV 5CHWA 1KLVA 2V4LA 2WX0A 4WQOB 4F8CB 3S2AA 1LM8B 2MRPA 1UBIA 4HCPB 1KJTA 3VXWA 2MX2A 4M8MA 3N3KB 4BBNC 3UGBB 4I6PA 2MP2A 2JRIB 2GMIC 2CU1A 2CS4A 1YJ1A 4NQKE 3WANA 3HHMA 1S3SG 2KN5A 3ZTDA 2IO3B 2KTFA 3CMMB 2G4SA 2ZZPB 1V49A 2Z59B 2FNJB 5D94A 5DCNA 5KHQA 4HDOA 3DDCB 3PSEB 3ALBA 1VD2A 4NNJB 1E7UA 2LVQA 3DCGA 4ZRKA 5BO4B 3K9OB 3KW5B 2CHWA 1D3ZA 2I1JA 3HM6X 4FJZA 1WX7A 4NQLB 1ISNA 4E74A 2MBHA 3ZTCA 2N4FA 2UWQA 3A9JB 4IWQA 3RZFA 2K6DB 2WYQA 4RMAA 2L8JA 4GDLA 3UIOB 4DHZB 4DK5A 3MJWA 4GDKA 4P7IA 1V5OA 2CKHB 3R7QA 2KOXA 2JY6A 2KFJA 5C23A 4MJSB 1E8WA 2Z0DB 3M63B 1WMHA 3QC8B 3KUDB 1WGDA 2K8HA 1GJZA 1QZEA 2IO2B 3KH0A 3M95A 1WZ0A 3WIMA 2BYFA 2IY0B 4MH0E 2IO0B 4EFOA 3ML8A 2IY1B 3H9DA 1OTRB 2C5LC 3AULA 3QCAA 2HJ8A 3W1SC 5DPWA 3APDA 3VUYA 5J18A 2NVUI 3U8ZA 5D6JB 3VAWA 2LRWA 2L0FA 3A1QA 3A9KB 2MBBB 4NJ7A 5LXIB 2BYVE 3PLVA 3QQ8B 4YL8A 4N9F4 4IWPA 2N9XA 2NBUA 1WGRA 2W9NA 2GOWA 2FIFA 3DBRI 1WX8A 4HJKA 4K1RB 2C9WB 2L7RA 4A3PA 2MA9B 2AEHA 5AEKB 5J2RA 2NPTB 3EECA 4MSMB 2BKFA 3H7PB 3QA8A 3R3MA 3V61A 1P0RA 5CX3A 3RZWC 4ICUA 4NAWA 4FJVB 4ZYNA 1TBEA 2K6QA 2PPHA 1Q0WB 2G45B 1WGYA 4IWOA 5DPRA 4BKGA 2KNBA 2ZPYA 4GDKB 2ZNVB 2LGDA 3QJZA 5J17A 1TGZB 3ZDMC 4HLEA 4KIKA 4AUQC 3PRZA 4WWPA 4HCNB 2KX3A 2V1YA 2N1WA 1WF9A 3EC8A 2O6VB 3DQVA 4GB9A 1MG8A 4MGIE 4ZDVA 2R2OA 5JZEB 3L16A 1EF5A 5E6OA 4LDTB 4WWNA 1WGHA 5CTRC 3A4RA 3RYTA 2GBNA 2GBMA 4GU2A 4OVUA 1XT9B 1WE6A 4AJWA 2BKRB 2AYOB 3PHXB 2HD5B 3SD5A 2KDIA 3T8MA 1V5TA 4AWJA 2KVRA 2IBIB 5IA7A 1G6JA 1RRBA 1EF1A 2KDEB 4DDGD 1WY8A 2ZCBA 4MDKE 4DXAB 4II3B 3B0AA 3DVGX 3R7RA 3V60A 1E8ZA 3PT2B 1L7YA 3L13A 5DPTA 2KX0A 4CYEA 4I6LB 4W9JA 2KMAA 2VRRB 3QHTA 1WFYA 4W9EA 4B9KA 2EKEC 3PZDA 4X57B 4W9DA 5D7GA 4KVGB 4BFRA 2XK5A 2M0XA 1A5RA 1C3TA 4JGHB 1V86A 4JL9A 4RM9A 1P9DU 2XEWA 4LCDE 4NAWB 5LXHA 3DBLI 4EKUA 1X1MA 2GBRA 2MQJA 3VTWA 2CHZA 1WH3A 2DZKA 3NS8A 2KC1A 2O6VD 4FADA 1WXMA 2L3ZA 4W9CA 3W1SA 3DBHI 2DZJA 1WXAA 2MW5A 3TCAA 2KK8A 2IZVB 4ANVA 3EHVA 2REXA 4BOZB 1JRUA 2KQSA 2J0MA 1L2NA 1CMXB 2GBKA 2K39A 2YVCA 1Q5WB 2HE7A 2MBEA 1PQSA 1WI0A 3APCA 2YLMA 3TL5A 3IHPC 3ONSA 4XC2A 1U4AA 1XQQA 2KANA 3GOEA 4PS3A 2JRHA 2BF8B 2KWCA 4G3XB 2I1KA 4URKA 3ZNHB 5JHBA 2LGYA 2PE9A 2DYBA 3ZNZB 4EZLA 4ZRIA 4IW0A 1NBFC 2EMTA 4DBGA 1Z2MA 3P2BA 1RLFA 2ZCCA 4TUUA 1LFDA 2OOBB 3DPDA 2LD9A 3N30A 4ICVA 4BKSA 1IP9A 3NZSA 2K8BA 4W9KA 1YIWA 2R2QA 4WJNA 3VDZA 2C7MB 2NR2A 3Q3FA 5AZGA 3DVGY 3WAOA 4ANXA 2UYZB 1F9JA 3L54A 4TQ1A 3HIZA 3ZLZA 3U30A 4KDIC 2BGFA 4B6WA 4G11A 4JLCA 4ASWC 1LQBA 2CHXA 3AI5A 4XX5A 4A20A 5E6PA 3ZW3A 2KHWB 3UIPB 3T9LA 4FJYA 1WXVA 2PJHA 2ZPNA 3VTUA 2KFKA 4KSKC 2MP2B 4HVBA 4G50A 2KD0A 2LI5A 2WWZA 2LVOA 4EOYA 1KM7A 1V80A 2MWSB 2NBWB 3UINB 3VVWB 4NY0A 1M94A 2KQ7A 1WR1A 3ZDTA 3ZRFA 3V6CB 4I6NB 1GUAB 4PS8A 1UD7A 1ZGUB 3ML9A 4E3CA 2K25A 1UZXB 2PEAA 3M3JA 1TTNA 2WX1A 2BWES 3H6NA 4BVUC 4DHZE 3VH3B 4GOCA 2V3SA 1HE8A 4GN1A 2FIDA 1YX5B 4GDLB 4JIOU 2KMCA 2LWPA 2DX5B 3L08A 3PPAA 1IPGA 3QX1A 3TIXA 1WRDB 2MBOA 2KZRA 3L0WB 3X0WA 3H1UA 4BKTA 1GG3A 1WMHB 3PS6A 3VFKA 4BBNF 3EFUA 3ZRCA 2K1FA 3VTVA 4MGKE 2FCQA 3KUZA 3OJ4B 1GC6A 2DZIA 4MSQB 3PLUA 2KJHB 1OEYA 4MGYE 3DVNU 2MLBA 3SDLC 1WXSA 3A1QB 2IYDB 2MSED 2A4ZA 4DHJB 1E5WA 2JUOA 4K81A 5CHFA 5TR5A 3ZUNA 1YQBA 1T0YA 4GGQA 2D07B 3TBLD 1OQYA 4HPLB 4LJPB 3GZNI 3ENEA 5E6NA 2KLCA 4FBJB 3HM3A 1V9JA 3DOWA 1LXDA 4A3OA 2L76A 4PYUA 4DWFA 3APFA 4IC7B 1H4RA 2LUEA 5L83A 4KZCA 1WYWB 4KV2A 2ZEQA 4AP4C 4HWIB 4RM8A 1NI2A 2LXCA 3CSTA 3JVZX 4WJQA 3A4SC 2JPHA 3BINA 3L10B 3TMPB 1WX9A 1SGHA 2B3AA 4MM3A 4KIKB 4IM3A 1P98A 3PV1A 4LDTD 1Q1OA 2ZJDA 1IYFA 3PVLA 4GSWA 3AU5A 1RFAA 4GXBA 2MCNB 2LJ5A 2NCNA 2FCNA 2RGFA 2LRUA 2PE6B 4J6IA 4EUTA 2LASA 3QARA 2JWZA 4KSLC 5GMVA 4DHJD 2DAFA 2EMSA 2KJ6A 4WAAA 1J8CA 4WJOA 4LJOB 2LZ6A 4XZ4A 3NZUA 1NDDA 2N9PC 1E7VA 3OJ3A 1S1QB 1V6EA 2KDFB 3MTNB 3QIJA 4FHKA 5FR6A 1OEYJ 4HPMB 4PS7A 2K8CA 5JHAA 1EO6A 4B95A 3LDZE 1K8RB 1BT0A 1WJ6A 2LGXA 4TKNA 1UH6A 3UQAA 3C0RB 1YX6B 2M8SA 2CR5A 2O2VA 2XK5B 2AL3A 2D3GA 4W9IA 2JZ3B 5G55A 3QK0A 2BWFA 3WA0A 5AZFA 5C1ZA 2N7EA 3RD2A 4F1SA 5JH5C 4MELA 1P3QU 2BYEA 2L05A 3L17A 4ZRJA 3A9KA 3ZKJC 3UF8A 2MBQA 1OGWA 3KYCD 4GIVA 4K7WA 4W9HA 2G4DB 3H7SA 1E8YA 2KTRA 3PHWB 1WJ4A 3JYUA 4CHKA 1GC7A 5KHOA 2ASQA 4K7SA 2JT4B 1XD3B 2NPTA 5LLIA 1FXTB 3H7PA 3SU8X 3AXCA 2DYMA 5D2MB 1KOTA 3W1YA 1WJNA 2GBJA 4OVVA 1VCBA 1WIAA 2XBBC 3R66C 4AOFA 3RUIB 3BY4B 2DENB 4WJPA 5CHVC 4MGZE 3ECIA 3ZIMA 3UQBA 3ZNGC 4K7UA 1E8XA 3HK0A 3OAWA 3N32A 1UELA 4IM2A 2O6VA 4KDLB 1V2YA 3RT3B 2DAJA 1Z5SB 3IVFA 3ZVVA 4JQWC 3D32A 4W9FA 4FHJA 1Y8RC 3IBEA 3RCZA 4G0NB 3SHQA 4W9LA 4TQ0A 2C60A 3KYDD 3JW0X 2NBVB 2O2VB 1J0GA 2D2QA 3PRMB 3CSFA 2KC2A 3PTFC 2FCMA 3NOBA 1SIFA 4IM0A 2KWUB 5G2NA 5AZHA 5EDSA 2KJRA 3ZO5B 2AL6A 2M1MA 2WDTB 3Q3JA 3RULA 3U7DA 3PRPB 1YD8U 2KTRB 3K9PB 4DDID 3VH4B 1H8CA 1I35A 2L0TA 1J19A 3DBSA 2N7DA 4FULA 2N9EB 3IFWB 2FUHB 4IUMB 3VQIA 1WE7A 5DPSA 3VUXA 3WAPA 3I3TB 3V6EB 4ANUA 4CO7A 3LJ3A 4GMVA 4HXDA 2L00B 2KXJA 4NPNA 2G3QB 4FA6A 2KFKB 2C7HA 2KO3A 3V62A 1GNUA 1ZW7A 2KWVB 2QHOA 4BOSC 2DZMA 3B1LX 2AWTA 2DHZA 3AU4A 2KKCA 2LXAA 2M17A 4TV3A 4F7ZA 3KVFB 1WGGA 1EUVB 3IG3A 2Z0EB 2DYOA 5HKHA 2J0JA 3NY5A 3QWZB 4WWOA 3B08A 3JSVA 2HTHA 3QAQA 4BKSD 1C1YB 5IAAC 2FCSA 4II2B 1WJUA 3PGEA 2ZNVC 2JZZA 2OJRA 4M0WB 1TZ1A 1AARA 3ZNID 1E90A 4ANWA 2ZVOA 4AJYB 4EEWA 3KUCB 3X23A 5L95C 1V81A 1R4MI 2NS5A
chains in the Genus database with same CATH superfamily
3PREA 1P1AA 2J0KA 4FLHA 4EZJA 2WXOA 2PKOA 3PZ8A 2WXQA 4FN2A 1DOXA 1SE9A 1K51A 3NHEB 2I38A 1CZPA 3O65B 4NZLB 3R2TA 1WM2A 4OZCA 2RPQA 2MH7A 1YQ3B 3WALA 2RD0A 3BWUD 1XEEA 3A33B 2JF5A 1ZE3D 2M4NA 4HDQA 4MEMA 2C7NB 2INCC 2IGDA 3DVNV 2V4LA 1LM8B 3VXWA 4BBNC 2MX2A 1E7PB 1L4DB 3BZDB 3Q8AA 1SF0A 4YSYB 1QOBA 3ZJTA 2KQ4X 2G4SA 1JWMD 3DCGA 3GE8C 3ZJVA 3N1YC 2CHWA 1FRDA 2I1JA 3HRDD 1ISNA 4OZAA 1FXIA 3ZTCA 2N4FA 4RMAA 1V5OA 1YN3A 1I4RA 2CKHB 3R7QA 3KWLA 2KFJA 5C23A 2PVOD 1R4NB 3QC8B 2IO2B 3WIMA 1TY0A 1M4VA 2OEDA 3ML8A 5FKAC 3U8ZA 2VH2A 5D6JB 4PT5A 1C4AA 3A1QA 3WCQA 2BYVE 3QQ8B 3Q6BA 1WGRA 1ZP0B 4B0EA 2C9WB 1TY2A 4A3PA 2MA9B 2NPTB 3MC8A 2BKFA 3QA8A 3Q14C 2LEKA 2G45B 5DPRA 4IWOA 4JWSC 3QJZA 3SEBA 1TGZB 2FE8A 3RMKC 4HCNB 2N1WA 3SR6A 2O6VB 3DQVA 4MGIE 5JZEB 3L16A 2K5PA 2N0SB 5CTRC 1I4PA 2GBNA 2GBMA 3RYTA 4GU2A 1XT9B 4AJWA 4AWJA 1V5TA 3IT6B 2IBIB 1JWUD 1T0QC 1EF1A 1XLPA 2ZCBA 4MDKE 3R7RA 1N61A 4PK1A 4DHZB 3FC4A 2KX0A 4CYEA 1J7CA 1XLOA 1WFYA 4B9KA 3PZDA 2QILA 2BB6A 5D7GA 1A5RA 4JL9A 1P9DU 1D4BA 1LO5D 4RF1A 3AEEB 1TS2A 4EKUA 1X1MA 1WH3A 2DZKA 3RN9C 4WWMA 4BZAA 2JXTA 1WXQA 3TCAA 3TEXA 4BOZB 1SBBB 1JRUA 4YSXB 2J0MA 1CMXB 3APCA 1Q5WB 3BYTB 1XQQA 2JRHA 3C19A 3C8YA 4C4VB 2DYBA 3ZNZB 3T3OA 4ZRIA 2EMTA 4DBGA 4O1NA 3DPDA 3N30A 3P4PB 1F52A 3NZSA 1EWYC 1HA5A 1V97A 1YIWA 2ACZB 5AZGA 3L54A 1F9JA 2WXNA 3HIZA 4B6WA 4ZHPA 4JLCA 1MHXA 3T9LA 1WXVA 2PJHA 3AM9A 2AQ3B 2WDQB 3MHZA 4KSKC 4EOYA 2LVOA 1TKYA 1V80A 2MWSB 1J7AA 2GRIA 1D6EC 1M94A 1YJJA 3ZDTA 4R3DA 3V6CB 2QJLA 4I6NB 3GB1A 4PS8A 1PFDA 4M0WA 2J4XA 2WGSA 3VR9B 4JE3B 4JIOU 4ZOHC 1SE4A 3L08A 3QX1A 2KACA 1WRDB 3FILA 2K9XA 2MHJA 4BBNF 3EFUA 2L32A 1I4QA 5LNK1 1P7FA 2PTLA 3R2IA 1K52A 1WXSA 3A1QB 2IYDB 2MSED 4DHJB 2JUOA 5BYSA 5CHFA 5TR5A 2D07B 3NVYA 3GZNI 5E6NA 1UWXA 1V9JA 2M0AA 1LXDA 2IDYA 3U4EG 2YEPF 1F1HA 5L83A 2LUEA 4KZCA 1WYWB 2ZEQA 4HWIB 4WJQA 3JVZX 3AH7A 4ZHOA 1YQ4B 1IUEA 3L10B 2HDEA 2GB1A 1TKEA 3VRAB 1NEKB 2ZJDA 3PVLA 4GSWA 1ZXHA 1C78A 2MCNB 3VR8B 2SEBD 1ENFA 4EUTA 2AX5A 4DQOC 2JWZA 4WAAA 1J8CA 1JRPA 4XZ4A 3OJ3A 1S1QB 1WRIA 4PS7A 2YEPB 1D5MC 1WJ6A 4P16A 4TKNA 4M00A 1OQRA 2M8SA 2AL3A 4MH8A 5AZFA 4F1SA 3H8HA 4MELA 1KLGD 3A9KA 1OGWA 4GIVA 4W9HA 3H7SA 3JYUA 2HTME 5KHOA 4KKJA 4ACFA 3AE5B 5LLIA 4KX6B 1KOTA 2JZPA 1VCBA 3EUB2 4A90A 4AOFA 3RUIB 2H89B 3BY4B 4WJPA 1PUTA 3ECIA 2DWQA 3OAWA 3J9CA 3ZVVA 3D32A 4RGMA 4W9FA 4FHJA 1Y8RC 3AEBB 5I4DA 2WXIA 2JQRB 1JMLA 3JW0X 4XWWA 5BYRA 2O2VB 1J0GA 3HUIA 5EDSA 1C79A 3ZO5B 3RI7C 3U7DA 4XYCA 1VZ6A 1YD8U 2KTRB 2BW2A 2L0TA 1NENB 2SAKA 4IOIE 3VUXA 4CO7A 4LLGM 2N9LA 4YTMB 3NVVA 3V62A 1PGBA 1GNUA 2QHOA 1RM6C 2DZMA 1SE2A 2M17A 2LXAA 5JXVA 1BUIC 5BYQA 4XE0A 2HTHA 3QAQA 2INDC 4HRSA 1WJUA 2TSSA 4M0WB 1TZ1A 1E90A 4AS1A 1QILA 2ZVOA 4AJYB 2LUMA 1V81A 2NS5A 3VUWA 4XWTA 4PYZA 1I42A 3WAMA 1MJDA 3TJPA 2J7QB 2KDBA 3FAHA 2JX5A 1WZ3A 3M62B 2BPSA 3VHTC 4EZKA 1E10A 2RR9A 1WM3A 1FMAD 1GB4A 1UBQA 1HEZE 2RSUA 2A5UA 2N1VA 1JALA 2LVPA 3OLMD 3JSVB 2KLGA 5CHWA 1KLVA 2WX0A 4WQOB 4C00A 3S2AA 4EE2A 4M8MA 2EKIA 4I6PA 2LJIA 2MP2A 2JRIB 2GMIC 2CS4A 3HHMA 1S3SG 2KN5A 3ZTDA 2JU6X 2KTFA 3NJTA 5KHQA 4CQNA 1V49A 2MJDA 3PSEB 4HDOA 3ALBA 4JX1C 4NNJB 1E7UA 4ZRKA 3KW5B 4FJZA 1WX7A 3P1MA 4NQLB 4E74A 1DYQA 1FO4A 4GLSC 4USAA 2WYQA 3AMZA 1K53A 4GDLA 4L2YA 1GPXA 1N60A 3ZQ4A 1JWSD 4MJSB 4P1BC 2PLPA 3ZGZA 4A8XC 3L4PA 1MPEA 1GJZA 1QZEA 2G9HD 3KH0A 1WZ0A 2BYFA 4HJGE 1ACCA 3QCAA 5DPWA 2PW9A 1UUPA 5J18A 2INNE 3A9KB 1DGJA 2N7JA 2WXMA 3PLVA 5IKCM 1ZXIA 3NVWA 4K1RB 1WX8A 5AEKB 3EECA 3LB8C 2KN4A 2FBWB 1TBEA 2PPHA 1L0YB 1Q0WB 4BKGA 3TEWA 4GDKB 2LGSA 4WH4A 4KIKA 4WWPA 1MVKA 2V1YA 3AEFB 4OZBA 4WWNA 1T6BX 3A4RA 5IO9A 1ET9A 3P63A 3SD5A 5AUKA 4C4VA 3MFGA 1WY8A 4II3B 3B0AA 3DVGX 3V60A 1L7YA 2PVGC 4I6LB 1QOFA 2KMAA 3QHTA 3FKYA 4X57B 3Q69A 1C3TA 2VZKB 2GBRA 3VTWA 2CHZA 1I4XA 3NS8A 3ETRA 3DBHI 3ZXVA 2WXRA 2KK8A 4ANVA 1V1OA 3Q8BA 1L6VA 1L2NA 2V9HA 2K39A 1PQSA 2YLMA 3TL5A 3IHPC 3ONSA 4PS3A 2KWCA 2JSVX 4G3XB 3ZNHB 2LGYA 2PE9A 2UU7A 4IKGA 3MC9A 1C4PA 1FFUA 1R4MB 1Z2MA 3P2BA 2ZCCA 4TUUA 2M56B 1KF6B 4YXDB 1LFDA 2OOBB 3RNCC 3VRBB 1IP9A 3AE4B 1QF6A 4KKIA 2K8BA 4RGOS 4KGRA 4W9KA 1I4HA 4WJNA 3I5JC 2C7MB 3Q3FA 3DVGY 3WAOA 4ASWC 2E6XA 2CHXA 1EU4A 3P42A 3UIPB 1IBXB 1F2RI 4J3OD 2MP2B 4G50A 4RF0A 3Q3OC 3N1ZC 2NBWB 2V3PA 2MJ3A 4NY0A 2KQ7A 3ZRFA 1L4ZB 1L0VB 1GUAB 2K25A 3AN1A 1UZXB 2PEAA 3H6NA 2BWES 3RNGC 4ARIA 3VH3B 1E6EB 1R7SA 2WXGA 4GDLB 1FIQA 4WQMA 3BK2A 2QIEB 1IPGA 3TIXA 2KZRA 3H1UA 3PS6A 1SJED 2BS3B 2K1FA 2LFIA 4MGKE 3KUZA 4YWGG 1L5PA 3PLUA 2ZW0A 2BVCA 1JCKB 1A70A 1T0RC 1YQBA 1RYJA 1OQYA 3W9CB 2KLCA 2D3BA 4A3OA 1Y56A 1HTQA 1QT9A 4PYUA 5HI1A 3DBRB 4DWFA 4AP4C 4RM8A 1NI2A 3CSTA 1FXAA 2B76B 2B3AA 4MM3A 4KIKB 3PV1A 1Q1OA 1IYFA 2WHIA 4JPSA 1RFAA 4GXBA 2LJ5A 4C7ZA 3CIRB 4KSLC 5GMVA 2DAFA 4XDDA 2LZ6A 1XO3A 1KLUD 1T5XD 3EFCA 1NDDA 1E7VA 3AE7B 1V6EA 3MTNB 4FHKA 2RPVA 1EO6A 1BT0A 2KMMA 2ON8A 4YTPB 2HJ1A 3UQAA 1YX6B 4HKQA 2VZKD 2CR5A 3AV8A 2O2VA 3E9SA 1EU3A 2BYEA 2L05A 1FNVA 2MBQA 3Q3NC 3KYCD 4A6QA 4DXFA 2KTRA 1WJ4A 3DBLB 2ASQA 2JT4B 3N1XC 4JWUC 1V1PB 3AXCA 5D2MB 3W1YA 1WJNA 2GBJA 4OVVA 3ZJUA 1JW9D 1WIAA 2BT6A 2IGGA 1ZPSA 1C76A 2D3CA 4K7UA 3N32A 4KDLB 1Z5SB 1MHHE 5BMIA 2CU3A 1SSNA 3IBEA 1KTKA 1QKZA 4G0NB 3RCZA 4TQ0A 2C60A 3PRMB 3CSFA 5G2NA 2KWUB 4RFBA 2M1MA 2WDTB 1N5WA 2D3AA 4MT5A 3K9PB 5BMHA 5C3JB 2N7DA 4FULA 2N9EB 2FUHB 3VQIA 5DPSA 2RDGA 3LJ3A 4HXDA 2G3QB 2RDBC 4FA6A 3BK1A 1YOVB 1ZW7A 2KWVB 2AWTA 5E6JA 3AU4A 4TV3A 4F7ZA 3KVFB 3URYA 2Z0EB 2DYOA 3QWZB 4UDUC 3B08A 3JSVA 2L83A 4BKSD 3TEZA 4II2B 3PGEA 2DLBA 4D2KA 3W5UB 1VRAB 1VZ8A 4OVZA 1ZKHA 4S17A 1ESFA 1UGMA 1VJKA 4DXGA 4NJ6A 4IG7B 1TKGA 2DBYA 3CF6E 4KZ0A 3HVDA 1N5XA 1XCTL 2Y5BB 2W55A 3AE3B 3AE2B 2JVCA 3RPFC 4MJSA 1WR6E 2D10A 4OHJA 4HKZE 4F8CB 3LYYA 2MRPA 1UBIA 4HCPB 1KJTA 3N3KB 1L0XB 2W82A 4ITKA 3WANA 2IO3B 2XN9C 2KWDA 3CMMB 2ZZPB 2Z59B 2FNJB 5DCNA 4MM3B 4N59A 3DDCB 1VD2A 2NTSA 2LVQA 3K9OB 2KYWA 2MBHA 3ABVB 2K3UA 2UWQA 3A9JB 1GAQB 4NJCA 1NYRA 2K6DB 2L8JA 3UIOB 1FNUA 3MJWA 4GDKA 4P7IA 4MACA 4ZRPA 4LNKA 3TEYA 1E8WA 3M63B 1HQRD 1WGDA 1FRRA 2JYTA 1XLQA 2IO0B 4EFOA 3H9DA 1OTRB 1RFKA 2HJ8A 2BYTA 3APDA 3VUYA 2NVUI 3Q3MC 2MBBB 4NJ7A 5EE3A 2WNMA 1AWDA 4H2AA 4YL8A 3Q8CA 3IAS1 3EGRA 2FIFA 4HJKA 2L7RA 2AEHA 2QCZA 4MSMB 3DHHC 4FJVB 5HFYA 1NI3A 2KNBA 1STEA 2ZNVB 2LGDA 3ZDMC 2WXHA 3NS1A 4HLEA 3AE9B 5MPOA 3DHIC 4AUQC 1HXYD 3EC8A 4GB9A 1MG8A 2R2OA 4HEA1 5IP4D 2Y3AA 3Q8FA 1SE3A 2WXPA 4OVUA 4A55A 2AYOB 2HD5B 1C4CA 2KDIA 3T8MA 2KVRA 5IA7A 4US9A 1G6JA 1RRBA 4DDGD 2NTTA 4DXAB 1E8ZA 3L13A 5DPTA 4W9JA 1YMHE 4US8A 4W9EA 1P7EA 4W9DA 4KVGB 2QMTA 2XK5A 2RMMA 4JGHB 1QQRA 4RM9A 2XEWA 4WURA 2QC8A 4NAWB 2MQJA 1WWTA 1TZOA 4YTNB 4FADA 4W9CA 2DZJA 1PDXA 3IT4B 2MW5A 3LXFA 1IGDA 3EHVA 2REXA 2MJEA 1IBXA 2GBKA 1B9RA 3V3XA 2YVCA 2MBEA 4N58A 1U4AA 2KANA 3GOEA 2BF8B 3RNAC 1JQ4A 1NBFC 3P4RB 1TIFA 4RCOA 3AEAB 2LD9A 3AB5A 4ICVA 2J52A 4BKSA 2WQYB 1C9FA 2R2QA 2GLSA 1FCLA 3VDZA 2JYEA 4ANXA 3ZLZA 1WYGA 4KDIC 2BGFA 1LQBA 4XX5A 4A20A 5E6PA 3E56A 1VDVA 4FJYA 1VLBA 2ZPNA 1AYFA 3VTUA 3NG0A 2LI5A 3P4QB 2WU2B 3VVWB 3AE6B 2V0GA 1NYQA 1OQQA 1UD7A 1ZGUB 3ML9A 1HTOA 4BVUC 2WX1A 4DHZE 4GOCA 2KDMA 2V3SA 4GN1A 1FPYA 2FIDA 1N63A 5EE9A 2LWPA 1QLBB 4P6VF 4YSZB 1FEHA 2DX5B 3PPAA 2J53A 2MBOA 3X0WA 3VFKA 3AEGB 3W2DA 2FCQA 2V4IB 1GC6A 3OJ4B 4KGTA 4MSQB 4P1CC 3NUHB 3DVNU 2MLBA 5TSSA 3W5VB 2OHFA 3HVZA 4BAXA 1E5WA 4RGTA 4K81A 2BS2B 3TBLD 4LJPB 1XF5L 3PZ7A 1EM7A 2Y5CA 1SJHD 4FBJB 3HM3A 2L76A 3APFA 4IC7B 1CK1A 2IJ0A 1DOIA 1N62A 4KV2A 1ZDXA 3BINA 4IM3A 1P98A 5C2TB 3AU5A 1DOYA 1V1PA 2LRUA 2PE6B 2W3SA 4J6IA 2LASA 2CJOA 5G5GA 4WJOA 2RDHA 4LJOB 2KVZA 1E0ZA 2WLBA 1FD6A 1WGKA 1F0ZA 2KDFB 4M01A 1OEYJ 4HPMB 2K8CA 5JHAA 1K8RB 1UH6A 4LTUA 2LGIA 2XK5B 4W9IA 5G55A 2JZ3B 3QK0A 2BWFA 3WA0A 5C1ZA 2N7EA 4ZRJA 3ZKJC 3SFDB 1ET6A 2WXJA 1E8YA 2BBCA 3PHWB 3RNBC 3GS2A 4ZRQA 1XD3B 4XGAB 3H7PA 1TS3A 2DYMA 4L23A 2XBBC 3R66C 2DENB 5CHVC 5HHDG 4MGZE 3MJ5A 3I57A 2VH1A 1E8XA 3DWGC 2AQ1B 4IM2A 2CJNA 3RT3B 1V2YA 2DAJA 3IVFA 4N6EB 4JQWC 4IDIA 1D5XC 3RNEC 2WP9B 3SHQA 3N9YC 4W9LA 1EWCA 1UF0A 2D2QA 3DHGC 3NOBA 3U2SC 5AZHA 2Z8LA 2KJRA 1IGCA 4B0MA 2KT7A 4ZYSA 1I35A 1AW7A 2QEJC 1J19A 3DBSA 2OJWA 3I9V1 1RWSA 3AECB 3IFWB 1WE7A 4ANUA 2J42A 2E3TA 4GMVA 5H8YE 2BS4B 2L00B 1GOZA 2INPE 2C7HA 2FUG1 2DHZA 1MG4A 1WGGA 1B1ZA 2H88B 2J0JA 3NY5A 3NVZA 4WWOA 3U52E 1ROEA 2ZNVC 2JZZA 2OJRA 1FFVA 1Q10A 5IOIA 1AARA 3ZNID 4ANWA 4LNNA 3X23A 1R4MI 2IGHA 3IAM1 1J7BA 1FNWA 2ZVNA 2XNAC 4TSSA 2MEKA 2FAZA 1RAXA 4M8NA 5BMGA 5EE1A 2JXXA 2G1EA 2D11A 2IO1B 3A9JA 3MC0B 2W3RA 4REZA 4W9GA 1R4NI 2WDVB 4HK2A 3MHSD 4E71A 1UNSA 1ZOYB 4LNFA 1TS5A 1YNTE 3UGBB 4L1BA 3B2GA 3GZNB 4S0RA 2CU1A 4NQKE 1YJ1A 4LK0M 2ZW1A 4FXCA 3GE3C 5D94A 2WXLA 4K3CA 3B9JA 5BO4B 1SXTA 1D3ZA 3HM6X 1I4GA 4LNIA 3EA6A 3RZFA 2M19A 4IWQA 3RFZB 4DK5A 2KOXA 2JY6A 3BVZA 2K22A 2Z0DB 3NRZA 1WMHA 3KUDB 2K8HA 3BVMA 3M95A 1TT5B 2IY0B 4MH0E 2IY1B 4M02A 2C5LC 3AULA 3W1SC 1V8CA 1JWBD 1CJEA 3VAWA 2LRWA 2L0FA 5LXIB 4YT0B 3NZ3A 4N9F4 4IWPA 2LHDA 2N9XA 2NBUA 2R61A 2W9NA 1T0SC 2GOWA 3DBRI 1NVID 5J2RA 3B2FA 3H7PB 4A9AA 1ZDVA 3R3MA 3V61A 1P0RA 5CX3A 3RZWC 4HPPA 4K3BA 3R8BA 4ICUA 4HROA 2WDRB 4NAWA 4ZYNA 2K6QA 1WGYA 4RNAA 2ZPYA 5J17A 3PRZA 2KX3A 1AN8A 1WF9A 4ZDVA 1XLNA 1EF5A 5E6OA 4LDTB 3OG5A 2IPKD 1WGHA 1YN4A 1WE6A 2BKRB 3PHXB 2NMQA 2PMVA 2WXFA 4C56C 2KDEB 1L6UA 1QOAA 5GXGB 3PT2B 5D3DA 2VRRB 1F2RC 2EKEC 3SFEB 2Q5WD 2L1AA 1UWMA 4BFRA 1MI0A 4WAFA 2M0XA 1KFYB 1T3QA 1V86A 2LHEA 4LCDE 2BQQA 2K0PA 5LXHA 1VR9A 3DBLI 2KC1A 2O6VD 1WXMA 2L3ZA 3W1SA 1WXAA 4OW0A 2IZVB 2BB5A 2KQSA 2HE7A 1WI0A 3BVGA 4XC2A 3AEDB 1PYWD 2I1KA 4URKA 5JHBA 4RGNA 2N9KA 1JWAD 3DWMA 4EZLA 1PGXA 2PIAA 4IW0A 1N6ZA 4C7YA 5FR3A 4TMAB 5FK9C 1RLFA 1TYGB 2I2YA 1FM0D 1XXGA 2NR2A 5IN7A 1KRHA 2UYZB 4TQ1A 3V05A 3RNFC 3U30A 2AQ2B 4G11A 3AI5A 2DNFA 3ZW3A 2KHWB 2WS3B 1LGRA 2KFKA 5AUIA 4HVBA 3MP9A 2KD0A 2WWZA 1KM7A 3UINB 2ICIA 4NAMA 1WR1A 3KLSX 2X8XX 5T8IA 4E3CA 3N20C 2W54A 1TTNA 3M3JA 3O13A 2Y5PA 1HE8A 2WXKA 1WSPA 1YX5B 2KMCA 1PGAA 5H92C 3L0WB 4BKTA 5D3IB 3PO0A 1GG3A 1WMHB 3OWEB 2BTEA 1VZ7A 1I7HA 3ZRCA 1GB1A 3VTVA 3Q2AC 2DZIA 2KJHB 1OEYA 4MGYE 4AQ7A 3SDLC 1HZ6A 1K50A 2A4ZA 4Q2JA 3ZUNA 3ZXRA 1T0YA 4GGQA 4HPLB 2JWUA 2V3NA 3ENEA 2QDFA 3DOWA 1YN5A 3T3NA 3I63C 1BXTA 1H4RA 1QOGA 2L52A 2LXCA 3A4SC 2JPHA 1C77A 3TMPB 1WX9A 1SGHA 3UI3A 2ONQA 4LDTD 1F77A 3AE1B 2QSDA 3FILB 1HZ5A 2NCNA 2FCNA 2X38A 2RGFA 4QAYA 3U7ZA 3QARA 4DHJD 2EMSA 2KJ6A 1JROA 3NZUA 2N9PC 5FR6A 3QIJA 2D5GA 1YJIA 5EE0A 4B95A 3LDZE 2LGXA 3GP7A 3C0RB 1UGJA 4C80A 2D3GA 3RD2A 1P3QU 3L17A 3UF8A 4K7WA 2G4DB 5G5HA 1SB3C 4CHKA 1GC7A 4K7SA 1E9MA 2NPTA 1FXTB 3DBHB 3SU8X 3BIID 1ZUD2 4KGSA 3ZIMA 3UQBA 3ZNGC 1BMLC 3HK0A 1UELA 3TUOA 2O6VA 2WU5B 4RH6A 1SIJA 3KYDD 2NBVB 4IM0A 3PTFC 2KC2A 5JH5C 2FCMA 1SIFA 3BYYB 1MFWA 2AL6A 3Q3JA 3RULA 3KWVA 3PRPB 3KQ4A 4DDID 3AE8B 3VH4B 3P4SB 1H8CA 1KH0A 3ZYYX 3Q8EA 4IUMB 3WAPA 3I3TB 2LMCA 3V6EB 2KXJA 4NPNA 1D5ZC 2KFKB 2KO3A 1OFFA 4BOSC 1SEBD 2EELA 3B1LX 2KKCA 1FCCC 4ARCA 1EUVB 3IG3A 3CWIA 5HKHA 2KAJA 3IXSA 1C1YB 4WIPA 5IAAC 2FCSA 2GI9A 1TS4A 1XCQL 4LNOA 3TSSA 1TJEA 4XDCA 1CQVA 5HG2A 4EEWA 5L95C 3KUCB
chains in the Genus database with same CATH topology
3PREA 1P1AA 1ZKHA 2J0KA 4FLHA 2ZVNA 3VUWA 4EZJA 4PYZA 1UGMA 1I42A 4FN2A 3WAMA 2FAZA 1SE9A 1RAXA 3NHEB 4M8NA 3TJPA 2J7QB 4NJ6A 4IG7B 2JXXA 2KDBA 3O65B 3CF6E 4KZ0A 1WM2A 1WZ3A 3M62B 2BPSA 2D11A 2IO1B 3A9JA 2RPQA 3VHTC 4EZKA 2RR9A 2Y5BB 3WALA 1WM3A 2RD0A 1UBQA 4W9GA 1R4NI 3A33B 2RSUA 2A5UA 4HK2A 2JF5A 2JVCA 2N1VA 3MHSD 2M4NA 4MJSA 2LVPA 3OLMD 4HDQA 4MEMA 1WR6E 2D10A 4E71A 3JSVB 2C7NB 2KLGA 3DVNV 5CHWA 1KLVA 2V4LA 2WX0A 4WQOB 4F8CB 3S2AA 1LM8B 2MRPA 1UBIA 4HCPB 1KJTA 3VXWA 2MX2A 4M8MA 3N3KB 4BBNC 3UGBB 4I6PA 2MP2A 2JRIB 2GMIC 2CU1A 2CS4A 1YJ1A 4NQKE 3WANA 3HHMA 1S3SG 2KN5A 3ZTDA 2IO3B 2KTFA 3CMMB 2G4SA 2ZZPB 1V49A 2Z59B 2FNJB 5D94A 5DCNA 5KHQA 4HDOA 3DDCB 3PSEB 3ALBA 1VD2A 4NNJB 1E7UA 2LVQA 3DCGA 4ZRKA 5BO4B 3K9OB 3KW5B 2CHWA 1D3ZA 2I1JA 3HM6X 4FJZA 1WX7A 4NQLB 1ISNA 4E74A 2MBHA 3ZTCA 2N4FA 2UWQA 3A9JB 4IWQA 3RZFA 2K6DB 2WYQA 4RMAA 2L8JA 4GDLA 3UIOB 4DHZB 4DK5A 3MJWA 4GDKA 4P7IA 1V5OA 2CKHB 3R7QA 2KOXA 2JY6A 2KFJA 5C23A 4MJSB 1E8WA 2Z0DB 3M63B 1WMHA 3QC8B 3KUDB 1WGDA 2K8HA 1GJZA 1QZEA 2IO2B 3KH0A 3M95A 1WZ0A 3WIMA 2BYFA 2IY0B 4MH0E 2IO0B 4EFOA 3ML8A 2IY1B 3H9DA 1OTRB 2C5LC 3AULA 3QCAA 2HJ8A 3W1SC 5DPWA 3APDA 3VUYA 5J18A 2NVUI 3U8ZA 5D6JB 3VAWA 2LRWA 2L0FA 3A1QA 3A9KB 2MBBB 4NJ7A 5LXIB 2BYVE 3PLVA 3QQ8B 4YL8A 4N9F4 4IWPA 2N9XA 2NBUA 1WGRA 2W9NA 2GOWA 2FIFA 3DBRI 1WX8A 4HJKA 4K1RB 2C9WB 2L7RA 4A3PA 2MA9B 2AEHA 5AEKB 5J2RA 2NPTB 3EECA 4MSMB 2BKFA 3H7PB 3QA8A 3R3MA 3V61A 1P0RA 5CX3A 3RZWC 4ICUA 4NAWA 4FJVB 4ZYNA 1TBEA 2K6QA 2PPHA 1Q0WB 2G45B 1WGYA 4IWOA 5DPRA 4BKGA 2KNBA 2ZPYA 4GDKB 2ZNVB 2LGDA 3QJZA 5J17A 1TGZB 3ZDMC 4HLEA 4KIKA 4AUQC 3PRZA 4WWPA 4HCNB 2KX3A 2V1YA 2N1WA 1WF9A 3EC8A 2O6VB 3DQVA 4GB9A 1MG8A 4MGIE 4ZDVA 2R2OA 5JZEB 3L16A 1EF5A 5E6OA 4LDTB 4WWNA 1WGHA 5CTRC 3A4RA 3RYTA 2GBNA 2GBMA 4GU2A 4OVUA 1XT9B 1WE6A 4AJWA 2BKRB 2AYOB 3PHXB 2HD5B 3SD5A 2KDIA 3T8MA 1V5TA 4AWJA 2KVRA 2IBIB 5IA7A 1G6JA 1RRBA 1EF1A 2KDEB 4DDGD 1WY8A 2ZCBA 4MDKE 4DXAB 4II3B 3B0AA 3DVGX 3R7RA 3V60A 1E8ZA 3PT2B 1L7YA 3L13A 5DPTA 2KX0A 4CYEA 4I6LB 4W9JA 2KMAA 2VRRB 3QHTA 1WFYA 4W9EA 4B9KA 2EKEC 3PZDA 4X57B 4W9DA 5D7GA 4KVGB 4BFRA 2XK5A 2M0XA 1A5RA 1C3TA 4JGHB 1V86A 4JL9A 4RM9A 1P9DU 2XEWA 4LCDE 4NAWB 5LXHA 3DBLI 4EKUA 1X1MA 2GBRA 2MQJA 3VTWA 2CHZA 1WH3A 2DZKA 3NS8A 2KC1A 2O6VD 4FADA 1WXMA 2L3ZA 4W9CA 3W1SA 3DBHI 2DZJA 1WXAA 2MW5A 3TCAA 2KK8A 2IZVB 4ANVA 3EHVA 2REXA 4BOZB 1JRUA 2KQSA 2J0MA 1L2NA 1CMXB 2GBKA 2K39A 2YVCA 1Q5WB 2HE7A 2MBEA 1PQSA 1WI0A 3APCA 2YLMA 3TL5A 3IHPC 3ONSA 4XC2A 1U4AA 1XQQA 2KANA 3GOEA 4PS3A 2JRHA 2BF8B 2KWCA 4G3XB 2I1KA 4URKA 3ZNHB 5JHBA 2LGYA 2PE9A 2DYBA 3ZNZB 4EZLA 4ZRIA 4IW0A 1NBFC 2EMTA 4DBGA 1Z2MA 3P2BA 1RLFA 2ZCCA 4TUUA 1LFDA 2OOBB 3DPDA 2LD9A 3N30A 4ICVA 4BKSA 1IP9A 3NZSA 2K8BA 4W9KA 1YIWA 2R2QA 4WJNA 3VDZA 2C7MB 2NR2A 3Q3FA 5AZGA 3DVGY 3WAOA 4ANXA 2UYZB 1F9JA 3L54A 4TQ1A 3HIZA 3ZLZA 3U30A 4KDIC 2BGFA 4B6WA 4G11A 4JLCA 4ASWC 1LQBA 2CHXA 3AI5A 4XX5A 4A20A 5E6PA 3ZW3A 2KHWB 3UIPB 3T9LA 4FJYA 1WXVA 2PJHA 2ZPNA 3VTUA 2KFKA 4KSKC 2MP2B 4HVBA 4G50A 2KD0A 2LI5A 2WWZA 2LVOA 4EOYA 1KM7A 1V80A 2MWSB 2NBWB 3UINB 3VVWB 4NY0A 1M94A 2KQ7A 1WR1A 3ZDTA 3ZRFA 3V6CB 4I6NB 1GUAB 4PS8A 1UD7A 1ZGUB 3ML9A 4E3CA 2K25A 1UZXB 2PEAA 3M3JA 1TTNA 2WX1A 2BWES 3H6NA 4BVUC 4DHZE 3VH3B 4GOCA 2V3SA 1HE8A 4GN1A 2FIDA 1YX5B 4GDLB 4JIOU 2KMCA 2LWPA 2DX5B 3L08A 3PPAA 1IPGA 3QX1A 3TIXA 1WRDB 2MBOA 2KZRA 3L0WB 3X0WA 3H1UA 4BKTA 1GG3A 1WMHB 3PS6A 3VFKA 4BBNF 3EFUA 3ZRCA 2K1FA 3VTVA 4MGKE 2FCQA 3KUZA 3OJ4B 1GC6A 2DZIA 4MSQB 3PLUA 2KJHB 1OEYA 4MGYE 3DVNU 2MLBA 3SDLC 1WXSA 3A1QB 2IYDB 2MSED 2A4ZA 4DHJB 1E5WA 2JUOA 4K81A 5CHFA 5TR5A 3ZUNA 1YQBA 1T0YA 4GGQA 2D07B 3TBLD 1OQYA 4HPLB 4LJPB 3GZNI 3ENEA 5E6NA 2KLCA 4FBJB 3HM3A 1V9JA 3DOWA 1LXDA 4A3OA 2L76A 4PYUA 4DWFA 3APFA 4IC7B 1H4RA 2LUEA 5L83A 4KZCA 1WYWB 4KV2A 2ZEQA 4AP4C 4HWIB 4RM8A 1NI2A 2LXCA 3CSTA 3JVZX 4WJQA 3A4SC 2JPHA 3BINA 3L10B 3TMPB 1WX9A 1SGHA 2B3AA 4MM3A 4KIKB 4IM3A 1P98A 3PV1A 4LDTD 1Q1OA 2ZJDA 1IYFA 3PVLA 4GSWA 3AU5A 1RFAA 4GXBA 2MCNB 2LJ5A 2NCNA 2FCNA 2RGFA 2LRUA 2PE6B 4J6IA 4EUTA 2LASA 3QARA 2JWZA 4KSLC 5GMVA 4DHJD 2DAFA 2EMSA 2KJ6A 4WAAA 1J8CA 4WJOA 4LJOB 2LZ6A 4XZ4A 3NZUA 1NDDA 2N9PC 1E7VA 3OJ3A 1S1QB 1V6EA 2KDFB 3MTNB 3QIJA 4FHKA 5FR6A 1OEYJ 4HPMB 4PS7A 2K8CA 5JHAA 1EO6A 4B95A 3LDZE 1K8RB 1BT0A 1WJ6A 2LGXA 4TKNA 1UH6A 3UQAA 3C0RB 1YX6B 2M8SA 2CR5A 2O2VA 2XK5B 2AL3A 2D3GA 4W9IA 2JZ3B 5G55A 3QK0A 2BWFA 3WA0A 5AZFA 5C1ZA 2N7EA 3RD2A 4F1SA 5JH5C 4MELA 1P3QU 2BYEA 2L05A 3L17A 4ZRJA 3A9KA 3ZKJC 3UF8A 2MBQA 1OGWA 3KYCD 4GIVA 4K7WA 4W9HA 2G4DB 3H7SA 1E8YA 2KTRA 3PHWB 1WJ4A 3JYUA 4CHKA 1GC7A 5KHOA 2ASQA 4K7SA 2JT4B 1XD3B 2NPTA 5LLIA 1FXTB 3H7PA 3SU8X 3AXCA 2DYMA 5D2MB 1KOTA 3W1YA 1WJNA 2GBJA 4OVVA 1VCBA 1WIAA 2XBBC 3R66C 4AOFA 3RUIB 3BY4B 2DENB 4WJPA 5CHVC 4MGZE 3ECIA 3ZIMA 3UQBA 3ZNGC 4K7UA 1E8XA 3HK0A 3OAWA 3N32A 1UELA 4IM2A 2O6VA 4KDLB 1V2YA 3RT3B 2DAJA 1Z5SB 3IVFA 3ZVVA 4JQWC 3D32A 4W9FA 4FHJA 1Y8RC 3IBEA 3RCZA 4G0NB 3SHQA 4W9LA 4TQ0A 2C60A 3KYDD 3JW0X 2NBVB 2O2VB 1J0GA 2D2QA 3PRMB 3CSFA 2KC2A 3PTFC 2FCMA 3NOBA 1SIFA 4IM0A 2KWUB 5G2NA 5AZHA 5EDSA 2KJRA 3ZO5B 2AL6A 2M1MA 2WDTB 3Q3JA 3RULA 3U7DA 3PRPB 1YD8U 2KTRB 3K9PB 4DDID 3VH4B 1H8CA 1I35A 2L0TA 1J19A 3DBSA 2N7DA 4FULA 2N9EB 3IFWB 2FUHB 4IUMB 3VQIA 1WE7A 5DPSA 3VUXA 3WAPA 3I3TB 3V6EB 4ANUA 4CO7A 3LJ3A 4GMVA 4HXDA 2L00B 2KXJA 4NPNA 2G3QB 4FA6A 2KFKB 2C7HA 2KO3A 3V62A 1GNUA 1ZW7A 2KWVB 2QHOA 4BOSC 2DZMA 3B1LX 2AWTA 2DHZA 3AU4A 2KKCA 2LXAA 2M17A 4TV3A 4F7ZA 3KVFB 1WGGA 1EUVB 3IG3A 2Z0EB 2DYOA 5HKHA 2J0JA 3NY5A 3QWZB 4WWOA 3B08A 3JSVA 2HTHA 3QAQA 4BKSD 1C1YB 5IAAC 2FCSA 4II2B 1WJUA 3PGEA 2ZNVC 2JZZA 2OJRA 4M0WB 1TZ1A 1AARA 3ZNID 1E90A 4ANWA 2ZVOA 4AJYB 4EEWA 3KUCB 3X23A 5L95C 1V81A 1R4MI 2NS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRE A;  1P1A A;  1ZKH A;  2J0K A;  4FLH A;  2ZVN A;  3VUW A;  4EZJ A;  4PYZ A;  1UGM A;  1I42 A;  4FN2 A;  3WAM A;  2FAZ A;  1SE9 A;  1RAX A;  3NHE B;  4M8N A;  3TJP A;  2J7Q B;  4NJ6 A;  4IG7 B;  2JXX A;  2KDB A;  3O65 B;  3CF6 E;  4KZ0 A;  1WM2 A;  1WZ3 A;  3M62 B;  2BPS A;  2D11 A;  2IO1 B;  3A9J A;  2RPQ A;  3VHT C;  4EZK A;  2RR9 A;  2Y5B B;  3WAL A;  1WM3 A;  2RD0 A;  1UBQ A;  4W9G A;  1R4N I;  3A33 B;  2RSU A;  2A5U A;  4HK2 A;  2JF5 A;  2JVC A;  2N1V A;  3MHS D;  2M4N A;  4MJS A;  2LVP A;  3OLM D;  4HDQ A;  4MEM A;  1WR6 E;  2D10 A;  4E71 A;  3JSV B;  2C7N B;  2KLG A;  3DVN V;  5CHW A;  1KLV A;  2V4L A;  2WX0 A;  4WQO B;  4F8C B;  3S2A A;  1LM8 B;  2MRP A;  1UBI A;  4HCP B;  1KJT A;  3VXW A;  2MX2 A;  4M8M A;  3N3K B;  4BBN C;  3UGB B;  4I6P A;  2MP2 A;  2JRI B;  2GMI C;  2CU1 A;  2CS4 A;  1YJ1 A;  4NQK E;  3WAN A;  3HHM A;  1S3S G;  2KN5 A;  3ZTD A;  2IO3 B;  2KTF A;  3CMM B;  2G4S A;  2ZZP B;  1V49 A;  2Z59 B;  2FNJ B;  5D94 A;  5DCN A;  5KHQ A;  4HDO A;  3DDC B;  3PSE B;  3ALB A;  1VD2 A;  4NNJ B;  1E7U A;  2LVQ A;  3DCG A;  4ZRK A;  5BO4 B;  3K9O B;  3KW5 B;  2CHW A;  1D3Z A;  2I1J A;  3HM6 X;  4FJZ A;  1WX7 A;  4NQL B;  1ISN A;  4E74 A;  2MBH A;  3ZTC A;  2N4F A;  2UWQ A;  3A9J B;  4IWQ A;  3RZF A;  2K6D B;  2WYQ A;  4RMA A;  2L8J A;  4GDL A;  3UIO B;  4DHZ B;  4DK5 A;  3MJW A;  4GDK A;  4P7I A;  1V5O A;  2CKH B;  3R7Q A;  2KOX A;  2JY6 A;  2KFJ A;  5C23 A;  4MJS B;  1E8W A;  2Z0D B;  3M63 B;  1WMH A;  3QC8 B;  3KUD B;  1WGD A;  2K8H A;  1GJZ A;  1QZE A;  2IO2 B;  3KH0 A;  3M95 A;  1WZ0 A;  3WIM A;  2BYF A;  2IY0 B;  4MH0 E;  2IO0 B;  4EFO A;  3ML8 A;  2IY1 B;  3H9D A;  1OTR B;  2C5L C;  3AUL A;  3QCA A;  2HJ8 A;  3W1S C;  5DPW A;  3APD A;  3VUY A;  5J18 A;  2NVU I;  3U8Z A;  5D6J B;  3VAW A;  2LRW A;  2L0F A;  3A1Q A;  3A9K B;  2MBB B;  4NJ7 A;  5LXI B;  2BYV E;  3PLV A;  3QQ8 B;  4YL8 A;  4N9F 4;  4IWP A;  2N9X A;  2NBU A;  1WGR A;  2W9N A;  2GOW A;  2FIF A;  3DBR I;  1WX8 A;  4HJK A;  4K1R B;  2C9W B;  2L7R A;  4A3P A;  2MA9 B;  2AEH A;  5AEK B;  5J2R A;  2NPT B;  3EEC A;  4MSM B;  2BKF A;  3H7P B;  3QA8 A;  3R3M A;  3V61 A;  1P0R A;  5CX3 A;  3RZW C;  4ICU A;  4NAW A;  4FJV B;  4ZYN A;  1TBE A;  2K6Q A;  2PPH A;  1Q0W B;  2G45 B;  1WGY A;  4IWO A;  5DPR A;  4BKG A;  2KNB A;  2ZPY A;  4GDK B;  2ZNV B;  2LGD A;  3QJZ A;  5J17 A;  1TGZ B;  3ZDM C;  4HLE A;  4KIK A;  4AUQ C;  3PRZ A;  4WWP A;  4HCN B;  2KX3 A;  2V1Y A;  2N1W A;  1WF9 A;  3EC8 A;  2O6V B;  3DQV A;  4GB9 A;  1MG8 A;  4MGI E;  4ZDV A;  2R2O A;  5JZE B;  3L16 A;  1EF5 A;  5E6O A;  4LDT B;  4WWN A;  1WGH A;  5CTR C;  3A4R A;  3RYT A;  2GBN A;  2GBM A;  4GU2 A;  4OVU A;  1XT9 B;  1WE6 A;  4AJW A;  2BKR B;  2AYO B;  3PHX B;  2HD5 B;  3SD5 A;  2KDI A;  3T8M A;  1V5T A;  4AWJ A;  2KVR A;  2IBI B;  5IA7 A;  1G6J A;  1RRB A;  1EF1 A;  2KDE B;  4DDG D;  1WY8 A;  2ZCB A;  4MDK E;  4DXA B;  4II3 B;  3B0A A;  3DVG X;  3R7R A;  3V60 A;  1E8Z A;  3PT2 B;  1L7Y A;  3L13 A;  5DPT A;  2KX0 A;  4CYE A;  4I6L B;  4W9J A;  2KMA A;  2VRR B;  3QHT A;  1WFY A;  4W9E A;  4B9K A;  2EKE C;  3PZD A;  4X57 B;  4W9D A;  5D7G A;  4KVG B;  4BFR A;  2XK5 A;  2M0X A;  1A5R A;  1C3T A;  4JGH B;  1V86 A;  4JL9 A;  4RM9 A;  1P9D U;  2XEW A;  4LCD E;  4NAW B;  5LXH A;  3DBL I;  4EKU A;  1X1M A;  2GBR A;  2MQJ A;  3VTW A;  2CHZ A;  1WH3 A;  2DZK A;  3NS8 A;  2KC1 A;  2O6V D;  4FAD A;  1WXM A;  2L3Z A;  4W9C A;  3W1S A;  3DBH I;  2DZJ A;  1WXA A;  2MW5 A;  3TCA A;  2KK8 A;  2IZV B;  4ANV A;  3EHV A;  2REX A;  4BOZ B;  1JRU A;  2KQS A;  2J0M A;  1L2N A;  1CMX B;  2GBK A;  2K39 A;  2YVC A;  1Q5W B;  2HE7 A;  2MBE A;  1PQS A;  1WI0 A;  3APC A;  2YLM A;  3TL5 A;  3IHP C;  3ONS A;  4XC2 A;  1U4A A;  1XQQ A;  2KAN A;  3GOE A;  4PS3 A;  2JRH A;  2BF8 B;  2KWC A;  4G3X B;  2I1K A;  4URK A;  3ZNH B;  5JHB A;  2LGY A;  2PE9 A;  2DYB A;  3ZNZ B;  4EZL A;  4ZRI A;  4IW0 A;  1NBF C;  2EMT A;  4DBG A;  1Z2M A;  3P2B A;  1RLF A;  2ZCC A;  4TUU A;  1LFD A;  2OOB B;  3DPD A;  2LD9 A;  3N30 A;  4ICV A;  4BKS A;  1IP9 A;  3NZS A;  2K8B A;  4W9K A;  1YIW A;  2R2Q A;  4WJN A;  3VDZ A;  2C7M B;  2NR2 A;  3Q3F A;  5AZG A;  3DVG Y;  3WAO A;  4ANX A;  2UYZ B;  1F9J A;  3L54 A;  4TQ1 A;  3HIZ A;  3ZLZ A;  3U30 A;  4KDI C;  2BGF A;  4B6W A;  4G11 A;  4JLC A;  4ASW C;  1LQB A;  2CHX A;  3AI5 A;  4XX5 A;  4A20 A;  5E6P A;  3ZW3 A;  2KHW B;  3UIP B;  3T9L A;  4FJY A;  1WXV A;  2PJH A;  2ZPN A;  3VTU A;  2KFK A;  4KSK C;  2MP2 B;  4HVB A;  4G50 A;  2KD0 A;  2LI5 A;  2WWZ A;  2LVO A;  4EOY A;  1KM7 A;  1V80 A;  2MWS B;  2NBW B;  3UIN B;  3VVW B;  4NY0 A;  1M94 A;  2KQ7 A;  1WR1 A;  3ZDT A;  3ZRF A;  3V6C B;  4I6N B;  1GUA B;  4PS8 A;  1UD7 A;  1ZGU B;  3ML9 A;  4E3C A;  2K25 A;  1UZX B;  2PEA A;  3M3J A;  1TTN A;  2WX1 A;  2BWE S;  3H6N A;  4BVU C;  4DHZ E;  3VH3 B;  4GOC A;  2V3S A;  1HE8 A;  4GN1 A;  2FID A;  1YX5 B;  4GDL B;  4JIO U;  2KMC A;  2LWP A;  2DX5 B;  3L08 A;  3PPA A;  1IPG A;  3QX1 A;  3TIX A;  1WRD B;  2MBO A;  2KZR A;  3L0W B;  3X0W A;  3H1U A;  4BKT A;  1GG3 A;  1WMH B;  3PS6 A;  3VFK A;  4BBN F;  3EFU A;  3ZRC A;  2K1F A;  3VTV A;  4MGK E;  2FCQ A;  3KUZ A;  3OJ4 B;  1GC6 A;  2DZI A;  4MSQ B;  3PLU A;  2KJH B;  1OEY A;  4MGY E;  3DVN U;  2MLB A;  3SDL C;  1WXS A;  3A1Q B;  2IYD B;  2MSE D;  2A4Z A;  4DHJ B;  1E5W A;  2JUO A;  4K81 A;  5CHF A;  5TR5 A;  3ZUN A;  1YQB A;  1T0Y A;  4GGQ A;  2D07 B;  3TBL D;  1OQY A;  4HPL B;  4LJP B;  3GZN I;  3ENE A;  5E6N A;  2KLC A;  4FBJ B;  3HM3 A;  1V9J A;  3DOW A;  1LXD A;  4A3O A;  2L76 A;  4PYU A;  4DWF A;  3APF A;  4IC7 B;  1H4R A;  2LUE A;  5L83 A;  4KZC A;  1WYW B;  4KV2 A;  2ZEQ A;  4AP4 C;  4HWI B;  4RM8 A;  1NI2 A;  2LXC A;  3CST A;  3JVZ X;  4WJQ A;  3A4S C;  2JPH A;  3BIN A;  3L10 B;  3TMP B;  1WX9 A;  1SGH A;  2B3A A;  4MM3 A;  4KIK B;  4IM3 A;  1P98 A;  3PV1 A;  4LDT D;  1Q1O A;  2ZJD A;  1IYF A;  3PVL A;  4GSW A;  3AU5 A;  1RFA A;  4GXB A;  2MCN B;  2LJ5 A;  2NCN A;  2FCN A;  2RGF A;  2LRU A;  2PE6 B;  4J6I A;  4EUT A;  2LAS A;  3QAR A;  2JWZ A;  4KSL C;  5GMV A;  4DHJ D;  2DAF A;  2EMS A;  2KJ6 A;  4WAA A;  1J8C A;  4WJO A;  4LJO B;  2LZ6 A;  4XZ4 A;  3NZU A;  1NDD A;  2N9P C;  1E7V A;  3OJ3 A;  1S1Q B;  1V6E A;  2KDF B;  3MTN B;  3QIJ A;  4FHK A;  5FR6 A;  1OEY J;  4HPM B;  4PS7 A;  2K8C A;  5JHA A;  1EO6 A;  4B95 A;  3LDZ E;  1K8R B;  1BT0 A;  1WJ6 A;  2LGX A;  4TKN A;  1UH6 A;  3UQA A;  3C0R B;  1YX6 B;  2M8S A;  2CR5 A;  2O2V A;  2XK5 B;  2AL3 A;  2D3G A;  4W9I A;  2JZ3 B;  5G55 A;  3QK0 A;  2BWF A;  3WA0 A;  5AZF A;  5C1Z A;  2N7E A;  3RD2 A;  4F1S A;  5JH5 C;  4MEL A;  1P3Q U;  2BYE A;  2L05 A;  3L17 A;  4ZRJ A;  3A9K A;  3ZKJ C;  3UF8 A;  2MBQ A;  1OGW A;  3KYC D;  4GIV A;  4K7W A;  4W9H A;  2G4D B;  3H7S A;  1E8Y A;  2KTR A;  3PHW B;  1WJ4 A;  3JYU A;  4CHK A;  1GC7 A;  5KHO A;  2ASQ A;  4K7S A;  2JT4 B;  1XD3 B;  2NPT A;  5LLI A;  1FXT B;  3H7P A;  3SU8 X;  3AXC A;  2DYM A;  5D2M B;  1KOT A;  3W1Y A;  1WJN A;  2GBJ A;  4OVV A;  1VCB A;  1WIA A;  2XBB C;  3R66 C;  4AOF A;  3RUI B;  3BY4 B;  2DEN B;  4WJP A;  5CHV C;  4MGZ E;  3ECI A;  3ZIM A;  3UQB A;  3ZNG C;  4K7U A;  1E8X A;  3HK0 A;  3OAW A;  3N32 A;  1UEL A;  4IM2 A;  2O6V A;  4KDL B;  1V2Y A;  3RT3 B;  2DAJ A;  1Z5S B;  3IVF A;  3ZVV A;  4JQW C;  3D32 A;  4W9F A;  4FHJ A;  1Y8R C;  3IBE A;  3RCZ A;  4G0N B;  3SHQ A;  4W9L A;  4TQ0 A;  2C60 A;  3KYD D;  3JW0 X;  2NBV B;  2O2V B;  1J0G A;  2D2Q A;  3PRM B;  3CSF A;  2KC2 A;  3PTF C;  2FCM A;  3NOB A;  1SIF A;  4IM0 A;  2KWU B;  5G2N A;  5AZH A;  5EDS A;  2KJR A;  3ZO5 B;  2AL6 A;  2M1M A;  2WDT B;  3Q3J A;  3RUL A;  3U7D A;  3PRP B;  1YD8 U;  2KTR B;  3K9P B;  4DDI D;  3VH4 B;  1H8C A;  1I35 A;  2L0T A;  1J19 A;  3DBS A;  2N7D A;  4FUL A;  2N9E B;  3IFW B;  2FUH B;  4IUM B;  3VQI A;  1WE7 A;  5DPS A;  3VUX A;  3WAP A;  3I3T B;  3V6E B;  4ANU A;  4CO7 A;  3LJ3 A;  4GMV A;  4HXD A;  2L00 B;  2KXJ A;  4NPN A;  2G3Q B;  4FA6 A;  2KFK B;  2C7H A;  2KO3 A;  3V62 A;  1GNU A;  1ZW7 A;  2KWV B;  2QHO A;  4BOS C;  2DZM A;  3B1L X;  2AWT A;  2DHZ A;  3AU4 A;  2KKC A;  2LXA A;  2M17 A;  4TV3 A;  4F7Z A;  3KVF B;  1WGG A;  1EUV B;  3IG3 A;  2Z0E B;  2DYO A;  5HKH A;  2J0J A;  3NY5 A;  3QWZ B;  4WWO A;  3B08 A;  3JSV A;  2HTH A;  3QAQ A;  4BKS D;  1C1Y B;  5IAA C;  2FCS A;  4II2 B;  1WJU A;  3PGE A;  2ZNV C;  2JZZ A;  2OJR A;  4M0W B;  1TZ1 A;  1AAR A;  3ZNI D;  1E90 A;  4ANW A;  2ZVO A;  4AJY B;  4EEW A;  3KUC B;  3X23 A;  5L95 C;  1V81 A;  1R4M I;  2NS5 A; 
#chains in the Genus database with same CATH topology
 3PRE A;  1P1A A;  2J0K A;  4FLH A;  4EZJ A;  2WXO A;  2PKO A;  3PZ8 A;  2WXQ A;  4FN2 A;  1DOX A;  1SE9 A;  1K51 A;  3NHE B;  2I38 A;  1CZP A;  3O65 B;  4NZL B;  3R2T A;  1WM2 A;  4OZC A;  2RPQ A;  2MH7 A;  1YQ3 B;  3WAL A;  2RD0 A;  3BWU D;  1XEE A;  3A33 B;  2JF5 A;  1ZE3 D;  2M4N A;  4HDQ A;  4MEM A;  2C7N B;  2INC C;  2IGD A;  3DVN V;  2V4L A;  1LM8 B;  3VXW A;  4BBN C;  2MX2 A;  1E7P B;  1L4D B;  3BZD B;  3Q8A A;  1SF0 A;  4YSY B;  1QOB A;  3ZJT A;  2KQ4 X;  2G4S A;  1JWM D;  3DCG A;  3GE8 C;  3ZJV A;  3N1Y C;  2CHW A;  1FRD A;  2I1J A;  3HRD D;  1ISN A;  4OZA A;  1FXI A;  3ZTC A;  2N4F A;  4RMA A;  1V5O A;  1YN3 A;  1I4R A;  2CKH B;  3R7Q A;  3KWL A;  2KFJ A;  5C23 A;  2PVO D;  1R4N B;  3QC8 B;  2IO2 B;  3WIM A;  1TY0 A;  1M4V A;  2OED A;  3ML8 A;  5FKA C;  3U8Z A;  2VH2 A;  5D6J B;  4PT5 A;  1C4A A;  3A1Q A;  3WCQ A;  2BYV E;  3QQ8 B;  3Q6B A;  1WGR A;  1ZP0 B;  4B0E A;  2C9W B;  1TY2 A;  4A3P A;  2MA9 B;  2NPT B;  3MC8 A;  2BKF A;  3QA8 A;  3Q14 C;  2LEK A;  2G45 B;  5DPR A;  4IWO A;  4JWS C;  3QJZ A;  3SEB A;  1TGZ B;  2FE8 A;  3RMK C;  4HCN B;  2N1W A;  3SR6 A;  2O6V B;  3DQV A;  4MGI E;  5JZE B;  3L16 A;  2K5P A;  2N0S B;  5CTR C;  1I4P A;  2GBN A;  2GBM A;  3RYT A;  4GU2 A;  1XT9 B;  4AJW A;  4AWJ A;  1V5T A;  3IT6 B;  2IBI B;  1JWU D;  1T0Q C;  1EF1 A;  1XLP A;  2ZCB A;  4MDK E;  3R7R A;  1N61 A;  4PK1 A;  4DHZ B;  3FC4 A;  2KX0 A;  4CYE A;  1J7C A;  1XLO A;  1WFY A;  4B9K A;  3PZD A;  2QIL A;  2BB6 A;  5D7G A;  1A5R A;  4JL9 A;  1P9D U;  1D4B A;  1LO5 D;  4RF1 A;  3AEE B;  1TS2 A;  4EKU A;  1X1M A;  1WH3 A;  2DZK A;  3RN9 C;  4WWM A;  4BZA A;  2JXT A;  1WXQ A;  3TCA A;  3TEX A;  4BOZ B;  1SBB B;  1JRU A;  4YSX B;  2J0M A;  1CMX B;  3APC A;  1Q5W B;  3BYT B;  1XQQ A;  2JRH A;  3C19 A;  3C8Y A;  4C4V B;  2DYB A;  3ZNZ B;  3T3O A;  4ZRI A;  2EMT A;  4DBG A;  4O1N A;  3DPD A;  3N30 A;  3P4P B;  1F52 A;  3NZS A;  1EWY C;  1HA5 A;  1V97 A;  1YIW A;  2ACZ B;  5AZG A;  3L54 A;  1F9J A;  2WXN A;  3HIZ A;  4B6W A;  4ZHP A;  4JLC A;  1MHX A;  3T9L A;  1WXV A;  2PJH A;  3AM9 A;  2AQ3 B;  2WDQ B;  3MHZ A;  4KSK C;  4EOY A;  2LVO A;  1TKY A;  1V80 A;  2MWS B;  1J7A A;  2GRI A;  1D6E C;  1M94 A;  1YJJ A;  3ZDT A;  4R3D A;  3V6C B;  2QJL A;  4I6N B;  3GB1 A;  4PS8 A;  1PFD A;  4M0W A;  2J4X A;  2WGS A;  3VR9 B;  4JE3 B;  4JIO U;  4ZOH C;  1SE4 A;  3L08 A;  3QX1 A;  2KAC A;  1WRD B;  3FIL A;  2K9X A;  2MHJ A;  4BBN F;  3EFU A;  2L32 A;  1I4Q A;  5LNK 1;  1P7F A;  2PTL A;  3R2I A;  1K52 A;  1WXS A;  3A1Q B;  2IYD B;  2MSE D;  4DHJ B;  2JUO A;  5BYS A;  5CHF A;  5TR5 A;  2D07 B;  3NVY A;  3GZN I;  5E6N A;  1UWX A;  1V9J A;  2M0A A;  1LXD A;  2IDY A;  3U4E G;  2YEP F;  1F1H A;  5L83 A;  2LUE A;  4KZC A;  1WYW B;  2ZEQ A;  4HWI B;  4WJQ A;  3JVZ X;  3AH7 A;  4ZHO A;  1YQ4 B;  1IUE A;  3L10 B;  2HDE A;  2GB1 A;  1TKE A;  3VRA B;  1NEK B;  2ZJD A;  3PVL A;  4GSW A;  1ZXH A;  1C78 A;  2MCN B;  3VR8 B;  2SEB D;  1ENF A;  4EUT A;  2AX5 A;  4DQO C;  2JWZ A;  4WAA A;  1J8C A;  1JRP A;  4XZ4 A;  3OJ3 A;  1S1Q B;  1WRI A;  4PS7 A;  2YEP B;  1D5M C;  1WJ6 A;  4P16 A;  4TKN A;  4M00 A;  1OQR A;  2M8S A;  2AL3 A;  4MH8 A;  5AZF A;  4F1S A;  3H8H A;  4MEL A;  1KLG D;  3A9K A;  1OGW A;  4GIV A;  4W9H A;  3H7S A;  3JYU A;  2HTM E;  5KHO A;  4KKJ A;  4ACF A;  3AE5 B;  5LLI A;  4KX6 B;  1KOT A;  2JZP A;  1VCB A;  3EUB 2;  4A90 A;  4AOF A;  3RUI B;  2H89 B;  3BY4 B;  4WJP A;  1PUT A;  3ECI A;  2DWQ A;  3OAW A;  3J9C A;  3ZVV A;  3D32 A;  4RGM A;  4W9F A;  4FHJ A;  1Y8R C;  3AEB B;  5I4D A;  2WXI A;  2JQR B;  1JML A;  3JW0 X;  4XWW A;  5BYR A;  2O2V B;  1J0G A;  3HUI A;  5EDS A;  1C79 A;  3ZO5 B;  3RI7 C;  3U7D A;  4XYC A;  1VZ6 A;  1YD8 U;  2KTR B;  2BW2 A;  2L0T A;  1NEN B;  2SAK A;  4IOI E;  3VUX A;  4CO7 A;  4LLG M;  2N9L A;  4YTM B;  3NVV A;  3V62 A;  1PGB A;  1GNU A;  2QHO A;  1RM6 C;  2DZM A;  1SE2 A;  2M17 A;  2LXA A;  5JXV A;  1BUI C;  5BYQ A;  4XE0 A;  2HTH A;  3QAQ A;  2IND C;  4HRS A;  1WJU A;  2TSS A;  4M0W B;  1TZ1 A;  1E90 A;  4AS1 A;  1QIL A;  2ZVO A;  4AJY B;  2LUM A;  1V81 A;  2NS5 A;  3VUW A;  4XWT A;  4PYZ A;  1I42 A;  3WAM A;  1MJD A;  3TJP A;  2J7Q B;  2KDB A;  3FAH A;  2JX5 A;  1WZ3 A;  3M62 B;  2BPS A;  3VHT C;  4EZK A;  1E10 A;  2RR9 A;  1WM3 A;  1FMA D;  1GB4 A;  1UBQ A;  1HEZ E;  2RSU A;  2A5U A;  2N1V A;  1JAL A;  2LVP A;  3OLM D;  3JSV B;  2KLG A;  5CHW A;  1KLV A;  2WX0 A;  4WQO B;  4C00 A;  3S2A A;  4EE2 A;  4M8M A;  2EKI A;  4I6P A;  2LJI A;  2MP2 A;  2JRI B;  2GMI C;  2CS4 A;  3HHM A;  1S3S G;  2KN5 A;  3ZTD A;  2JU6 X;  2KTF A;  3NJT A;  5KHQ A;  4CQN A;  1V49 A;  2MJD A;  3PSE B;  4HDO A;  3ALB A;  4JX1 C;  4NNJ B;  1E7U A;  4ZRK A;  3KW5 B;  4FJZ A;  1WX7 A;  3P1M A;  4NQL B;  4E74 A;  1DYQ A;  1FO4 A;  4GLS C;  4USA A;  2WYQ A;  3AMZ A;  1K53 A;  4GDL A;  4L2Y A;  1GPX A;  1N60 A;  3ZQ4 A;  1JWS D;  4MJS B;  4P1B C;  2PLP A;  3ZGZ A;  4A8X C;  3L4P A;  1MPE A;  1GJZ A;  1QZE A;  2G9H D;  3KH0 A;  1WZ0 A;  2BYF A;  4HJG E;  1ACC A;  3QCA A;  5DPW A;  2PW9 A;  1UUP A;  5J18 A;  2INN E;  3A9K B;  1DGJ A;  2N7J A;  2WXM A;  3PLV A;  5IKC M;  1ZXI A;  3NVW A;  4K1R B;  1WX8 A;  5AEK B;  3EEC A;  3LB8 C;  2KN4 A;  2FBW B;  1TBE A;  2PPH A;  1L0Y B;  1Q0W B;  4BKG A;  3TEW A;  4GDK B;  2LGS A;  4WH4 A;  4KIK A;  4WWP A;  1MVK A;  2V1Y A;  3AEF B;  4OZB A;  4WWN A;  1T6B X;  3A4R A;  5IO9 A;  1ET9 A;  3P63 A;  3SD5 A;  5AUK A;  4C4V A;  3MFG A;  1WY8 A;  4II3 B;  3B0A A;  3DVG X;  3V60 A;  1L7Y A;  2PVG C;  4I6L B;  1QOF A;  2KMA A;  3QHT A;  3FKY A;  4X57 B;  3Q69 A;  1C3T A;  2VZK B;  2GBR A;  3VTW A;  2CHZ A;  1I4X A;  3NS8 A;  3ETR A;  3DBH I;  3ZXV A;  2WXR A;  2KK8 A;  4ANV A;  1V1O A;  3Q8B A;  1L6V A;  1L2N A;  2V9H A;  2K39 A;  1PQS A;  2YLM A;  3TL5 A;  3IHP C;  3ONS A;  4PS3 A;  2KWC A;  2JSV X;  4G3X B;  3ZNH B;  2LGY A;  2PE9 A;  2UU7 A;  4IKG A;  3MC9 A;  1C4P A;  1FFU A;  1R4M B;  1Z2M A;  3P2B A;  2ZCC A;  4TUU A;  2M56 B;  1KF6 B;  4YXD B;  1LFD A;  2OOB B;  3RNC C;  3VRB B;  1IP9 A;  3AE4 B;  1QF6 A;  4KKI A;  2K8B A;  4RGO S;  4KGR A;  4W9K A;  1I4H A;  4WJN A;  3I5J C;  2C7M B;  3Q3F A;  3DVG Y;  3WAO A;  4ASW C;  2E6X A;  2CHX A;  1EU4 A;  3P42 A;  3UIP B;  1IBX B;  1F2R I;  4J3O D;  2MP2 B;  4G50 A;  4RF0 A;  3Q3O C;  3N1Z C;  2NBW B;  2V3P A;  2MJ3 A;  4NY0 A;  2KQ7 A;  3ZRF A;  1L4Z B;  1L0V B;  1GUA B;  2K25 A;  3AN1 A;  1UZX B;  2PEA A;  3H6N A;  2BWE S;  3RNG C;  4ARI A;  3VH3 B;  1E6E B;  1R7S A;  2WXG A;  4GDL B;  1FIQ A;  4WQM A;  3BK2 A;  2QIE B;  1IPG A;  3TIX A;  2KZR A;  3H1U A;  3PS6 A;  1SJE D;  2BS3 B;  2K1F A;  2LFI A;  4MGK E;  3KUZ A;  4YWG G;  1L5P A;  3PLU A;  2ZW0 A;  2BVC A;  1JCK B;  1A70 A;  1T0R C;  1YQB A;  1RYJ A;  1OQY A;  3W9C B;  2KLC A;  2D3B A;  4A3O A;  1Y56 A;  1HTQ A;  1QT9 A;  4PYU A;  5HI1 A;  3DBR B;  4DWF A;  4AP4 C;  4RM8 A;  1NI2 A;  3CST A;  1FXA A;  2B76 B;  2B3A A;  4MM3 A;  4KIK B;  3PV1 A;  1Q1O A;  1IYF A;  2WHI A;  4JPS A;  1RFA A;  4GXB A;  2LJ5 A;  4C7Z A;  3CIR B;  4KSL C;  5GMV A;  2DAF A;  4XDD A;  2LZ6 A;  1XO3 A;  1KLU D;  1T5X D;  3EFC A;  1NDD A;  1E7V A;  3AE7 B;  1V6E A;  3MTN B;  4FHK A;  2RPV A;  1EO6 A;  1BT0 A;  2KMM A;  2ON8 A;  4YTP B;  2HJ1 A;  3UQA A;  1YX6 B;  4HKQ A;  2VZK D;  2CR5 A;  3AV8 A;  2O2V A;  3E9S A;  1EU3 A;  2BYE A;  2L05 A;  1FNV A;  2MBQ A;  3Q3N C;  3KYC D;  4A6Q A;  4DXF A;  2KTR A;  1WJ4 A;  3DBL B;  2ASQ A;  2JT4 B;  3N1X C;  4JWU C;  1V1P B;  3AXC A;  5D2M B;  3W1Y A;  1WJN A;  2GBJ A;  4OVV A;  3ZJU A;  1JW9 D;  1WIA A;  2BT6 A;  2IGG A;  1ZPS A;  1C76 A;  2D3C A;  4K7U A;  3N32 A;  4KDL B;  1Z5S B;  1MHH E;  5BMI A;  2CU3 A;  1SSN A;  3IBE A;  1KTK A;  1QKZ A;  4G0N B;  3RCZ A;  4TQ0 A;  2C60 A;  3PRM B;  3CSF A;  5G2N A;  2KWU B;  4RFB A;  2M1M A;  2WDT B;  1N5W A;  2D3A A;  4MT5 A;  3K9P B;  5BMH A;  5C3J B;  2N7D A;  4FUL A;  2N9E B;  2FUH B;  3VQI A;  5DPS A;  2RDG A;  3LJ3 A;  4HXD A;  2G3Q B;  2RDB C;  4FA6 A;  3BK1 A;  1YOV B;  1ZW7 A;  2KWV B;  2AWT A;  5E6J A;  3AU4 A;  4TV3 A;  4F7Z A;  3KVF B;  3URY A;  2Z0E B;  2DYO A;  3QWZ B;  4UDU C;  3B08 A;  3JSV A;  2L83 A;  4BKS D;  3TEZ A;  4II2 B;  3PGE A;  2DLB A;  4D2K A;  3W5U B;  1VRA B;  1VZ8 A;  4OVZ A;  1ZKH A;  4S17 A;  1ESF A;  1UGM A;  1VJK A;  4DXG A;  4NJ6 A;  4IG7 B;  1TKG A;  2DBY A;  3CF6 E;  4KZ0 A;  3HVD A;  1N5X A;  1XCT L;  2Y5B B;  2W55 A;  3AE3 B;  3AE2 B;  2JVC A;  3RPF C;  4MJS A;  1WR6 E;  2D10 A;  4OHJ A;  4HKZ E;  4F8C B;  3LYY A;  2MRP A;  1UBI A;  4HCP B;  1KJT A;  3N3K B;  1L0X B;  2W82 A;  4ITK A;  3WAN A;  2IO3 B;  2XN9 C;  2KWD A;  3CMM B;  2ZZP B;  2Z59 B;  2FNJ B;  5DCN A;  4MM3 B;  4N59 A;  3DDC B;  1VD2 A;  2NTS A;  2LVQ A;  3K9O B;  2KYW A;  2MBH A;  3ABV B;  2K3U A;  2UWQ A;  3A9J B;  1GAQ B;  4NJC A;  1NYR A;  2K6D B;  2L8J A;  3UIO B;  1FNU A;  3MJW A;  4GDK A;  4P7I A;  4MAC A;  4ZRP A;  4LNK A;  3TEY A;  1E8W A;  3M63 B;  1HQR D;  1WGD A;  1FRR A;  2JYT A;  1XLQ A;  2IO0 B;  4EFO A;  3H9D A;  1OTR B;  1RFK A;  2HJ8 A;  2BYT A;  3APD A;  3VUY A;  2NVU I;  3Q3M C;  2MBB B;  4NJ7 A;  5EE3 A;  2WNM A;  1AWD A;  4H2A A;  4YL8 A;  3Q8C A;  3IAS 1;  3EGR A;  2FIF A;  4HJK A;  2L7R A;  2AEH A;  2QCZ A;  4MSM B;  3DHH C;  4FJV B;  5HFY A;  1NI3 A;  2KNB A;  1STE A;  2ZNV B;  2LGD A;  3ZDM C;  2WXH A;  3NS1 A;  4HLE A;  3AE9 B;  5MPO A;  3DHI C;  4AUQ C;  1HXY D;  3EC8 A;  4GB9 A;  1MG8 A;  2R2O A;  4HEA 1;  5IP4 D;  2Y3A A;  3Q8F A;  1SE3 A;  2WXP A;  4OVU A;  4A55 A;  2AYO B;  2HD5 B;  1C4C A;  2KDI A;  3T8M A;  2KVR A;  5IA7 A;  4US9 A;  1G6J A;  1RRB A;  4DDG D;  2NTT A;  4DXA B;  1E8Z A;  3L13 A;  5DPT A;  4W9J A;  1YMH E;  4US8 A;  4W9E A;  1P7E A;  4W9D A;  4KVG B;  2QMT A;  2XK5 A;  2RMM A;  4JGH B;  1QQR A;  4RM9 A;  2XEW A;  4WUR A;  2QC8 A;  4NAW B;  2MQJ A;  1WWT A;  1TZO A;  4YTN B;  4FAD A;  4W9C A;  2DZJ A;  1PDX A;  3IT4 B;  2MW5 A;  3LXF A;  1IGD A;  3EHV A;  2REX A;  2MJE A;  1IBX A;  2GBK A;  1B9R A;  3V3X A;  2YVC A;  2MBE A;  4N58 A;  1U4A A;  2KAN A;  3GOE A;  2BF8 B;  3RNA C;  1JQ4 A;  1NBF C;  3P4R B;  1TIF A;  4RCO A;  3AEA B;  2LD9 A;  3AB5 A;  4ICV A;  2J52 A;  4BKS A;  2WQY B;  1C9F A;  2R2Q A;  2GLS A;  1FCL A;  3VDZ A;  2JYE A;  4ANX A;  3ZLZ A;  1WYG A;  4KDI C;  2BGF A;  1LQB A;  4XX5 A;  4A20 A;  5E6P A;  3E56 A;  1VDV A;  4FJY A;  1VLB A;  2ZPN A;  1AYF A;  3VTU A;  3NG0 A;  2LI5 A;  3P4Q B;  2WU2 B;  3VVW B;  3AE6 B;  2V0G A;  1NYQ A;  1OQQ A;  1UD7 A;  1ZGU B;  3ML9 A;  1HTO A;  4BVU C;  2WX1 A;  4DHZ E;  4GOC A;  2KDM A;  2V3S A;  4GN1 A;  1FPY A;  2FID A;  1N63 A;  5EE9 A;  2LWP A;  1QLB B;  4P6V F;  4YSZ B;  1FEH A;  2DX5 B;  3PPA A;  2J53 A;  2MBO A;  3X0W A;  3VFK A;  3AEG B;  3W2D A;  2FCQ A;  2V4I B;  1GC6 A;  3OJ4 B;  4KGT A;  4MSQ B;  4P1C C;  3NUH B;  3DVN U;  2MLB A;  5TSS A;  3W5V B;  2OHF A;  3HVZ A;  4BAX A;  1E5W A;  4RGT A;  4K81 A;  2BS2 B;  3TBL D;  4LJP B;  1XF5 L;  3PZ7 A;  1EM7 A;  2Y5C A;  1SJH D;  4FBJ B;  3HM3 A;  2L76 A;  3APF A;  4IC7 B;  1CK1 A;  2IJ0 A;  1DOI A;  1N62 A;  4KV2 A;  1ZDX A;  3BIN A;  4IM3 A;  1P98 A;  5C2T B;  3AU5 A;  1DOY A;  1V1P A;  2LRU A;  2PE6 B;  2W3S A;  4J6I A;  2LAS A;  2CJO A;  5G5G A;  4WJO A;  2RDH A;  4LJO B;  2KVZ A;  1E0Z A;  2WLB A;  1FD6 A;  1WGK A;  1F0Z A;  2KDF B;  4M01 A;  1OEY J;  4HPM B;  2K8C A;  5JHA A;  1K8R B;  1UH6 A;  4LTU A;  2LGI A;  2XK5 B;  4W9I A;  5G55 A;  2JZ3 B;  3QK0 A;  2BWF A;  3WA0 A;  5C1Z A;  2N7E A;  4ZRJ A;  3ZKJ C;  3SFD B;  1ET6 A;  2WXJ A;  1E8Y A;  2BBC A;  3PHW B;  3RNB C;  3GS2 A;  4ZRQ A;  1XD3 B;  4XGA B;  3H7P A;  1TS3 A;  2DYM A;  4L23 A;  2XBB C;  3R66 C;  2DEN B;  5CHV C;  5HHD G;  4MGZ E;  3MJ5 A;  3I57 A;  2VH1 A;  1E8X A;  3DWG C;  2AQ1 B;  4IM2 A;  2CJN A;  3RT3 B;  1V2Y A;  2DAJ A;  3IVF A;  4N6E B;  4JQW C;  4IDI A;  1D5X C;  3RNE C;  2WP9 B;  3SHQ A;  3N9Y C;  4W9L A;  1EWC A;  1UF0 A;  2D2Q A;  3DHG C;  3NOB A;  3U2S C;  5AZH A;  2Z8L A;  2KJR A;  1IGC A;  4B0M A;  2KT7 A;  4ZYS A;  1I35 A;  1AW7 A;  2QEJ C;  1J19 A;  3DBS A;  2OJW A;  3I9V 1;  1RWS A;  3AEC B;  3IFW B;  1WE7 A;  4ANU A;  2J42 A;  2E3T A;  4GMV A;  5H8Y E;  2BS4 B;  2L00 B;  1GOZ A;  2INP E;  2C7H A;  2FUG 1;  2DHZ A;  1MG4 A;  1WGG A;  1B1Z A;  2H88 B;  2J0J A;  3NY5 A;  3NVZ A;  4WWO A;  3U52 E;  1ROE A;  2ZNV C;  2JZZ A;  2OJR A;  1FFV A;  1Q10 A;  5IOI A;  1AAR A;  3ZNI D;  4ANW A;  4LNN A;  3X23 A;  1R4M I;  2IGH A;  3IAM 1;  1J7B A;  1FNW A;  2ZVN A;  2XNA C;  4TSS A;  2MEK A;  2FAZ A;  1RAX A;  4M8N A;  5BMG A;  5EE1 A;  2JXX A;  2G1E A;  2D11 A;  2IO1 B;  3A9J A;  3MC0 B;  2W3R A;  4REZ A;  4W9G A;  1R4N I;  2WDV B;  4HK2 A;  3MHS D;  4E71 A;  1UNS A;  1ZOY B;  4LNF A;  1TS5 A;  1YNT E;  3UGB B;  4L1B A;  3B2G A;  3GZN B;  4S0R A;  2CU1 A;  4NQK E;  1YJ1 A;  4LK0 M;  2ZW1 A;  4FXC A;  3GE3 C;  5D94 A;  2WXL A;  4K3C A;  3B9J A;  5BO4 B;  1SXT A;  1D3Z A;  3HM6 X;  1I4G A;  4LNI A;  3EA6 A;  3RZF A;  2M19 A;  4IWQ A;  3RFZ B;  4DK5 A;  2KOX A;  2JY6 A;  3BVZ A;  2K22 A;  2Z0D B;  3NRZ A;  1WMH A;  3KUD B;  2K8H A;  3BVM A;  3M95 A;  1TT5 B;  2IY0 B;  4MH0 E;  2IY1 B;  4M02 A;  2C5L C;  3AUL A;  3W1S C;  1V8C A;  1JWB D;  1CJE A;  3VAW A;  2LRW A;  2L0F A;  5LXI B;  4YT0 B;  3NZ3 A;  4N9F 4;  4IWP A;  2LHD A;  2N9X A;  2NBU A;  2R61 A;  2W9N A;  1T0S C;  2GOW A;  3DBR I;  1NVI D;  5J2R A;  3B2F A;  3H7P B;  4A9A A;  1ZDV A;  3R3M A;  3V61 A;  1P0R A;  5CX3 A;  3RZW C;  4HPP A;  4K3B A;  3R8B A;  4ICU A;  4HRO A;  2WDR B;  4NAW A;  4ZYN A;  2K6Q A;  1WGY A;  4RNA A;  2ZPY A;  5J17 A;  3PRZ A;  2KX3 A;  1AN8 A;  1WF9 A;  4ZDV A;  1XLN A;  1EF5 A;  5E6O A;  4LDT B;  3OG5 A;  2IPK D;  1WGH A;  1YN4 A;  1WE6 A;  2BKR B;  3PHX B;  2NMQ A;  2PMV A;  2WXF A;  4C56 C;  2KDE B;  1L6U A;  1QOA A;  5GXG B;  3PT2 B;  5D3D A;  2VRR B;  1F2R C;  2EKE C;  3SFE B;  2Q5W D;  2L1A A;  1UWM A;  4BFR A;  1MI0 A;  4WAF A;  2M0X A;  1KFY B;  1T3Q A;  1V86 A;  2LHE A;  4LCD E;  2BQQ A;  2K0P A;  5LXH A;  1VR9 A;  3DBL I;  2KC1 A;  2O6V D;  1WXM A;  2L3Z A;  3W1S A;  1WXA A;  4OW0 A;  2IZV B;  2BB5 A;  2KQS A;  2HE7 A;  1WI0 A;  3BVG A;  4XC2 A;  3AED B;  1PYW D;  2I1K A;  4URK A;  5JHB A;  4RGN A;  2N9K A;  1JWA D;  3DWM A;  4EZL A;  1PGX A;  2PIA A;  4IW0 A;  1N6Z A;  4C7Y A;  5FR3 A;  4TMA B;  5FK9 C;  1RLF A;  1TYG B;  2I2Y A;  1FM0 D;  1XXG A;  2NR2 A;  5IN7 A;  1KRH A;  2UYZ B;  4TQ1 A;  3V05 A;  3RNF C;  3U30 A;  2AQ2 B;  4G11 A;  3AI5 A;  2DNF A;  3ZW3 A;  2KHW B;  2WS3 B;  1LGR A;  2KFK A;  5AUI A;  4HVB A;  3MP9 A;  2KD0 A;  2WWZ A;  1KM7 A;  3UIN B;  2ICI A;  4NAM A;  1WR1 A;  3KLS X;  2X8X X;  5T8I A;  4E3C A;  3N20 C;  2W54 A;  1TTN A;  3M3J A;  3O13 A;  2Y5P A;  1HE8 A;  2WXK A;  1WSP A;  1YX5 B;  2KMC A;  1PGA A;  5H92 C;  3L0W B;  4BKT A;  5D3I B;  3PO0 A;  1GG3 A;  1WMH B;  3OWE B;  2BTE A;  1VZ7 A;  1I7H A;  3ZRC A;  1GB1 A;  3VTV A;  3Q2A C;  2DZI A;  2KJH B;  1OEY A;  4MGY E;  4AQ7 A;  3SDL C;  1HZ6 A;  1K50 A;  2A4Z A;  4Q2J A;  3ZUN A;  3ZXR A;  1T0Y A;  4GGQ A;  4HPL B;  2JWU A;  2V3N A;  3ENE A;  2QDF A;  3DOW A;  1YN5 A;  3T3N A;  3I63 C;  1BXT A;  1H4R A;  1QOG A;  2L52 A;  2LXC A;  3A4S C;  2JPH A;  1C77 A;  3TMP B;  1WX9 A;  1SGH A;  3UI3 A;  2ONQ A;  4LDT D;  1F77 A;  3AE1 B;  2QSD A;  3FIL B;  1HZ5 A;  2NCN A;  2FCN A;  2X38 A;  2RGF A;  4QAY A;  3U7Z A;  3QAR A;  4DHJ D;  2EMS A;  2KJ6 A;  1JRO A;  3NZU A;  2N9P C;  5FR6 A;  3QIJ A;  2D5G A;  1YJI A;  5EE0 A;  4B95 A;  3LDZ E;  2LGX A;  3GP7 A;  3C0R B;  1UGJ A;  4C80 A;  2D3G A;  3RD2 A;  1P3Q U;  3L17 A;  3UF8 A;  4K7W A;  2G4D B;  5G5H A;  1SB3 C;  4CHK A;  1GC7 A;  4K7S A;  1E9M A;  2NPT A;  1FXT B;  3DBH B;  3SU8 X;  3BII D;  1ZUD 2;  4KGS A;  3ZIM A;  3UQB A;  3ZNG C;  1BML C;  3HK0 A;  1UEL A;  3TUO A;  2O6V A;  2WU5 B;  4RH6 A;  1SIJ A;  3KYD D;  2NBV B;  4IM0 A;  3PTF C;  2KC2 A;  5JH5 C;  2FCM A;  1SIF A;  3BYY B;  1MFW A;  2AL6 A;  3Q3J A;  3RUL A;  3KWV A;  3PRP B;  3KQ4 A;  4DDI D;  3AE8 B;  3VH4 B;  3P4S B;  1H8C A;  1KH0 A;  3ZYY X;  3Q8E A;  4IUM B;  3WAP A;  3I3T B;  2LMC A;  3V6E B;  2KXJ A;  4NPN A;  1D5Z C;  2KFK B;  2KO3 A;  1OFF A;  4BOS C;  1SEB D;  2EEL A;  3B1L X;  2KKC A;  1FCC C;  4ARC A;  1EUV B;  3IG3 A;  3CWI A;  5HKH A;  2KAJ A;  3IXS A;  1C1Y B;  4WIP A;  5IAA C;  2FCS A;  2GI9 A;  1TS4 A;  1XCQ L;  4LNO A;  3TSS A;  1TJE A;  4XDC A;  1CQV A;  5HG2 A;  4EEW A;  5L95 C;  3KUC B; 
#chains in the Genus database with same CATH homology
 3PRE A;  1P1A A;  1ZKH A;  2J0K A;  4FLH A;  2ZVN A;  3VUW A;  4EZJ A;  4PYZ A;  1UGM A;  1I42 A;  4FN2 A;  3WAM A;  2FAZ A;  1SE9 A;  1RAX A;  3NHE B;  4M8N A;  3TJP A;  2J7Q B;  4NJ6 A;  4IG7 B;  2JXX A;  2KDB A;  3O65 B;  3CF6 E;  4KZ0 A;  1WM2 A;  1WZ3 A;  3M62 B;  2BPS A;  2D11 A;  2IO1 B;  3A9J A;  2RPQ A;  3VHT C;  4EZK A;  2RR9 A;  2Y5B B;  3WAL A;  1WM3 A;  2RD0 A;  1UBQ A;  4W9G A;  1R4N I;  3A33 B;  2RSU A;  2A5U A;  4HK2 A;  2JF5 A;  2JVC A;  2N1V A;  3MHS D;  2M4N A;  4MJS A;  2LVP A;  3OLM D;  4HDQ A;  4MEM A;  1WR6 E;  2D10 A;  4E71 A;  3JSV B;  2C7N B;  2KLG A;  3DVN V;  5CHW A;  1KLV A;  2V4L A;  2WX0 A;  4WQO B;  4F8C B;  3S2A A;  1LM8 B;  2MRP A;  1UBI A;  4HCP B;  1KJT A;  3VXW A;  2MX2 A;  4M8M A;  3N3K B;  4BBN C;  3UGB B;  4I6P A;  2MP2 A;  2JRI B;  2GMI C;  2CU1 A;  2CS4 A;  1YJ1 A;  4NQK E;  3WAN A;  3HHM A;  1S3S G;  2KN5 A;  3ZTD A;  2IO3 B;  2KTF A;  3CMM B;  2G4S A;  2ZZP B;  1V49 A;  2Z59 B;  2FNJ B;  5D94 A;  5DCN A;  5KHQ A;  4HDO A;  3DDC B;  3PSE B;  3ALB A;  1VD2 A;  4NNJ B;  1E7U A;  2LVQ A;  3DCG A;  4ZRK A;  5BO4 B;  3K9O B;  3KW5 B;  2CHW A;  1D3Z A;  2I1J A;  3HM6 X;  4FJZ A;  1WX7 A;  4NQL B;  1ISN A;  4E74 A;  2MBH A;  3ZTC A;  2N4F A;  2UWQ A;  3A9J B;  4IWQ A;  3RZF A;  2K6D B;  2WYQ A;  4RMA A;  2L8J A;  4GDL A;  3UIO B;  4DHZ B;  4DK5 A;  3MJW A;  4GDK A;  4P7I A;  1V5O A;  2CKH B;  3R7Q A;  2KOX A;  2JY6 A;  2KFJ A;  5C23 A;  4MJS B;  1E8W A;  2Z0D B;  3M63 B;  1WMH A;  3QC8 B;  3KUD B;  1WGD A;  2K8H A;  1GJZ A;  1QZE A;  2IO2 B;  3KH0 A;  3M95 A;  1WZ0 A;  3WIM A;  2BYF A;  2IY0 B;  4MH0 E;  2IO0 B;  4EFO A;  3ML8 A;  2IY1 B;  3H9D A;  1OTR B;  2C5L C;  3AUL A;  3QCA A;  2HJ8 A;  3W1S C;  5DPW A;  3APD A;  3VUY A;  5J18 A;  2NVU I;  3U8Z A;  5D6J B;  3VAW A;  2LRW A;  2L0F A;  3A1Q A;  3A9K B;  2MBB B;  4NJ7 A;  5LXI B;  2BYV E;  3PLV A;  3QQ8 B;  4YL8 A;  4N9F 4;  4IWP A;  2N9X A;  2NBU A;  1WGR A;  2W9N A;  2GOW A;  2FIF A;  3DBR I;  1WX8 A;  4HJK A;  4K1R B;  2C9W B;  2L7R A;  4A3P A;  2MA9 B;  2AEH A;  5AEK B;  5J2R A;  2NPT B;  3EEC A;  4MSM B;  2BKF A;  3H7P B;  3QA8 A;  3R3M A;  3V61 A;  1P0R A;  5CX3 A;  3RZW C;  4ICU A;  4NAW A;  4FJV B;  4ZYN A;  1TBE A;  2K6Q A;  2PPH A;  1Q0W B;  2G45 B;  1WGY A;  4IWO A;  5DPR A;  4BKG A;  2KNB A;  2ZPY A;  4GDK B;  2ZNV B;  2LGD A;  3QJZ A;  5J17 A;  1TGZ B;  3ZDM C;  4HLE A;  4KIK A;  4AUQ C;  3PRZ A;  4WWP A;  4HCN B;  2KX3 A;  2V1Y A;  2N1W A;  1WF9 A;  3EC8 A;  2O6V B;  3DQV A;  4GB9 A;  1MG8 A;  4MGI E;  4ZDV A;  2R2O A;  5JZE B;  3L16 A;  1EF5 A;  5E6O A;  4LDT B;  4WWN A;  1WGH A;  5CTR C;  3A4R A;  3RYT A;  2GBN A;  2GBM A;  4GU2 A;  4OVU A;  1XT9 B;  1WE6 A;  4AJW A;  2BKR B;  2AYO B;  3PHX B;  2HD5 B;  3SD5 A;  2KDI A;  3T8M A;  1V5T A;  4AWJ A;  2KVR A;  2IBI B;  5IA7 A;  1G6J A;  1RRB A;  1EF1 A;  2KDE B;  4DDG D;  1WY8 A;  2ZCB A;  4MDK E;  4DXA B;  4II3 B;  3B0A A;  3DVG X;  3R7R A;  3V60 A;  1E8Z A;  3PT2 B;  1L7Y A;  3L13 A;  5DPT A;  2KX0 A;  4CYE A;  4I6L B;  4W9J A;  2KMA A;  2VRR B;  3QHT A;  1WFY A;  4W9E A;  4B9K A;  2EKE C;  3PZD A;  4X57 B;  4W9D A;  5D7G A;  4KVG B;  4BFR A;  2XK5 A;  2M0X A;  1A5R A;  1C3T A;  4JGH B;  1V86 A;  4JL9 A;  4RM9 A;  1P9D U;  2XEW A;  4LCD E;  4NAW B;  5LXH A;  3DBL I;  4EKU A;  1X1M A;  2GBR A;  2MQJ A;  3VTW A;  2CHZ A;  1WH3 A;  2DZK A;  3NS8 A;  2KC1 A;  2O6V D;  4FAD A;  1WXM A;  2L3Z A;  4W9C A;  3W1S A;  3DBH I;  2DZJ A;  1WXA A;  2MW5 A;  3TCA A;  2KK8 A;  2IZV B;  4ANV A;  3EHV A;  2REX A;  4BOZ B;  1JRU A;  2KQS A;  2J0M A;  1L2N A;  1CMX B;  2GBK A;  2K39 A;  2YVC A;  1Q5W B;  2HE7 A;  2MBE A;  1PQS A;  1WI0 A;  3APC A;  2YLM A;  3TL5 A;  3IHP C;  3ONS A;  4XC2 A;  1U4A A;  1XQQ A;  2KAN A;  3GOE A;  4PS3 A;  2JRH A;  2BF8 B;  2KWC A;  4G3X B;  2I1K A;  4URK A;  3ZNH B;  5JHB A;  2LGY A;  2PE9 A;  2DYB A;  3ZNZ B;  4EZL A;  4ZRI A;  4IW0 A;  1NBF C;  2EMT A;  4DBG A;  1Z2M A;  3P2B A;  1RLF A;  2ZCC A;  4TUU A;  1LFD A;  2OOB B;  3DPD A;  2LD9 A;  3N30 A;  4ICV A;  4BKS A;  1IP9 A;  3NZS A;  2K8B A;  4W9K A;  1YIW A;  2R2Q A;  4WJN A;  3VDZ A;  2C7M B;  2NR2 A;  3Q3F A;  5AZG A;  3DVG Y;  3WAO A;  4ANX A;  2UYZ B;  1F9J A;  3L54 A;  4TQ1 A;  3HIZ A;  3ZLZ A;  3U30 A;  4KDI C;  2BGF A;  4B6W A;  4G11 A;  4JLC A;  4ASW C;  1LQB A;  2CHX A;  3AI5 A;  4XX5 A;  4A20 A;  5E6P A;  3ZW3 A;  2KHW B;  3UIP B;  3T9L A;  4FJY A;  1WXV A;  2PJH A;  2ZPN A;  3VTU A;  2KFK A;  4KSK C;  2MP2 B;  4HVB A;  4G50 A;  2KD0 A;  2LI5 A;  2WWZ A;  2LVO A;  4EOY A;  1KM7 A;  1V80 A;  2MWS B;  2NBW B;  3UIN B;  3VVW B;  4NY0 A;  1M94 A;  2KQ7 A;  1WR1 A;  3ZDT A;  3ZRF A;  3V6C B;  4I6N B;  1GUA B;  4PS8 A;  1UD7 A;  1ZGU B;  3ML9 A;  4E3C A;  2K25 A;  1UZX B;  2PEA A;  3M3J A;  1TTN A;  2WX1 A;  2BWE S;  3H6N A;  4BVU C;  4DHZ E;  3VH3 B;  4GOC A;  2V3S A;  1HE8 A;  4GN1 A;  2FID A;  1YX5 B;  4GDL B;  4JIO U;  2KMC A;  2LWP A;  2DX5 B;  3L08 A;  3PPA A;  1IPG A;  3QX1 A;  3TIX A;  1WRD B;  2MBO A;  2KZR A;  3L0W B;  3X0W A;  3H1U A;  4BKT A;  1GG3 A;  1WMH B;  3PS6 A;  3VFK A;  4BBN F;  3EFU A;  3ZRC A;  2K1F A;  3VTV A;  4MGK E;  2FCQ A;  3KUZ A;  3OJ4 B;  1GC6 A;  2DZI A;  4MSQ B;  3PLU A;  2KJH B;  1OEY A;  4MGY E;  3DVN U;  2MLB A;  3SDL C;  1WXS A;  3A1Q B;  2IYD B;  2MSE D;  2A4Z A;  4DHJ B;  1E5W A;  2JUO A;  4K81 A;  5CHF A;  5TR5 A;  3ZUN A;  1YQB A;  1T0Y A;  4GGQ A;  2D07 B;  3TBL D;  1OQY A;  4HPL B;  4LJP B;  3GZN I;  3ENE A;  5E6N A;  2KLC A;  4FBJ B;  3HM3 A;  1V9J A;  3DOW A;  1LXD A;  4A3O A;  2L76 A;  4PYU A;  4DWF A;  3APF A;  4IC7 B;  1H4R A;  2LUE A;  5L83 A;  4KZC A;  1WYW B;  4KV2 A;  2ZEQ A;  4AP4 C;  4HWI B;  4RM8 A;  1NI2 A;  2LXC A;  3CST A;  3JVZ X;  4WJQ A;  3A4S C;  2JPH A;  3BIN A;  3L10 B;  3TMP B;  1WX9 A;  1SGH A;  2B3A A;  4MM3 A;  4KIK B;  4IM3 A;  1P98 A;  3PV1 A;  4LDT D;  1Q1O A;  2ZJD A;  1IYF A;  3PVL A;  4GSW A;  3AU5 A;  1RFA A;  4GXB A;  2MCN B;  2LJ5 A;  2NCN A;  2FCN A;  2RGF A;  2LRU A;  2PE6 B;  4J6I A;  4EUT A;  2LAS A;  3QAR A;  2JWZ A;  4KSL C;  5GMV A;  4DHJ D;  2DAF A;  2EMS A;  2KJ6 A;  4WAA A;  1J8C A;  4WJO A;  4LJO B;  2LZ6 A;  4XZ4 A;  3NZU A;  1NDD A;  2N9P C;  1E7V A;  3OJ3 A;  1S1Q B;  1V6E A;  2KDF B;  3MTN B;  3QIJ A;  4FHK A;  5FR6 A;  1OEY J;  4HPM B;  4PS7 A;  2K8C A;  5JHA A;  1EO6 A;  4B95 A;  3LDZ E;  1K8R B;  1BT0 A;  1WJ6 A;  2LGX A;  4TKN A;  1UH6 A;  3UQA A;  3C0R B;  1YX6 B;  2M8S A;  2CR5 A;  2O2V A;  2XK5 B;  2AL3 A;  2D3G A;  4W9I A;  2JZ3 B;  5G55 A;  3QK0 A;  2BWF A;  3WA0 A;  5AZF A;  5C1Z A;  2N7E A;  3RD2 A;  4F1S A;  5JH5 C;  4MEL A;  1P3Q U;  2BYE A;  2L05 A;  3L17 A;  4ZRJ A;  3A9K A;  3ZKJ C;  3UF8 A;  2MBQ A;  1OGW A;  3KYC D;  4GIV A;  4K7W A;  4W9H A;  2G4D B;  3H7S A;  1E8Y A;  2KTR A;  3PHW B;  1WJ4 A;  3JYU A;  4CHK A;  1GC7 A;  5KHO A;  2ASQ A;  4K7S A;  2JT4 B;  1XD3 B;  2NPT A;  5LLI A;  1FXT B;  3H7P A;  3SU8 X;  3AXC A;  2DYM A;  5D2M B;  1KOT A;  3W1Y A;  1WJN A;  2GBJ A;  4OVV A;  1VCB A;  1WIA A;  2XBB C;  3R66 C;  4AOF A;  3RUI B;  3BY4 B;  2DEN B;  4WJP A;  5CHV C;  4MGZ E;  3ECI A;  3ZIM A;  3UQB A;  3ZNG C;  4K7U A;  1E8X A;  3HK0 A;  3OAW A;  3N32 A;  1UEL A;  4IM2 A;  2O6V A;  4KDL B;  1V2Y A;  3RT3 B;  2DAJ A;  1Z5S B;  3IVF A;  3ZVV A;  4JQW C;  3D32 A;  4W9F A;  4FHJ A;  1Y8R C;  3IBE A;  3RCZ A;  4G0N B;  3SHQ A;  4W9L A;  4TQ0 A;  2C60 A;  3KYD D;  3JW0 X;  2NBV B;  2O2V B;  1J0G A;  2D2Q A;  3PRM B;  3CSF A;  2KC2 A;  3PTF C;  2FCM A;  3NOB A;  1SIF A;  4IM0 A;  2KWU B;  5G2N A;  5AZH A;  5EDS A;  2KJR A;  3ZO5 B;  2AL6 A;  2M1M A;  2WDT B;  3Q3J A;  3RUL A;  3U7D A;  3PRP B;  1YD8 U;  2KTR B;  3K9P B;  4DDI D;  3VH4 B;  1H8C A;  1I35 A;  2L0T A;  1J19 A;  3DBS A;  2N7D A;  4FUL A;  2N9E B;  3IFW B;  2FUH B;  4IUM B;  3VQI A;  1WE7 A;  5DPS A;  3VUX A;  3WAP A;  3I3T B;  3V6E B;  4ANU A;  4CO7 A;  3LJ3 A;  4GMV A;  4HXD A;  2L00 B;  2KXJ A;  4NPN A;  2G3Q B;  4FA6 A;  2KFK B;  2C7H A;  2KO3 A;  3V62 A;  1GNU A;  1ZW7 A;  2KWV B;  2QHO A;  4BOS C;  2DZM A;  3B1L X;  2AWT A;  2DHZ A;  3AU4 A;  2KKC A;  2LXA A;  2M17 A;  4TV3 A;  4F7Z A;  3KVF B;  1WGG A;  1EUV B;  3IG3 A;  2Z0E B;  2DYO A;  5HKH A;  2J0J A;  3NY5 A;  3QWZ B;  4WWO A;  3B08 A;  3JSV A;  2HTH A;  3QAQ A;  4BKS D;  1C1Y B;  5IAA C;  2FCS A;  4II2 B;  1WJU A;  3PGE A;  2ZNV C;  2JZZ A;  2OJR A;  4M0W B;  1TZ1 A;  1AAR A;  3ZNI D;  1E90 A;  4ANW A;  2ZVO A;  4AJY B;  4EEW A;  3KUC B;  3X23 A;  5L95 C;  1V81 A;  1R4M I;  2NS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...