2G4SA

Anomalous substructure of nbr1pb1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
b'AMEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Next to BRCA1 gene 1 protein
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 24
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2g4sA01
4FHJA 4HJKA 5LXHA 2JT4B 1WZ3A 2N9EB 3A9KB 1S1QB 4ICVA 2R2QA 3KYCD 3UF8A 1U4AA 2MWSB 3KW5B 3S2AA 3KYDD 2KHWB 5LXIB 3ENEA 1V81A 5E6OA 3MTNB 3B08A 1P1AA 3QIJA 2N4FA 5IAAC 3KUZA 2C7MB 3RZFA 3ZO5B 4NJ6A 4GB9A 4GDLB 4MGIE 5JZEB 3UIPB 3L0WB 2PE9A 3JSVA 2RD0A 2W9NA 2FCQA 4GDKB 2RGFA 4WWNA 1RFAA 2GBJA 2L3ZA 3R3MA 3HM3A 1YX5B 3L16A 1E8YA 2Z0DB 2BYEA 4OVUA 2M17A 3DPDA 2IY1B 1BT0A 2XK5A 3N30A 3L10B 2MBOA 2LWPA 4WWPA 2D11A 2IY0B 2J0MA 1P3QU 3PZDA 2KO3A 4W9KA 1EF5A 1EF1A 2ASQA 4W9FA 3PRZA 2IYDB 5J2RA 4GMVA 1OEYJ 1G6JA 4F7ZA 4ICUA 3QHTA 3ZRFA 2KDFB 2MBBB 1KLVA 2WYQA 3NOBA 4E74A 4NAWA 1WXVA 2BF8B 3OAWA 2LI5A 2G45B 3DVNV 1J8CA 3V6CB 1VCBA 2IZVB 4MM3A 4IWQA 3PGEA 2BGFA 5FR6A 2KQSA 1RLFA 3RYTA 4ZDVA 2GMIC 2QHOA 3ZNGC 2K8HA 5L95C 3DCGA 1WX8A 2MP2A 2CHWA 1XD3B 3QAQA 2JZZA 2KD0A 3Q3FA 4LJOB 4HWIB 4P7IA 4RM9A 2WX0A 3JSVB 2KLGA 2AEHA 4W9CA 2D07B 2I1KA 2Y5BB 3QWZB 4PS8A 4HCPB 4FN2A 3VTVA 5L83A 3ZTCA 2KOXA 4ANVA 2ZJDA 3T9LA 3IVFA 4HXDA 4TQ1A 5AZFA 3WA0A 2AWTA 2BYVE 3ZVVA 2MBQA 2XK5B 2AYOB 4MEMA 4EUTA 1JRUA 2MX2A 3W1YA 4BOSC 5GMVA 4PS7A 2B3AA 3PHXB 4M8MA 4MSMB 1UELA 2JUOA 3RUIB 4GIVA 3PV1A 2I1JA 2MSED 2EMTA 2L0FA 3N32A 4NAWB 4IC7B 3KUCB 4JQWC 2A4ZA 4BVUC 3VVWB 2DZJA 2N9XA 2LXCA 4MGYE 3LJ3A 3W1SA 2BKRB 1P9DU 1KOTA 4AUQC 4BKGA 3U30A 2LASA 2BKFA 2EMSA 1LFDA 2A5UA 2KFJA 2ZVNA 3TMPB 3X23A 1D3ZA 5CHWA 4MDKE 4RMAA 2MP2B 2RPQA 4IM2A 4WJQA 2JF5A 4ZRKA 2KDEB 5CX3A 4BBNC 2VRRB 4NPNA 4AOFA 4EEWA 4FJVB 3TCAA 3K9OB 3A1QA 4G11A 1LQBA 4KZCA 2K8CA 2KTFA 1WGGA 3DBHI 4G3XB 4HLEA 2NBUA 2JRHA 1EO6A 2RR9A 3APDA 1OTRB 2IO1B 3JVZX 2CHZA 2M4NA 3QQ8B 5JHAA 1WX9A 3OJ3A 2C9WB 3VFKA 1UH6A 4KSKC 2CKHB 2DAFA 2BWFA 2LXAA 3MHSD 4BKSA 4URKA 1A5RA 1I42A 3QK0A 5DPWA 2JZ3B 1RRBA 1SE9A 1WGHA 2KWCA 2UWQA 3AXCA 3P2BA 3M95A 2AL6A 2KC1A 2KWVB 2KANA 3PHWB 2FCNA 5BO4B 3EECA 1VD2A 3BY4B 3T8MA 4HDQA 5J18A 2M1MA 1WXMA 2J0JA 3KUDB 2LVPA 5JH5C 2JVCA 3ZNID 4ANUA 2HTHA 2MLBA 1WXAA 5EDSA 4G50A 1HE8A 1WY8A 3TJPA 4ANWA 4DXAB 4GN1A 4KDLB 4IWOA 4TKNA 2KMAA 2ZZPB 1FXTB 3VUXA 3IHPC 1RAXA 1TBEA 5D6JB 3B0AA 4W9IA 1T0YA 2RSUA 3L08A 4MJSA 3V60A 3H1UA 4J6IA 3VXWA 3M63B 2LD9A 1OEYA 3BINA 1WJ6A 3OJ4B 1WJ4A 3A1QB 2GBMA 4FJZA 4K81A 4KIKA 2N7DA 1S3SG 2JY6A 2N1VA 3ZKJC 2LZ6A 3EC8A 3V61A 1J19A 1WE6A 2LRWA 2M8SA 3CSTA 4W9LA 4GOCA 3EHVA 3VHTC 1Q0WB 1SGHA 2WX1A 3ALBA 4E71A 1IP9A 2M0XA 3ONSA 3NZUA 3ML9A 4FJYA 4DDGD 1TTNA 1C3TA 1WF9A 1ZGUB 3IBEA 1V9JA 4HVBA 2KDIA 4MELA 1LM8B 2KVRA 4KZ0A 2HE7A 1WH3A 2XEWA 2V4LA 4I6PA 1Q1OA 1E7UA 3ZUNA 1WI0A 2N7EA 2DENB 4TQ0A 3KH0A 3VUWA 4B9KA 1WE7A 4IM0A 3LDZE 5E6PA 4I6NB 3TL5A 3VH3B 4A3OA 3B1LX 1NBFC 1L7YA 3VAWA 4N9F4 3UIOB 2BPSA 3TBLD 4KV2A 2L76A 2K6QA 2ZPNA 3QA8A 1ISNA 2ZPYA 4AJYB 5TR5A 4XC2A 3WAOA 3VQIA 3DVGX 4CHKA 4F8CB 3PSEB 4DK5A 4W9DA 1EUVB 3ZTDA 1V49A 1YD8U 1YJ1A 3JYUA 1WX7A 3APCA 1V5OA 2L00B 4MJSB 4BKSD 3DVNU 2LUEA 2FUHB 2FCSA 4MGZE 1V6EA 2KK8A 1WRDB 2YVCA 4KIKB 3AU5A 3W1SC 2C5LC 4GSWA 4W9HA 3HM6X 2MA9B 2C7HA 3ZLZA 1UZXB 3RZWC 2J0KA 1P98A 4RM8A 5E6NA 2LGDA 3DBSA 1UD7A 3PRMB 3VTUA 2YLMA 3R7RA 3ZDTA 2DYBA 2KNBA 3HIZA 2JWZA 4K1RB 3NS8A 1Z2MA 5D94A 4PYZA 2N9PC 1R4MI 2MQJA 5DCNA 2CR5A 5LLIA 1E8XA 1WGYA 2K8BA 3PLUA 5D2MB 3UGBB 4W9GA 2K39A 3H6NA 4NY0A 5G2NA 1IPGA 2ZNVC 3A9JA 4M8NA 1WR6E 3A4SC 3WAPA 2LJ5A 2KJ6A 2OJRA 4ZYNA 2FIFA 1GUAB 4CYEA 2WWZA 4II3B 4EZLA 2L05A 2IO0B 3NY5A 4JIOU 2Z59B 3DDCB 3PS6A 2AL3A 2K25A 4E3CA 3UINB 1GNUA 4DDID 1V86A 4EZJA 1QZEA 4A3PA 1E7VA 3O65B 3DBRI 3SD5A 3UQBA 3ZDMC 3ZIMA 2LVOA 2K6DB 2KDBA 3L54A 1WIAA 5G55A 1K8RB 1WM2A 3V6EB 3L17A 2DHZA 4ZRIA 5AZGA 1XT9B 4GU2A 4IM3A 1NI2A 1GC7A 2NBWB 2ZCCA 1C1YB 4II2B 2PPHA 4EKUA 5HKHA 4HK2A 3QX1A 2KFKA 2LRUA 4WWOA 2JRIB 2JPHA 4F1SA 3K9PB 2NPTA 3X0WA 1XQQA 3WIMA 4BOZB 3M3JA 3H9DA 3DVGY 4MH0E 1PQSA 2LGYA 3DQVA 5JHBA 4YL8A 3A9JB 4FBJB 3WALA 3SU8X 5AEKB 4WJPA 3M62B 3RT3B 2Z0EB 4EZKA 1LXDA 2NS5A 1KM7A 1YQBA 3OLMD 4XZ4A 2O2VA 4NNJB 1V80A 4KDIC 1UGMA 2L8JA 4FULA 2G3QB 3ZNHB 3ZW3A 3R66C 2MBHA 3PTFC 2MBEA 1TZ1A 1WFYA 2KTRA 2D2QA 4BBNF 1I35A 4WQOB 1P0RA 2KJHB 4AP4C 2KLCA 2D3GA 4HDOA 5KHOA 2KZRA 4B95A 3MJWA 4JGHB 1WMHA 2KN5A 4IW0A 4LJPB 2ZNVB 3ZNZB 2O6VA 5DPRA 3U8ZA 4WJNA 5KHQA 4JLCA 4DHZE 2G4DB 3GOEA 3IG3A 2FAZA 2K1FA 3QJZA 4X57B 5CHVC 3DOWA 1UBQA 4FADA 1WXSA 4KVGB 1IYFA 1H8CA 3JW0X 2C60A 5D7GA 4GXBA 3H7PA 2PEAA 2FNJB 2LGXA 3IFWB 2DZIA 3I3TB 1GJZA 2KX3A 1Y8RC 2EKEC 2KFKB 2CU1A 1KJTA 2NBVB 3CSFA 2JXXA 2NPTB 2R2OA 4K7SA 1NDDA 4KSLC 3QARA 3RD2A 5CTRC 2KKCA 2O2VB 1OQYA 4HCNB 1E5WA 2BYFA 1E90A 4XX5A 2KC2A 3RCZA 4BFRA 1YIWA 3NHEB 2MCNB 1OGWA 4K7WA 3KVFB 4AJWA 4JL9A 1V2YA 2D10A 3HK0A 2KTRB 4OVVA 3C0RB 3ML8A 1E8ZA 1V5TA 2V3SA 3QCAA 3EFUA 2IO3B 2XBBC 2WDTB 4FHKA 3V62A 2DX5B 4I6LB 2KWUB 3RULA 1WR1A 2J7QB 2KQ7A 4BKTA 1ZKHA 4NQLB 1Q5WB 1WMHB 2REXA 2NR2A 2O6VB 4K7UA 4A20A 4IUMB 2V1YA 3WAMA 3AU4A 5DPSA 4WJOA 4NJ7A 1SIFA 1CMXB 3GZNI 4PYUA 2BWES 5IA7A 3VH4B 1X1MA 1WZ0A 1AARA 4ANXA 3PVLA 4WAAA 3H7PB 1ZW7A 2OOBB 4GGQA 4EFOA 2DYOA 5C23A 4DHJB 5C1ZA 1GC6A 3PREA 3Q3JA 4ZRJA 4DWFA 4NQKE 2FIDA 3CF6E 4FLHA 2N1WA 3PRPB 3VTWA 3HHMA 2LVQA 4CO7A 1TGZB 5AZHA 3TIXA 4PS3A 4B6WA 3A33B 1R4NI 2GBNA 2O6VD 1L2NA 2PE6B 1WJNA 2DAJA 2UYZB 3A4RA 1F9JA 1E8WA 3N3KB 5J17A 4IG7B 3H7SA 3U7DA 3VDZA 3DBLI 4HPLB 3SDLC 2C7NB 3QC8B 2KX0A 1UBIA 2NVUI 2ZVOA 3A9KA 3CMMB 2ZCBA 4ASWC 4EOYA 2DZKA 2DYMA 3L13A 2GBRA 3ECIA 1GG3A 3NZSA 4DBGA 4DHJD 2HJ8A 4HPMB 2ZEQA 4MSQB 4W9EA 5DPTA 2KJRA 4GDLA 3PT2B 2NCNA 3WANA 1WGRA 2G4SA 1J0GA 2MW5A 4G0NB 2FCMA 4LDTB 1Z5SB 3AI5A 4FA6A 2CHXA 4GDKA 3D32A 4AWJA 3UQAA 1H4RA 2CS4A 3SHQA 1WYWB 3PPAA 2L0TA 1MG8A 5CHFA 4TV3A 4LCDE 2IBIB 1YX6B 4TUUA 2HD5B 4IWPA 2KMCA 4W9JA 2GBKA 3AULA 2MRPA 4DHZB 2GOWA 3APFA 1WGDA 3PLVA 2KXJA 4M0WB 3R7QA 1M94A 2PJHA 2IO2B 1WJUA 2L7RA 3ZRCA 2DZMA 3VUYA 1WM3A 4LDTD 4MGKE
chains in the Genus database with same CATH superfamily
4FHJA 2N9EB 1WZ3A 3A9KB 1S1QB 5IN7A 3S2AA 3KWVA 1WYGA 1YOVB 3MTNB 1C78A 4GDLB 4MGIE 5JZEB 4YTNB 3UIPB 2SAKA 3AE4B 2MH7A 2RD0A 2W9NA 2WXRA 4GDKB 3L16A 2J4XA 2WXQA 1SJHD 3L10B 1FNWA 2IY0B 4MH8A 1EF1A 1G6JA 2JXTA 3ZRFA 2QEJC 1KLVA 4NAWA 3DVNV 1J8CA 4MM3A 2IGGA 3P4QB 2N0SB 5FR6A 4WURA 3B9JA 3ZYYX 4A6QA 3AM9A 2KD0A 1TKEA 2WX0A 2KLGA 2GI9A 4W9CA 2Y5BB 4PS8A 4P1CC 5L83A 5IKCM 2ZJDA 1YQ4B 4JX1C 3IVFA 3HRDD 1VR9A 4EUTA 1BUIC 1JRUA 1TIFA 2MX2A 1GB1A 4PS7A 1C76A 3BIID 1SBBB 1UELA 3RUIB 4GIVA 2L0FA 3N32A 4JQWC 2DZJA 5JXVA 4L1BA 3W1SA 4AUQC 2WDRB 1GPXA 1T0QC 2A5UA 3X23A 2M19A 5CHWA 2MP2B 4IM2A 3AE5B 3MC0B 2KDEB 4BBNC 1BMLC 2NTSA 1NVID 4RH6A 1VDVA 4AOFA 2K5PA 3TCAA 1E7PB 4G3XB 1QKZA 1EO6A 1MHHE 3AEAB 1OTRB 3JVZX 1TS3A 2JQRB 1XCTL 2LGSA 2DAFA 3MHSD 2WNMA 1A5RA 2TSSA 5EE9A 3P2BA 3AXCA 3M95A 4R3DA 1RWSA 2KWVB 3FILB 2KANA 3Q14C 3PHWB 2AX5A 2FCNA 1C77A 3AE7B 2XNAC 5BO4B 3BY4B 4KGTA 2YEPF 3I63C 2MLBA 2MHJA 1XLNA 1HE8A 4ANWA 4IWOA 3H8HA 4TKNA 3VUXA 4HKQA 5D6JB 1T0YA 2RSUA 2JX5A 4K3CA 3M63B 4LLGM 1TS2A 1WJ6A 3OJ4B 3A1QB 1AW7A 4RNAA 1S3SG 3ZKJC 1ESFA 3EC8A 2Y5PA 1J19A 2RDBC 3VHTC 1SGHA 2VH2A 1IP9A 2V0GA 1TTNA 2AQ3B 1C3TA 1ZGUB 1V9JA 1KLGD 2KDIA 4MELA 1YJJA 1WH3A 1FD6A 1Q1OA 3HVZA 3AV8A 3LDZE 1IUEA 4A3OA 4LNNA 1NBFC 3AE1B 1OQRA 1FIQA 2ZPNA 3QA8A 4F8CB 2KMMA 2UU7A 1EUVB 3Q6BA 2IPKD 1YJ1A 4BKSD 3APCA 3EUB2 4MGZE 2FCSA 5FKAC 3GP7A 4JPSA 3AU5A 1FCCC 2C5LC 1ZXHA 1UZXB 3RZWC 2J0KA 2QMTA 4RM8A 3DBSA 1UD7A 4NZLB 1MPEA 1SE3A 3HIZA 2JWZA 2WQYB 5D94A 2M56B 2K8BA 3Q8BA 3C19A 3UGBB 2ZNVC 3WAPA 1JWBD 3IT4B 1GUAB 2WWZA 2L05A 3TEXA 4JIOU 2Z59B 1DOIA 4ARIA 2W3RA 3DDCB 2LMCA 1NYRA 2K25A 3L4PA 2FBWB 3UINB 1V86A 1MHXA 3AEEB 3SD5A 3UQBA 2LVOA 2AQ2B 3V6EB 5AZGA 4ZRIA 1XT9B 4HJGE 1C1YB 1TYGB 1TKGA 2KFKA 4F1SA 1PGBA 3P4SB 4BOZB 2KQ4X 4MH0E 2LGYA 5JHBA 3DQVA 4FBJB 3WALA 4WAFA 4B0EA 2BS2B 1YQBA 3OLMD 2O2VA 4NNJB 3ZNHB 2D3CA 3W5UB 2E6XA 1DGJA 3P63A 3PTFC 2MBEA 1UF0A 2KTRA 3GZNB 1I35A 5IO9A 1P0RA 2BB6A 2VH1A 4NAMA 2D3GA 2L1AA 1ZE3D 3AH7A 4JGHB 2KN5A 2GB1A 2K1FA 2PIAA 3QJZA 4X57B 2OEDA 4JWUC 1FMAD 1H8CA 3JW0X 4XGAB 2C60A 4GXBA 3IFWB 2DZIA 3I3TB 2KX3A 1I4GA 2CU1A 1KJTA 3CSFA 2JXXA 1FRDA 3IAS1 2KKCA 4HCNB 4M01A 1E5WA 2WP9B 3DWGC 2YEPB 4BFRA 1YIWA 1UWMA 3NHEB 1OGWA 2MCNB 4OVVA 4EE2A 3QCAA 1ACCA 2WDTB 2WXIA 2KQ7A 2PVGC 2J42A 3RPFC 4PYUA 4N6EB 3VH4B 1X1MA 1AARA 3E9SA 4WAAA 2OOBB 1L0VB 3PREA 4NQKE 2FIDA 1R7SA 2N1WA 4ITKA 1TGZB 4M0WA 2NMQA 1R4NI 1L2NA 3BK1A 2KWDA 4JE3B 1F9JA 5J17A 4IG7B 3VDZA 3U7DA 3SDLC 3CMMB 3RI7C 4ASWC 2ZCBA 2DYMA 3L13A 1BXTA 2QSDA 3AECB 3KWLA 5DPTA 2NCNA 1WGRA 4UDUC 2CHXA 1HZ6A 3D32A 4AWJA 3UQAA 3Q3MC 1EU3A 1VZ6A 2WDVB 3U52E 3PPAA 5CHFA 4TV3A 1I7HA 4TUUA 3BVMA 2GBKA 2MRPA 1PFDA 1WGDA 3PLVA 1M94A 1WJUA 2L7RA 1WM3A 4OW0A 1TZOA 1HTOA 4MGKE 5LXHA 2JT4B 1F2RC 2X8XX 1C4AA 2R2QA 3KYCD 4O1NA 1U4AA 3DHGC 5LXIB 5E6OA 2QIEB 1D5XC 2C7MB 2MJDA 3RZFA 4NJ6A 2BTEA 1Q10A 1JROA 1L6UA 2ON8A 2RGFA 3Q8EA 2GBJA 2L3ZA 1IBXB 1T0RC 3HM3A 2JWUA 1E8YA 2Z0DB 2BYEA 5IP4D 2XK5A 2MBOA 4WWPA 1EM7A 1P3QU 3PZDA 4W9KA 4W9FA 4N58A 2IYDB 4GMVA 1QT9A 3QHTA 3NOBA 4E74A 1SXTA 3OAWA 2WXMA 1PYWD 1VCBA 5GXGB 5D3DA 2BGFA 1WRIA 3I57A 2KQSA 1JWAD 2WU5B 5L95C 3DCGA 5LNK1 4RF1A 4PT5A 2WLBA 3QAQA 2JZZA 4HWIB 1T6BX 3JSVB 2D07B 3QWZB 4FN2A 1UUPA 4GLSC 3ZTCA 1TT5B 5AZFA 1I4RA 2BYVE 4MEMA 3W1YA 4L23A 5GMVA 4MSMB 2E3TA 1SJED 2BBCA 4ZYSA 2EMTA 5IOIA 4MT5A 4ACFA 3VVWB 2PKOA 4MGYE 1EU4A 1KOTA 2BKRB 2BKFA 2LASA 3AEBB 1MG4A 1SE2A 4RMAA 2RPQA 4NPNA 1JMLA 2WXGA 3MC8A 1WGGA 2G1EA 1FPYA 4HLEA 4HEA1 2M4NA 1WX9A 3ZJVA 2C9WB 1JWSD 2H89B 1L0XB 4URKA 2Y5CA 2KWCA 1MJDA 2J52A 1P7EA 2V9HA 2KC1A 3FAHA 3ZXRA 1E0ZA 3T8MA 4HDQA 2M1MA 1WXMA 5JH5C 1FEHA 2JVCA 3P1MA 3NS1A 4KDLB 3DHIC 1RAXA 4MJSA 4B0MA 2K0PA 4KKIA 4US8A 3BINA 1DOXA 2ZW0A 3HUIA 4LTUA 1M4VA 2JYEA 2M8SA 3CSTA 1K50A 1Q0WB 2QJLA 2WX1A 3RNCC 2M0XA 4FJYA 4HVBA 1LM8B 4KZ0A 1YJIA 2V4LA 4YSXB 1E7UA 3ZUNA 3KH0A 3VUWA 5BYSA 5H8YE 1WE7A 3DWMA 3VH3B 4C56C 3DBRB 1L7YA 2WXFA 4J3OD 3TBLD 2L76A 1ISNA 1ZP0B 2ZPYA 4AJYB 5TR5A 3VQIA 3DVGX 3I9V1 3RMKC 3JYUA 2L00B 4RCOA 2N9KA 3DVNU 4KIKB 3HM6X 1FFVA 3TEYA 2LGDA 3T3OA 3R2IA 3R7RA 4K1RB 3NS8A 1F0ZA 4PYZA 2N9PC 3RNAC 2CR5A 1E8XA 3PLUA 5D2MB 1FNUA 1IPGA 4RF0A 1N60A 3NRZA 4ZYNA 1FNVA 1I4XA 2FIFA 4LNOA 4CYEA 4II3B 2IO0B 3DHHC 2WXJA 3BK2A 1FM0D 1L6VA 2EELA 4RGMA 4DDID 3P4PB 1QLBB 4NJCA 2IGDA 1QZEA 1E7VA 1C4PA 3ZDMC 2KDBA 3L54A 5G55A 2DHZA 4GU2A 4IM3A 5FR3A 3P4RB 3W2DA 5HKHA 1K51A 2LRUA 2INDC 2NPTA 3WIMA 3DVGY 2HJ1A 1PQSA 4XWTA 3A9JB 2I38A 3SU8X 5AEKB 3RT3B 4EZKA 1LXDA 4XZ4A 4US9A 3ZW3A 2MBHA 2D2QA 2D3BA 2ZW1A 2KJHB 4ZRQA 4HDOA 5KHOA 3VR9B 1WMHA 4IW0A 4LJPB 2ZNVB 2OHFA 2CJNA 3TSSA 3U8ZA 4WJNA 4JLCA 5CHVC 1UBQA 1IGCA 2PEAA 2FNJB 3W9CB 1C9FA 2EKEC 3DBLB 4JWSC 2R2OA 1XF5L 1ZUD2 4K7SA 1NDDA 3RNFC 2VZKB 3RD2A 2WXOA 4YSZB 3RCZA 4AJWA 2BYTA 1V2YA 2XN9C 3ML8A 4YWGG 4FHKA 1ENFA 5EE0A 4P6VF 1PGXA 3MP9A 4BAXA 4QAYA 2NR2A 2O6VB 4K7UA 4S17A 5T8IA 4A20A 4A8XC 2VZKD 3AE8B 4WJOA 4C4VB 2W55A 3GZNI 1CMXB 4NJ7A 4ANXA 3H7PB 1ZW7A 5HFYA 3AMZA 4GGQA 4ZHOA 3W5VB 5C1ZA 1B9RA 1NEKB 3U7ZA 3C8YA 3SEBA 1UNSA 2QCZA 1N6ZA 4PS3A 3A33B 4A90A 2O6VD 2PE6B 3H7SA 2C7NB 3A9KA 2AQ1B 3ECIA 3NZSA 1VZ7A 1XLOA 2ZEQA 3AE9B 1WSPA 4W9EA 1J7AA 4GDLA 3PT2B 3FKYA 2G4SA 2MW5A 4LDTB 1F52A 1Z5SB 4GDKA 1H4RA 3SHQA 1WYWB 2L0TA 1UGJA 2IBIB 1YN3A 2JYTA 2QC8A 2KMCA 3AULA 4DHZB 1ZXIA 2GOWA 3ZRCA 4OVZA 1NI3A 4C80A 4LDTD 1E10A 2QDFA 2KN4A 2MJEA 4ICVA 3UF8A 3N1YC 3KW5B 3KYDD 2KHWB 1F2RI 3ENEA 3B08A 1P1AA 3QIJA 5IAAC 3KUZA 3O13A 3ZO5B 4A9AA 3IT6B 1RFAA 1LGRA 2MJ3A 1QOFA 1WWTA 4HRSA 1V1PB 2RPVA 1B1ZA 2LWPA 4XYCA 2J0MA 1EF5A 2Q5WD 3PZ7A 1OEYJ 4F7ZA 4XWWA 2BF8B 2LI5A 4PK1A 3V6CB 2IZVB 2RDHA 4ARCA 1D4BA 1ZDVA 3RYTA 2QHOA 2WXKA 3RFZB 1HQRD 2MP2A 2CHWA 1XD3B 1I4HA 4LJOB 4P7IA 5AUKA 2INPE 5BMGA 2JU6X 1CK1A 4C7YA 2AEHA 4HCPB 4P16A 2KOXA 4ANVA 1VLBA 3T9LA 3WA0A 2AWTA 4TSSA 2MBQA 2BB5A 2X38A 1JWUD 2W54A 1J7CA 4M8MA 2JUOA 3URYA 3FILA 2I1JA 2MSED 4NAWB 4IC7B 4BVUC 1NENB 2N9XA 4MM3B 4IDIA 2LXCA 3LJ3A 3AEFB 5FK9C 3ZQ4A 2PLPA 2EMSA 1LFDA 3FC4A 1SB3C 2KFJA 1D3ZA 2JF5A 2PVOD 2G9HD 5CX3A 4EEWA 2LJIA 4ZHPA 3A1QA 4A55A 2K8CA 2KTFA 3DBHI 2IDYA 1HA5A 2JRHA 2IO1B 2PMVA 3MHZA 3VFKA 4KSKC 2LHEA 2BW2A 2CKHB 4BKSA 2B76B 3QK0A 5DPWA 1SE9A 1WGHA 4N59A 1SF0A 1QF6A 2W3SA 3EECA 1VD2A 4C00A 5J18A 1K53A 2LVPA 3Q8AA 1TKYA 4ANUA 2HTHA 1WXAA 4G50A 3ZXVA 3KLSX 3TJPA 4DXAB 2KMAA 5AUIA 1R4MB 5HI1A 3MFGA 3H1UA 4J6IA 2WXLA 1VRAB 4K81A 4FJZA 2GBMA 4ZRPA 2N1VA 2LZ6A 3V61A 1PGAA 2LRWA 4W9LA 4GOCA 3EHVA 1L0YB 1JW9D 3ONSA 3N1ZC 3ML9A 2WXPA 3IBEA 3V05A 4I6PA 1QOAA 4TQ0A 1TJEA 4B9KA 4YTMB 2DNFA 1A70A 3TL5A 1RM6C 3PO0A 4N9F4 3UIOB 4KV2A 3OWEB 3SFDB 2IJ0A 1J7BA 1MI0A 3WAOA 4CHKA 2PW9A 2V3PA 1JCKB 1TS5A 1WX7A 2LUEA 3VRBB 2FUHB 1V6EA 1WRDB 2KK8A 3W1SC 3EA6A 4W9HA 4USAA 2C7HA 3ZLZA 3WCQA 2WS3B 5E6NA 5EE1A 3VTUA 1ZOYB 2DYBA 2KNBA 1XLQA 1YMHE 3LB8C 5LLIA 1XLPA 2BS4B 2K39A 4NY0A 4XE0A 4D2KA 5G2NA 3AB5A 1WR6E 3A4SC 2LJ5A 2OJRA 1ROEA 4XDDA 2J53A 2GRIA 2DBYA 3R8BA 3PS6A 2AL3A 4E3CA 1GNUA 4MACA 4A3PA 4KX6B 3DBRI 3ZIMA 1JALA 1TY0A 2N9LA 2INCC 5HG2A 1K8RB 1CQVA 4KGSA 1NI2A 1GC7A 2NBWB 4EKUA 4HK2A 3QX1A 3UI3A 2JRIB 2JPHA 4WH4A 3X0WA 3AE3B 3H9DA 3M3JA 4YL8A 2D5GA 2ONQA 3Q8CA 4WJPA 2KDMA 3TUOA 1V80A 1UGMA 3BWUD 2G3QB 2SEBD 3R66C 1FRRA 1SIJA 1C79A 1WFYA 4IKGA 2CJOA 1T0SC 1PUTA 2K22A 2KZRA 4B95A 3MJWA 3BVGA 1HXYD 3ZNZB 5KHQA 3GE8C 2G4DB 3GOEA 4DHZE 4DXGA 3DOWA 4WWMA 1KTKA 1WXSA 4KVGB 4OZBA 4TMAB 2LGXA 1GJZA 3RNEC 2KFKB 2NBVB 2WGSA 3SR6A 3AE2B 3QARA 1OQQA 1RYJA 1I4PA 2O2VB 2BYFA 3CWIA 1E90A 4XX5A 2ACZB 4HKZE 1N63A 4K7WA 4JL9A 2D10A 2KTRB 4RGOS 3C0RB 1HTQA 2V3SA 2JZPA 1C4CA 3V62A 2DX5B 2KWUB 3RULA 1WR1A 2J7QB 1T5XD 4NQLB 2KT7A 2REXA 4AS1A 2V1YA 4HROA 3AU4A 4CQNA 5DPSA 1QOBA 4YT0B 1SIFA 3NJTA 5IA7A 2BWES 3B2GA 1YNTE 3PVLA 4EFOA 1CJEA 2DYOA 4DHJB 4IOIE 2LUMA 3VRAB 4KGRA 3Q3JA 4DWFA 4L2YA 3CF6E 4FLHA 3PRPB 3VTWA 3HHMA 2Y3AA 2DAJA 1VZ8A 3LYYA 2UYZB 3A4RA 1F1HA 1E8WA 3N3KB 3BVZA 3DBLI 4HPLB 1FXAA 3QC8B 2NVUI 5EE3A 4EOYA 2DZKA 2BS3B 3ETRA 4YSYB 4RFBA 4DHJD 3KQ4A 1ET9A 2KJRA 2BVCA 3WANA 1J0GA 4G0NB 2FCMA 3AI5A 3EFCA 4FA6A 1ET6A 4P1BC 1IBXA 2CS4A 1MG8A 1ZDXA 2DWQA 3PZ8A 4IWPA 1HEZE 3NVZA 3APFA 5C3JB 4M0WB 2KXJA 3R7QA 1L5PA 1T3QA 2PJHA 1VJKA 2DZMA 5MPOA 4HJKA 5BYRA 3AE6B 2MWSB 1V81A 2N4FA 4GB9A 3L0WB 2PE9A 1YN5A 3JSVA 5HHDG 2FCQA 4WQMA 4WWNA 2QILA 3R3MA 3N1XC 1YX5B 4C7ZA 4OVUA 2M17A 3DPDA 2IY1B 1BT0A 2GLSA 3N30A 2IGHA 3Q8FA 2D11A 3GE3C 1TS4A 2ICIA 2KO3A 3U2SC 2BQQA 2ASQA 3BZDB 3PRZA 5J2RA 3RN9C 4ICUA 3BYYB 2KDFB 2MBBB 2WYQA 1WXVA 1AWDA 2G45B 1N5XA 2K9XA 3PGEA 4IWQA 1FCLA 1QOGA 3VR8B 3I5JC 1RLFA 5I4DA 2MEKA 1GB4A 4ZDVA 2OJWA 2GMIC 4LK0M 3ZNGC 2K8HA 1WX8A 2KYWA 3ZJTA 1MFWA 3Q3FA 4RM9A 2I1KA 3VTVA 1V1OA 3GS2A 3J9CA 1YN4A 1XO3A 2WXNA 1FXIA 4DQOC 4HXDA 4TQ1A 4XDCA 3ZVVA 2XK5B 2AYOB 4BOSC 1L4ZB 2B3AA 3PHXB 2NTTA 3Q3NC 3PV1A 3KUCB 3EGRA 1E9MA 2A4ZA 4S0RA 4Q2JA 5E6JA 4M00A 1P9DU 4BKGA 3U30A 3MC9A 1P7FA 2ZVNA 3TMPB 1YQ3B 2BT6A 4OZCA 4MDKE 1KLUD 4OZAA 4WJQA 4ZRKA 1L4DB 2VRRB 4FJVB 4K3BA 3K9OB 2WDQB 4G11A 1LQBA 4KZCA 4REZA 1JWMD 1DYQA 2NBUA 2RR9A 3APDA 2CHZA 3QQ8B 5JHAA 3OJ3A 4HPPA 1SEBD 1UH6A 2LXAA 2BWFA 1I42A 2JZ3B 1RRBA 2UWQA 4FXCA 2AL6A 1HZ5A 4YTPB 1GAQB 1QQRA 2J0JA 3KUDB 3U4EG 3OG5A 1LO5D 3ZNID 5EDSA 2LEKA 1WY8A 2JSVX 4GN1A 1F77A 2ZZPB 1FXTB 3IHPC 3AEGB 5G5GA 3TEZA 1TBEA 1N5WA 2CU3A 3B0AA 4W9IA 3L08A 3V60A 3VXWA 2LD9A 1OEYA 3RNBC 5BMHA 4LNKA 4KIKA 5BMIA 1WJ4A 2N7DA 1KH0A 2JY6A 4M02A 3Q69A 1WE6A 3ALBA 4E71A 1STEA 3NZUA 4DDGD 1WF9A 3ABVB 4RGTA 2KVRA 2HE7A 2EKIA 2XEWA 2N7JA 2DLBA 1WI0A 2N7EA 2DENB 2WU2B 4IM0A 5E6PA 4I6NB 1I4QA 3B1LX 4DXFA 2FUG1 3VAWA 2BPSA 1KRHA 3NG0A 2LGIA 2K6QA 3MJ5A 3T3NA 4XC2A 1FO4A 1SSNA 3PSEB 4DK5A 4W9DA 3ZTDA 1V49A 1YD8U 4MJSB 1V5OA 2LHDA 2YVCA 2K3UA 4GSWA 2MA9B 1P98A 1AYFA 3PRMB 2YLMA 3ZDTA 3Q2AC 1JRPA 1Z2MA 4LNFA 1R4MI 2MQJA 5DCNA 1AN8A 3ZGZA 1WGYA 4W9GA 2INNE 3H6NA 3IAM1 2HDEA 3A9JA 5H92C 4M8NA 3LXFA 2KJ6A 3HVDA 4EZLA 2H88B 3NY5A 2RMMA 3NVYA 2D3AA 1TY2A 2V4IB 3TEWA 1XCQL 3AEDB 4EZJA 3O65B 1N61A 1V97A 2K6DB 3NZ3A 2PTLA 1WIAA 1WM2A 2LFIA 3L17A 3N9YC 1FFUA 5D3IB 2ZCCA 4II2B 2PPHA 1IGDA 1UWXA 4WWOA 3K9PB 4WIPA 1XQQA 1E6EB 3M62B 2Z0EB 2KACA 2NS5A 1KM7A 1V8CA 4KDIC 1D6EC 2L8JA 4FULA 4OHJA 1QILA 1Y56A 1TZ1A 5TSSA 4BBNF 4WQOB 4AP4C 2KLCA 4BZAA 4AQ7A 2I2YA 2O6VA 5DPRA 4H2AA 3V3XA 3IG3A 1EWCA 2FAZA 1DOYA 4C4VA 4FADA 1GOZA 1KFYB 1IYFA 1R4NB 2RDGA 5D7GA 3H7PA 5G5HA 3B2FA 1Y8RC 1WGKA 2WHIA 2NPTB 2M0AA 3RNGC 1N62A 4KSLC 1XXGA 2HTME 4YXDB 5CTRC 1OQYA 2KC2A 1EWYC 3CIRB 1WXQA 3KVFB 1OFFA 3HK0A 3P42A 1E8ZA 1V5TA 3GB1A 4RGNA 3EFUA 2IO3B 2XBBC 3DBHB 4I6LB 5BYQA 4BKTA 1ZKHA 1Q5WB 1WMHB 3SFEB 2FE8A 1KF6B 1MVKA 4IUMB 3WAMA 3N20C 1RFKA 1WZ0A 2Z8LA 1JQ4A 4ZOHC 5C23A 2L83A 3R2TA 1GC6A 1XEEA 3AN1A 4ZRJA 2V3NA 2LVQA 4CO7A 3TIXA 5AZHA 4B6WA 3BYTB 3E56A 5C2TB 2GBNA 1WJNA 1CZPA 2L52A 4LNIA 2KX0A 1UBIA 2ZVOA 3NUHB 2L32A 1ZPSA 3Q3OC 2GBRA 1GG3A 4DBGA 1K52A 2HJ8A 4HPMB 4MSQB 2W82A 3NVVA 2WXHA 3IXSA 1NYQA 4LCDE 1PDXA 4KKJA 1YX6B 1V1PA 2HD5B 4W9JA 3ZJUA 2KVZA 1SE4A 2KAJA 1D5ZC 2IO2B 1D5MC 3VUYA 2R61A 3NVWA
chains in the Genus database with same CATH topology
4FHJA 4HJKA 5LXHA 2JT4B 1WZ3A 2N9EB 3A9KB 1S1QB 4ICVA 2R2QA 3KYCD 3UF8A 1U4AA 2MWSB 3KW5B 3S2AA 3KYDD 2KHWB 5LXIB 3ENEA 1V81A 5E6OA 3MTNB 3B08A 1P1AA 3QIJA 2N4FA 5IAAC 3KUZA 2C7MB 3RZFA 3ZO5B 4NJ6A 4GB9A 4GDLB 4MGIE 5JZEB 3UIPB 3L0WB 2PE9A 3JSVA 2RD0A 2W9NA 2FCQA 4GDKB 2RGFA 4WWNA 1RFAA 2GBJA 2L3ZA 3R3MA 3HM3A 1YX5B 3L16A 1E8YA 2Z0DB 2BYEA 4OVUA 2M17A 3DPDA 2IY1B 1BT0A 2XK5A 3N30A 3L10B 2MBOA 2LWPA 4WWPA 2D11A 2IY0B 2J0MA 1P3QU 3PZDA 2KO3A 4W9KA 1EF5A 1EF1A 2ASQA 4W9FA 3PRZA 2IYDB 5J2RA 4GMVA 1OEYJ 1G6JA 4F7ZA 4ICUA 3QHTA 3ZRFA 2KDFB 2MBBB 1KLVA 2WYQA 3NOBA 4E74A 4NAWA 1WXVA 2BF8B 3OAWA 2LI5A 2G45B 3DVNV 1J8CA 3V6CB 1VCBA 2IZVB 4MM3A 4IWQA 3PGEA 2BGFA 5FR6A 2KQSA 1RLFA 3RYTA 4ZDVA 2GMIC 2QHOA 3ZNGC 2K8HA 5L95C 3DCGA 1WX8A 2MP2A 2CHWA 1XD3B 3QAQA 2JZZA 2KD0A 3Q3FA 4LJOB 4HWIB 4P7IA 4RM9A 2WX0A 3JSVB 2KLGA 2AEHA 4W9CA 2D07B 2I1KA 2Y5BB 3QWZB 4PS8A 4HCPB 4FN2A 3VTVA 5L83A 3ZTCA 2KOXA 4ANVA 2ZJDA 3T9LA 3IVFA 4HXDA 4TQ1A 5AZFA 3WA0A 2AWTA 2BYVE 3ZVVA 2MBQA 2XK5B 2AYOB 4MEMA 4EUTA 1JRUA 2MX2A 3W1YA 4BOSC 5GMVA 4PS7A 2B3AA 3PHXB 4M8MA 4MSMB 1UELA 2JUOA 3RUIB 4GIVA 3PV1A 2I1JA 2MSED 2EMTA 2L0FA 3N32A 4NAWB 4IC7B 3KUCB 4JQWC 2A4ZA 4BVUC 3VVWB 2DZJA 2N9XA 2LXCA 4MGYE 3LJ3A 3W1SA 2BKRB 1P9DU 1KOTA 4AUQC 4BKGA 3U30A 2LASA 2BKFA 2EMSA 1LFDA 2A5UA 2KFJA 2ZVNA 3TMPB 3X23A 1D3ZA 5CHWA 4MDKE 4RMAA 2MP2B 2RPQA 4IM2A 4WJQA 2JF5A 4ZRKA 2KDEB 5CX3A 4BBNC 2VRRB 4NPNA 4AOFA 4EEWA 4FJVB 3TCAA 3K9OB 3A1QA 4G11A 1LQBA 4KZCA 2K8CA 2KTFA 1WGGA 3DBHI 4G3XB 4HLEA 2NBUA 2JRHA 1EO6A 2RR9A 3APDA 1OTRB 2IO1B 3JVZX 2CHZA 2M4NA 3QQ8B 5JHAA 1WX9A 3OJ3A 2C9WB 3VFKA 1UH6A 4KSKC 2CKHB 2DAFA 2BWFA 2LXAA 3MHSD 4BKSA 4URKA 1A5RA 1I42A 3QK0A 5DPWA 2JZ3B 1RRBA 1SE9A 1WGHA 2KWCA 2UWQA 3AXCA 3P2BA 3M95A 2AL6A 2KC1A 2KWVB 2KANA 3PHWB 2FCNA 5BO4B 3EECA 1VD2A 3BY4B 3T8MA 4HDQA 5J18A 2M1MA 1WXMA 2J0JA 3KUDB 2LVPA 5JH5C 2JVCA 3ZNID 4ANUA 2HTHA 2MLBA 1WXAA 5EDSA 4G50A 1HE8A 1WY8A 3TJPA 4ANWA 4DXAB 4GN1A 4KDLB 4IWOA 4TKNA 2KMAA 2ZZPB 1FXTB 3VUXA 3IHPC 1RAXA 1TBEA 5D6JB 3B0AA 4W9IA 1T0YA 2RSUA 3L08A 4MJSA 3V60A 3H1UA 4J6IA 3VXWA 3M63B 2LD9A 1OEYA 3BINA 1WJ6A 3OJ4B 1WJ4A 3A1QB 2GBMA 4FJZA 4K81A 4KIKA 2N7DA 1S3SG 2JY6A 2N1VA 3ZKJC 2LZ6A 3EC8A 3V61A 1J19A 1WE6A 2LRWA 2M8SA 3CSTA 4W9LA 4GOCA 3EHVA 3VHTC 1Q0WB 1SGHA 2WX1A 3ALBA 4E71A 1IP9A 2M0XA 3ONSA 3NZUA 3ML9A 4FJYA 4DDGD 1TTNA 1C3TA 1WF9A 1ZGUB 3IBEA 1V9JA 4HVBA 2KDIA 4MELA 1LM8B 2KVRA 4KZ0A 2HE7A 1WH3A 2XEWA 2V4LA 4I6PA 1Q1OA 1E7UA 3ZUNA 1WI0A 2N7EA 2DENB 4TQ0A 3KH0A 3VUWA 4B9KA 1WE7A 4IM0A 3LDZE 5E6PA 4I6NB 3TL5A 3VH3B 4A3OA 3B1LX 1NBFC 1L7YA 3VAWA 4N9F4 3UIOB 2BPSA 3TBLD 4KV2A 2L76A 2K6QA 2ZPNA 3QA8A 1ISNA 2ZPYA 4AJYB 5TR5A 4XC2A 3WAOA 3VQIA 3DVGX 4CHKA 4F8CB 3PSEB 4DK5A 4W9DA 1EUVB 3ZTDA 1V49A 1YD8U 1YJ1A 3JYUA 1WX7A 3APCA 1V5OA 2L00B 4MJSB 4BKSD 3DVNU 2LUEA 2FUHB 2FCSA 4MGZE 1V6EA 2KK8A 1WRDB 2YVCA 4KIKB 3AU5A 3W1SC 2C5LC 4GSWA 4W9HA 3HM6X 2MA9B 2C7HA 3ZLZA 1UZXB 3RZWC 2J0KA 1P98A 4RM8A 5E6NA 2LGDA 3DBSA 1UD7A 3PRMB 3VTUA 2YLMA 3R7RA 3ZDTA 2DYBA 2KNBA 3HIZA 2JWZA 4K1RB 3NS8A 1Z2MA 5D94A 4PYZA 2N9PC 1R4MI 2MQJA 5DCNA 2CR5A 5LLIA 1E8XA 1WGYA 2K8BA 3PLUA 5D2MB 3UGBB 4W9GA 2K39A 3H6NA 4NY0A 5G2NA 1IPGA 2ZNVC 3A9JA 4M8NA 1WR6E 3A4SC 3WAPA 2LJ5A 2KJ6A 2OJRA 4ZYNA 2FIFA 1GUAB 4CYEA 2WWZA 4II3B 4EZLA 2L05A 2IO0B 3NY5A 4JIOU 2Z59B 3DDCB 3PS6A 2AL3A 2K25A 4E3CA 3UINB 1GNUA 4DDID 1V86A 4EZJA 1QZEA 4A3PA 1E7VA 3O65B 3DBRI 3SD5A 3UQBA 3ZDMC 3ZIMA 2LVOA 2K6DB 2KDBA 3L54A 1WIAA 5G55A 1K8RB 1WM2A 3V6EB 3L17A 2DHZA 4ZRIA 5AZGA 1XT9B 4GU2A 4IM3A 1NI2A 1GC7A 2NBWB 2ZCCA 1C1YB 4II2B 2PPHA 4EKUA 5HKHA 4HK2A 3QX1A 2KFKA 2LRUA 4WWOA 2JRIB 2JPHA 4F1SA 3K9PB 2NPTA 3X0WA 1XQQA 3WIMA 4BOZB 3M3JA 3H9DA 3DVGY 4MH0E 1PQSA 2LGYA 3DQVA 5JHBA 4YL8A 3A9JB 4FBJB 3WALA 3SU8X 5AEKB 4WJPA 3M62B 3RT3B 2Z0EB 4EZKA 1LXDA 2NS5A 1KM7A 1YQBA 3OLMD 4XZ4A 2O2VA 4NNJB 1V80A 4KDIC 1UGMA 2L8JA 4FULA 2G3QB 3ZNHB 3ZW3A 3R66C 2MBHA 3PTFC 2MBEA 1TZ1A 1WFYA 2KTRA 2D2QA 4BBNF 1I35A 4WQOB 1P0RA 2KJHB 4AP4C 2KLCA 2D3GA 4HDOA 5KHOA 2KZRA 4B95A 3MJWA 4JGHB 1WMHA 2KN5A 4IW0A 4LJPB 2ZNVB 3ZNZB 2O6VA 5DPRA 3U8ZA 4WJNA 5KHQA 4JLCA 4DHZE 2G4DB 3GOEA 3IG3A 2FAZA 2K1FA 3QJZA 4X57B 5CHVC 3DOWA 1UBQA 4FADA 1WXSA 4KVGB 1IYFA 1H8CA 3JW0X 2C60A 5D7GA 4GXBA 3H7PA 2PEAA 2FNJB 2LGXA 3IFWB 2DZIA 3I3TB 1GJZA 2KX3A 1Y8RC 2EKEC 2KFKB 2CU1A 1KJTA 2NBVB 3CSFA 2JXXA 2NPTB 2R2OA 4K7SA 1NDDA 4KSLC 3QARA 3RD2A 5CTRC 2KKCA 2O2VB 1OQYA 4HCNB 1E5WA 2BYFA 1E90A 4XX5A 2KC2A 3RCZA 4BFRA 1YIWA 3NHEB 2MCNB 1OGWA 4K7WA 3KVFB 4AJWA 4JL9A 1V2YA 2D10A 3HK0A 2KTRB 4OVVA 3C0RB 3ML8A 1E8ZA 1V5TA 2V3SA 3QCAA 3EFUA 2IO3B 2XBBC 2WDTB 4FHKA 3V62A 2DX5B 4I6LB 2KWUB 3RULA 1WR1A 2J7QB 2KQ7A 4BKTA 1ZKHA 4NQLB 1Q5WB 1WMHB 2REXA 2NR2A 2O6VB 4K7UA 4A20A 4IUMB 2V1YA 3WAMA 3AU4A 5DPSA 4WJOA 4NJ7A 1SIFA 1CMXB 3GZNI 4PYUA 2BWES 5IA7A 3VH4B 1X1MA 1WZ0A 1AARA 4ANXA 3PVLA 4WAAA 3H7PB 1ZW7A 2OOBB 4GGQA 4EFOA 2DYOA 5C23A 4DHJB 5C1ZA 1GC6A 3PREA 3Q3JA 4ZRJA 4DWFA 4NQKE 2FIDA 3CF6E 4FLHA 2N1WA 3PRPB 3VTWA 3HHMA 2LVQA 4CO7A 1TGZB 5AZHA 3TIXA 4PS3A 4B6WA 3A33B 1R4NI 2GBNA 2O6VD 1L2NA 2PE6B 1WJNA 2DAJA 2UYZB 3A4RA 1F9JA 1E8WA 3N3KB 5J17A 4IG7B 3H7SA 3U7DA 3VDZA 3DBLI 4HPLB 3SDLC 2C7NB 3QC8B 2KX0A 1UBIA 2NVUI 2ZVOA 3A9KA 3CMMB 2ZCBA 4ASWC 4EOYA 2DZKA 2DYMA 3L13A 2GBRA 3ECIA 1GG3A 3NZSA 4DBGA 4DHJD 2HJ8A 4HPMB 2ZEQA 4MSQB 4W9EA 5DPTA 2KJRA 4GDLA 3PT2B 2NCNA 3WANA 1WGRA 2G4SA 1J0GA 2MW5A 4G0NB 2FCMA 4LDTB 1Z5SB 3AI5A 4FA6A 2CHXA 4GDKA 3D32A 4AWJA 3UQAA 1H4RA 2CS4A 3SHQA 1WYWB 3PPAA 2L0TA 1MG8A 5CHFA 4TV3A 4LCDE 2IBIB 1YX6B 4TUUA 2HD5B 4IWPA 2KMCA 4W9JA 2GBKA 3AULA 2MRPA 4DHZB 2GOWA 3APFA 1WGDA 3PLVA 2KXJA 4M0WB 3R7QA 1M94A 2PJHA 2IO2B 1WJUA 2L7RA 3ZRCA 2DZMA 3VUYA 1WM3A 4LDTD 4MGKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FHJ A;  4HJK A;  5LXH A;  2JT4 B;  1WZ3 A;  2N9E B;  3A9K B;  1S1Q B;  4ICV A;  2R2Q A;  3KYC D;  3UF8 A;  1U4A A;  2MWS B;  3KW5 B;  3S2A A;  3KYD D;  2KHW B;  5LXI B;  3ENE A;  1V81 A;  5E6O A;  3MTN B;  3B08 A;  1P1A A;  3QIJ A;  2N4F A;  5IAA C;  3KUZ A;  2C7M B;  3RZF A;  3ZO5 B;  4NJ6 A;  4GB9 A;  4GDL B;  4MGI E;  5JZE B;  3UIP B;  3L0W B;  2PE9 A;  3JSV A;  2RD0 A;  2W9N A;  2FCQ A;  4GDK B;  2RGF A;  4WWN A;  1RFA A;  2GBJ A;  2L3Z A;  3R3M A;  3HM3 A;  1YX5 B;  3L16 A;  1E8Y A;  2Z0D B;  2BYE A;  4OVU A;  2M17 A;  3DPD A;  2IY1 B;  1BT0 A;  2XK5 A;  3N30 A;  3L10 B;  2MBO A;  2LWP A;  4WWP A;  2D11 A;  2IY0 B;  2J0M A;  1P3Q U;  3PZD A;  2KO3 A;  4W9K A;  1EF5 A;  1EF1 A;  2ASQ A;  4W9F A;  3PRZ A;  2IYD B;  5J2R A;  4GMV A;  1OEY J;  1G6J A;  4F7Z A;  4ICU A;  3QHT A;  3ZRF A;  2KDF B;  2MBB B;  1KLV A;  2WYQ A;  3NOB A;  4E74 A;  4NAW A;  1WXV A;  2BF8 B;  3OAW A;  2LI5 A;  2G45 B;  3DVN V;  1J8C A;  3V6C B;  1VCB A;  2IZV B;  4MM3 A;  4IWQ A;  3PGE A;  2BGF A;  5FR6 A;  2KQS A;  1RLF A;  3RYT A;  4ZDV A;  2GMI C;  2QHO A;  3ZNG C;  2K8H A;  5L95 C;  3DCG A;  1WX8 A;  2MP2 A;  2CHW A;  1XD3 B;  3QAQ A;  2JZZ A;  2KD0 A;  3Q3F A;  4LJO B;  4HWI B;  4P7I A;  4RM9 A;  2WX0 A;  3JSV B;  2KLG A;  2AEH A;  4W9C A;  2D07 B;  2I1K A;  2Y5B B;  3QWZ B;  4PS8 A;  4HCP B;  4FN2 A;  3VTV A;  5L83 A;  3ZTC A;  2KOX A;  4ANV A;  2ZJD A;  3T9L A;  3IVF A;  4HXD A;  4TQ1 A;  5AZF A;  3WA0 A;  2AWT A;  2BYV E;  3ZVV A;  2MBQ A;  2XK5 B;  2AYO B;  4MEM A;  4EUT A;  1JRU A;  2MX2 A;  3W1Y A;  4BOS C;  5GMV A;  4PS7 A;  2B3A A;  3PHX B;  4M8M A;  4MSM B;  1UEL A;  2JUO A;  3RUI B;  4GIV A;  3PV1 A;  2I1J A;  2MSE D;  2EMT A;  2L0F A;  3N32 A;  4NAW B;  4IC7 B;  3KUC B;  4JQW C;  2A4Z A;  4BVU C;  3VVW B;  2DZJ A;  2N9X A;  2LXC A;  4MGY E;  3LJ3 A;  3W1S A;  2BKR B;  1P9D U;  1KOT A;  4AUQ C;  4BKG A;  3U30 A;  2LAS A;  2BKF A;  2EMS A;  1LFD A;  2A5U A;  2KFJ A;  2ZVN A;  3TMP B;  3X23 A;  1D3Z A;  5CHW A;  4MDK E;  4RMA A;  2MP2 B;  2RPQ A;  4IM2 A;  4WJQ A;  2JF5 A;  4ZRK A;  2KDE B;  5CX3 A;  4BBN C;  2VRR B;  4NPN A;  4AOF A;  4EEW A;  4FJV B;  3TCA A;  3K9O B;  3A1Q A;  4G11 A;  1LQB A;  4KZC A;  2K8C A;  2KTF A;  1WGG A;  3DBH I;  4G3X B;  4HLE A;  2NBU A;  2JRH A;  1EO6 A;  2RR9 A;  3APD A;  1OTR B;  2IO1 B;  3JVZ X;  2CHZ A;  2M4N A;  3QQ8 B;  5JHA A;  1WX9 A;  3OJ3 A;  2C9W B;  3VFK A;  1UH6 A;  4KSK C;  2CKH B;  2DAF A;  2BWF A;  2LXA A;  3MHS D;  4BKS A;  4URK A;  1A5R A;  1I42 A;  3QK0 A;  5DPW A;  2JZ3 B;  1RRB A;  1SE9 A;  1WGH A;  2KWC A;  2UWQ A;  3AXC A;  3P2B A;  3M95 A;  2AL6 A;  2KC1 A;  2KWV B;  2KAN A;  3PHW B;  2FCN A;  5BO4 B;  3EEC A;  1VD2 A;  3BY4 B;  3T8M A;  4HDQ A;  5J18 A;  2M1M A;  1WXM A;  2J0J A;  3KUD B;  2LVP A;  5JH5 C;  2JVC A;  3ZNI D;  4ANU A;  2HTH A;  2MLB A;  1WXA A;  5EDS A;  4G50 A;  1HE8 A;  1WY8 A;  3TJP A;  4ANW A;  4DXA B;  4GN1 A;  4KDL B;  4IWO A;  4TKN A;  2KMA A;  2ZZP B;  1FXT B;  3VUX A;  3IHP C;  1RAX A;  1TBE A;  5D6J B;  3B0A A;  4W9I A;  1T0Y A;  2RSU A;  3L08 A;  4MJS A;  3V60 A;  3H1U A;  4J6I A;  3VXW A;  3M63 B;  2LD9 A;  1OEY A;  3BIN A;  1WJ6 A;  3OJ4 B;  1WJ4 A;  3A1Q B;  2GBM A;  4FJZ A;  4K81 A;  4KIK A;  2N7D A;  1S3S G;  2JY6 A;  2N1V A;  3ZKJ C;  2LZ6 A;  3EC8 A;  3V61 A;  1J19 A;  1WE6 A;  2LRW A;  2M8S A;  3CST A;  4W9L A;  4GOC A;  3EHV A;  3VHT C;  1Q0W B;  1SGH A;  2WX1 A;  3ALB A;  4E71 A;  1IP9 A;  2M0X A;  3ONS A;  3NZU A;  3ML9 A;  4FJY A;  4DDG D;  1TTN A;  1C3T A;  1WF9 A;  1ZGU B;  3IBE A;  1V9J A;  4HVB A;  2KDI A;  4MEL A;  1LM8 B;  2KVR A;  4KZ0 A;  2HE7 A;  1WH3 A;  2XEW A;  2V4L A;  4I6P A;  1Q1O A;  1E7U A;  3ZUN A;  1WI0 A;  2N7E A;  2DEN B;  4TQ0 A;  3KH0 A;  3VUW A;  4B9K A;  1WE7 A;  4IM0 A;  3LDZ E;  5E6P A;  4I6N B;  3TL5 A;  3VH3 B;  4A3O A;  3B1L X;  1NBF C;  1L7Y A;  3VAW A;  4N9F 4;  3UIO B;  2BPS A;  3TBL D;  4KV2 A;  2L76 A;  2K6Q A;  2ZPN A;  3QA8 A;  1ISN A;  2ZPY A;  4AJY B;  5TR5 A;  4XC2 A;  3WAO A;  3VQI A;  3DVG X;  4CHK A;  4F8C B;  3PSE B;  4DK5 A;  4W9D A;  1EUV B;  3ZTD A;  1V49 A;  1YD8 U;  1YJ1 A;  3JYU A;  1WX7 A;  3APC A;  1V5O A;  2L00 B;  4MJS B;  4BKS D;  3DVN U;  2LUE A;  2FUH B;  2FCS A;  4MGZ E;  1V6E A;  2KK8 A;  1WRD B;  2YVC A;  4KIK B;  3AU5 A;  3W1S C;  2C5L C;  4GSW A;  4W9H A;  3HM6 X;  2MA9 B;  2C7H A;  3ZLZ A;  1UZX B;  3RZW C;  2J0K A;  1P98 A;  4RM8 A;  5E6N A;  2LGD A;  3DBS A;  1UD7 A;  3PRM B;  3VTU A;  2YLM A;  3R7R A;  3ZDT A;  2DYB A;  2KNB A;  3HIZ A;  2JWZ A;  4K1R B;  3NS8 A;  1Z2M A;  5D94 A;  4PYZ A;  2N9P C;  1R4M I;  2MQJ A;  5DCN A;  2CR5 A;  5LLI A;  1E8X A;  1WGY A;  2K8B A;  3PLU A;  5D2M B;  3UGB B;  4W9G A;  2K39 A;  3H6N A;  4NY0 A;  5G2N A;  1IPG A;  2ZNV C;  3A9J A;  4M8N A;  1WR6 E;  3A4S C;  3WAP A;  2LJ5 A;  2KJ6 A;  2OJR A;  4ZYN A;  2FIF A;  1GUA B;  4CYE A;  2WWZ A;  4II3 B;  4EZL A;  2L05 A;  2IO0 B;  3NY5 A;  4JIO U;  2Z59 B;  3DDC B;  3PS6 A;  2AL3 A;  2K25 A;  4E3C A;  3UIN B;  1GNU A;  4DDI D;  1V86 A;  4EZJ A;  1QZE A;  4A3P A;  1E7V A;  3O65 B;  3DBR I;  3SD5 A;  3UQB A;  3ZDM C;  3ZIM A;  2LVO A;  2K6D B;  2KDB A;  3L54 A;  1WIA A;  5G55 A;  1K8R B;  1WM2 A;  3V6E B;  3L17 A;  2DHZ A;  4ZRI A;  5AZG A;  1XT9 B;  4GU2 A;  4IM3 A;  1NI2 A;  1GC7 A;  2NBW B;  2ZCC A;  1C1Y B;  4II2 B;  2PPH A;  4EKU A;  5HKH A;  4HK2 A;  3QX1 A;  2KFK A;  2LRU A;  4WWO A;  2JRI B;  2JPH A;  4F1S A;  3K9P B;  2NPT A;  3X0W A;  1XQQ A;  3WIM A;  4BOZ B;  3M3J A;  3H9D A;  3DVG Y;  4MH0 E;  1PQS A;  2LGY A;  3DQV A;  5JHB A;  4YL8 A;  3A9J B;  4FBJ B;  3WAL A;  3SU8 X;  5AEK B;  4WJP A;  3M62 B;  3RT3 B;  2Z0E B;  4EZK A;  1LXD A;  2NS5 A;  1KM7 A;  1YQB A;  3OLM D;  4XZ4 A;  2O2V A;  4NNJ B;  1V80 A;  4KDI C;  1UGM A;  2L8J A;  4FUL A;  2G3Q B;  3ZNH B;  3ZW3 A;  3R66 C;  2MBH A;  3PTF C;  2MBE A;  1TZ1 A;  1WFY A;  2KTR A;  2D2Q A;  4BBN F;  1I35 A;  4WQO B;  1P0R A;  2KJH B;  4AP4 C;  2KLC A;  2D3G A;  4HDO A;  5KHO A;  2KZR A;  4B95 A;  3MJW A;  4JGH B;  1WMH A;  2KN5 A;  4IW0 A;  4LJP B;  2ZNV B;  3ZNZ B;  2O6V A;  5DPR A;  3U8Z A;  4WJN A;  5KHQ A;  4JLC A;  4DHZ E;  2G4D B;  3GOE A;  3IG3 A;  2FAZ A;  2K1F A;  3QJZ A;  4X57 B;  5CHV C;  3DOW A;  1UBQ A;  4FAD A;  1WXS A;  4KVG B;  1IYF A;  1H8C A;  3JW0 X;  2C60 A;  5D7G A;  4GXB A;  3H7P A;  2PEA A;  2FNJ B;  2LGX A;  3IFW B;  2DZI A;  3I3T B;  1GJZ A;  2KX3 A;  1Y8R C;  2EKE C;  2KFK B;  2CU1 A;  1KJT A;  2NBV B;  3CSF A;  2JXX A;  2NPT B;  2R2O A;  4K7S A;  1NDD A;  4KSL C;  3QAR A;  3RD2 A;  5CTR C;  2KKC A;  2O2V B;  1OQY A;  4HCN B;  1E5W A;  2BYF A;  1E90 A;  4XX5 A;  2KC2 A;  3RCZ A;  4BFR A;  1YIW A;  3NHE B;  2MCN B;  1OGW A;  4K7W A;  3KVF B;  4AJW A;  4JL9 A;  1V2Y A;  2D10 A;  3HK0 A;  2KTR B;  4OVV A;  3C0R B;  3ML8 A;  1E8Z A;  1V5T A;  2V3S A;  3QCA A;  3EFU A;  2IO3 B;  2XBB C;  2WDT B;  4FHK A;  3V62 A;  2DX5 B;  4I6L B;  2KWU B;  3RUL A;  1WR1 A;  2J7Q B;  2KQ7 A;  4BKT A;  1ZKH A;  4NQL B;  1Q5W B;  1WMH B;  2REX A;  2NR2 A;  2O6V B;  4K7U A;  4A20 A;  4IUM B;  2V1Y A;  3WAM A;  3AU4 A;  5DPS A;  4WJO A;  4NJ7 A;  1SIF A;  1CMX B;  3GZN I;  4PYU A;  2BWE S;  5IA7 A;  3VH4 B;  1X1M A;  1WZ0 A;  1AAR A;  4ANX A;  3PVL A;  4WAA A;  3H7P B;  1ZW7 A;  2OOB B;  4GGQ A;  4EFO A;  2DYO A;  5C23 A;  4DHJ B;  5C1Z A;  1GC6 A;  3PRE A;  3Q3J A;  4ZRJ A;  4DWF A;  4NQK E;  2FID A;  3CF6 E;  4FLH A;  2N1W A;  3PRP B;  3VTW A;  3HHM A;  2LVQ A;  4CO7 A;  1TGZ B;  5AZH A;  3TIX A;  4PS3 A;  4B6W A;  3A33 B;  1R4N I;  2GBN A;  2O6V D;  1L2N A;  2PE6 B;  1WJN A;  2DAJ A;  2UYZ B;  3A4R A;  1F9J A;  1E8W A;  3N3K B;  5J17 A;  4IG7 B;  3H7S A;  3U7D A;  3VDZ A;  3DBL I;  4HPL B;  3SDL C;  2C7N B;  3QC8 B;  2KX0 A;  1UBI A;  2NVU I;  2ZVO A;  3A9K A;  3CMM B;  2ZCB A;  4ASW C;  4EOY A;  2DZK A;  2DYM A;  3L13 A;  2GBR A;  3ECI A;  1GG3 A;  3NZS A;  4DBG A;  4DHJ D;  2HJ8 A;  4HPM B;  2ZEQ A;  4MSQ B;  4W9E A;  5DPT A;  2KJR A;  4GDL A;  3PT2 B;  2NCN A;  3WAN A;  1WGR A;  2G4S A;  1J0G A;  2MW5 A;  4G0N B;  2FCM A;  4LDT B;  1Z5S B;  3AI5 A;  4FA6 A;  2CHX A;  4GDK A;  3D32 A;  4AWJ A;  3UQA A;  1H4R A;  2CS4 A;  3SHQ A;  1WYW B;  3PPA A;  2L0T A;  1MG8 A;  5CHF A;  4TV3 A;  4LCD E;  2IBI B;  1YX6 B;  4TUU A;  2HD5 B;  4IWP A;  2KMC A;  4W9J A;  2GBK A;  3AUL A;  2MRP A;  4DHZ B;  2GOW A;  3APF A;  1WGD A;  3PLV A;  2KXJ A;  4M0W B;  3R7Q A;  1M94 A;  2PJH A;  2IO2 B;  1WJU A;  2L7R A;  3ZRC A;  2DZM A;  3VUY A;  1WM3 A;  4LDT D;  4MGK E; 
#chains in the Genus database with same CATH topology
 4FHJ A;  2N9E B;  1WZ3 A;  3A9K B;  1S1Q B;  5IN7 A;  3S2A A;  3KWV A;  1WYG A;  1YOV B;  3MTN B;  1C78 A;  4GDL B;  4MGI E;  5JZE B;  4YTN B;  3UIP B;  2SAK A;  3AE4 B;  2MH7 A;  2RD0 A;  2W9N A;  2WXR A;  4GDK B;  3L16 A;  2J4X A;  2WXQ A;  1SJH D;  3L10 B;  1FNW A;  2IY0 B;  4MH8 A;  1EF1 A;  1G6J A;  2JXT A;  3ZRF A;  2QEJ C;  1KLV A;  4NAW A;  3DVN V;  1J8C A;  4MM3 A;  2IGG A;  3P4Q B;  2N0S B;  5FR6 A;  4WUR A;  3B9J A;  3ZYY X;  4A6Q A;  3AM9 A;  2KD0 A;  1TKE A;  2WX0 A;  2KLG A;  2GI9 A;  4W9C A;  2Y5B B;  4PS8 A;  4P1C C;  5L83 A;  5IKC M;  2ZJD A;  1YQ4 B;  4JX1 C;  3IVF A;  3HRD D;  1VR9 A;  4EUT A;  1BUI C;  1JRU A;  1TIF A;  2MX2 A;  1GB1 A;  4PS7 A;  1C76 A;  3BII D;  1SBB B;  1UEL A;  3RUI B;  4GIV A;  2L0F A;  3N32 A;  4JQW C;  2DZJ A;  5JXV A;  4L1B A;  3W1S A;  4AUQ C;  2WDR B;  1GPX A;  1T0Q C;  2A5U A;  3X23 A;  2M19 A;  5CHW A;  2MP2 B;  4IM2 A;  3AE5 B;  3MC0 B;  2KDE B;  4BBN C;  1BML C;  2NTS A;  1NVI D;  4RH6 A;  1VDV A;  4AOF A;  2K5P A;  3TCA A;  1E7P B;  4G3X B;  1QKZ A;  1EO6 A;  1MHH E;  3AEA B;  1OTR B;  3JVZ X;  1TS3 A;  2JQR B;  1XCT L;  2LGS A;  2DAF A;  3MHS D;  2WNM A;  1A5R A;  2TSS A;  5EE9 A;  3P2B A;  3AXC A;  3M95 A;  4R3D A;  1RWS A;  2KWV B;  3FIL B;  2KAN A;  3Q14 C;  3PHW B;  2AX5 A;  2FCN A;  1C77 A;  3AE7 B;  2XNA C;  5BO4 B;  3BY4 B;  4KGT A;  2YEP F;  3I63 C;  2MLB A;  2MHJ A;  1XLN A;  1HE8 A;  4ANW A;  4IWO A;  3H8H A;  4TKN A;  3VUX A;  4HKQ A;  5D6J B;  1T0Y A;  2RSU A;  2JX5 A;  4K3C A;  3M63 B;  4LLG M;  1TS2 A;  1WJ6 A;  3OJ4 B;  3A1Q B;  1AW7 A;  4RNA A;  1S3S G;  3ZKJ C;  1ESF A;  3EC8 A;  2Y5P A;  1J19 A;  2RDB C;  3VHT C;  1SGH A;  2VH2 A;  1IP9 A;  2V0G A;  1TTN A;  2AQ3 B;  1C3T A;  1ZGU B;  1V9J A;  1KLG D;  2KDI A;  4MEL A;  1YJJ A;  1WH3 A;  1FD6 A;  1Q1O A;  3HVZ A;  3AV8 A;  3LDZ E;  1IUE A;  4A3O A;  4LNN A;  1NBF C;  3AE1 B;  1OQR A;  1FIQ A;  2ZPN A;  3QA8 A;  4F8C B;  2KMM A;  2UU7 A;  1EUV B;  3Q6B A;  2IPK D;  1YJ1 A;  4BKS D;  3APC A;  3EUB 2;  4MGZ E;  2FCS A;  5FKA C;  3GP7 A;  4JPS A;  3AU5 A;  1FCC C;  2C5L C;  1ZXH A;  1UZX B;  3RZW C;  2J0K A;  2QMT A;  4RM8 A;  3DBS A;  1UD7 A;  4NZL B;  1MPE A;  1SE3 A;  3HIZ A;  2JWZ A;  2WQY B;  5D94 A;  2M56 B;  2K8B A;  3Q8B A;  3C19 A;  3UGB B;  2ZNV C;  3WAP A;  1JWB D;  3IT4 B;  1GUA B;  2WWZ A;  2L05 A;  3TEX A;  4JIO U;  2Z59 B;  1DOI A;  4ARI A;  2W3R A;  3DDC B;  2LMC A;  1NYR A;  2K25 A;  3L4P A;  2FBW B;  3UIN B;  1V86 A;  1MHX A;  3AEE B;  3SD5 A;  3UQB A;  2LVO A;  2AQ2 B;  3V6E B;  5AZG A;  4ZRI A;  1XT9 B;  4HJG E;  1C1Y B;  1TYG B;  1TKG A;  2KFK A;  4F1S A;  1PGB A;  3P4S B;  4BOZ B;  2KQ4 X;  4MH0 E;  2LGY A;  5JHB A;  3DQV A;  4FBJ B;  3WAL A;  4WAF A;  4B0E A;  2BS2 B;  1YQB A;  3OLM D;  2O2V A;  4NNJ B;  3ZNH B;  2D3C A;  3W5U B;  2E6X A;  1DGJ A;  3P63 A;  3PTF C;  2MBE A;  1UF0 A;  2KTR A;  3GZN B;  1I35 A;  5IO9 A;  1P0R A;  2BB6 A;  2VH1 A;  4NAM A;  2D3G A;  2L1A A;  1ZE3 D;  3AH7 A;  4JGH B;  2KN5 A;  2GB1 A;  2K1F A;  2PIA A;  3QJZ A;  4X57 B;  2OED A;  4JWU C;  1FMA D;  1H8C A;  3JW0 X;  4XGA B;  2C60 A;  4GXB A;  3IFW B;  2DZI A;  3I3T B;  2KX3 A;  1I4G A;  2CU1 A;  1KJT A;  3CSF A;  2JXX A;  1FRD A;  3IAS 1;  2KKC A;  4HCN B;  4M01 A;  1E5W A;  2WP9 B;  3DWG C;  2YEP B;  4BFR A;  1YIW A;  1UWM A;  3NHE B;  1OGW A;  2MCN B;  4OVV A;  4EE2 A;  3QCA A;  1ACC A;  2WDT B;  2WXI A;  2KQ7 A;  2PVG C;  2J42 A;  3RPF C;  4PYU A;  4N6E B;  3VH4 B;  1X1M A;  1AAR A;  3E9S A;  4WAA A;  2OOB B;  1L0V B;  3PRE A;  4NQK E;  2FID A;  1R7S A;  2N1W A;  4ITK A;  1TGZ B;  4M0W A;  2NMQ A;  1R4N I;  1L2N A;  3BK1 A;  2KWD A;  4JE3 B;  1F9J A;  5J17 A;  4IG7 B;  3VDZ A;  3U7D A;  3SDL C;  3CMM B;  3RI7 C;  4ASW C;  2ZCB A;  2DYM A;  3L13 A;  1BXT A;  2QSD A;  3AEC B;  3KWL A;  5DPT A;  2NCN A;  1WGR A;  4UDU C;  2CHX A;  1HZ6 A;  3D32 A;  4AWJ A;  3UQA A;  3Q3M C;  1EU3 A;  1VZ6 A;  2WDV B;  3U52 E;  3PPA A;  5CHF A;  4TV3 A;  1I7H A;  4TUU A;  3BVM A;  2GBK A;  2MRP A;  1PFD A;  1WGD A;  3PLV A;  1M94 A;  1WJU A;  2L7R A;  1WM3 A;  4OW0 A;  1TZO A;  1HTO A;  4MGK E;  5LXH A;  2JT4 B;  1F2R C;  2X8X X;  1C4A A;  2R2Q A;  3KYC D;  4O1N A;  1U4A A;  3DHG C;  5LXI B;  5E6O A;  2QIE B;  1D5X C;  2C7M B;  2MJD A;  3RZF A;  4NJ6 A;  2BTE A;  1Q10 A;  1JRO A;  1L6U A;  2ON8 A;  2RGF A;  3Q8E A;  2GBJ A;  2L3Z A;  1IBX B;  1T0R C;  3HM3 A;  2JWU A;  1E8Y A;  2Z0D B;  2BYE A;  5IP4 D;  2XK5 A;  2MBO A;  4WWP A;  1EM7 A;  1P3Q U;  3PZD A;  4W9K A;  4W9F A;  4N58 A;  2IYD B;  4GMV A;  1QT9 A;  3QHT A;  3NOB A;  4E74 A;  1SXT A;  3OAW A;  2WXM A;  1PYW D;  1VCB A;  5GXG B;  5D3D A;  2BGF A;  1WRI A;  3I57 A;  2KQS A;  1JWA D;  2WU5 B;  5L95 C;  3DCG A;  5LNK 1;  4RF1 A;  4PT5 A;  2WLB A;  3QAQ A;  2JZZ A;  4HWI B;  1T6B X;  3JSV B;  2D07 B;  3QWZ B;  4FN2 A;  1UUP A;  4GLS C;  3ZTC A;  1TT5 B;  5AZF A;  1I4R A;  2BYV E;  4MEM A;  3W1Y A;  4L23 A;  5GMV A;  4MSM B;  2E3T A;  1SJE D;  2BBC A;  4ZYS A;  2EMT A;  5IOI A;  4MT5 A;  4ACF A;  3VVW B;  2PKO A;  4MGY E;  1EU4 A;  1KOT A;  2BKR B;  2BKF A;  2LAS A;  3AEB B;  1MG4 A;  1SE2 A;  4RMA A;  2RPQ A;  4NPN A;  1JML A;  2WXG A;  3MC8 A;  1WGG A;  2G1E A;  1FPY A;  4HLE A;  4HEA 1;  2M4N A;  1WX9 A;  3ZJV A;  2C9W B;  1JWS D;  2H89 B;  1L0X B;  4URK A;  2Y5C A;  2KWC A;  1MJD A;  2J52 A;  1P7E A;  2V9H A;  2KC1 A;  3FAH A;  3ZXR A;  1E0Z A;  3T8M A;  4HDQ A;  2M1M A;  1WXM A;  5JH5 C;  1FEH A;  2JVC A;  3P1M A;  3NS1 A;  4KDL B;  3DHI C;  1RAX A;  4MJS A;  4B0M A;  2K0P A;  4KKI A;  4US8 A;  3BIN A;  1DOX A;  2ZW0 A;  3HUI A;  4LTU A;  1M4V A;  2JYE A;  2M8S A;  3CST A;  1K50 A;  1Q0W B;  2QJL A;  2WX1 A;  3RNC C;  2M0X A;  4FJY A;  4HVB A;  1LM8 B;  4KZ0 A;  1YJI A;  2V4L A;  4YSX B;  1E7U A;  3ZUN A;  3KH0 A;  3VUW A;  5BYS A;  5H8Y E;  1WE7 A;  3DWM A;  3VH3 B;  4C56 C;  3DBR B;  1L7Y A;  2WXF A;  4J3O D;  3TBL D;  2L76 A;  1ISN A;  1ZP0 B;  2ZPY A;  4AJY B;  5TR5 A;  3VQI A;  3DVG X;  3I9V 1;  3RMK C;  3JYU A;  2L00 B;  4RCO A;  2N9K A;  3DVN U;  4KIK B;  3HM6 X;  1FFV A;  3TEY A;  2LGD A;  3T3O A;  3R2I A;  3R7R A;  4K1R B;  3NS8 A;  1F0Z A;  4PYZ A;  2N9P C;  3RNA C;  2CR5 A;  1E8X A;  3PLU A;  5D2M B;  1FNU A;  1IPG A;  4RF0 A;  1N60 A;  3NRZ A;  4ZYN A;  1FNV A;  1I4X A;  2FIF A;  4LNO A;  4CYE A;  4II3 B;  2IO0 B;  3DHH C;  2WXJ A;  3BK2 A;  1FM0 D;  1L6V A;  2EEL A;  4RGM A;  4DDI D;  3P4P B;  1QLB B;  4NJC A;  2IGD A;  1QZE A;  1E7V A;  1C4P A;  3ZDM C;  2KDB A;  3L54 A;  5G55 A;  2DHZ A;  4GU2 A;  4IM3 A;  5FR3 A;  3P4R B;  3W2D A;  5HKH A;  1K51 A;  2LRU A;  2IND C;  2NPT A;  3WIM A;  3DVG Y;  2HJ1 A;  1PQS A;  4XWT A;  3A9J B;  2I38 A;  3SU8 X;  5AEK B;  3RT3 B;  4EZK A;  1LXD A;  4XZ4 A;  4US9 A;  3ZW3 A;  2MBH A;  2D2Q A;  2D3B A;  2ZW1 A;  2KJH B;  4ZRQ A;  4HDO A;  5KHO A;  3VR9 B;  1WMH A;  4IW0 A;  4LJP B;  2ZNV B;  2OHF A;  2CJN A;  3TSS A;  3U8Z A;  4WJN A;  4JLC A;  5CHV C;  1UBQ A;  1IGC A;  2PEA A;  2FNJ B;  3W9C B;  1C9F A;  2EKE C;  3DBL B;  4JWS C;  2R2O A;  1XF5 L;  1ZUD 2;  4K7S A;  1NDD A;  3RNF C;  2VZK B;  3RD2 A;  2WXO A;  4YSZ B;  3RCZ A;  4AJW A;  2BYT A;  1V2Y A;  2XN9 C;  3ML8 A;  4YWG G;  4FHK A;  1ENF A;  5EE0 A;  4P6V F;  1PGX A;  3MP9 A;  4BAX A;  4QAY A;  2NR2 A;  2O6V B;  4K7U A;  4S17 A;  5T8I A;  4A20 A;  4A8X C;  2VZK D;  3AE8 B;  4WJO A;  4C4V B;  2W55 A;  3GZN I;  1CMX B;  4NJ7 A;  4ANX A;  3H7P B;  1ZW7 A;  5HFY A;  3AMZ A;  4GGQ A;  4ZHO A;  3W5V B;  5C1Z A;  1B9R A;  1NEK B;  3U7Z A;  3C8Y A;  3SEB A;  1UNS A;  2QCZ A;  1N6Z A;  4PS3 A;  3A33 B;  4A90 A;  2O6V D;  2PE6 B;  3H7S A;  2C7N B;  3A9K A;  2AQ1 B;  3ECI A;  3NZS A;  1VZ7 A;  1XLO A;  2ZEQ A;  3AE9 B;  1WSP A;  4W9E A;  1J7A A;  4GDL A;  3PT2 B;  3FKY A;  2G4S A;  2MW5 A;  4LDT B;  1F52 A;  1Z5S B;  4GDK A;  1H4R A;  3SHQ A;  1WYW B;  2L0T A;  1UGJ A;  2IBI B;  1YN3 A;  2JYT A;  2QC8 A;  2KMC A;  3AUL A;  4DHZ B;  1ZXI A;  2GOW A;  3ZRC A;  4OVZ A;  1NI3 A;  4C80 A;  4LDT D;  1E10 A;  2QDF A;  2KN4 A;  2MJE A;  4ICV A;  3UF8 A;  3N1Y C;  3KW5 B;  3KYD D;  2KHW B;  1F2R I;  3ENE A;  3B08 A;  1P1A A;  3QIJ A;  5IAA C;  3KUZ A;  3O13 A;  3ZO5 B;  4A9A A;  3IT6 B;  1RFA A;  1LGR A;  2MJ3 A;  1QOF A;  1WWT A;  4HRS A;  1V1P B;  2RPV A;  1B1Z A;  2LWP A;  4XYC A;  2J0M A;  1EF5 A;  2Q5W D;  3PZ7 A;  1OEY J;  4F7Z A;  4XWW A;  2BF8 B;  2LI5 A;  4PK1 A;  3V6C B;  2IZV B;  2RDH A;  4ARC A;  1D4B A;  1ZDV A;  3RYT A;  2QHO A;  2WXK A;  3RFZ B;  1HQR D;  2MP2 A;  2CHW A;  1XD3 B;  1I4H A;  4LJO B;  4P7I A;  5AUK A;  2INP E;  5BMG A;  2JU6 X;  1CK1 A;  4C7Y A;  2AEH A;  4HCP B;  4P16 A;  2KOX A;  4ANV A;  1VLB A;  3T9L A;  3WA0 A;  2AWT A;  4TSS A;  2MBQ A;  2BB5 A;  2X38 A;  1JWU D;  2W54 A;  1J7C A;  4M8M A;  2JUO A;  3URY A;  3FIL A;  2I1J A;  2MSE D;  4NAW B;  4IC7 B;  4BVU C;  1NEN B;  2N9X A;  4MM3 B;  4IDI A;  2LXC A;  3LJ3 A;  3AEF B;  5FK9 C;  3ZQ4 A;  2PLP A;  2EMS A;  1LFD A;  3FC4 A;  1SB3 C;  2KFJ A;  1D3Z A;  2JF5 A;  2PVO D;  2G9H D;  5CX3 A;  4EEW A;  2LJI A;  4ZHP A;  3A1Q A;  4A55 A;  2K8C A;  2KTF A;  3DBH I;  2IDY A;  1HA5 A;  2JRH A;  2IO1 B;  2PMV A;  3MHZ A;  3VFK A;  4KSK C;  2LHE A;  2BW2 A;  2CKH B;  4BKS A;  2B76 B;  3QK0 A;  5DPW A;  1SE9 A;  1WGH A;  4N59 A;  1SF0 A;  1QF6 A;  2W3S A;  3EEC A;  1VD2 A;  4C00 A;  5J18 A;  1K53 A;  2LVP A;  3Q8A A;  1TKY A;  4ANU A;  2HTH A;  1WXA A;  4G50 A;  3ZXV A;  3KLS X;  3TJP A;  4DXA B;  2KMA A;  5AUI A;  1R4M B;  5HI1 A;  3MFG A;  3H1U A;  4J6I A;  2WXL A;  1VRA B;  4K81 A;  4FJZ A;  2GBM A;  4ZRP A;  2N1V A;  2LZ6 A;  3V61 A;  1PGA A;  2LRW A;  4W9L A;  4GOC A;  3EHV A;  1L0Y B;  1JW9 D;  3ONS A;  3N1Z C;  3ML9 A;  2WXP A;  3IBE A;  3V05 A;  4I6P A;  1QOA A;  4TQ0 A;  1TJE A;  4B9K A;  4YTM B;  2DNF A;  1A70 A;  3TL5 A;  1RM6 C;  3PO0 A;  4N9F 4;  3UIO B;  4KV2 A;  3OWE B;  3SFD B;  2IJ0 A;  1J7B A;  1MI0 A;  3WAO A;  4CHK A;  2PW9 A;  2V3P A;  1JCK B;  1TS5 A;  1WX7 A;  2LUE A;  3VRB B;  2FUH B;  1V6E A;  1WRD B;  2KK8 A;  3W1S C;  3EA6 A;  4W9H A;  4USA A;  2C7H A;  3ZLZ A;  3WCQ A;  2WS3 B;  5E6N A;  5EE1 A;  3VTU A;  1ZOY B;  2DYB A;  2KNB A;  1XLQ A;  1YMH E;  3LB8 C;  5LLI A;  1XLP A;  2BS4 B;  2K39 A;  4NY0 A;  4XE0 A;  4D2K A;  5G2N A;  3AB5 A;  1WR6 E;  3A4S C;  2LJ5 A;  2OJR A;  1ROE A;  4XDD A;  2J53 A;  2GRI A;  2DBY A;  3R8B A;  3PS6 A;  2AL3 A;  4E3C A;  1GNU A;  4MAC A;  4A3P A;  4KX6 B;  3DBR I;  3ZIM A;  1JAL A;  1TY0 A;  2N9L A;  2INC C;  5HG2 A;  1K8R B;  1CQV A;  4KGS A;  1NI2 A;  1GC7 A;  2NBW B;  4EKU A;  4HK2 A;  3QX1 A;  3UI3 A;  2JRI B;  2JPH A;  4WH4 A;  3X0W A;  3AE3 B;  3H9D A;  3M3J A;  4YL8 A;  2D5G A;  2ONQ A;  3Q8C A;  4WJP A;  2KDM A;  3TUO A;  1V80 A;  1UGM A;  3BWU D;  2G3Q B;  2SEB D;  3R66 C;  1FRR A;  1SIJ A;  1C79 A;  1WFY A;  4IKG A;  2CJO A;  1T0S C;  1PUT A;  2K22 A;  2KZR A;  4B95 A;  3MJW A;  3BVG A;  1HXY D;  3ZNZ B;  5KHQ A;  3GE8 C;  2G4D B;  3GOE A;  4DHZ E;  4DXG A;  3DOW A;  4WWM A;  1KTK A;  1WXS A;  4KVG B;  4OZB A;  4TMA B;  2LGX A;  1GJZ A;  3RNE C;  2KFK B;  2NBV B;  2WGS A;  3SR6 A;  3AE2 B;  3QAR A;  1OQQ A;  1RYJ A;  1I4P A;  2O2V B;  2BYF A;  3CWI A;  1E90 A;  4XX5 A;  2ACZ B;  4HKZ E;  1N63 A;  4K7W A;  4JL9 A;  2D10 A;  2KTR B;  4RGO S;  3C0R B;  1HTQ A;  2V3S A;  2JZP A;  1C4C A;  3V62 A;  2DX5 B;  2KWU B;  3RUL A;  1WR1 A;  2J7Q B;  1T5X D;  4NQL B;  2KT7 A;  2REX A;  4AS1 A;  2V1Y A;  4HRO A;  3AU4 A;  4CQN A;  5DPS A;  1QOB A;  4YT0 B;  1SIF A;  3NJT A;  5IA7 A;  2BWE S;  3B2G A;  1YNT E;  3PVL A;  4EFO A;  1CJE A;  2DYO A;  4DHJ B;  4IOI E;  2LUM A;  3VRA B;  4KGR A;  3Q3J A;  4DWF A;  4L2Y A;  3CF6 E;  4FLH A;  3PRP B;  3VTW A;  3HHM A;  2Y3A A;  2DAJ A;  1VZ8 A;  3LYY A;  2UYZ B;  3A4R A;  1F1H A;  1E8W A;  3N3K B;  3BVZ A;  3DBL I;  4HPL B;  1FXA A;  3QC8 B;  2NVU I;  5EE3 A;  4EOY A;  2DZK A;  2BS3 B;  3ETR A;  4YSY B;  4RFB A;  4DHJ D;  3KQ4 A;  1ET9 A;  2KJR A;  2BVC A;  3WAN A;  1J0G A;  4G0N B;  2FCM A;  3AI5 A;  3EFC A;  4FA6 A;  1ET6 A;  4P1B C;  1IBX A;  2CS4 A;  1MG8 A;  1ZDX A;  2DWQ A;  3PZ8 A;  4IWP A;  1HEZ E;  3NVZ A;  3APF A;  5C3J B;  4M0W B;  2KXJ A;  3R7Q A;  1L5P A;  1T3Q A;  2PJH A;  1VJK A;  2DZM A;  5MPO A;  4HJK A;  5BYR A;  3AE6 B;  2MWS B;  1V81 A;  2N4F A;  4GB9 A;  3L0W B;  2PE9 A;  1YN5 A;  3JSV A;  5HHD G;  2FCQ A;  4WQM A;  4WWN A;  2QIL A;  3R3M A;  3N1X C;  1YX5 B;  4C7Z A;  4OVU A;  2M17 A;  3DPD A;  2IY1 B;  1BT0 A;  2GLS A;  3N30 A;  2IGH A;  3Q8F A;  2D11 A;  3GE3 C;  1TS4 A;  2ICI A;  2KO3 A;  3U2S C;  2BQQ A;  2ASQ A;  3BZD B;  3PRZ A;  5J2R A;  3RN9 C;  4ICU A;  3BYY B;  2KDF B;  2MBB B;  2WYQ A;  1WXV A;  1AWD A;  2G45 B;  1N5X A;  2K9X A;  3PGE A;  4IWQ A;  1FCL A;  1QOG A;  3VR8 B;  3I5J C;  1RLF A;  5I4D A;  2MEK A;  1GB4 A;  4ZDV A;  2OJW A;  2GMI C;  4LK0 M;  3ZNG C;  2K8H A;  1WX8 A;  2KYW A;  3ZJT A;  1MFW A;  3Q3F A;  4RM9 A;  2I1K A;  3VTV A;  1V1O A;  3GS2 A;  3J9C A;  1YN4 A;  1XO3 A;  2WXN A;  1FXI A;  4DQO C;  4HXD A;  4TQ1 A;  4XDC A;  3ZVV A;  2XK5 B;  2AYO B;  4BOS C;  1L4Z B;  2B3A A;  3PHX B;  2NTT A;  3Q3N C;  3PV1 A;  3KUC B;  3EGR A;  1E9M A;  2A4Z A;  4S0R A;  4Q2J A;  5E6J A;  4M00 A;  1P9D U;  4BKG A;  3U30 A;  3MC9 A;  1P7F A;  2ZVN A;  3TMP B;  1YQ3 B;  2BT6 A;  4OZC A;  4MDK E;  1KLU D;  4OZA A;  4WJQ A;  4ZRK A;  1L4D B;  2VRR B;  4FJV B;  4K3B A;  3K9O B;  2WDQ B;  4G11 A;  1LQB A;  4KZC A;  4REZ A;  1JWM D;  1DYQ A;  2NBU A;  2RR9 A;  3APD A;  2CHZ A;  3QQ8 B;  5JHA A;  3OJ3 A;  4HPP A;  1SEB D;  1UH6 A;  2LXA A;  2BWF A;  1I42 A;  2JZ3 B;  1RRB A;  2UWQ A;  4FXC A;  2AL6 A;  1HZ5 A;  4YTP B;  1GAQ B;  1QQR A;  2J0J A;  3KUD B;  3U4E G;  3OG5 A;  1LO5 D;  3ZNI D;  5EDS A;  2LEK A;  1WY8 A;  2JSV X;  4GN1 A;  1F77 A;  2ZZP B;  1FXT B;  3IHP C;  3AEG B;  5G5G A;  3TEZ A;  1TBE A;  1N5W A;  2CU3 A;  3B0A A;  4W9I A;  3L08 A;  3V60 A;  3VXW A;  2LD9 A;  1OEY A;  3RNB C;  5BMH A;  4LNK A;  4KIK A;  5BMI A;  1WJ4 A;  2N7D A;  1KH0 A;  2JY6 A;  4M02 A;  3Q69 A;  1WE6 A;  3ALB A;  4E71 A;  1STE A;  3NZU A;  4DDG D;  1WF9 A;  3ABV B;  4RGT A;  2KVR A;  2HE7 A;  2EKI A;  2XEW A;  2N7J A;  2DLB A;  1WI0 A;  2N7E A;  2DEN B;  2WU2 B;  4IM0 A;  5E6P A;  4I6N B;  1I4Q A;  3B1L X;  4DXF A;  2FUG 1;  3VAW A;  2BPS A;  1KRH A;  3NG0 A;  2LGI A;  2K6Q A;  3MJ5 A;  3T3N A;  4XC2 A;  1FO4 A;  1SSN A;  3PSE B;  4DK5 A;  4W9D A;  3ZTD A;  1V49 A;  1YD8 U;  4MJS B;  1V5O A;  2LHD A;  2YVC A;  2K3U A;  4GSW A;  2MA9 B;  1P98 A;  1AYF A;  3PRM B;  2YLM A;  3ZDT A;  3Q2A C;  1JRP A;  1Z2M A;  4LNF A;  1R4M I;  2MQJ A;  5DCN A;  1AN8 A;  3ZGZ A;  1WGY A;  4W9G A;  2INN E;  3H6N A;  3IAM 1;  2HDE A;  3A9J A;  5H92 C;  4M8N A;  3LXF A;  2KJ6 A;  3HVD A;  4EZL A;  2H88 B;  3NY5 A;  2RMM A;  3NVY A;  2D3A A;  1TY2 A;  2V4I B;  3TEW A;  1XCQ L;  3AED B;  4EZJ A;  3O65 B;  1N61 A;  1V97 A;  2K6D B;  3NZ3 A;  2PTL A;  1WIA A;  1WM2 A;  2LFI A;  3L17 A;  3N9Y C;  1FFU A;  5D3I B;  2ZCC A;  4II2 B;  2PPH A;  1IGD A;  1UWX A;  4WWO A;  3K9P B;  4WIP A;  1XQQ A;  1E6E B;  3M62 B;  2Z0E B;  2KAC A;  2NS5 A;  1KM7 A;  1V8C A;  4KDI C;  1D6E C;  2L8J A;  4FUL A;  4OHJ A;  1QIL A;  1Y56 A;  1TZ1 A;  5TSS A;  4BBN F;  4WQO B;  4AP4 C;  2KLC A;  4BZA A;  4AQ7 A;  2I2Y A;  2O6V A;  5DPR A;  4H2A A;  3V3X A;  3IG3 A;  1EWC A;  2FAZ A;  1DOY A;  4C4V A;  4FAD A;  1GOZ A;  1KFY B;  1IYF A;  1R4N B;  2RDG A;  5D7G A;  3H7P A;  5G5H A;  3B2F A;  1Y8R C;  1WGK A;  2WHI A;  2NPT B;  2M0A A;  3RNG C;  1N62 A;  4KSL C;  1XXG A;  2HTM E;  4YXD B;  5CTR C;  1OQY A;  2KC2 A;  1EWY C;  3CIR B;  1WXQ A;  3KVF B;  1OFF A;  3HK0 A;  3P42 A;  1E8Z A;  1V5T A;  3GB1 A;  4RGN A;  3EFU A;  2IO3 B;  2XBB C;  3DBH B;  4I6L B;  5BYQ A;  4BKT A;  1ZKH A;  1Q5W B;  1WMH B;  3SFE B;  2FE8 A;  1KF6 B;  1MVK A;  4IUM B;  3WAM A;  3N20 C;  1RFK A;  1WZ0 A;  2Z8L A;  1JQ4 A;  4ZOH C;  5C23 A;  2L83 A;  3R2T A;  1GC6 A;  1XEE A;  3AN1 A;  4ZRJ A;  2V3N A;  2LVQ A;  4CO7 A;  3TIX A;  5AZH A;  4B6W A;  3BYT B;  3E56 A;  5C2T B;  2GBN A;  1WJN A;  1CZP A;  2L52 A;  4LNI A;  2KX0 A;  1UBI A;  2ZVO A;  3NUH B;  2L32 A;  1ZPS A;  3Q3O C;  2GBR A;  1GG3 A;  4DBG A;  1K52 A;  2HJ8 A;  4HPM B;  4MSQ B;  2W82 A;  3NVV A;  2WXH A;  3IXS A;  1NYQ A;  4LCD E;  1PDX A;  4KKJ A;  1YX6 B;  1V1P A;  2HD5 B;  4W9J A;  3ZJU A;  2KVZ A;  1SE4 A;  2KAJ A;  1D5Z C;  2IO2 B;  1D5M C;  3VUY A;  2R61 A;  3NVW A; 
#chains in the Genus database with same CATH homology
 4FHJ A;  4HJK A;  5LXH A;  2JT4 B;  1WZ3 A;  2N9E B;  3A9K B;  1S1Q B;  4ICV A;  2R2Q A;  3KYC D;  3UF8 A;  1U4A A;  2MWS B;  3KW5 B;  3S2A A;  3KYD D;  2KHW B;  5LXI B;  3ENE A;  1V81 A;  5E6O A;  3MTN B;  3B08 A;  1P1A A;  3QIJ A;  2N4F A;  5IAA C;  3KUZ A;  2C7M B;  3RZF A;  3ZO5 B;  4NJ6 A;  4GB9 A;  4GDL B;  4MGI E;  5JZE B;  3UIP B;  3L0W B;  2PE9 A;  3JSV A;  2RD0 A;  2W9N A;  2FCQ A;  4GDK B;  2RGF A;  4WWN A;  1RFA A;  2GBJ A;  2L3Z A;  3R3M A;  3HM3 A;  1YX5 B;  3L16 A;  1E8Y A;  2Z0D B;  2BYE A;  4OVU A;  2M17 A;  3DPD A;  2IY1 B;  1BT0 A;  2XK5 A;  3N30 A;  3L10 B;  2MBO A;  2LWP A;  4WWP A;  2D11 A;  2IY0 B;  2J0M A;  1P3Q U;  3PZD A;  2KO3 A;  4W9K A;  1EF5 A;  1EF1 A;  2ASQ A;  4W9F A;  3PRZ A;  2IYD B;  5J2R A;  4GMV A;  1OEY J;  1G6J A;  4F7Z A;  4ICU A;  3QHT A;  3ZRF A;  2KDF B;  2MBB B;  1KLV A;  2WYQ A;  3NOB A;  4E74 A;  4NAW A;  1WXV A;  2BF8 B;  3OAW A;  2LI5 A;  2G45 B;  3DVN V;  1J8C A;  3V6C B;  1VCB A;  2IZV B;  4MM3 A;  4IWQ A;  3PGE A;  2BGF A;  5FR6 A;  2KQS A;  1RLF A;  3RYT A;  4ZDV A;  2GMI C;  2QHO A;  3ZNG C;  2K8H A;  5L95 C;  3DCG A;  1WX8 A;  2MP2 A;  2CHW A;  1XD3 B;  3QAQ A;  2JZZ A;  2KD0 A;  3Q3F A;  4LJO B;  4HWI B;  4P7I A;  4RM9 A;  2WX0 A;  3JSV B;  2KLG A;  2AEH A;  4W9C A;  2D07 B;  2I1K A;  2Y5B B;  3QWZ B;  4PS8 A;  4HCP B;  4FN2 A;  3VTV A;  5L83 A;  3ZTC A;  2KOX A;  4ANV A;  2ZJD A;  3T9L A;  3IVF A;  4HXD A;  4TQ1 A;  5AZF A;  3WA0 A;  2AWT A;  2BYV E;  3ZVV A;  2MBQ A;  2XK5 B;  2AYO B;  4MEM A;  4EUT A;  1JRU A;  2MX2 A;  3W1Y A;  4BOS C;  5GMV A;  4PS7 A;  2B3A A;  3PHX B;  4M8M A;  4MSM B;  1UEL A;  2JUO A;  3RUI B;  4GIV A;  3PV1 A;  2I1J A;  2MSE D;  2EMT A;  2L0F A;  3N32 A;  4NAW B;  4IC7 B;  3KUC B;  4JQW C;  2A4Z A;  4BVU C;  3VVW B;  2DZJ A;  2N9X A;  2LXC A;  4MGY E;  3LJ3 A;  3W1S A;  2BKR B;  1P9D U;  1KOT A;  4AUQ C;  4BKG A;  3U30 A;  2LAS A;  2BKF A;  2EMS A;  1LFD A;  2A5U A;  2KFJ A;  2ZVN A;  3TMP B;  3X23 A;  1D3Z A;  5CHW A;  4MDK E;  4RMA A;  2MP2 B;  2RPQ A;  4IM2 A;  4WJQ A;  2JF5 A;  4ZRK A;  2KDE B;  5CX3 A;  4BBN C;  2VRR B;  4NPN A;  4AOF A;  4EEW A;  4FJV B;  3TCA A;  3K9O B;  3A1Q A;  4G11 A;  1LQB A;  4KZC A;  2K8C A;  2KTF A;  1WGG A;  3DBH I;  4G3X B;  4HLE A;  2NBU A;  2JRH A;  1EO6 A;  2RR9 A;  3APD A;  1OTR B;  2IO1 B;  3JVZ X;  2CHZ A;  2M4N A;  3QQ8 B;  5JHA A;  1WX9 A;  3OJ3 A;  2C9W B;  3VFK A;  1UH6 A;  4KSK C;  2CKH B;  2DAF A;  2BWF A;  2LXA A;  3MHS D;  4BKS A;  4URK A;  1A5R A;  1I42 A;  3QK0 A;  5DPW A;  2JZ3 B;  1RRB A;  1SE9 A;  1WGH A;  2KWC A;  2UWQ A;  3AXC A;  3P2B A;  3M95 A;  2AL6 A;  2KC1 A;  2KWV B;  2KAN A;  3PHW B;  2FCN A;  5BO4 B;  3EEC A;  1VD2 A;  3BY4 B;  3T8M A;  4HDQ A;  5J18 A;  2M1M A;  1WXM A;  2J0J A;  3KUD B;  2LVP A;  5JH5 C;  2JVC A;  3ZNI D;  4ANU A;  2HTH A;  2MLB A;  1WXA A;  5EDS A;  4G50 A;  1HE8 A;  1WY8 A;  3TJP A;  4ANW A;  4DXA B;  4GN1 A;  4KDL B;  4IWO A;  4TKN A;  2KMA A;  2ZZP B;  1FXT B;  3VUX A;  3IHP C;  1RAX A;  1TBE A;  5D6J B;  3B0A A;  4W9I A;  1T0Y A;  2RSU A;  3L08 A;  4MJS A;  3V60 A;  3H1U A;  4J6I A;  3VXW A;  3M63 B;  2LD9 A;  1OEY A;  3BIN A;  1WJ6 A;  3OJ4 B;  1WJ4 A;  3A1Q B;  2GBM A;  4FJZ A;  4K81 A;  4KIK A;  2N7D A;  1S3S G;  2JY6 A;  2N1V A;  3ZKJ C;  2LZ6 A;  3EC8 A;  3V61 A;  1J19 A;  1WE6 A;  2LRW A;  2M8S A;  3CST A;  4W9L A;  4GOC A;  3EHV A;  3VHT C;  1Q0W B;  1SGH A;  2WX1 A;  3ALB A;  4E71 A;  1IP9 A;  2M0X A;  3ONS A;  3NZU A;  3ML9 A;  4FJY A;  4DDG D;  1TTN A;  1C3T A;  1WF9 A;  1ZGU B;  3IBE A;  1V9J A;  4HVB A;  2KDI A;  4MEL A;  1LM8 B;  2KVR A;  4KZ0 A;  2HE7 A;  1WH3 A;  2XEW A;  2V4L A;  4I6P A;  1Q1O A;  1E7U A;  3ZUN A;  1WI0 A;  2N7E A;  2DEN B;  4TQ0 A;  3KH0 A;  3VUW A;  4B9K A;  1WE7 A;  4IM0 A;  3LDZ E;  5E6P A;  4I6N B;  3TL5 A;  3VH3 B;  4A3O A;  3B1L X;  1NBF C;  1L7Y A;  3VAW A;  4N9F 4;  3UIO B;  2BPS A;  3TBL D;  4KV2 A;  2L76 A;  2K6Q A;  2ZPN A;  3QA8 A;  1ISN A;  2ZPY A;  4AJY B;  5TR5 A;  4XC2 A;  3WAO A;  3VQI A;  3DVG X;  4CHK A;  4F8C B;  3PSE B;  4DK5 A;  4W9D A;  1EUV B;  3ZTD A;  1V49 A;  1YD8 U;  1YJ1 A;  3JYU A;  1WX7 A;  3APC A;  1V5O A;  2L00 B;  4MJS B;  4BKS D;  3DVN U;  2LUE A;  2FUH B;  2FCS A;  4MGZ E;  1V6E A;  2KK8 A;  1WRD B;  2YVC A;  4KIK B;  3AU5 A;  3W1S C;  2C5L C;  4GSW A;  4W9H A;  3HM6 X;  2MA9 B;  2C7H A;  3ZLZ A;  1UZX B;  3RZW C;  2J0K A;  1P98 A;  4RM8 A;  5E6N A;  2LGD A;  3DBS A;  1UD7 A;  3PRM B;  3VTU A;  2YLM A;  3R7R A;  3ZDT A;  2DYB A;  2KNB A;  3HIZ A;  2JWZ A;  4K1R B;  3NS8 A;  1Z2M A;  5D94 A;  4PYZ A;  2N9P C;  1R4M I;  2MQJ A;  5DCN A;  2CR5 A;  5LLI A;  1E8X A;  1WGY A;  2K8B A;  3PLU A;  5D2M B;  3UGB B;  4W9G A;  2K39 A;  3H6N A;  4NY0 A;  5G2N A;  1IPG A;  2ZNV C;  3A9J A;  4M8N A;  1WR6 E;  3A4S C;  3WAP A;  2LJ5 A;  2KJ6 A;  2OJR A;  4ZYN A;  2FIF A;  1GUA B;  4CYE A;  2WWZ A;  4II3 B;  4EZL A;  2L05 A;  2IO0 B;  3NY5 A;  4JIO U;  2Z59 B;  3DDC B;  3PS6 A;  2AL3 A;  2K25 A;  4E3C A;  3UIN B;  1GNU A;  4DDI D;  1V86 A;  4EZJ A;  1QZE A;  4A3P A;  1E7V A;  3O65 B;  3DBR I;  3SD5 A;  3UQB A;  3ZDM C;  3ZIM A;  2LVO A;  2K6D B;  2KDB A;  3L54 A;  1WIA A;  5G55 A;  1K8R B;  1WM2 A;  3V6E B;  3L17 A;  2DHZ A;  4ZRI A;  5AZG A;  1XT9 B;  4GU2 A;  4IM3 A;  1NI2 A;  1GC7 A;  2NBW B;  2ZCC A;  1C1Y B;  4II2 B;  2PPH A;  4EKU A;  5HKH A;  4HK2 A;  3QX1 A;  2KFK A;  2LRU A;  4WWO A;  2JRI B;  2JPH A;  4F1S A;  3K9P B;  2NPT A;  3X0W A;  1XQQ A;  3WIM A;  4BOZ B;  3M3J A;  3H9D A;  3DVG Y;  4MH0 E;  1PQS A;  2LGY A;  3DQV A;  5JHB A;  4YL8 A;  3A9J B;  4FBJ B;  3WAL A;  3SU8 X;  5AEK B;  4WJP A;  3M62 B;  3RT3 B;  2Z0E B;  4EZK A;  1LXD A;  2NS5 A;  1KM7 A;  1YQB A;  3OLM D;  4XZ4 A;  2O2V A;  4NNJ B;  1V80 A;  4KDI C;  1UGM A;  2L8J A;  4FUL A;  2G3Q B;  3ZNH B;  3ZW3 A;  3R66 C;  2MBH A;  3PTF C;  2MBE A;  1TZ1 A;  1WFY A;  2KTR A;  2D2Q A;  4BBN F;  1I35 A;  4WQO B;  1P0R A;  2KJH B;  4AP4 C;  2KLC A;  2D3G A;  4HDO A;  5KHO A;  2KZR A;  4B95 A;  3MJW A;  4JGH B;  1WMH A;  2KN5 A;  4IW0 A;  4LJP B;  2ZNV B;  3ZNZ B;  2O6V A;  5DPR A;  3U8Z A;  4WJN A;  5KHQ A;  4JLC A;  4DHZ E;  2G4D B;  3GOE A;  3IG3 A;  2FAZ A;  2K1F A;  3QJZ A;  4X57 B;  5CHV C;  3DOW A;  1UBQ A;  4FAD A;  1WXS A;  4KVG B;  1IYF A;  1H8C A;  3JW0 X;  2C60 A;  5D7G A;  4GXB A;  3H7P A;  2PEA A;  2FNJ B;  2LGX A;  3IFW B;  2DZI A;  3I3T B;  1GJZ A;  2KX3 A;  1Y8R C;  2EKE C;  2KFK B;  2CU1 A;  1KJT A;  2NBV B;  3CSF A;  2JXX A;  2NPT B;  2R2O A;  4K7S A;  1NDD A;  4KSL C;  3QAR A;  3RD2 A;  5CTR C;  2KKC A;  2O2V B;  1OQY A;  4HCN B;  1E5W A;  2BYF A;  1E90 A;  4XX5 A;  2KC2 A;  3RCZ A;  4BFR A;  1YIW A;  3NHE B;  2MCN B;  1OGW A;  4K7W A;  3KVF B;  4AJW A;  4JL9 A;  1V2Y A;  2D10 A;  3HK0 A;  2KTR B;  4OVV A;  3C0R B;  3ML8 A;  1E8Z A;  1V5T A;  2V3S A;  3QCA A;  3EFU A;  2IO3 B;  2XBB C;  2WDT B;  4FHK A;  3V62 A;  2DX5 B;  4I6L B;  2KWU B;  3RUL A;  1WR1 A;  2J7Q B;  2KQ7 A;  4BKT A;  1ZKH A;  4NQL B;  1Q5W B;  1WMH B;  2REX A;  2NR2 A;  2O6V B;  4K7U A;  4A20 A;  4IUM B;  2V1Y A;  3WAM A;  3AU4 A;  5DPS A;  4WJO A;  4NJ7 A;  1SIF A;  1CMX B;  3GZN I;  4PYU A;  2BWE S;  5IA7 A;  3VH4 B;  1X1M A;  1WZ0 A;  1AAR A;  4ANX A;  3PVL A;  4WAA A;  3H7P B;  1ZW7 A;  2OOB B;  4GGQ A;  4EFO A;  2DYO A;  5C23 A;  4DHJ B;  5C1Z A;  1GC6 A;  3PRE A;  3Q3J A;  4ZRJ A;  4DWF A;  4NQK E;  2FID A;  3CF6 E;  4FLH A;  2N1W A;  3PRP B;  3VTW A;  3HHM A;  2LVQ A;  4CO7 A;  1TGZ B;  5AZH A;  3TIX A;  4PS3 A;  4B6W A;  3A33 B;  1R4N I;  2GBN A;  2O6V D;  1L2N A;  2PE6 B;  1WJN A;  2DAJ A;  2UYZ B;  3A4R A;  1F9J A;  1E8W A;  3N3K B;  5J17 A;  4IG7 B;  3H7S A;  3U7D A;  3VDZ A;  3DBL I;  4HPL B;  3SDL C;  2C7N B;  3QC8 B;  2KX0 A;  1UBI A;  2NVU I;  2ZVO A;  3A9K A;  3CMM B;  2ZCB A;  4ASW C;  4EOY A;  2DZK A;  2DYM A;  3L13 A;  2GBR A;  3ECI A;  1GG3 A;  3NZS A;  4DBG A;  4DHJ D;  2HJ8 A;  4HPM B;  2ZEQ A;  4MSQ B;  4W9E A;  5DPT A;  2KJR A;  4GDL A;  3PT2 B;  2NCN A;  3WAN A;  1WGR A;  2G4S A;  1J0G A;  2MW5 A;  4G0N B;  2FCM A;  4LDT B;  1Z5S B;  3AI5 A;  4FA6 A;  2CHX A;  4GDK A;  3D32 A;  4AWJ A;  3UQA A;  1H4R A;  2CS4 A;  3SHQ A;  1WYW B;  3PPA A;  2L0T A;  1MG8 A;  5CHF A;  4TV3 A;  4LCD E;  2IBI B;  1YX6 B;  4TUU A;  2HD5 B;  4IWP A;  2KMC A;  4W9J A;  2GBK A;  3AUL A;  2MRP A;  4DHZ B;  2GOW A;  3APF A;  1WGD A;  3PLV A;  2KXJ A;  4M0W B;  3R7Q A;  1M94 A;  2PJH A;  2IO2 B;  1WJU A;  2L7R A;  3ZRC A;  2DZM A;  3VUY A;  1WM3 A;  4LDT D;  4MGK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...