2G4UA

Anomalous substructure of porcine pancreatic elastaase (ca)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords elastase-1
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g4uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g4uA01
3EGKH 4XBCA 2FESH 2M5TA 1A2CH 1DY9A 1SGTA 4AB8A 3BIVH 3OTJE 1FXYA 4GAWA 1AMHA 1F92A 3RC5A 3ATMA 2ZFRH 3PMBB 4IMZA 1M9UA 4D7GA 1TABE 3PROA 3RXGA 2ZDKA 2HLCA 1QFKH 1W7GH 1AGJA 1BTHH 1QNJA 1F7ZA 1F0RA 2GT8A 1C1NA 1O3DA 4A1VA 3U9AH 2IJOB 2ODPA 3NKKA 1SHHB 1O38A 1IQMA 4ZROA 3RXOA 2YOLA 1FPHH 2BXUH 3A7YA 4BTIB 4OS7A 3T27A 2BDIA 4JK6A 2VVCA 1OWHA 1BTYA 2ANYA 1GBDA 1EZUC 4WY3A 5SGAE 1WV7H 1MD7A 1S6HA 1HAXB 3LGTA 4D8NA 5C20A 1OOKB 3TH2H 1GBCA 3PO1C 1S83A 9ESTA 2C8ZB 1V2RT 2A4QA 3FANA 3VB7A 3MI4A 1QRZA 1LTOA 1MCTA 3UNSA 1XUGA 1O3OA 2GX4A 1H4WA 5CHAB 3RXPA 1O3AA 3UOUA 1GI1A 1HCGA 1O3PB 1FN8A 1K1NA 4XDEA 3D62A 1K28D 1C1QA 1O3JA 3F1SB 3WY8A 4B1TA 2BX3A 3AW1A 5L2YH 4ABHA 1NFUA 3FP6E 1W12U 2QXIA 3N7OA 1G9IE 1PFXC 1TBQH 3LIWA 2FOAA 2C93B 4DJZB 1HUTH 3PB1E 4SGAE 1HJ8A 3GOVB 1S85A 5GPIB 1ELBA 2BDAA 4X1SU 1P05A 1EP5A 3SBKA 3ZZBA 3ZYDA 2OC8A 2Y81A 1P10A 1YP9A 3AW0A 2ZPQA 1F0TA 2P8OB 4J1YA 1BMMH 2HPQH 2RCEA 4B75A 2F9NA 1FY5A 1OPHB 1C2DA 1YM0A 1H8IH 1GBLA 3QTVH 3I29A 4HGCA 3PM3A 1SGFG 2AIPA 1OWDA 5EPNA 1EB1H 2GCTC 2Q1JA 1IQJA 1C5LH 1GG6C 2BQ7B 5EG4A 3ZZ5A 1G2MA 1KIGH 1XUKA 1DOJA 3TGIE 1A3BH 1J14A 3OY5U 3K6ZA 2BDHA 1KTSB 3QLPH 1A61H 1O2GH 5LGOA 1O3GA 4KTUA 1FJSA 1YPMH 3MTYA 4BAQB 1DY8A 1QGFA 3A7ZA 1K1OA 2C4FH 2H5CA 3OX7U 1V3XA 1J8AA 1UCYH 5C1UA 1MKWH 2SGPE 2SGEE 1G30B 5DP5A 3B9FH 1O2PA 3RMMH 2STBE 5EQSA 1DX5M 1P2QA 1B0EA 1V2TT 2CMYA 4J2YB 3SJ9A 1F2SE 2A5IA 4YOJA 1MAYA 2XWBI 1AWFH 1UTOA 5J4SA 1KLJH 4MG3A 4BAKB 1FZZA 1PYTC 1L4ZA 3HKJB 4NA9H 4TWWA 1BBRE 1IQIA 1T4VH 1OSSA 2WPKS 3A89A 1V2VT 1O5BB 2ZFTA 1C1SA 1QRWA 2ZPSA 3F9EA 2WPJS 3NK8A 2XWAA 4BTTB 3RXVA 4I8LA 1PQ7A 2NWNA 1RTKA 4U30A 1TNLA 4ZHMU 2P59A 1HFDA 2D2DA 2GMTC 3UY9A 1SGQE 3VEQB 3KHVA 1GI3A 1NS3A 2I6SA 1P2KA 2STAE 4F49A 2GCTB 2PWXA 1DVAH 1GHAG 1HRTH 4Y6DA 4IN1A 3DA9B 1O2KA 1RGQA 2NU4E 1YBWA 1V2KT 4JYTA 3VB4A 4DG4A 3V7TA 4VGCB 1CA0B 1C4V2 1OP0A 1HNEE 5GXPA 2G4TA 1CGJE 4BTUB 1C1MA 1ZTLA 3QGNB 2IPHA 1O2UA 1NPMA 4E06H 3U98H 2V35A 3K9XB 3LT3A 3QK1A 1CHGA 2C8YB 3GCNA 1VITH 1GPZA 1TAWA 4NFEA 4O3UA 1A4WH 5F03A 2QC2A 3PMJA 2JH6D 2QXJA 1SOZA 3AAUA 4NZQA 1TRMA 1C1RA 1UVTH 1KXBA 2PKAB 2BY5X 2Z9LA 4I31A 3C1KA 4Y7BA 2PV9B 3GCTG 2SGFE 4UONA 2IOTA 3PYHA 1AB9C 3Q3XA 3SV9A 4I33A 1DLKB 1HBTH 4OS2A 1NO9H 1O2HA 3STJA 2XC4A 3A87A 2JETC 1CU1A 4DOQA 1DWCH 4Y8ZA 4NCYA 1WU1A 2ZDMA 1EATA 3P17H 1INCA 4LXBH 3IG6B 3BN9A 4Z0KA 1GMDF 4DIIH 4KGAA 3C27B 1W3CA 1H9LB 1KDQA 4AFUA 2BLOA 3NZIA 1Y5UT 1C5NH 3W95A 3O8BA 1HPGA 5EGMA 3A7TA 2AERH 5C1XA 3HK3B 2VVVA 4UFFH 3TU7H 1THSH 1G3DA 2FTMA 1P3CA 1TMBH 8GCHG 1FN6A 1TLDA 5GCHG 4ASHA 4NZLA 2F9VA 5EXMA 2W7UA 4ABJA 3URDA 4AYYB 2AMPA 5K0HA 2AGIX 1N6XA 1SGNE 1BMNH 3EQ0H 1Z7KA 2G00A 2CF8H 1NN6A 4AYVB 2P3UB 1AN1E 4YTAA 4ABEA 4INLA 1Z8JB 2BDBA 1WOFA 4ZKNU 1J16A 3OSYA 2QXHA 1H1BA 1T7CA 4M7GA 1TRYA 3BTQE 4TYDA 5A0AE 1TPAE 3D49H 1LPKB 3QTOH 3R3GB 4K8BA 1TQ0B 2WPLS 2F9PA 1VGCC 1WBGB 1BTUA 2B0FA 3ESTA 3M5LA 3MU8A 4X0WU 1TMUH 1XVMA 2J94A 3MHWU 1C2LA 5DJ7A 1TGCA 1C4U2 1A1RA 3KQBA 6GCHF 3SUGA 3S69A 4CBOA 3F9HA 1B5GH 1A5IA 2V0BA 3FZZA 1DANH 1NRPH 5IDKA 2YNAA 3SN8A 2R0KA 3ZZ7A 1GBMA 3DT0H 1BDAA 5CMXH 4MVNA 3JZ1B 3BG4B 3MU5A 1E37B 2GV7A 4DT7B 2TBSA 1CHOF 4YT6H 1DUEA 3M37A 2G5VA 3A80A 2CV3A 2VGCB 1VR1H 4K3JA 5E2PA 3ATLA 4B2BA 2XC0A 3BV9B 4RKOB 1FQ3A 1FONA 3P70B 1CT4E 1YKTA 1T8NA 1RD3B 4I8JA 5FCRA 3RXUA 1GCDA 2Z9JA 5H4IB 4WH8A 1DFPA 2UUKB 1BITA 2DE9A 4CRBA 1DXPA 1N8OB 2OBQA 3W94A 1V2UT 8KME2 1WYKA 1K1LA 1SGRE 4FXGH 1SFQB 2HNTC 3F68H 5JPMH 3A7XA 1LVBA 3ZV8A 2IN2A 1X7AC 4GUXA 1SL3A 1JBUH 1GJ8B 1GDNA 1XVOA 2Y7ZA 1C5SA 3UOPA 2VGCC 2AYWA 3M3TA 4UEHH 2FI4E 3HGPA 2Z9IA 3RXCA 1ARBA 3BTTE 3BTKE 3RXMA 4DURA 4Z6AH 4AFSA 1FAKH 4ZH8A 1J9CH 3HGNA 3O8RA 3MH5A 5T3HA 1P09A 1MQ5A 4XE4A 3MH4A 3S0NA 2A32A 1O5CB 3VFEA 2HALA 3KQDA 1D3TB 3A85A 2ZFPH 1ZTJA 1MD8A 2HNTE 2VWMA 2FOFA 2A45B 1LQEA 2WV4A 1SGEE 5G4BA 1TMTH 3VB6A 1TGTA 1UJ1A 2P8OC 1CSOE 2CN0H 3ZVAA 3ZZ3A 1ABJH 4GPGA 3KCGH 2ZWLH 1UCYE 4RKJB 1B0FA 2ZF0H 1EQ9A 3F6UH 1TRNA 1YLCA 1G36A 3ZVFA 1ZMJA 1GDUA 3RXHA 4K60A 1GJ5H 1AVGH 3MMGA 4DW2U 2G52A 1XMNB 6ESTA 1E0FD 3TVJB 1ABIH 1HAYB 1LHDH 1KXFA 1BTPA 3TK6A 1TIOA 4BOHA 1IQLA 1PQ5A 2QN5T 3RXQA 1PPBH 1Y3VA 4Q7ZA 3P8OA 3SUDA 1AWHB 5EODA 3BEIB 4CBNA 2TGAA 3PTNA 1O5FH 1O2NA 1ELGA 5A09A 3RC4A 1SSXA 1AIXH 3MU0A 1SQAA 2FI3E 1ZSLA 3RXEA 1CT2E 4B71A 2BY9X 1OYQA 4FU8A 3MU4A 1WQSA 4I8KA 3A7VA 2ZGHA 1EZQA 1MTVA 4KELA 1O36A 1G37A 1AUTC 7GCHF 1NRSH 1C1PA 2FEQH 1NROH 2VIWA 2CGAA 1QB6A 3LC3A 3V3MA 4BANB 4XBDA 1GL1A 1AY6H 1EXFA 1L2EA 2B9LA 4K1TA 3TITA 3QN7A 2GVFA 2XYAA 4UE7H 1PPCE 1EJAA 8GCHF 3VGCB 2PLXA 4ZXXH 3AAVA 4WXVA 3HKIB 2Z9GA 2AH4X 3ZZCA 1HAIH 1AFQC 2H1UA 2OLGA 3RU4T 2XC5A 2PKSC 2ZGCA 1SI5H 1C2IA 3K65B 1IQHA 1O34A 1OP2A 1EPTC 4LK4A 3I78A 1GJAB 3O8CA 2K1QA 1UTQA 2BD4A 4MLFB 1GJ6A 1P11E 2BXTH 2V3OH 1VJ9U 1ZPCA 1C5MD 3QWCH 2DUCA 1GCTC 2WUCA 2A1DB 2O8UA 2FI5E 1AKSB 1BHXB 4LZ4B 1G32B 1L1GA 1MZDA 1C5ZB 2GZ7A 1YPHE 1CT0E 4NA8A 2ZU3A 1DS2E 2W7SA 4CHAB 1EAXA 2R9PA 4A92A 2ANKH 5F6MA 5LPRA 2ANMH 3TK9A 4FUHA 1A7SA 4X6NA 1PQ8A 1N8OC 1TYNA 1WAYB 3URCA 2CF9H 1NRNH 2BQWB 1DXWA 4IMQA 2H9EH 2VB0A 4OS1A 1NFXA 3MWIU 4NSYA 2FOMB 3LGIA 4RN6A 3E8LA 2TRMA 3BTDE 3SV2H 1MU6B 3RXJA 1DWEH 2FOCA 1O5AB 4R0IA 1W14U 1ZGVA 4X8SH 1F0UA 1GJ7B 3UWJH 4HFPB 7LPRA 3SHCH 1OYTH 2BY8X 2FTLE 3BG4C 1LKAA 2CHAC 1PQAA 2OCVB 1MQ6A 1AQ7A 3SGBE 5HMAA 1AD8H 1YPEH 2OINA 3T5FH 1HAPH 2I6QA 1O2JA 1YPJH 2WYGA 2H5DA 2ZU1A 2UUFB 3A8CA 1GI9B 2ZHDA 3TJUA 2BB4A 4IC5A 1GGDB 1UHBA 3BF6H 2SFAA 2WINI 1VZQH 2BDGA 3U1IB 2NU1E 3M7UA 1SLWB 2D1JA 3P8NA 4YT7H 1GI7B 4ISHH 2ZNKH 1L4DA 3E90B 4O3TA 4WF8A 1G3BA 4ISIH 1ZPZA 2AIQA 1C2KA 1QQUA 3FZDA 1QL7A 1YYY1 1YPKH 3M3SA 5JBBS 1IQKA 2FOHA 1DLEA 2Q6DA 2ZFSA 3AASA 3OYPA 4YLUA 3STIA 1D3QB 3LPRA 5HYOA 1MU8B 1XUJA 1ELTA 1O39A 2GT7A 2VWLA 5F8ZA 6GCHG 2SNVA 5ETXA 2C8WB 5GDSH 2BVXH 1LVMA 1TPPA 1Y3WA 2OTVA 3SW2B 2G51A 1CGIE 2TGTA 3PTBA 1ZPBA 3SJKA 1O3HA 3ITIA 3M5MA 2ZKSA 3RXIA 2ZHWH 3ZZ6A 1HAGE 3T29A 1CGHA 1F5KU 3O8DA 5IYTA 2A7HA 2AGGX 3BEFB 1UTPA 1VCWA 3E3TA 4WWYA 3SGQE 3U69H 1D6WA 1C2MA 2BM2A 4AG2A 1ETTH 2ZEBA 3B23B 2B8OH 4H42U 4D76A 1SB1H 3HATH 1E35B 4BAOB 1LKBA 3A8BA 5F8XA 2GV6A 1K2I1 1HXEH 3LJOA 1A0LA 3IWMA 4AZ2B 2XXLA 4NIYA 3M7TA 1GMDG 4Q7YA 1E38B 2OXSA 2NU2E 1EX3A 2AEIH 2ZC9H 3CP7A 1O2IA 2ZP0H 3E6PH 4IN2A 5FXLA 5FBIA 1S5SA 1S0QA 1F5RA 1EAWA 3SQEE 2P16A 2AGEX 2RA3A 4VGCC 5AHGH 1D9IA 2ZU5A 2FODA 3E1XB 2Y7XA 2ZTYA 2BD7A 3S7KB 4CHAC 1C5OH 2HOBA 1XKAC 5AFZH 1U6QA 2JETB 4ZXYH 3UQVA 1CA8B 1P2JA 1UTMA 5HM2A 2D26C 3E0PB 1IAUA 3LOXA 2FM2A 1EUFA 4CRGA 1RTFB 1AZ8A 1O2OA 2R3UA 5DO4H 1W11U 1EZSC 1FUJA 1OX1A 1MTNC 4NFFA 4Q80A 1ZMNA 3V0XA 5TCAA 2A7JA 5FPTA 3MNSA 4CRCA 4Y8YA 4X2YA 4MNYA 4X8VH 1BA8B 2ANWA 2ZO3H 5BPEA 2XCNA 3A81A 3M3VA 1ZR0A 4RSPA 3F9GA 2QY0B 4K5ZA 4DCDA 3OY6U 1KXAA 1QBNA 1SHYA 2A2XH 2EI6A 3UREA 5BRRE 1K1PA 1DSUA 1CA0C 3BEUA 4JYVH 3HPTB 1V2JT 1O5DH 4ZKSU 2O8WA 2GCHF 5C1YA 3TK5A 2ZPRA 1WQVH 2F3CE 3TJOA 5T6FA 2FX6A 3SI3H 2J9NA 5DKMA 1MUEB 1NESE 1UVOA 4X2XA 1GBJA 1O2VA 4TPYA 1YPGH 5DPAA 1ETRH 3SO3A 5DP8A 1YGCH 1FY8E 1P06A 3RXDA 2WPIS 3M35A 1V2WT 1FV9A 1MTWA 5EQQA 3SJIA 3SNAA 3T62A 1HYLA 5DP4A 2OC7A 5JB8S 1FY3A 1NZQH 4X6PA 4IS5A 1UCYK 3PV4A 4K69A 2G5NA 4YESB 3GY6A 1O5GH 4U2WA 1NTPA 4KP0A 4YLQH 2J95A 1VGCB 2W5EA 2ZQ1A 2FPZA 1GWAA 1SFIA 1CHOG 1S0RA 4GCHF 3NPSA 4MNWA 1GL0E 2BTCE 5K7RA 2ZDNA 5ESBA 4DIHH 1BB0B 4AGKA 3DD2H 1Y8TA 1QTFA 1EJNA 1GJ9B 2BYAX 2QXGA 3PO1B 1QJ6B 1GVZA 2B7DH 2ZTXA 4ABBA 3V12A 2WUBA 3VB3A 5CE1A 1W2KH 2FZZA 1GBIA 3SU3A 4FUBA 1TE0A 1UVPA 3S9AA 2BLQA 4Y8XA 1GHXH 2Z3CA 1AZZA 4KKDA 3LGYA 2ULLA 3UQOA 4GSOA 1C1VH 2FLBH 4E05H 1DT2A 2BZAA 1TPSA 3ZZ9A 1BRUP 1ELFA 2G81E 1GVLA 2A2QH 1UHBB 4H6TA 1NT1A 1SGCA 3ZZ4A 1K21H 5E0GA 5HXFA 4NIVA 4MPXA 5HM9A 1GVKB 1XM1A 3UIRA 4ISOA 2BDYA 1TA2A 3GYLB 2W3KA 1DE7H 4YOGA 2FOGA 1NFWA 1O3NA 1O5EH 2ESTE 4ZHLU 1BBRK 1CO7E 1L1JA 1KTTB 2JH0D 3TJNA 4GHQA 1Z8IB 1MBQA 1DICA 2J4IA 5EW2H 3D23A 2HWLB 3MU1A 1ESAA 1T8OA 1KLTA 1CBWB 1SC8U 3HK6B 3SV6A 3SU1A 3KIDU 1MZAA 3A84A 1O2QA 1TNKA 5T6DA 1ZYOA 2O8LA 1VITF 4X2WA 5GCHF 1BTZA 4MTBA 1IQFA 3UNQA 1Z8RA 3BTWE 4JCNA 2UUJB 1Q31A 3DUXH 1ESTA 2ZG0H 1IQNA 1ELAA 1SVPA 1EOLA 4NSVA 3FVFB 1GJBB 2FIRH 1RTLA 3EDXB 3P92A 1QBOA 1OWEA 5C67A 1GI6A 3A86A 5I25A 2WPMS 1Y3XA 3ZVGA 1LQDB 2PFEA 4IBLH 5GWZA 1C5UA 3LC5A 2C3SA 4NIXA 2ZDAH 2OC1A 4NWLA 3MYWA 1GG6B 1OXGA 4Y0ZE 1LPGB 1ANBA 1LCYA 2XW9A 3TH4H 2FMJA 2G55A 2ZFQH 3GDVA 3V13A 4AG1A 2D8WA 1TQ7B 2A7CA 1LVOA 9LPRA 3S9CA 1JRSA 2THFB 1RJXB 2GGVB 2UWOA 4UDWH 7ESTE 1P2IA 1THRH 1AUJA 1HB0B 4YOIA 1CVWH 2BOKA 3MO9A 1JIMA 3KNXA 2SGQE 3Q3KA 3PWCA 1GHZA 4Q7XA 1QQ4A 1TWXB 1P57B 4PROA 3RP2A 2P3FH 3AVZA 1LO6A 1OWIA 4CH8B 1XXDA 5A0BA 2BLWA 1O3CA 2LNCA 4SGBE 3SZNA 1GI8B 5A8YA 1HAZB 5FX5A 2RA0A 3SU2A 1O2ZA 1LHEH 3U1JB 1O2XA 1EAUA 2XCFA 4E7NA 4FU7A 2BY7X 1UTJA 2PTNA 5PTPA 3GY2A 1T8MA 1TNJA 3PMAB 3DFLA 2FP7B 3SJ8A 2PUQH 4Y10E 1O3MA 4B76A 4B2CA 1QR3E 1UK3A 2J92A 1GBFA 3P95A 4HTCH 5J4QA 4I8HA 1TNGA 3KGPA 1K1MA 4AORA 3A7WA 4QT8C 2PKSB 1W8BH 3SU0A 4O9VA 4I32A 4JZDH 4K8YA 3H5CB 4AB9A 3FAOA 1AU8A 4WMEA 3SV7A 1AI8H 1KXDA 4X1PU 1BHXF 3BTHE 3VB5A 4R8TB 1HIAB 1QL9A 1JRTA 1GBBA 1AFQB 1IQGA 4MNXA 4ISLA 4TWYA 4MPVA 1MAXA 4B74A 2VIQA 1BRAA 1O2LA 2A0QB 3GYMA 1GHWH 3A8DA 3VGCC 1GI5A 1QA0A 2XRCA 1WTGH 5I46H 1GI0A 1UTKA 2Z6BD 4AGJA 3H7OA 2GMTB 4IW4E 3RDZA 2C90B 2V3HH 3IITA 3TNSA 1P03A 4TY6A 1GI4A 1TGSZ 1QY6A 3SQHE 3K2UA 2TGPZ 2QF3A 1TX8A 3DHKH 2ZHQH 1FY1A 1PPHE 5TJXA 4K1SA 1VJAU 2ODYB 3RC6A 2ILNA 4FUIA 4GHTA 1SOTA 1WSSH 5EXNA 2AFQB 4WH6A 1QHRB 1DPOA 1VCPA 2ALPA 3G01A 1TBZH 3ODFA 3P8FA 3UFAA 1LHFH 3SU6A 5JB9S 2OP9A 3QUMP 4MDSA 3RU4D 2FDAA 3TIUA 5JBAS 4Y71A 1HGTH 2XTTB 1S84A 1TB6H 1UVSH 4MQAA 3UPEA 1IHTH 4H4FA 4B2AA 1C1TA 2GD4B 3RM0H 3SORA 1FDPA 1Y3UA 4Y11E 3RXKA 4CR5A 2KAIA 3ATWA 3MH7A 1TONA 1NFYA 4Y79A 4U32A 2G8TA 3PLBA 1TNHA 1EZXC 6CHAB 5LH8A 2Z3EA 3ZZ8A 1WCZA 4GVUA 4BNRA 1J17T 3BTFE 3Q77A 2ZZUH 1D3PB 4CRAA 3PWBA 5T6GA 1LVYA 2ZCLP 1C9PA 1GBAA 1IQEA 1GBKA 1H9IE 1T31A 1W10U 3SGAE 1ELCA 3GY4A 1CE5A 4OS6A 2ODQA 1ZTKA 2CHAB 1C2GA 1O2YA 4CREA 2ZIQH 1P04A 4JZIA 1AHTH 2Z7FE 1BTXA 1BZXE 1EB2A 1RRKA 1BIOA 1ANEA 1GDQA 3RXBA 4E7RG 3K6YA 2XBVA 3EAJA 4INKA 4CR9A 1UVUH 4YZUA 2HRVA 4OS5A 1JWTA 3RXFA 5TCCA 1ANDA 1G2LA 1SPJA 4AX9H 3EE0B 1LHGH 3EYDA 1UK4A 2ZCKP 1YCPM 1ZRKA 3BIUH 4NIWA 3PLPA 1GBHA 3ZVCA 1HAVB 2LPRA 2HGTH 2VIVA 4MPUA 5ABWA 3B8JA 1AKSA 1ACBE 1BJUA 3SNEA 4BXWA 5E0JA 3GCHC 2FXRA 2UUYA 2ZFFH 1C5VA 3M7QA 1RXPA 3NXPA 1FPCH 1ZJKA 1HJ9A 1AVXA 2VINA 2WV5A 3TLOA 4NGAH 6LPRA 4UFEH 1QRXA 2BX4A 1FI8A 2WPHS 1A46H 4FUGA 3LGWA 2SNWA 5FX6A 4X8TH 3TNTA 1IHSH 2RDLA 3SNBA 1GMCG 2JH5D 3CS7A 4DGJA 1BBRH 1VCQA 4O97A 1ID5H 3LU9B 4X1RU 1MKWK 5A8ZA 3S9BA 1NU7B 1W13U 2VIPA 2HVXA 4WMFA 1XUFA 2TIOA 4A1TA 1MMJN 1SGFA 3LH3A 4JMYA 1K22H 2BLVA 3LDXH 1BTWA 1E34B 3A88A 3S7HB 3LGUA 2FYQA 3SJOA 3CENA 2ZTZA 4XFQA 2A4RA 1GCTB 2W26A 2Z9KA 3QX5H 2H9HA 1KYNA 1HV7A 1P2NA 1S6FA 1AO5A 3QGJA 3TJVA 1H9HE 1K9OE 2EA3A 2R2WU 1C5RA 4NWKA 1C5WB 5EPYA 2J2UA 1TPOA 1FAXA 1TOCB 2B5TB 1ZMLA 2F91A 1JOUB 1YPLH 3GY8A 4KTCA 4Y7AA 1QB1A 2FLRH 4OGYA 1PPGE 1NRQH 2Y5GA 5FHTA 1EPTB 3KEEA 4MPWA 1KXCA 2PSXA 3RU4E 4FUJA 2PUXB 2GDEH 1GBTA 2GKVE 3MO6A 1ELDE 3RUOA 1UO6A 1QA7A 1XUHA 1T4UH 1EASA 1OWKA 2Q6FA 1BT7A 3A82A 7KMEH 1SGPE 1A0JA 2AS9A 3RM2H 1C4Y2 1BRCE 1NRRH 1HIAA 3GY3A 3Q00A 2ZHFH 1BMLA 3VXFH 3RXTA 1BQYA 3MOCA 2VIDA 3ENSB 1FNIA 2A4GA 5F8TA 4BAHB 1QURH 2VJ1A 5JBTA 1K1JA 3BTME 1AVWA 1TNIA 1HAHH 1UMAH 1P2MA 1SGIB 4Q2KA 1KSNA 1SBWA 1AB9B 1OP8A 3H7TA 3T25A 4X6MA 3RMNH 1RIWB 2RG3A 4ZMAH 3JZ2B 2R2MB 1TX7A 3LJJA 4ABIA 4ABGA 1HDTH 2PSYA 1MKXK 3RXAA 1JXPA 1C5XB 3RMLH 4WVPE 1HAVA 2R0LA 1GHYH 1YC0A 1NM6A 1NC6A 5C3NA 1V2OT 1YCPH 2J38A 2ZHEH 3E91A 2TPIZ 4B73A 4NG9H 1ANCA 1O35A 1Z71A 1QBVH 2VWNA 4ABDA 1HAOH 2ZQ2A 2VH0A 4LZ1H 3MH6A 3U8RH 1ZSKA 3MO3A 3MFJA 3L6PA 2NU3E 5AFYH 4ZAEA 4AFQA 1OS8A 1CQQA 1W7XH 1O32A 1QB9A 3GCTF 1HJAB 1H8DH 1D6RA 5JDUB 1RS0A 1MTUA 2WYJA 3SUEA 3SU5A 1O30A 3E0NB 3ZYEA 2BDCA 2Y82A 1KY9A 1OKXA 2FOEA 2SGAA 1O37A 1UTNA 6CHAC 4Y0YE 2O8TA 3MNBA 3U8OH 5L30H 1GMHF 2OQUA 3NCLA 4BXSA 1AE8H 1P3EA 2HNTF 2YNBA 1SR5C 1QIXB 1Q2WA 1GBEA 1Z1IA 3UR9A 4ESTE 4FU9A 1O3LA 2Y5FA 2QV1A 1RIWC 4I7YH 5DG6A 2ZDLA 3RLWH 3VXEH 1LPZB 1ETSH 1MTNB 3GDSA 2W3IA 4INHA 2QIQA 3ZVEA 1F0SA 1P8VC 2ZU2A 2DE8A 1XX9A 4A6LA 1GJDB 2OBOA 3QDZB 5JBCS 1AE5A 2H6MA 4XSKU 2VH6A 1ZOMA 2F9OA 5LPFA 1SLXB 1DDJA 3L3TA 3TGJE 1Y59T 3QZQA 2Y5HA 2EC9H 4OS4A 4KTSA 1JMOH 2Y80A 4D7FA 1P01A 1FLEE 2VNTA 4HZHA 1ZLRA 4AN7A 2C8XB 1CBWC 1ZHMA 4A5TS 1GMHG 1ELVA 2GZ9A 2BMGB 3UUZA 1E36B 1HXFH 3SNDA 4ZKOU 2TGDA 1WUNH 1T32A 1XKBC 5B6OA 1W0ZU 1D3DB 5FAHA 5GJ4B 2PGQB 2XBXA 2VIOA 4FUEA 1MH0A 5GIBA 4ZHAA 2GCHG 4D9QA 4CRDA 3SV8A 4JZFH 3FP7E 2FO9A 1GMCF 2ALVA 1G3EA 1QL8A 3SI4H 3GISB 1ESBA 1A5HA 4XOJA 1FIZA 1PYTD 2GTBA 1K1IA 3FP8E 4JZ1A 1V2QT 1P9SA 1ORFA 1L1NA 4OGXA 4WMDA 4BAMB 3KL6A 1PPFE 1Z6JH 4UFDH 1DSTA 1Y3YA 5EW1H 1P9UA 1LMWB 1PJPA 3RMOH 3TGKE 2Y6TA 1O3KA 3GY7A 5CHAC 1O3BA 5DGJA 1GHVH 1SLUB 1FIWA 1QCPA 3KN2A 5EQRA 1AFEH 3LONA 4MNVA 2ZCHP 5DP6A 1ZHRA 1O33A 1S82A 4U01A 2XNIA 1GHBF 2ZDVH 4YM9A 1O3FA 1ZJDA 5E8EH 2V6NA 4FVDA 2NU0E 1GHBG 1WTHD 5DP7A 2BOHB 1DM4B 1P2OA 5A8XA 2PR3A 3GDUA 1EJMA 3SUFA 2EI8A 4Y76A 1F5LA 1P12E 5AF9H 8ESTE 1SQTA 4THNH 5JYIA 5EU8A 4UD9H 3NWUA 2BD8A 2R3YA 2UWPA 1TBRH 3QO6A 1V2LT 4TY7A 5C5NA 3T26A 5C2ZA 1D4PB 2A4OA 2PHBA 2BVSH 3OU0A 2ZGBH 5AVDA 1C2EA 4K2YA 4F4OC 1QJ7B 2XBWA 3R0FA 1GHAF 3BSQA 5DK1A 2ZA5A 3M36A 2FOBA 1BJVA 3BTEE 4WJG2 2KAIB 3ATIA 1O2MA 1DITH 1UTLM 2O8MA 4H6SB 4ABAA 2ZECA 2PGBB 4X6OA 4AOQA 1P02A 5FCKA 3ZVBA 3LKWA 2P94A 1C1UH 2Q6GA 3P8GA 1V2PT 3T2NA 2F9BH 4XBBA 2H9TH 1TALA 1EPTA 3L33A 1O0DH 4A1XA 1O2RA 1SG8B 1A0HB 1EAIA 1ZZZA 3DFJA 4WXIA 1EP6A 2F9UA 1MBMA 1LHCH 1C1OA 2XBYA 4CH2B 1SQOA 3UWIA 1TGBA 3P6ZB 1C9TA 2ASUB 1NY22 1BRBE 2ZGJA 1ZRBA 2P95A 2JKHA 1NU9A 2BHGA 2UWLA 1C5YB 2ZU4A 3SU4A 3MNCA 1C5QA 4LOYH 3I77A 4AFZA 2A31A 3SOSA 1UK2A 2CXVA 3Q76A 3NUMA 2GZ8A 4A7IB 3SHAH 1YLDA 1GJ4H 1BMAA 1SMFE 3BTGE 1LDTT 2BD5A 1JIRA 1OWJA 2BD3A 1C5PA 2QA9E 2CJIA 1C5TA 1Z6EA 1TFXA 3EA7A 1DWBH 1A5GH 1ZGIA 5A2MH 2OUAA 2ZI2H 4TPIZ 1TX6A 5FPSA 1KXEA 3ODDA 5FBEA 4GLYA 1V2ST 1V2NT 2AMDA 2P93A 3KQEA 1SGDE 1C2FA 1V2MT 1TA6A 1O31A 3PLKA 2BD2A 3GCHB 1DUAA 3KF2A 3GY5A 2PW8H 3FFGA 4ZKRU 3MNXA 4X1QU 3A83A 2FYRA 3SNCA 4FVBA 4JYUH 1FY4A 1EOJA 1B7XB 1G3CA 4IGDA 2BQ6B 2ZGXH 4K1EA 5EXLA 1YCPK 2SGDE 4FUDA 4JK5A 3EA9A 4ISNA 1W0YH 1SLVB 4O03A 1DWDH 4YO9A 2FX4A 1MKXH 4FUCA 2FWWA 3U8TH 1ARCA 3PMHB 2PTCE 3M5OA 3ZV9A 4I8GA 2QF0A 2A5KA 2PKAA 4IC6A 1Y5BT 1Z8GA 3ZZDA 3UTUH 4FUFA 4DVAU 1O2SA 4X2VA 3LGVA 2Z3DA 4CRFA 2O9QA 1ZHPA 3Q3YA 3D65E 1O3IA 1S81A 1TGNA 5L2ZH 3ATKA 1XXFA 2BZ6H 1T8LA 5DP9A 1YF4A 3UR6A 3UNRA 1L0ZA 1BUIA 4ZUHA 2BVRH 1O2WA 2QYIA 1GJCB 3RXRA 2EEKA 7GCHG 5EOKA 1N6YA 1C2JA 2FS9A 2OD3B 1SGYE 2QGRA 1O2TA 1Z1JA 4NA7A 1PPEE 2AMQA 2VWOA 5L6NH 2G4UA 5DP3A 1ZSJA 1C1WH 3M5NA 1PPZA 4X1NU 3GCOA 2OQ5A 1KDQB 5HGGA 1THPB 4X8UH 2A5AA 3QZRA 5FPYA 2Z94A 1Q3XA 4DY7B 1C2HA 3E16B 1FMGA 1P0SH 1YPHC 2GDDA 2OC0A 1BOQA 5E2OA 1J15A 1VITG 2QCYA 3GICB 3RXLA 8LPRA 3CS0A 1BCUH 1V6DA 2J34A 2BD9A 1GGDC 4GCHG 2BY6X 1XUIA 4JZEH 1KLIH 1HJAC 5ESTE 2VVUA 3ELAH 1N1LA 3LH1A 1MTSA 1O3EA 3KQCA 3RLYH 1TOMH 1MCVA 1A3EH 2P3TB 5E0HA 2EI7A 1EKBB 4UFGH 1Y5AT 2QAAA 3M61U 3RXSA 1RFNA 1IOEA 3VPKA 2F83A 3ZVDA 3TPIZ 5A0CA 1QJ1B 3A8AA 1GI2A 2FS8A 1ELEE 5C5OA 4HI3A 2GP9B 3BG8A 3TH3H 4ABFA 3ZZAA 2H2ZA 3EA8A 2HPPH 3T28A 2VU8E 1HLTH 4D9RA 3F9FA 5LPEA
chains in the Genus database with same CATH superfamily
3EGKH 4XBCA 2FESH 2M5TA 1A2CH 1DY9A 1SGTA 4AB8A 3BIVH 3OTJE 1FXYA 4GAWA 1AMHA 1F92A 3RC5A 3ATMA 2ZFRH 3PMBB 4IMZA 1M9UA 4D7GA 1TABE 3PROA 3RXGA 2ZDKA 2HLCA 1QFKH 1W7GH 2KCOA 1AGJA 1BTHH 1QNJA 1F7ZA 1F0RA 2GT8A 1C1NA 1O3DA 2V3MA 4A1VA 5HKKD 3U9AH 2IJOB 2ODPA 3NKKA 2KZ4A 5IK2D 1SHHB 1O38A 1IQMA 4ZROA 3RXOA 2YOLA 1FPHH 2BXUH 3A7YA 4BTIB 2L74A 4OS7A 3T27A 2BDIA 4JK6A 2VVCA 1OWHA 1BTYA 2ANYA 1GBDA 1EZUC 4WY3A 5SGAE 1WV7H 1MD7A 1S6HA 2F4LA 1HAXB 3LGTA 4D8NA 5C20A 1OOKB 3TH2H 1GBCA 3PO1C 1S83A 9ESTA 2C8ZB 1V2RT 2A4QA 3FANA 3VB7A 3MI4A 1QRZA 1LTOA 1MCTA 3UNSA 3N7EA 1XUGA 1O3OA 2GX4A 1H4WA 5CHAB 3RXPA 1O3AA 3UOUA 1GI1A 1HCGA 1O3PB 1FN8A 1K1NA 4XDEA 3D62A 1K28D 1C1QA 1O3JA 3F1SB 3WY8A 4B1TA 2BX3A 3AW1A 5L2YH 4ABHA 1NFUA 3FP6E 1W12U 2QXIA 3N7OA 1G9IE 1PFXC 1TBQH 3LIWA 2FOAA 2C93B 2HVYB 4DJZB 1HUTH 3PB1E 4SGAE 1HJ8A 3GOVB 1S85A 5GPIB 1ELBA 2BDAA 4X1SU 1P05A 2HLDD 1EP5A 1KMHB 3SBKA 3ZZBA 3ZYDA 2OC8A 4F55A 2Y81A 1P10A 1YP9A 3AW0A 2ZPQA 1F0TA 2P8OB 4J1YA 1BMMH 2HPQH 2RCEA 4B75A 2KR7A 2F9NA 1FY5A 1OPHB 1C2DA 1YM0A 1H8IH 1GBLA 3QTVH 4RI0A 3I29A 4HGCA 3PM3A 1SGFG 2AIPA 1OWDA 5EPNA 4ACAA 5FL7D 1EB1H 2GCTC 2Q1JA 1IQJA 1C5LH 1GG6C 2BQ7B 3PV2A 5EG4A 3ZZ5A 1G2MA 1KIGH 1XUKA 1DOJA 3TGIE 1A3BH 1J14A 3OY5U 3K6ZA 4Z1MD 2BDHA 1KTSB 3QLPH 1A61H 1O2GH 5LGOA 1O3GA 4KTUA 1FJSA 1YPMH 3MTYA 3FKSD 4BAQB 1DY8A 1QGFA 3A7ZA 1K1OA 2C4FH 2H5CA 3OX7U 1V3XA 1J8AA 1UCYH 5C1UA 1MKWH 2SGPE 2SGEE 1G30B 5DP5A 3B9FH 1O2PA 3RMMH 2WPDD 2STBE 5EQSA 1DX5M 1P2QA 1B0EA 1V2TT 2CMYA 4J2YB 3SJ9A 1F2SE 2A5IA 4YOJA 1MAYA 2XWBI 1AWFH 1UTOA 5J4SA 1KLJH 4MG3A 4BAKB 1FZZA 1PYTC 1L4ZA 3HKJB 4NA9H 4TWWA 1BBRE 1IQIA 1T4VH 1OSSA 2WPKS 3A89A 1V2VT 1O5BB 2ZFTA 1C1SA 1QRWA 2ZPSA 3F9EA 2WPJS 3NK8A 2XWAA 4BTTB 3RXVA 4I8LA 1PQ7A 2NWNA 1RTKA 4U30A 1TNLA 4ZHMU 2P59A 1HFDA 2D2DA 2GMTC 3UY9A 1SGQE 3VEQB 3KHVA 1GI3A 1NS3A 2I6SA 1P2KA 2STAE 4F49A 2GCTB 2PWXA 1DVAH 1GHAG 1HRTH 4Y6DA 4IN1A 3DA9B 1O2KA 1RGQA 2NU4E 1YBWA 1V2KT 4JYTA 3VB4A 4DG4A 3V7TA 4VGCB 3SYJA 1CA0B 1C4V2 1OP0A 1HNEE 5GXPA 2G4TA 1CGJE 4BTUB 1C1MA 1ZTLA 3QGNB 2IPHA 4YXWD 1O2UA 1NPMA 4E06H 3U98H 2V35A 3K9XB 3LT3A 3QK1A 1CHGA 2F43B 2C8YB 3GCNA 1VITH 1GPZA 1TAWA 4NFEA 4O3UA 1A4WH 5F03A 2QC2A 3PMJA 2JH6D 2QXJA 1SOZA 3AAUA 4NZQA 1TRMA 1C1RA 1UVTH 1KXBA 2PKAB 2BY5X 2Z9LA 3GS9A 4I31A 1MABB 3C1KA 4Y7BA 2PV9B 3GCTG 2SGFE 4UONA 2IOTA 3PYHA 1AB9C 3Q3XA 3SV9A 4I33A 1DLKB 1HBTH 4OS2A 1NO9H 1O2HA 3STJA 2XC4A 3A87A 2JETC 1CU1A 4DOQA 1DWCH 5EJZA 4Y8ZA 4NCYA 1WU1A 2ZDMA 1EATA 3P17H 1INCA 4LXBH 3IG6B 3BN9A 4Z0KA 1GMDF 4DIIH 4KGAA 3C27B 1W3CA 1H9LB 1KDQA 4AFUA 2BLOA 3NZIA 1Y5UT 1C5NH 3W95A 3O8BA 1HPGA 5EGMA 3A7TA 2AERH 5C1XA 3HK3B 2VVVA 4UFFH 3TU7H 2QF5A 1THSH 1G3DA 2FTMA 1P3CA 1TMBH 8GCHG 1FN6A 1TLDA 5GCHG 4ASHA 4NZLA 2F9VA 5EXMA 2W7UA 4ABJA 3URDA 4AYYB 2AMPA 5K0HA 2AGIX 1N6XA 1SGNE 1BMNH 3EQ0H 1Z7KA 2G00A 2CF8H 1NN6A 4AYVB 2P3UB 1AN1E 4YTAA 5DSFA 4ABEA 4INLA 1Z8JB 5KEDA 2BDBA 1WOFA 4ZKNU 1J16A 3OSYA 2QXHA 1H1BA 1T7CA 4M7GA 1TRYA 3BTQE 4TYDA 5A0AE 1TPAE 3D49H 1LPKB 3QTOH 3R3GB 4K8BA 1TQ0B 2WPLS 2F9PA 1VGCC 1WBGB 1BTUA 2B0FA 2KCYA 3ESTA 3M5LA 3MU8A 4X0WU 1TMUH 1XVMA 2J94A 3MHWU 1C2LA 5DJ7A 1TGCA 1C4U2 1A1RA 3KQBA 2JJ2D 2JIZD 6GCHF 2LP6A 3SUGA 3S69A 4CBOA 3F9HA 1B5GH 1A5IA 2V0BA 3FZZA 1DANH 1NRPH 5IDKA 2YNAA 3SN8A 2R0KA 3ZZ7A 1GBMA 3DT0H 1BDAA 5CMXH 4MVNA 3JZ1B 3BG4B 3MU5A 3MQKC 1E37B 2GV7A 4DT7B 2TBSA 3AK5A 1CHOF 2KFWA 4YT6H 1DUEA 3M37A 2G5VA 3A80A 2CV3A 2VGCB 1VR1H 4K3JA 5E2PA 3ATLA 4B2BA 2XC0A 3BV9B 4RKOB 1FQ3A 1FONA 3P70B 1CT4E 1YKTA 1T8NA 1RD3B 4I8JA 5FCRA 3RXUA 4AC9A 1GCDA 2Z9JA 5H4IB 4WH8A 1DFPA 2LELA 2UUKB 1BITA 2DE9A 4CRBA 1DXPA 1N8OB 2OBQA 3W1EA 3W94A 1V2UT 8KME2 1WYKA 2VBCA 1K1LA 1SGRE 4FXGH 1SFQB 2HNTC 3F68H 5JPMH 3A7XA 1LVBA 3DSGA 3ZV8A 2IN2A 1X7AC 4GUXA 1SL3A 1JBUH 1GJ8B 1GDNA 3KYFA 1XVOA 2Y7ZA 1C5SA 3UOPA 2VGCC 5HIYA 2AYWA 4M9FA 3M3TA 4UEHH 2FI4E 3HGPA 2Z9IA 3RXCA 1ARBA 3BTTE 3BTKE 3RXMA 4DURA 4Z6AH 4AFSA 1FAKH 4ZH8A 1J9CH 3HGNA 3O8RA 3MH5A 5T3HA 1P09A 1MQ5A 4XE4A 3MH4A 3S0NA 2A32A 1O5CB 3VFEA 2HALA 3KQDA 1D3TB 3A85A 2ZFPH 1ZTJA 1MD8A 2HNTE 2VWMA 2FOFA 2A45B 1LQEA 2WV4A 1SGEE 5G4BA 1TMTH 3VB6A 1TGTA 1UJ1A 2P8OC 1CSOE 2CN0H 3F0OA 3ZVAA 3ZZ3A 1ABJH 4GPGA 3KCGH 2ZWLH 1UCYE 4RKJB 1B0FA 2ZF0H 1EQ9A 3F6UH 3FO8D 1TRNA 1YLCA 1G36A 3ZVFA 1ZMJA 1GDUA 3DCLA 3RXHA 4K60A 1GJ5H 1AVGH 3MMGA 4DW2U 2G52A 1XMNB 6ESTA 1E0FD 3TVJB 2OK5A 1ABIH 2XNDD 1HAYB 1LHDH 1KXFA 1BTPA 3TK6A 1TIOA 4BOHA 1IQLA 1PQ5A 2QN5T 1YWUA 3RXQA 1PPBH 1Y3VA 4Q7ZA 3P8OA 3SUDA 1AWHB 5EODA 3BEIB 4CBNA 2TGAA 3PTNA 1O5FH 1O2NA 1ELGA 5A09A 3RC4A 1SSXA 1AIXH 3MU0A 1SQAA 2FI3E 1ZSLA 3RXEA 1CT2E 4B71A 2BY9X 1OYQA 4FU8A 3MU4A 1WQSA 4I8KA 3A7VA 2ZGHA 1EZQA 1MTVA 4KELA 1O36A 1G37A 1AUTC 3F2FA 7GCHF 1NRSH 1C1PA 2FEQH 1NROH 2VIWA 2CGAA 1QB6A 3LC3A 3V3MA 4BANB 2EQNA 4XBDA 1GL1A 1AY6H 1EXFA 1L2EA 2B9LA 4K1TA 3TITA 3QN7A 2GVFA 2XYAA 4UE7H 1PPCE 1EJAA 8GCHF 3VGCB 2PLXA 4ZXXH 3AAVA 4RT0A 4WXVA 3HKIB 2Z9GA 2AH4X 3ZZCA 1HAIH 1AFQC 2H1UA 2OLGA 3RU4T 2XC5A 2PKSC 2ZGCA 1SI5H 1C2IA 3OAAD 3K65B 1IQHA 1O34A 1OP2A 1EPTC 4LK4A 3I78A 1GJAB 3O8CA 2K1QA 1UTQA 2BD4A 4TSFD 4MLFB 1GJ6A 1P11E 2BXTH 2V3OH 1VJ9U 1ZPCA 1C5MD 3QWCH 5EIYA 2DUCA 1GCTC 2WUCA 2A1DB 2O8UA 3PRBA 4TT3D 5C94A 2FI5E 3OEHD 1AKSB 1BHXB 4LZ4B 1G32B 1L1GA 1MZDA 1C5ZB 2GZ7A 1YPHE 1CT0E 4NA8A 2ZU3A 2AHME 1DS2E 2W7SA 4CHAB 1EAXA 2R9PA 4A92A 2ANKH 5F6MA 5LPRA 2ANMH 3TK9A 4FUHA 1A7SA 4X6NA 1PQ8A 1N8OC 1TYNA 1WAYB 3URCA 2CF9H 1NRNH 2BQWB 1DXWA 4IMQA 2H9EH 2VB0A 4OS1A 1NFXA 3MWIU 4NSYA 2FOMB 3LGIA 4RN6A 3E8LA 2TRMA 3BTDE 3SV2H 1MU6B 3RXJA 2CK3D 1DWEH 2FOCA 2KCAA 1O5AB 4R0IA 1W14U 1ZGVA 4X8SH 1F0UA 1GJ7B 3UWJH 4HFPB 7LPRA 3SHCH 2XOKD 1OYTH 2BY8X 2FTLE 3BG4C 1LKAA 2CHAC 1PQAA 2OCVB 1MQ6A 1AQ7A 3SGBE 5HMAA 1AD8H 2GJGA 1YPEH 2OINA 3T5FH 1HAPH 2I6QA 1O2JA 1YPJH 2WYGA 2H5DA 2ZU1A 3KYGA 2UUFB 3A8CA 1GI9B 2ZHDA 3TJUA 2BB4A 4IC5A 1GGDB 1UHBA 3BF6H 2SFAA 2WINI 1VZQH 2BDGA 3U1IB 2NU1E 3M7UA 1SLWB 2D1JA 3P8NA 4YT7H 1GI7B 4ISHH 2ZNKH 1L4DA 3E90B 4O3TA 4WF8A 1G3BA 4ISIH 1ZPZA 2AIQA 1C2KA 1QQUA 2KM0A 3FZDA 1QL7A 1YYY1 1WXRA 1YPKH 3M3SA 5JBBS 1IQKA 2FOHA 4Q63A 1DLEA 2Q6DA 2ZFSA 1E1QD 3AASA 3OYPA 4YLUA 3STIA 1D3QB 2J5UA 3LPRA 5HYOA 1MU8B 1XUJA 1ELTA 1O39A 2GT7A 2VWLA 5F8ZA 6GCHG 2SNVA 5ETXA 2C8WB 5GDSH 2M2AA 2BVXH 1LVMA 1TPPA 1Y3WA 2OTVA 3SW2B 2G51A 1CGIE 2TGTA 3PTBA 2QF4A 1ZPBA 3SJKA 1O3HA 3ITIA 3M5MA 2ZKSA 1BMFD 3RXIA 2ZHWH 3ZZ6A 1HAGE 3T29A 1CGHA 1F5KU 3O8DA 5IYTA 2A7HA 2AGGX 3BEFB 1FX0B 1UTPA 1VCWA 3E3TA 4WWYA 3SGQE 3U69H 1D6WA 1C2MA 2BM2A 4AG2A 1ETTH 2ZEBA 3B23B 2B8OH 4H42U 4D76A 1SB1H 3HATH 1E35B 4BAOB 1LKBA 2PP6A 3A8BA 5F8XA 2GV6A 1K2I1 1HXEH 3LJOA 1A0LA 3IWMA 4AZ2B 2XXLA 4NIYA 3M7TA 1GMDG 4Q7YA 1E38B 2OXSA 2NU2E 1EX3A 2AEIH 2ZC9H 3CP7A 1O2IA 2ZP0H 3E6PH 4IN2A 5FXLA 5FBIA 1S5SA 1S0QA 1F5RA 2RDEA 1EAWA 3SQEE 2P16A 2AGEX 2RA3A 4VGCC 5AHGH 5EJ1A 1D9IA 2ZU5A 4ACBA 2FODA 3E1XB 2Y7XA 2ZTYA 2BD7A 3S7KB 4CHAC 4HG6A 1C5OH 4XD7D 2HOBA 1XKAC 5AFZH 1U6QA 2JETB 4ZXYH 3UQVA 1CA8B 1P2JA 1UTMA 5HM2A 2D26C 3E0PB 1IAUA 3LOXA 2FM2A 1EUFA 4CRGA 1RTFB 1AZ8A 1O2OA 2R3UA 5DO4H 1W11U 1EZSC 1FUJA 1OX1A 1MTNC 4NFFA 4Q80A 1ZMNA 3V0XA 5TCAA 5B6LA 2A7JA 5FPTA 3MNSA 4CRCA 4Y8YA 4X2YA 4MNYA 4X8VH 1BA8B 2ANWA 2ZO3H 5BPEA 2XCNA 3A81A 3M3VA 1ZR0A 4RSPA 3F9GA 1COWD 2QY0B 4K5ZA 4DCDA 3OY6U 1KXAA 1QBNA 1SHYA 2A2XH 2EI6A 3UREA 5BRRE 1K1PA 4XRNA 1DSUA 1CA0C 3BEUA 4JYVH 3HPTB 1V2JT 1O5DH 2WSSD 2O8WA 4ZKSU 1K0HA 2GCHF 5C1YA 3TK5A 2ZPRA 1WQVH 2F3CE 3TJOA 5T6FA 2FX6A 3SI3H 2J9NA 5DKMA 1MUEB 1NESE 1UVOA 4X2XA 1GBJA 1NBME 1O2VA 3H09A 4TPYA 1YPGH 5DPAA 1ETRH 3SO3A 3ZIAD 2J98B 1YGCH 5DP8A 1FY8E 1P06A 3RXDA 2WPIS 3M35A 1V2WT 1FV9A 1MTWA 5EQQA 3SJIA 3SNAA 3T62A 1HYLA 5DP4A 2OC7A 5JB8S 1FY3A 1NZQH 4X6PA 4IS5A 1UCYK 3PV4A 4K69A 2G5NA 4YESB 3GY6A 1O5GH 4U2WA 1NTPA 4KP0A 4YLQH 2J95A 1VGCB 2W5EA 2ZQ1A 2FPZA 1GWAA 3KQ5A 1SFIA 1CHOG 1S0RA 4GCHF 3NPSA 4MNWA 1GL0E 2BTCE 5K7RA 2ZDNA 5ESBA 4DIHH 1BB0B 4AGKA 3DD2H 1Y8TA 1QTFA 1EJNA 1GJ9B 2BYAX 2QXGA 3PO1B 1QJ6B 1GVZA 2B7DH 2ZTXA 4ABBA 3V12A 2WUBA 3VB3A 5CE1A 1W2KH 2FZZA 4F48B 1GBIA 3SU3A 4FUBA 1TE0A 1UVPA 3S9AA 2BLQA 4Y8XA 1GHXH 2Z3CA 1AZZA 4KKDA 3LGYA 2ULLA 3UQOA 4GSOA 1C1VH 2FLBH 4E05H 1DT2A 2BZAA 1TPSA 3ZZ9A 1BRUP 1ELFA 2G81E 1GVLA 2A2QH 1UHBB 3F2GA 4H6TA 1NT1A 1SGCA 3ZZ4A 1K21H 5E0GA 5HXFA 4NIVA 4MPXA 5HM9A 1GVKB 1XM1A 3UIRA 4ISOA 2BDYA 1TA2A 3GYLB 2W3KA 1DE7H 4YOGA 2FOGA 1NFWA 1O3NA 1O5EH 2ESTE 4RT1A 4ZHLU 1BBRK 1CO7E 1L1JA 1KTTB 2JH0D 3TJNA 4GHQA 1Z8IB 1MBQA 1DICA 2J4IA 5EW2H 3D23A 2HWLB 3MU1A 1ESAA 1T8OA 1KLTA 1CBWB 1SC8U 3HK6B 3SV6A 3SU1A 3KIDU 1MZAA 3A84A 1O2QA 1TNKA 5T6DA 1ZYOA 2O8LA 1VITF 4X2WA 5GCHF 1BTZA 2KCPA 4MTBA 1IQFA 3UNQA 1Z8RA 3BTWE 4JCNA 2UUJB 1Q31A 3DUXH 1ESTA 2ZG0H 1IQNA 1ELAA 1SVPA 1EOLA 4NSVA 3FVFB 1GJBB 2FIRH 1RTLA 3EDXB 3P92A 1QBOA 1OWEA 5C67A 1GI6A 3A86A 5I25A 2WPMS 1Y3XA 3ZVGA 1LQDB 2PFEA 4IBLH 5GWZA 1C5UA 3LC5A 2C3SA 4NIXA 2ZDAH 2OC1A 4NWLA 3MYWA 1GG6B 1OXGA 4Y0ZE 1LPGB 1ANBA 1LCYA 2XW9A 5KECA 3TH4H 2FMJA 2G55A 2ZFQH 3GDVA 3V13A 4AG1A 2D8WA 1TQ7B 2A7CA 1LVOA 9LPRA 3S9CA 1JRSA 2THFB 1RJXB 2GGVB 2UWOA 4UDWH 7ESTE 1P2IA 1THRH 3U28C 1AUJA 1HB0B 4YOIA 1CVWH 2BOKA 3MO9A 1JIMA 3KNXA 2SGQE 3Q3KA 3NRLA 4FOUC 3PWCA 1GHZA 4Q7XA 1QQ4A 1TWXB 1P57B 4PROA 3RP2A 2P3FH 3AVZA 1LO6A 1OWIA 4CH8B 1XXDA 5A0BA 2BLWA 1O3CA 2LNCA 4SGBE 3SZNA 1GI8B 5A8YA 1HAZB 5FX5A 2RA0A 3SU2A 1O2ZA 1LHEH 3U1JB 1O2XA 1EAUA 2XCFA 4E7NA 4FU7A 2BY7X 1UTJA 2PTNA 5PTPA 3GY2A 1T8MA 1TNJA 1H8HD 3PMAB 3DFLA 3EE7A 2FP7B 3SJ8A 2PUQH 4Y10E 1O3MA 3OTPA 4B76A 4B2CA 1W0KD 1QR3E 1UK3A 2J92A 1GBFA 3P95A 2QE7D 4HTCH 5J4QA 4I8HA 1TNGA 3KGPA 1K1MA 4AORA 3A7WA 4QT8C 2PKSB 1W8BH 4I86A 3SU0A 4O9VA 4I32A 4JZDH 4K8YA 3H5CB 4AB9A 3FAOA 1AU8A 4WMEA 3FOAA 3SV7A 1AI8H 1KXDA 4X1PU 1BHXF 2WHXA 3BTHE 3VB5A 4R8TB 1HIAB 1QL9A 1JRTA 1GBBA 4P00A 1AFQB 1IQGA 4MNXA 4ISLA 4TWYA 4MPVA 1MAXA 4B74A 2VIQA 1BRAA 1O2LA 2A0QB 3GYMA 1GHWH 3A8DA 3VGCC 1GI5A 1QA0A 2XRCA 1WTGH 5I46H 1GI0A 1UTKA 2Z6BD 4AGJA 3H7OA 2GMTB 4IW4E 3RDZA 2C90B 2V3HH 3IITA 3TNSA 1P03A 4TY6A 1GI4A 1TGSZ 1QY6A 3SQHE 3K2UA 2TGPZ 2QF3A 1TX8A 3DHKH 2ZHQH 1FY1A 1PPHE 5TJXA 4K1SA 1VJAU 2ODYB 3RC6A 2ILNA 4FUIA 4GHTA 1SOTA 2W6ID 1WSSH 3N7DA 5EXNA 2AFQB 4WH6A 1QHRB 5C0UA 1DPOA 1VCPA 2ALPA 3G01A 1TBZH 3ODFA 3P8FA 3UFAA 1LHFH 3SU6A 5T1VA 5JB9S 2OP9A 3QUMP 4MDSA 3RU4D 2FDAA 3TIUA 5JBAS 4Y71A 1HGTH 2XTTB 1S84A 1TB6H 1UVSH 4MQAA 3UPEA 1IHTH 4H4FA 4B2AA 1C1TA 2GD4B 3RM0H 3SORA 1FDPA 1Y3UA 4Y11E 3RXKA 4CR5A 2KAIA 3ATWA 3MH7A 1TONA 1NFYA 4Y79A 4U32A 2G8TA 3PLBA 1TNHA 1EZXC 6CHAB 5LH8A 2Z3EA 3ZZ8A 1WCZA 4GVUA 4BNRA 1J17T 3BTFE 3Q77A 2ZZUH 1D3PB 4CRAA 3PWBA 5T6GA 1LVYA 1SKYE 1E1RD 2RFKC 2ZCLP 1C9PA 1GBAA 1IQEA 1GBKA 1H9IE 1T31A 1W10U 3SGAE 1ELCA 3GY4A 4DT4A 1CE5A 4OS6A 2ODQA 1ZTKA 2CHAB 1C2GA 1O2YA 4CREA 2ZIQH 1P04A 5DN6D 4JZIA 1AHTH 2Z7FE 1BTXA 1BZXE 1EB2A 1RRKA 1BIOA 1ANEA 1GDQA 3RXBA 4E7RG 3K6YA 2XBVA 3EAJA 4INKA 3UB0A 4CR9A 1UVUH 4YZUA 5CHBA 2HRVA 2V7QD 4OS5A 1JWTA 3RXFA 5TCCA 1ANDA 1G2LA 1SPJA 4AX9H 3EE0B 1LHGH 3EYDA 1UK4A 2ZCKP 1YCPM 1ZRKA 3BIUH 4NIWA 3PLPA 1GBHA 3ZVCA 1HAVB 2LPRA 2HGTH 2VIVA 4MPUA 5ABWA 2IJD1 3B8JA 1AKSA 1ACBE 1BJUA 3SNEA 4BXWA 5E0JA 3GCHC 2JJ1D 2FXRA 2UUYA 2ZFFH 1C5VA 3M7QA 1RXPA 3NXPA 1FPCH 1ZJKA 1HJ9A 1AVXA 2VINA 2WV5A 3TLOA 4NGAH 6LPRA 4UFEH 1QRXA 2BX4A 1FI8A 2WPHS 1A46H 4FUGA 3LGWA 2SNWA 5FX6A 4X8TH 1YY3A 3TNTA 1IHSH 2RDLA 3SNBA 1GMCG 2JH5D 3CS7A 4DGJA 1BBRH 1VCQA 4O97A 1ID5H 3LU9B 4X1RU 1MKWK 5A8ZA 3S9BA 1NU7B 1W13U 2VIPA 2HVXA 4WMFA 1XUFA 2TIOA 4A1TA 1MMJN 1SGFA 3LH3A 4JMYA 1K22H 2BLVA 3LDXH 1BTWA 1E34B 3A88A 3S7HB 3LGUA 2FYQA 3SJOA 3CENA 2ZTZA 4XFQA 2A4RA 1GCTB 2W26A 2Z9KA 3QX5H 2H9HA 1KYNA 1HV7A 1P2NA 1S6FA 1AO5A 3QGJA 3TJVA 1H9HE 1K9OE 2EA3A 2R2WU 1C5RA 4NWKA 1C5WB 5EPYA 2J2UA 1TPOA 4B6FA 1FAXA 1TOCB 2B5TB 2YMSD 1ZMLA 2F91A 1JOUB 1YPLH 3GY8A 4KTCA 4Y7AA 1QB1A 2FLRH 4OGYA 1PPGE 1NRQH 2Y5GA 5FHTA 1EPTB 3KEEA 4MPWA 1KXCA 2PSXA 3RU4E 4FUJA 2PUXB 1E79D 2GDEH 2GKVE 1GBTA 3MO6A 1ELDE 3RUOA 1UO6A 1QA7A 1XUHA 1T4UH 2Q6FA 1EASA 1OWKA 1BT7A 3A82A 7KMEH 1SGPE 1A0JA 2AS9A 3RM2H 2JDID 1C4Y2 1BRCE 1NRRH 1HIAA 3GY3A 1NBMD 3Q00A 2ZHFH 1BMLA 3VXFH 3RXTA 1BQYA 3MOCA 2VIDA 3ENSB 1FNIA 2A4GA 5F8TA 1EFRD 4BAHB 1QURH 2VJ1A 5JBTA 1K1JA 3BTME 1AVWA 1TNIA 1HAHH 1UMAH 1P2MA 1SGIB 4Q2KA 1KSNA 5HIZA 1SBWA 1AB9B 1OP8A 3H7TA 3T25A 4X6MA 3RMNH 1RIWB 2RG3A 4ZMAH 3JZ2B 2R2MB 1TX7A 3LJJA 4ABIA 4ABGA 5F53A 1HDTH 2PSYA 1MKXK 3RXAA 1JXPA 4OM9A 1C5XB 3RMLH 4WVPE 1HAVA 2R0LA 1GHYH 1YC0A 1NM6A 1NC6A 1VKYA 3VG8A 5C3NA 1V2OT 1YCPH 2J38A 2ZHEH 3E91A 2TPIZ 3PRDA 4B73A 4NG9H 1ANCA 1O35A 1Z71A 1QBVH 2VWNA 4ABDA 1HAOH 2J98A 2ZQ2A 2IPQX 1QZ8A 2VH0A 4LZ1H 3MH6A 3U8RH 1ZSKA 3MO3A 3MFJA 3L6PA 2NU3E 5AFYH 4ZAEA 4AFQA 1OS8A 1CQQA 1W7XH 1O32A 1QB9A 3GCTF 2J97A 1HJAB 1H8DH 1D6RA 5JDUB 1RS0A 1MTUA 2WYJA 3SUEA 3SU5A 1O30A 3E0NB 3ZYEA 2BDCA 2Y82A 1KY9A 1OKXA 2FOEA 3F2HA 2SGAA 1O37A 1UTNA 6CHAC 4Y0YE 2O8TA 3MNBA 3U8OH 5L30H 2EY4C 1GMHF 2OQUA 3NCLA 2L6OA 4BXSA 1AE8H 1P3EA 2HNTF 2YNBA 1SR5C 1QIXB 1Q2WA 1GBEA 1Z1IA 3UR9A 4ESTE 4FU9A 1O3LA 2Y5FA 4FETA 2QV1A 1RIWC 4I7YH 5DG6A 2ZDLA 3RLWH 3VXEH 1LPZB 1ETSH 1MTNB 3GDSA 2W3IA 4INHA 2QIQA 3ZVEA 1F0SA 1P8VC 2ZU2A 2DE8A 1XX9A 4Q4LA 4A6LA 1GJDB 2OBOA 3QDZB 5JBCS 1AE5A 2H6MA 4XSKU 2VH6A 1ZOMA 2F9OA 5LPFA 1SLXB 1DDJA 3L3TA 3TGJE 1Y59T 3QZQA 2Y5HA 2EC9H 4OS4A 1UW7A 4KTSA 1JMOH 2Y80A 4D7FA 1P01A 1FLEE 2VNTA 4HZHA 1ZLRA 4AN7A 2C8XB 1CBWC 1ZHMA 4A5TS 1GMHG 1ELVA 2GZ9A 2BMGB 3UUZA 1E36B 1HXFH 1SQRA 3SNDA 4ZKOU 2TGDA 1WUNH 1T32A 1XKBC 5B6OA 1W0ZU 1D3DB 3N99A 5FAHA 5GJ4B 2PGQB 2XBXA 2VIOA 4FUEA 1MH0A 5GIBA 4ZHAA 2GCHG 4D9QA 4CRDA 1OHHD 3SV8A 4JZFH 3FP7E 2FO9A 1GMCF 2ALVA 1G3EA 1QL8A 1H8ED 3SI4H 3GISB 1ESBA 1A5HA 3SZEA 4XOJA 1FIZA 1PYTD 2GTBA 1K1IA 3FP8E 4JZ1A 1V2QT 1P9SA 1ORFA 1L1NA 4OGXA 4WMDA 4BAMB 3KL6A 1PPFE 1Z6JH 4UFDH 1DSTA 1Y3YA 5EW1H 1P9UA 1LMWB 1PJPA 3RMOH 3TGKE 2Y6TA 1O3KA 3GY7A 5CHAC 1O3BA 5DGJA 1GHVH 1SLUB 1FIWA 1QCPA 3KN2A 5EQRA 1AFEH 3LONA 4MNVA 2ZCHP 5DP6A 1ZHRA 1O33A 1S82A 4U01A 2XNIA 1GHBF 2ZDVH 4YM9A 1O3FA 1ZJDA 5E8EH 2KX4A 2V6NA 4FVDA 2NU0E 1GHBG 1WTHD 5DP7A 2BOHB 1DM4B 1P2OA 5A8XA 2PR3A 3GDUA 1EJMA 3SUFA 2EI8A 4Y76A 1F5LA 1P12E 5GNDA 5AF9H 8ESTE 1SQTA 4THNH 5JYIA 5EU8A 4UD9H 3NWUA 2BD8A 2R3YA 2UWPA 1TBRH 3QO6A 1V2LT 4TY7A 5C5NA 3T26A 5C2ZA 1D4PB 4P02A 2A4OA 2PHBA 2BVSH 3OU0A 2ZGBH 5AVDA 1C2EA 4K2YA 4F4OC 1QJ7B 2XBWA 3R0FA 1GHAF 3BSQA 2WV9A 5DK1A 4ASUD 2ZA5A 3M36A 2FOBA 1BJVA 3BTEE 4WJG2 2KAIB 3ATIA 1O2MA 5CDFE 1DITH 1UTLM 2O8MA 4H6SB 4ABAA 2ZECA 2PGBB 4X6OA 4AOQA 1P02A 5FCKA 3ZVBA 3LKWA 2P94A 1C1UH 2Q6GA 3P8GA 1V2PT 3T2NA 2F9BH 4XBBA 2H9TH 1TALA 3WWBA 1EPTA 3L33A 1O0DH 4A1XA 1O2RA 1SG8B 1A0HB 1EAIA 3FN8A 1ZZZA 3DFJA 4WXIA 1EP6A 2F9UA 1MBMA 1LHCH 1C1OA 2XBYA 4CH2B 1SQOA 1S6LA 3UWIA 1TGBA 3P6ZB 1C9TA 2ASUB 1NY22 1BRBE 2ZGJA 1ZRBA 3OFND 2P95A 2JKHA 3F0PA 1NU9A 2BHGA 2UWLA 1C5YB 2ZU4A 3SU4A 3MNCA 1C5QA 4LOYH 3I77A 4AFZA 2YMSC 2A31A 3SOSA 1UK2A 2CXVA 3Q76A 3NUMA 2GZ8A 4A7IB 3SHAH 1YLDA 1GJ4H 1BMAA 1SMFE 3BTGE 1LDTT 2BD5A 1JIRA 1OWJA 2BD3A 1C5PA 2QA9E 2CJIA 1C5TA 3WW7A 2K8IA 1Z6EA 1TFXA 3EA7A 5KGOA 1DWBH 1A5GH 1ZGIA 5A2MH 2OUAA 2ZI2H 4TPIZ 1TX6A 5FPSA 1KXEA 3ODDA 5FBEA 4GLYA 1V2ST 1V2NT 4ZCNA 2AMDA 2P93A 3KQEA 1SGDE 3CNRA 1C2FA 1V2MT 1TA6A 1O31A 3PLKA 2BD2A 3GCHB 1DUAA 3KF2A 3GY5A 2PW8H 3FFGA 4ZKRU 3MNXA 4X1QU 2W6JD 3A83A 2FYRA 3SNCA 4FVBA 4JYUH 1FY4A 3DSPA 1EOJA 1B7XB 1G3CA 4IGDA 2BQ6B 2ZGXH 4K1EA 2K0QA 5C17A 5EXLA 1YCPK 2SGDE 4FUDA 4JK5A 3EA9A 4ISNA 1W0YH 1SLVB 4O03A 1DWDH 4YO9A 2FX4A 1MKXH 4FUCA 2FWWA 3U8TH 1ARCA 3DSOA 3PMHB 2PTCE 3M5OA 3ZV9A 4I8GA 2QF0A 2A5KA 2PKAA 4IC6A 1Y5BT 1Z8GA 3ZZDA 3UTUH 4FUFA 4DVAU 3OE7D 1O2SA 4X2VA 3LGVA 2Z3DA 4CRFA 2O9QA 4B6EA 1ZHPA 3Q3YA 3D65E 1O3IA 1S81A 1TGNA 5L2ZH 3ATKA 1XXFA 2BZ6H 1T8LA 5DP9A 1YF4A 3UR6A 3UNRA 1L0ZA 1BUIA 1YLNA 4ZUHA 2BVRH 1O2WA 2QYIA 1GJCB 3RXRA 2EEKA 7GCHG 5EOKA 1N6YA 1C2JA 2FS9A 2OD3B 1SGYE 2QGRA 1O2TA 1Z1JA 4NA7A 1PPEE 5C0TA 2AMQA 2VWOA 5L6NH 2G4UA 5DP3A 1ZSJA 1C1WH 3M5NA 1PPZA 4X1NU 3GCOA 2OQ5A 1KDQB 5HGGA 1THPB 4X8UH 2A5AA 3QZRA 5FPYA 2Z94A 1Q3XA 4DY7B 1C2HA 3E16B 1FMGA 1P0SH 1YPHC 2GDDA 2OC0A 1BOQA 2YMSB 5E2OA 1J15A 1VITG 2QCYA 3GICB 3RXLA 8LPRA 3CS0A 1BCUH 1V6DA 2J34A 2BD9A 1GGDC 4GCHG 2BY6X 1XUIA 4JZEH 1KLIH 1HJAC 5ESTE 2VVUA 3F3BA 3ELAH 1N1LA 3LH1A 1MTSA 1O3EA 1WDIA 3KQCA 3RLYH 1TOMH 1MCVA 1W0JD 1A3EH 2P3TB 5E0HA 5EJLA 2EI7A 1EKBB 4UFGH 1Y5AT 2QAAA 3OEED 3M61U 3RXSA 1RFNA 1IOEA 3VPKA 2WZQA 2F83A 3PV5A 3ZVDA 3TPIZ 5A0CA 1QJ1B 3A8AA 3WWFA 1GI2A 2FS8A 1ELEE 5C5OA 4HI3A 2GP9B 3BG8A 3TH3H 4ABFA 3ZZAA 2H2ZA 3EA8A 2HPPH 3UAIC 3T28A 2VU8E 1HLTH 4D9RA 3F9FA 5LPEA
chains in the Genus database with same CATH topology
3EGKH 4XBCA 2FESH 2M5TA 1A2CH 1DY9A 1SGTA 4AB8A 3BIVH 3OTJE 1FXYA 4GAWA 1AMHA 1F92A 3RC5A 3ATMA 2ZFRH 3PMBB 4IMZA 1M9UA 4D7GA 1TABE 3PROA 3RXGA 2ZDKA 2HLCA 1QFKH 1W7GH 1AGJA 1BTHH 1QNJA 1F7ZA 1F0RA 2GT8A 1C1NA 1O3DA 4A1VA 3U9AH 2IJOB 2ODPA 3NKKA 1SHHB 1O38A 1IQMA 4ZROA 3RXOA 2YOLA 1FPHH 2BXUH 3A7YA 4BTIB 4OS7A 3T27A 2BDIA 4JK6A 2VVCA 1OWHA 1BTYA 2ANYA 1GBDA 1EZUC 4WY3A 5SGAE 1WV7H 1MD7A 1S6HA 1HAXB 3LGTA 4D8NA 5C20A 1OOKB 3TH2H 1GBCA 3PO1C 1S83A 9ESTA 2C8ZB 1V2RT 2A4QA 3FANA 3VB7A 3MI4A 1QRZA 1LTOA 1MCTA 3UNSA 1XUGA 1O3OA 2GX4A 1H4WA 5CHAB 3RXPA 1O3AA 3UOUA 1GI1A 1HCGA 1O3PB 1FN8A 1K1NA 4XDEA 3D62A 1K28D 1C1QA 1O3JA 3F1SB 3WY8A 4B1TA 2BX3A 3AW1A 5L2YH 4ABHA 1NFUA 3FP6E 1W12U 2QXIA 3N7OA 1G9IE 1PFXC 1TBQH 3LIWA 2FOAA 2C93B 4DJZB 1HUTH 3PB1E 4SGAE 1HJ8A 3GOVB 1S85A 5GPIB 1ELBA 2BDAA 4X1SU 1P05A 1EP5A 3SBKA 3ZZBA 3ZYDA 2OC8A 2Y81A 1P10A 1YP9A 3AW0A 2ZPQA 1F0TA 2P8OB 4J1YA 1BMMH 2HPQH 2RCEA 4B75A 2F9NA 1FY5A 1OPHB 1C2DA 1YM0A 1H8IH 1GBLA 3QTVH 3I29A 4HGCA 3PM3A 1SGFG 2AIPA 1OWDA 5EPNA 1EB1H 2GCTC 2Q1JA 1IQJA 1C5LH 1GG6C 2BQ7B 5EG4A 3ZZ5A 1G2MA 1KIGH 1XUKA 1DOJA 3TGIE 1A3BH 1J14A 3OY5U 3K6ZA 2BDHA 1KTSB 3QLPH 1A61H 1O2GH 5LGOA 1O3GA 4KTUA 1FJSA 1YPMH 3MTYA 4BAQB 1DY8A 1QGFA 3A7ZA 1K1OA 2C4FH 2H5CA 3OX7U 1V3XA 1J8AA 1UCYH 5C1UA 1MKWH 2SGPE 2SGEE 1G30B 5DP5A 3B9FH 1O2PA 3RMMH 2STBE 5EQSA 1DX5M 1P2QA 1B0EA 1V2TT 2CMYA 4J2YB 3SJ9A 1F2SE 2A5IA 4YOJA 1MAYA 2XWBI 1AWFH 1UTOA 5J4SA 1KLJH 4MG3A 4BAKB 1FZZA 1PYTC 1L4ZA 3HKJB 4NA9H 4TWWA 1BBRE 1IQIA 1T4VH 1OSSA 2WPKS 3A89A 1V2VT 1O5BB 2ZFTA 1C1SA 1QRWA 2ZPSA 3F9EA 2WPJS 3NK8A 2XWAA 4BTTB 3RXVA 4I8LA 1PQ7A 2NWNA 1RTKA 4U30A 1TNLA 4ZHMU 2P59A 1HFDA 2D2DA 2GMTC 3UY9A 1SGQE 3VEQB 3KHVA 1GI3A 1NS3A 2I6SA 1P2KA 2STAE 4F49A 2GCTB 2PWXA 1DVAH 1GHAG 1HRTH 4Y6DA 4IN1A 3DA9B 1O2KA 1RGQA 2NU4E 1YBWA 1V2KT 4JYTA 3VB4A 4DG4A 3V7TA 4VGCB 1CA0B 1C4V2 1OP0A 1HNEE 5GXPA 2G4TA 1CGJE 4BTUB 1C1MA 1ZTLA 3QGNB 2IPHA 1O2UA 1NPMA 4E06H 3U98H 2V35A 3K9XB 3LT3A 3QK1A 1CHGA 2C8YB 3GCNA 1VITH 1GPZA 1TAWA 4NFEA 4O3UA 1A4WH 5F03A 2QC2A 3PMJA 2JH6D 2QXJA 1SOZA 3AAUA 4NZQA 1TRMA 1C1RA 1UVTH 1KXBA 2PKAB 2BY5X 2Z9LA 4I31A 3C1KA 4Y7BA 2PV9B 3GCTG 2SGFE 4UONA 2IOTA 3PYHA 1AB9C 3Q3XA 3SV9A 4I33A 1DLKB 1HBTH 4OS2A 1NO9H 1O2HA 3STJA 2XC4A 3A87A 2JETC 1CU1A 4DOQA 1DWCH 4Y8ZA 4NCYA 1WU1A 2ZDMA 1EATA 3P17H 1INCA 4LXBH 3IG6B 3BN9A 4Z0KA 1GMDF 4DIIH 4KGAA 3C27B 1W3CA 1H9LB 1KDQA 4AFUA 2BLOA 3NZIA 1Y5UT 1C5NH 3W95A 3O8BA 1HPGA 5EGMA 3A7TA 2AERH 5C1XA 3HK3B 2VVVA 4UFFH 3TU7H 1THSH 1G3DA 2FTMA 1P3CA 1TMBH 8GCHG 1FN6A 1TLDA 5GCHG 4ASHA 4NZLA 2F9VA 5EXMA 2W7UA 4ABJA 3URDA 4AYYB 2AMPA 5K0HA 2AGIX 1N6XA 1SGNE 1BMNH 3EQ0H 1Z7KA 2G00A 2CF8H 1NN6A 4AYVB 2P3UB 1AN1E 4YTAA 4ABEA 4INLA 1Z8JB 2BDBA 1WOFA 4ZKNU 1J16A 3OSYA 2QXHA 1H1BA 1T7CA 4M7GA 1TRYA 3BTQE 4TYDA 5A0AE 1TPAE 3D49H 1LPKB 3QTOH 3R3GB 4K8BA 1TQ0B 2WPLS 2F9PA 1VGCC 1WBGB 1BTUA 2B0FA 3ESTA 3M5LA 3MU8A 4X0WU 1TMUH 1XVMA 2J94A 3MHWU 1C2LA 5DJ7A 1TGCA 1C4U2 1A1RA 3KQBA 6GCHF 3SUGA 3S69A 4CBOA 3F9HA 1B5GH 1A5IA 2V0BA 3FZZA 1DANH 1NRPH 5IDKA 2YNAA 3SN8A 2R0KA 3ZZ7A 1GBMA 3DT0H 1BDAA 5CMXH 4MVNA 3JZ1B 3BG4B 3MU5A 1E37B 2GV7A 4DT7B 2TBSA 1CHOF 4YT6H 1DUEA 3M37A 2G5VA 3A80A 2CV3A 2VGCB 1VR1H 4K3JA 5E2PA 3ATLA 4B2BA 2XC0A 3BV9B 4RKOB 1FQ3A 1FONA 3P70B 1CT4E 1YKTA 1T8NA 1RD3B 4I8JA 5FCRA 3RXUA 1GCDA 2Z9JA 5H4IB 4WH8A 1DFPA 2UUKB 1BITA 2DE9A 4CRBA 1DXPA 1N8OB 2OBQA 3W94A 1V2UT 8KME2 1WYKA 1K1LA 1SGRE 4FXGH 1SFQB 2HNTC 3F68H 5JPMH 3A7XA 1LVBA 3ZV8A 2IN2A 1X7AC 4GUXA 1SL3A 1JBUH 1GJ8B 1GDNA 1XVOA 2Y7ZA 1C5SA 3UOPA 2VGCC 2AYWA 3M3TA 4UEHH 2FI4E 3HGPA 2Z9IA 3RXCA 1ARBA 3BTTE 3BTKE 3RXMA 4DURA 4Z6AH 4AFSA 1FAKH 4ZH8A 1J9CH 3HGNA 3O8RA 3MH5A 5T3HA 1P09A 1MQ5A 4XE4A 3MH4A 3S0NA 2A32A 1O5CB 3VFEA 2HALA 3KQDA 1D3TB 3A85A 2ZFPH 1ZTJA 1MD8A 2HNTE 2VWMA 2FOFA 2A45B 1LQEA 2WV4A 1SGEE 5G4BA 1TMTH 3VB6A 1TGTA 1UJ1A 2P8OC 1CSOE 2CN0H 3ZVAA 3ZZ3A 1ABJH 4GPGA 3KCGH 2ZWLH 1UCYE 4RKJB 1B0FA 2ZF0H 1EQ9A 3F6UH 1TRNA 1YLCA 1G36A 3ZVFA 1ZMJA 1GDUA 3RXHA 4K60A 1GJ5H 1AVGH 3MMGA 4DW2U 2G52A 1XMNB 6ESTA 1E0FD 3TVJB 1ABIH 1HAYB 1LHDH 1KXFA 1BTPA 3TK6A 1TIOA 4BOHA 1IQLA 1PQ5A 2QN5T 3RXQA 1PPBH 1Y3VA 4Q7ZA 3P8OA 3SUDA 1AWHB 5EODA 3BEIB 4CBNA 2TGAA 3PTNA 1O5FH 1O2NA 1ELGA 5A09A 3RC4A 1SSXA 1AIXH 3MU0A 1SQAA 2FI3E 1ZSLA 3RXEA 1CT2E 4B71A 2BY9X 1OYQA 4FU8A 3MU4A 1WQSA 4I8KA 3A7VA 2ZGHA 1EZQA 1MTVA 4KELA 1O36A 1G37A 1AUTC 7GCHF 1NRSH 1C1PA 2FEQH 1NROH 2VIWA 2CGAA 1QB6A 3LC3A 3V3MA 4BANB 4XBDA 1GL1A 1AY6H 1EXFA 1L2EA 2B9LA 4K1TA 3TITA 3QN7A 2GVFA 2XYAA 4UE7H 1PPCE 1EJAA 8GCHF 3VGCB 2PLXA 4ZXXH 3AAVA 4WXVA 3HKIB 2Z9GA 2AH4X 3ZZCA 1HAIH 1AFQC 2H1UA 2OLGA 3RU4T 2XC5A 2PKSC 2ZGCA 1SI5H 1C2IA 3K65B 1IQHA 1O34A 1OP2A 1EPTC 4LK4A 3I78A 1GJAB 3O8CA 2K1QA 1UTQA 2BD4A 4MLFB 1GJ6A 1P11E 2BXTH 2V3OH 1VJ9U 1ZPCA 1C5MD 3QWCH 2DUCA 1GCTC 2WUCA 2A1DB 2O8UA 2FI5E 1AKSB 1BHXB 4LZ4B 1G32B 1L1GA 1MZDA 1C5ZB 2GZ7A 1YPHE 1CT0E 4NA8A 2ZU3A 1DS2E 2W7SA 4CHAB 1EAXA 2R9PA 4A92A 2ANKH 5F6MA 5LPRA 2ANMH 3TK9A 4FUHA 1A7SA 4X6NA 1PQ8A 1N8OC 1TYNA 1WAYB 3URCA 2CF9H 1NRNH 2BQWB 1DXWA 4IMQA 2H9EH 2VB0A 4OS1A 1NFXA 3MWIU 4NSYA 2FOMB 3LGIA 4RN6A 3E8LA 2TRMA 3BTDE 3SV2H 1MU6B 3RXJA 1DWEH 2FOCA 1O5AB 4R0IA 1W14U 1ZGVA 4X8SH 1F0UA 1GJ7B 3UWJH 4HFPB 7LPRA 3SHCH 1OYTH 2BY8X 2FTLE 3BG4C 1LKAA 2CHAC 1PQAA 2OCVB 1MQ6A 1AQ7A 3SGBE 5HMAA 1AD8H 1YPEH 2OINA 3T5FH 1HAPH 2I6QA 1O2JA 1YPJH 2WYGA 2H5DA 2ZU1A 2UUFB 3A8CA 1GI9B 2ZHDA 3TJUA 2BB4A 4IC5A 1GGDB 1UHBA 3BF6H 2SFAA 2WINI 1VZQH 2BDGA 3U1IB 2NU1E 3M7UA 1SLWB 2D1JA 3P8NA 4YT7H 1GI7B 4ISHH 2ZNKH 1L4DA 3E90B 4O3TA 4WF8A 1G3BA 4ISIH 1ZPZA 2AIQA 1C2KA 1QQUA 3FZDA 1QL7A 1YYY1 1YPKH 3M3SA 5JBBS 1IQKA 2FOHA 1DLEA 2Q6DA 2ZFSA 3AASA 3OYPA 4YLUA 3STIA 1D3QB 3LPRA 5HYOA 1MU8B 1XUJA 1ELTA 1O39A 2GT7A 2VWLA 5F8ZA 6GCHG 2SNVA 5ETXA 2C8WB 5GDSH 2BVXH 1LVMA 1TPPA 1Y3WA 2OTVA 3SW2B 2G51A 1CGIE 2TGTA 3PTBA 1ZPBA 3SJKA 1O3HA 3ITIA 3M5MA 2ZKSA 3RXIA 2ZHWH 3ZZ6A 1HAGE 3T29A 1CGHA 1F5KU 3O8DA 5IYTA 2A7HA 2AGGX 3BEFB 1UTPA 1VCWA 3E3TA 4WWYA 3SGQE 3U69H 1D6WA 1C2MA 2BM2A 4AG2A 1ETTH 2ZEBA 3B23B 2B8OH 4H42U 4D76A 1SB1H 3HATH 1E35B 4BAOB 1LKBA 3A8BA 5F8XA 2GV6A 1K2I1 1HXEH 3LJOA 1A0LA 3IWMA 4AZ2B 2XXLA 4NIYA 3M7TA 1GMDG 4Q7YA 1E38B 2OXSA 2NU2E 1EX3A 2AEIH 2ZC9H 3CP7A 1O2IA 2ZP0H 3E6PH 4IN2A 5FXLA 5FBIA 1S5SA 1S0QA 1F5RA 1EAWA 3SQEE 2P16A 2AGEX 2RA3A 4VGCC 5AHGH 1D9IA 2ZU5A 2FODA 3E1XB 2Y7XA 2ZTYA 2BD7A 3S7KB 4CHAC 1C5OH 2HOBA 1XKAC 5AFZH 1U6QA 2JETB 4ZXYH 3UQVA 1CA8B 1P2JA 1UTMA 5HM2A 2D26C 3E0PB 1IAUA 3LOXA 2FM2A 1EUFA 4CRGA 1RTFB 1AZ8A 1O2OA 2R3UA 5DO4H 1W11U 1EZSC 1FUJA 1OX1A 1MTNC 4NFFA 4Q80A 1ZMNA 3V0XA 5TCAA 2A7JA 5FPTA 3MNSA 4CRCA 4Y8YA 4X2YA 4MNYA 4X8VH 1BA8B 2ANWA 2ZO3H 5BPEA 2XCNA 3A81A 3M3VA 1ZR0A 4RSPA 3F9GA 2QY0B 4K5ZA 4DCDA 3OY6U 1KXAA 1QBNA 1SHYA 2A2XH 2EI6A 3UREA 5BRRE 1K1PA 1DSUA 1CA0C 3BEUA 4JYVH 3HPTB 1V2JT 1O5DH 4ZKSU 2O8WA 2GCHF 5C1YA 3TK5A 2ZPRA 1WQVH 2F3CE 3TJOA 5T6FA 2FX6A 3SI3H 2J9NA 5DKMA 1MUEB 1NESE 1UVOA 4X2XA 1GBJA 1O2VA 4TPYA 1YPGH 5DPAA 1ETRH 3SO3A 5DP8A 1YGCH 1FY8E 1P06A 3RXDA 2WPIS 3M35A 1V2WT 1FV9A 1MTWA 5EQQA 3SJIA 3SNAA 3T62A 1HYLA 5DP4A 2OC7A 5JB8S 1FY3A 1NZQH 4X6PA 4IS5A 1UCYK 3PV4A 4K69A 2G5NA 4YESB 3GY6A 1O5GH 4U2WA 1NTPA 4KP0A 4YLQH 2J95A 1VGCB 2W5EA 2ZQ1A 2FPZA 1GWAA 1SFIA 1CHOG 1S0RA 4GCHF 3NPSA 4MNWA 1GL0E 2BTCE 5K7RA 2ZDNA 5ESBA 4DIHH 1BB0B 4AGKA 3DD2H 1Y8TA 1QTFA 1EJNA 1GJ9B 2BYAX 2QXGA 3PO1B 1QJ6B 1GVZA 2B7DH 2ZTXA 4ABBA 3V12A 2WUBA 3VB3A 5CE1A 1W2KH 2FZZA 1GBIA 3SU3A 4FUBA 1TE0A 1UVPA 3S9AA 2BLQA 4Y8XA 1GHXH 2Z3CA 1AZZA 4KKDA 3LGYA 2ULLA 3UQOA 4GSOA 1C1VH 2FLBH 4E05H 1DT2A 2BZAA 1TPSA 3ZZ9A 1BRUP 1ELFA 2G81E 1GVLA 2A2QH 1UHBB 4H6TA 1NT1A 1SGCA 3ZZ4A 1K21H 5E0GA 5HXFA 4NIVA 4MPXA 5HM9A 1GVKB 1XM1A 3UIRA 4ISOA 2BDYA 1TA2A 3GYLB 2W3KA 1DE7H 4YOGA 2FOGA 1NFWA 1O3NA 1O5EH 2ESTE 4ZHLU 1BBRK 1CO7E 1L1JA 1KTTB 2JH0D 3TJNA 4GHQA 1Z8IB 1MBQA 1DICA 2J4IA