2G4UA

Anomalous substructure of porcine pancreatic elastaase (ca)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elastase-1
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
molecule tags Hydrolase
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g4uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g4uA01
2P3FH 1O2OA 1CU1A 4Z6AH 3S9CA 2ZQ2A 1O5FH 5C67A 3GY8A 1GBJA 1O2ZA 1TABE 1C5YB 2ILNA 3IG6B 1H4WA 2A4RA 1DS2E 1AVGH 3O8CA 2UUFB 6CHAB 1C2JA 1DWEH 4X2VA 2LNCA 1B5GH 2SGAA 1A0JA 1LPZB 1V2OT 5A0CA 3E3TA 2C90B 2CN0H 4WH8A 1TIOA 1S6FA 3ZYDA 1BCUH 4NA8A 1ZHRA 2GT8A 2BQ6B 3QWCH 3SUGA 1O3EA 2BLQA 2FESH 1G2LA 1HBTH 3F9FA 1EZSC 1G3BA 3MYWA 2ZDKA 4Q80A 3TJOA 1BTYA 1BTZA 2PTNA 1BITA 1LCYA 4INKA 1Z8RA 4GPGA 1NU7B 2OCVB 2BQWB 1YLCA 1EJNA 1ARBA 1GHWH 1QHRB 1CGHA 4IGDA 3A80A 1C5SA 2Y6TA 1UTPA 2BDHA 1ANBA 1HAHH 1C2KA 4K5ZA 2AIQA 4YT7H 2R3UA 1GI7B 4CBOA 1OP8A 2ZCKP 1ELGA 2JETB 4E06H 2GV7A 1DOJA 4IW4E 4UFDH 1C1PA 1N8OB 1MCTA 1WSSH 2ESTE 4IS5A 1MKWH 4WWYA 1C5OH 4K3JA 2SGQE 1SLWB 2H5CA 1UVOA 3GICB 1NT1A 2QYIA 1AGJA 3VEQB 1JOUB 1QBNA 1NU9A 1D9IA 3TNSA 3RXJA 1IQHA 1EOJA 2A31A 1VCWA 4I8KA 1C4U2 3HATH 2Z7FE 1IQNA 1RTKA 4F4OC 5GJ4B 2RA3A 1TGNA 1KLJH 3BTME 3ENSB 5JPMH 1AO5A 1L4DA 3VFEA 1LHGH 1KDQA 2W26A 1SGPE 1S0QA 3UUZA 3PB1E 1O2PA 1BBRK 2PUQH 2D1JA 1C2MA 4B73A 2XBVA 3TH2H 4ABFA 1O5DH 3KN2A 2J9NA 3ATWA 4KTSA 5JDUB 4A5TS 5EW2H 1O3IA 4H42U 3RXTA 2P3UB 2BDCA 2BD9A 3FFGA 1DM4B 3BTQE 1YPGH 1EZXC 3T28A 2PSYA 4IC6A 2GGVB 1XUIA 4RKOB 2ZZUH 1AUJA 4TY7A 1ELCA 2ZWLH 5C2ZA 4D7GA 1U6QA 3LOXA 1ARCA 1Y3XA 1MD8A 2A5AA 1HJAC 3Q3XA 3SUFA 4BOHA 4KTCA 1GCDA 2BY5X 4UDWH 2H9TH 3LGUA 2WPIS 3SGBE 4X1NU 4B76A 4DGJA 3K65B 5FHTA 1XKBC 4DY7B 3RC5A 4X1SU 3O8RA 1TOMH 2YNAA 4ZROA 2SNWA 3ZZBA 1XUKA 2H5DA 1UTNA 1P04A 4AN7A 4GVUA 1ESTA 2HNTE 3ZZ8A 1T8LA 5BRRE 2ZPQA 4ZKNU 3VB3A 1JRTA 2V6NA 2A45B 2AIPA 2H2ZA 1O5CB 3D49H 1UTLM 5F03A 1FY5A 1Y3YA 4NZQA 2BVXH 4WMDA 3MTYA 1BQYA 4UE7H 2TGTA 1AB9B 3M61U 4KTUA 2CJIA 2P8OB 5E2PA 2FO9A 3V13A 3I29A 3Q00A 3M7QA 1TA2A 2BVRH 4D76A 1DE7H 1GMCF 1KLTA 1IAUA 5EU8A 3M5LA 2VINA 5EW1H 1Y8TA 3MH7A 4MLFB 4M7GA 3DUXH 4YO9A 2GCHG 4YOIA 3ITIA 2R2WU 1TNGA 2BDAA 3RXEA 5F8ZA 3V7TA 3O8BA 3EYDA 2TBSA 5E0HA 5DJ7A 5FX6A 4R8TB 2OC0A 4YLQH 3M37A 1HV7A 4GHQA 3KF2A 4B2BA 1N6YA 1YPJH 3MH6A 1LMWB 1DVAH 1UMAH 5PTPA 1GCTB 1QL8A 1GDQA 1P2IA 1HB0B 1D3QB 4OGYA 1KY9A 2Z6BD 1CGJE 4K1SA 1FUJA 1LHCH 3EA7A 1GHBF 2FTMA 4FUBA 1CT2E 1P09A 4DCDA 5LPFA 1E0FD 2HLCA 3SJKA 1EQ9A 1HJ9A 1O34A 2BD2A 1ZSJA 4WMFA 1ELFA 1SGTA 1C5ZB 1F0TA 1CQQA 1UTKA 1QA7A 1YBWA 2ZP0H 4ZHLU 4CRDA 5GPIB 1WQVH 1WAYB 1O2XA 2VJ1A 2PKAB 3NXPA 3OY5U 4BXSA 2ZFSA 1H1BA 5E0JA 2TIOA 2ODPA 1TWXB 3GDSA 1AFQB 3U69H 2FX6A 6ESTA 1W14U 1O5EH 2AFQB 1A0LA 3GDUA 3SV8A 1EB2A 3UOPA 1CHOF 2Q1JA 4INHA 3QN7A 3SV7A 1SGNE 3MH5A 3UR6A 2TGDA 1C5RA 4MPWA 1TA6A 3SQHE 1E38B 2QV1A 3QUMP 1J15A 2BD4A 5AVDA 2XWBI 2XRCA 4LZ4B 2GMTB 3BTFE 3PLPA 1MZDA 1W7XH 2XWAA 1QB9A 2PHBA 2ZHEH 3CENA 1ZRKA 1UTJA 2Z9KA 3UREA 1EOLA 2Z9LA 1FIZA 1Y5UT 3OTJE 1L4ZA 1ELBA 1G3DA 3UTUH 2FXRA 2ANMH 3PWCA 3F1SB 1A61H 1G3EA 3MWIU 3ATKA 3NK8A 5GDSH 2ZTZA 1FAXA 1FXYA 4ZHMU 3STIA 3S9AA 1NPMA 2ZO3H 1GVKB 3QTOH 3F9HA 3RXGA 1DSUA 4CHAB 2HNTC 2FI3E 4DVAU 4BTTB 4I8LA 1GJ8B 1PPGE 3U8RH 3MO3A 2VB0A 1FPCH 2J95A 2BYAX 3P8OA 4NFFA 3ZVDA 1KXCA 1V6DA 3DD2H 3DFLA 2ANYA 3DT0H 2QA9E 1GJ5H 3E1XB 1F2SE 1GBDA 1OWKA 4B74A 1F5KU 2QAAA 3ZZDA 2F9NA 1OWDA 4GHTA 2G4TA 1ABJH 2ZECA 3P17H 3TIUA 3W95A 4BAQB 1OYTH 2I6SA 1RS0A 1EJMA 3VB6A 2PGQB 1RXPA 4XBCA 1SOTA 2ZFQH 2P59A 2A32A 5T6FA 1P11E 3RLWH 3LIWA 3NKKA 1GL0E 4FVDA 1QTFA 2G5NA 2V35A 2CXVA 1QBOA 2OLGA 2O8UA 1HUTH 4O03A 1YYY1 1QJ1B 1KYNA 1EKBB 3ODDA 5FPSA 3V3MA 3SU3A 3M3SA 1RD3B 7GCHG 3M35A 3SU5A 4ZKSU 1G2MA 1GHAF 1AWHB 1Y5BT 1QJ7B 3R3GB 1F7ZA 1ID5H 1PQ7A 2SNVA 2TGAA 3CS7A 1QNJA 1HXFH 3TNTA 3UIRA 2GKVE 3MU8A 5CHAC 6GCHG 1GG6C 5HM9A 1P10A 2ZCHP 3SNCA 1HRTH 1X7AC 1ETSH 6CHAC 2FIRH 4CRFA 1WV7H 1V2WT 3U1JB 2FLRH 3MNXA 1ELVA 4CR5A 1CGIE 1NFYA 2ZU2A 1S5SA 2HPPH 3ELAH 2Y7ZA 2ZG0H 3Q76A 3UNSA 2W3IA 2AGGX 4QT8C 1ZPCA 1BTUA 5F8XA 2PKSB 1QJ6B 1UHBA 2D2DA 1LVMA 2WPHS 1D6WA 5FBIA 2F3CE 3M5MA 2AH4X 5C5NA 1GVLA 1C9PA 4Y7AA 4IN1A 2XBWA 3OU0A 1VJAU 1UCYE 1KXAA 2DE9A 1UJ1A 3BN9A 4XDEA 1TALA 3ZZCA 1W0ZU 1YPHC 1DUAA 1C2GA 1GBFA 3RXUA 2FP7B 1N8OC 1SPJA 3PWBA 5DP9A 3RMMH 2QIQA 1GMHG 4X1QU 5E0GA 4LXBH 4FUGA 1IHTH 1CA0C 1NZQH 4X8UH 2BX4A 2OP9A 3UQOA 5T6DA 7LPRA 4AFZA 3FP6E 1TB6H 2Y82A 2OC8A 1XUJA 1PFXC 4WH6A 2Z3CA 1GBTA 1ZOMA 1AWFH 3TGJE 4ZHAA 4TWWA 4UONA 3TK5A 1NRRH 2WYGA 3K6YA 2ZKSA 2V3OH 4YZUA 5DKMA 1RIWC 3MO9A 4YT6H 2ZI2H 1RJXB 2AMQA 2BY7X 3SJ9A 3UNQA 4OS7A 1GI4A 1MTVA 4X6OA 2FM2A 3QO6A 1MKXH 3ODFA 1ELTA 5L2ZH 3GY3A 4K8YA 5C1XA 1O3GA 2OBOA 1AUTC 1V2KT 1KIGH 1RGQA 2QN5T 1P3CA 4Q7XA 4ASHA 5JYIA 3TVJB 1BOQA 4LK4A 2ZU1A 4DOQA 3RC4A 1Q31A 1ANEA 1W10U 2IPHA 1GJ7B 5AFYH 3M5NA 5EPNA 3ZVGA 2ZDLA 4Y10E 5SGAE 1TGCA 1VITF 3HKIB 1HPGA 5A09A 1NFWA 3LC5A 1AFEH 1QQUA 3PYHA 1AKSA 4ISOA 3MI4A 1ESBA 3M7TA 3I77A 2NU1E 3GY4A 5H4IB 3SNEA 1ESAA 1OKXA 1C9TA 3HPTB 1NY22 3QZQA 1TYNA 4FUHA 4ZH8A 2BY9X 3P6ZB 1PPFE 3T27A 1UVPA 1MKWK 3QTVH 3H7TA 1GI9B 2VIDA 3Q77A 1OS8A 5EXNA 1GHVH 5G4BA 2GCTC 2VU8E 1HIAB 1K1JA 2ZNKH 1MTUA 3GCNA 1J14A 2NU2E 4I33A 3SJIA 3BTDE 1V2JT 1FY8E 1TNLA 3NPSA 1T4VH 2VVUA 1L2EA 1O2HA 1D6RA 1C5NH 1P8VC 1QURH 2VGCC 3FP7E 4K1TA 5GWZA 1FY1A 4NSVA 1AY6H 1XXDA 4D9QA 4NCYA 4ZKRU 1O5BB 4FU8A 1ELEE 3WY8A 1GGDC 4X8VH 2ZHQH 2G52A 1O2RA 1QIXB 1ZZZA 1KXEA 1KSNA 1S0RA 2O8TA 4I31A 1YC0A 3BEFB 5GCHF 2AMDA 2A4QA 2A1DB 1S81A 5CHAB 3RU4T 3O8DA 1GG6B 4RN6A 1GMDG 2ZGCA 2G00A 2XC4A 1BRAA 1Y59T 3BEIB 3M7UA 3TJUA 1QB6A 3B8JA 4FVBA 4MNVA 2R0KA 1SHHB 5A0AE 1P05A 1GCTC 3PV4A 4I8HA 2ZQ1A 1NS3A 4D8NA 1SGFA 1B7XB 2ZTXA 1GJ9B 1Y3UA 4K2YA 4A7IB 2F9VA 1N1LA 3SU2A 1P12E 5HXFA 4ZKOU 2UUKB 1IQEA 1HAOH 2R2MB 8ESTE 1GBCA 2ZGBH 1EAWA 4JZDH 4NFEA 3MU5A 4H6SB 3ATLA 1P2JA 4ABHA 1NFUA 4D7FA 5EG4A 2QGRA 5EQRA 1RTFB 5JBAS 1A3EH 1O39A 1L1NA 1C5XB 4X8SH 2NU0E 5HM2A 1IQGA 2Y81A 5DPAA 1D3PB 2TPIZ 3RXBA 1PPBH 3SZNA 2KAIA 1C1NA 1DT2A 2QF3A 1SQAA 1AFQC 4X1PU 3BTEE 3RXMA 1Z8GA 3U8OH 2Q6GA 3UWIA 1IQLA 1CA0B 1ZSKA 1VR1H 1E36B 3BIUH 4YLUA 1A5GH 3LJOA 3Q3KA 1J9CH 2FS8A 1VITH 3RC6A 2ZFTA 3NCLA 2QY0B 2GMTC 2H9HA 2ZPRA 1GBEA 1H9LB 5DP7A 5ESTE 1H8IH 1F5LA 1RIWB 2PFEA 1THPB 4F49A 1ZMLA 3GDVA 4I32A 2AMPA 1EZQA 3VB4A 3VPKA 3PMAB 1TGTA 4X6NA 1BTPA 1EPTB 4NWKA 3SHAH 1TBRH 1HXEH 3SHCH 1NN6A 1C5VA 5T3HA 9LPRA 3TPIZ 1UK3A 1XMNB 4O3UA 1AN1E 3FZZA 4ZMAH 2P93A 4A1XA 4CHAC 1XVOA 1GI8B 2CF9H 4AOQA 1S82A 4X6MA 4ABGA 3LGWA 1D3TB 4OS6A 4MDSA 3SU1A 3B9FH 4U01A 1DUEA 3SW2B 3EAJA 4VGCC 1HAVB 2H6MA 4JK6A 2ULLA 3TJVA 3RP2A 1BMAA 3P70B 1UVUH 4AFUA 2OC1A 3ZZAA 1YGCH 4AYYB 1C5UA 3KL6A 1AIXH 2Z9IA 1YCPH 2JH0D 4U2WA 3V12A 3U1IB 3GY2A 5DG6A 1O3PB 1UK4A 5L2YH 1EATA 1UTQA 2CMYA 1GMCG 1J16A 4YOGA 1A2CH 1NO9H 2A2QH 2GCTB 4E7RG 1FMGA 1P03A 4Z0KA 4XE4A 3RXAA 3TH3H 1PQ8A 1DY9A 2FWWA 2A5IA 2YNBA 1P01A 1NFXA 4CREA 2QF0A 1ZPBA 1QA0A 4KP0A 1PPCE 2PGBB 8GCHG 5JBTA 1A46H 2EI7A 2EA3A 3A8CA 2VGCB 1T8MA 2ZFPH 3A8BA 5HYOA 1P02A 1MU6B 2JH5D 1AZ8A 1YLDA 1BTHH 4AZ2B 3RXFA 3T5FH 1GVZA 1Q2WA 3SBKA 2OTVA 3EA8A 2BHGA 5A0BA 4JZ1A 3URDA 5JBCS 3AAUA 4KELA 1GGDB 1T32A 2V3HH 3L3TA 1OWIA 1GJ6A 2OUAA 3GCTG 1W7GH 1MCVA 3HK6B 4AB9A 3G01A 2BX3A 1F92A 1JWTA 1HAPH 2F91A 4Q7YA 1IQKA 2OINA 3LH3A 2FS9A 1SLVB 2UUYA 2XCNA 3MH4A 1CT4E 1HAVA 2FYQA 3H7OA 2PKSC 5ESBA 2AS9A 3QLPH 2G81E 1EP5A 2A2XH 4Y71A 4TYDA 2WUCA 1D4PB 5EXLA 4NA7A 2QXGA 4JYVH 4MNYA 1ABIH 3K9XB 4XSKU 2WPLS 4AFSA 3A7ZA 1CE5A 3RXQA 5TJXA 1WUNH 4OS1A 5AF9H 1YCPM 1OSSA 1W11U 2VVCA 1O3JA 1LVYA 2HNTF 3BTKE 4FU7A 2XC5A 1BMMH 2CGAA 4UFGH 3P8FA 1V2VT 1TONA 3SU0A 3TK6A 2IOTA 1BRCE 4ABAA 1P0SH 3A81A 3UQVA 2ZPSA 2BOKA 4I8JA 3BTTE 3P8GA 3A83A 2G51A 2TGPZ 3FVFB 3E6PH 1LPGB 1WYKA 2J34A 1Y3VA 9ESTA 3ZV9A 4CH8B 1CBWB 1B0EA 1W3CA 2GCHF 5FCRA 3GOVB 3RXHA 3LGIA 1DICA 3M3VA 1SGEE 1O3FA 1T7CA 3MU1A 2FDAA 3D62A 2G55A 1TPAE 4UD9H 3QDZB 5AFZH 4MPXA 1MTSA 1TOCB 1N6XA 2F9OA 4R0IA 2WINI 2OBQA 2Q6DA 1LTOA 3SV6A 4UEHH 3LONA 1NRQH 3LH1A 5C1YA 1XUGA 5ETXA 2NWNA 3ATIA 4K1EA 1V2NT 3JZ1B 1CSOE 2FOEA 2UWOA 4BAMB 1DX5M 1C5QA 3SUEA 3SGQE 3T29A 1Y3WA 4HFPB 1FN6A 1LVBA 3W94A 3UNRA 2ALPA 2PV9B 1TNIA 4MQAA 2IN2A 1UTMA 5DP5A 3OSYA 4ABEA 4A1VA 3KQCA 1BJVA 3QX5H 4MNXA 2EI6A 4VGCB 2HPQH 3SORA 1VZQH 4MG3A 4OS2A 2G4UA 3SV9A 2VIWA 4BTIB 1WQSA 1ETTH 2PKAA 3E8LA 4O3TA 2J92A 4ABDA 2FEQH 2RG3A 3IWMA 1DWCH 1FY4A 2XC0A 2VIQA 1GBKA 1QCPA 5DK1A 2VIVA 1Z8IB 1O2UA 1PPHE 1XKAC 2Z9JA 3KIDU 1TFXA 1Z71A 2JH6D 1C1OA 2ALVA 3ATMA 1O36A 2RCEA 1TBQH 4DT7B 4INLA 2FX4A 4AG1A 3C27B 4FUJA 3RMLH 2ASUB 3SQEE 1O2QA 1OWJA 1A0HB 1G9IE 1QQ4A 1UVTH 3ZZ6A 3MU0A 3ZVFA 1PPZA 3IITA 1MKXK 4AB8A 5K7RA 2B0FA 2NU3E 5DP8A 4ISIH 2BM2A 2QXJA 2HVXA 1LVOA 2I6QA 3EDXB 3SOSA 3NWUA 2STAE 2HOBA 3MNBA 2ZFFH 1GDUA 1AE5A 2HGTH 2SGPE 5EXMA 3PLKA 1A3BH 4U32A 3RM2H 3SJOA 1DY8A 1TMUH 3EE0B 4AORA 1GI2A 1TX8A 3UR9A 3BG4B 1CHGA 1V2TT 3A85A 4B2AA 2ZDNA 3SO3A 4UFFH 3FAOA 2J4IA 3ZVEA 1GJDB 4DIIH 3U9AH 1SB1H 1MMJN 2ZGHA 3LJJA 5EOKA 1ZJDA 2GD4B 1V2QT 4CBNA 1O2JA 1YM0A 4NIYA 2B9LA 3PMJA 1GI5A 2NU4E 1QR3E 2STBE 7GCHF 1O33A 3NZIA 1E35B 1DITH 1CO7E 1EXFA 5DO4H 4ABIA 3SNBA 2F9BH 3LDXH 2DUCA 3VB5A 1TAWA 3P8NA 4MTBA 4DIHH 1V2RT 1K1PA 2BVSH 5LH8A 6GCHF 1FONA 1J17T 1XVMA 2C8YB 4WJG2 1QRXA 2ZHWH 1TLDA 3RXCA 1SSXA 1SG8B 8LPRA 1S6HA 4JZIA 2OQ5A 7KMEH 1AVWA 3FP8E 3GY5A 1Z6JH 3A7WA 2GP9B 4LZ1H 3AAVA 2PUXB 4NIWA 2O8WA 3T25A 3P95A 5EODA 1XXFA 1YF4A 4SGAE 1F5RA 1C4Y2 2W7SA 2OC7A 3RXPA 3MNCA 1TPOA 3LT3A 2HALA 2ODQA 3MMGA 5HMAA 1ZYOA 3HKJB 1EPTC 2O9QA 4BNRA 5GXPA 2WV4A 4BXWA 1A4WH 4K8BA 4HTCH 1O3CA 1YPKH 4GCHG 3BIVH 4JK5A 4ISHH 1O35A 1YKTA 1SMFE 2ZC9H 1RRKA 1O0DH 1ZSLA 3RXIA 2J2UA 1HAGE 4B2CA 3ESTA 1A7SA 1GJCB 1NRSH 2A7HA 4I7YH 1O3NA 1WTGH 1K22H 1AU8A 1GMHF 1P3EA 2HRVA 2XNIA 4FUDA 2P95A 4HZHA 3RU4E 4JZEH 2FYRA 1SLUB 1BTWA 3S69A 1JIRA 3MU4A 2H1UA 1Z8JB 1S84A 1NRPH 3DHKH 1W2KH 1O32A 3E16B 5A8XA 2VWOA 1HLTH 1OOKB 1BRBE 2ZEBA 3A7XA 1C2IA 3EA9A 2BY6X 2F9UA 4WY3A 4FUCA 1LKAA 2PR3A 2FOFA 2ANKH 1SVPA 4IN2A 1C1MA 1Z1JA 4Q7ZA 1F0RA 1BA8B 1C2HA 1P2OA 4GUXA 1S85A 4CRGA 5L6NH 5DP4A 1O38A 3QGNB 2BQ7B 2O8MA 1O3MA 1FPHH 3A84A 3SUDA 1C2EA 1C1WH 1AMHA 2ZIQH 3LU9B 1HYLA 1ZHPA 1O3HA 1SOZA 1QRWA 3GCHC 1T8NA 1BMNH 2BXUH 1KTTB 1K1OA 2WYJA 2F9PA 2FI5E 3BTWE 1JXPA 2VWNA 4MNWA 1O30A 2PTCE 1ZHMA 3A7VA 5TCCA 1MH0A 1TRMA 2BY8X 4B1TA 5A8YA 3MFJA 3LGTA 4ISLA 2F83A 3JZ2B 2ANWA 1WBGB 2J94A 1BDAA 1H9HE 2XW9A 3KGPA 2BMGB 4NIVA 5DP6A 3FZDA 1BBRE 1O37A 4Y79A 3TITA 1C5WB 1M9UA 1TNJA 1YPLH 3AVZA 4MVNA 4AX9H 2QCYA 1Q3XA 2ZDAH 4O9VA 1CA8B 2W3KA 4WF8A 1EAXA 1TBZH 1O3LA 1V2PT 4KGAA 1EAUA 3F68H 2BDGA 3SNDA 4SGBE 4ZUHA 5C5OA 2SGFE 1YCPK 2AYWA 2Q6FA 3RXRA 1PQ5A 1QL9A 1IQJA 1SGDE 4Y8ZA 1KDQB 1GJBB 1KXFA 3D65E 3L33A 5IDKA 3P92A 1ZLRA 4GAWA 3VGCC 2ZTYA 2C8XB 3SJ8A 3RU4D 4JZFH 1EP6A 1CVWH 2FPZA 3KQEA 1ORFA 2Y80A 1HIAA 2A7CA 1FLEE 2SGDE 3DFJA 4K60A 3MHWU 3SI3H 1UO6A 5FX5A 1AVXA 4JYTA 3GYMA 1PYTD 1OX1A 2GVFA 3E0PB 3RXLA 1UVSH 3ZVBA 1DANH 1HAIH 1O3OA 1FN8A 4NG9H 3UWJH 3A7YA 1CBWC 4CRCA 2FOHA 2BD5A 2VIPA 2VWLA 2ZU3A 2ZU5A 2BLWA 2C8WB 3QZRA 1K2I1 1GMDF 4FUFA 2XBXA 4UFEH 3OX7U 3A8AA 3URCA 2GDEH 1JIMA 2PSXA 1NESE 1HCGA 1UCYH 3PM3A 1BJUA 3EQ0H 4JCNA 3A88A 3VXEH 1Z1IA 4NWLA 1BHXB 4CR9A 3SI4H 1ACBE 2W7UA 1FI8A 2FOBA 1H8DH 2A4OA 2O8LA 3ZZ5A 2BDBA 2FTLE 2EEKA 1GI6A 1AI8H 1K9OE 4E7NA 1IOEA 1TX6A 1PYTC 3MNSA 3RM0H 3L6PA 1O2GH 1O2LA 3BEUA 4YM9A 1LKBA 3PTNA 4FUEA 3Q3YA 3KNXA 5L30H 1F0UA 1FY3A 1V2LT 4Q2KA 2ZGXH 1HFDA 1GBIA 3S0NA 3T2NA 4HI3A 1P06A 2P3TB 1SGQE 3EGKH 3SU6A 1F0SA 1TMTH 3A8DA 1TPPA 1C5MD 1UTOA 1EUFA 1SGRE 1TMBH 1KTSB 2FMJA 4B75A 2ZCLP 3N7OA 2FOMB 4WXIA 3UPEA 4WXVA 2IJOB 2V0BA 4ZAEA 3RXVA 1W13U 1GHXH 2R0LA 5FXLA 4DG4A 1GBBA 1HDTH 2DE8A 4WVPE 1XUHA 1J8AA 1WCZA 3PMBB 4FUIA 1L1GA 3M5OA 1NC6A 2ZHDA 1C4V2 4X2YA 5AHGH 2B8OH 1C1UH 1FJSA 1MTNB 1O2TA 1ANCA 2ZF0H 2D26C 1HGTH 3AASA 4H6TA 2BLVA 2VIOA 3PROA 5E2OA 5EPYA 7ESTE 1DXWA 1P2KA 1MBQA 3ZZ4A 3A86A 1G37A 1BMLA 3BTGE 4X2XA 1LHEH 2R9PA 2XYAA 3GCHB 4JYUH 1AHTH 2BD7A 2XTTB 3HGNA 1TE0A 3ZVCA 4CH2B 1E34B 4XOJA 3U98H 3TGIE 1DLEA 1EPTA 1DLKB 1P2NA 2GX4A 1VJ9U 1C1RA 3ZZ3A 1MD7A 4NSYA 3GYLB 1GHBG 5JB8S 3LC3A 1GI0A 5EQQA 5EQSA 1FZZA 4BANB 1BUIA 3U8TH 1A1RA 1SGFG 4Y0ZE 4X1RU 1TQ0B 4BAKB 1JBUH 3PMHB 5CMXH 1NRNH 3BG4C 1GDNA 1WTHD 1TX7A 5I46H 2UWLA 2EI8A 1P9UA 2A5KA 4TY6A 2XCFA 3M36A 1FQ3A 1OPHB 5C20A 1C2FA 1TGSZ 1SQOA 1ZR0A 1RTLA 3ZV8A 1MU8B 2VVVA 1ELDE 1CHOG 1QB1A 1QFKH 4AG2A 1BBRH 4NA9H 1SL3A 8GCHF 1VCPA 2QC2A 3VGCB 1QY6A 8KME2 5LGOA 1VGCC 1EZUC 3A82A 4FXGH 1NM6A 1AD8H 1D3DB 4AGKA 1GHYH 1SHYA 1ZGVA 1CT0E 3GCTF 1C1TA 2YOLA 3E0NB 1SGYE 3VXFH 3A89A 1O2YA 3KQBA 4I8GA 1SFQB 4X6PA 1K28D 1O2IA 2SFAA 2QXIA 1O2KA 1ELAA 2CV3A 1B0FA 2PLXA 4OS4A 1XUFA 3B23B 1HAYB 4DW2U 4WMEA 4B71A 2K1QA 1O31A 4X8TH 3QK1A 1ZMJA 4MPUA 2C93B 3SV2H 1TGBA 3M3TA 1G30B 2B7DH 1QGFA 4NIXA 1Z6EA 1V2MT 1HAZB 2AERH 1FNIA 1ZGIA 2XXLA 5HGGA 3TK9A 2AGIX 3GY7A 4CRBA 2D8WA 1LHFH 5J4QA 1K1MA 3R0FA 2LPRA 1XM1A 1FDPA 1BZXE 1YPHE 4AYVB 2CHAC 1GJAB 5FPYA 2GT7A 3RXDA 1BB0B 1O3BA 2R3YA 2C4FH 2BZ6H 2JKHA 3BF6H 2WV5A 3GY6A 1P2MA 4D9RA 4ESTE 4THNH 1LO6A 2FOAA 1Z7KA 3RMOH 3F6UH 3NUMA 5JBBS 3LPRA 2WPKS 1OP2A 4PROA 5DGJA 1GI1A 1YPMH 1GBHA 2XBYA 2ZDMA 4Y0YE 3CP7A 4KKDA 1GBMA 2Z3EA 1W8BH 1ZJKA 2VNTA 5C1UA 3ZZ7A 1DWDH 1O3DA 3DA9B 1V3XA 1C5LH 1IQFA 3VB7A 4E05H 4RSPA 1QBVH 1O2MA 1AZZA 1FV9A 4X0WU 1ZPZA 5F6MA 3S9BA 1GHAG 1GWAA 2P16A 2H9EH 3UOUA 3ZZ9A 1HNEE 4Y8XA 2ZU4A 4BTUB 3CS0A 4Y11E 1A5HA 4Y8YA 2OD3B 3AW1A 5CE1A 1SFIA 4J1YA 3ZVAA 4CRAA 5JB9S 1INCA 4FU9A 1AQ7A 3C1KA 1IQIA 3HGPA 1GPZA 1HJAB 1MTWA 1RFNA 1OP0A 4OGXA 4OS5A 3BV9B 1GI3A 1UHBB 4TPYA 1TPSA 1O5GH 3KCGH 4TWYA 1PQAA 4LOYH 1PPEE 3RLYH 4BAOB 4J2YB 2UUJB 4A92A 4A6LA 3QGJA 5B6OA 1C2DA 2WPJS 3RDZA 4ABJA 2OQUA 4ISNA 3S7KB 3SNAA 4HGCA 1AE8H 3PO1C 1C2LA 1WOFA 1MAXA 2SGEE 1HAXB 3BTHE 1P9SA 5BPEA 5TCAA 2VH6A 2CF8H 4MPVA 1G32B 2FOGA 1OWHA 4Y76A 3SN8A 2HWLB 1O2NA 1ANDA 1BHXF 1DWBH 2FZZA 5LPEA 1O3KA 1GJ4H 4JMYA 1G36A 1K1IA 1WU1A 4ZXXH 2Y7XA 1TNHA 2FOCA 3E90B 2C8ZB 2A7JA 1ETRH 2G5VA 1NTPA 1C5TA 1LHDH 4X2WA 1PJPA 1THSH 3TJNA 2M5TA 4IMQA 2ZHFH 3A87A 1UK2A 3UFAA 5ABWA 3OYPA 2RDLA 5IYTA 1C5PA 1KXBA 2BZAA 1BIOA 3H5CB 3BG8A 1E37B 2ZDVH 4AFQA 1K21H 3MO6A 1DSTA 1W12U 1GHZA 2AGEX 3KHVA 1GBLA 1MBMA 2GZ9A 5FCKA 1OYQA 2ODYB 2BDYA 1C1QA 1BTXA 2Y5GA 1JRSA 1LQDB 2FLBH 5LPRA 1VGCB 5E8EH 4DJZB 1A5IA 5I25A 1Y5AT 3KEEA 4YOJA 4GSOA 2GDDA 1K1NA 1YPEH 1O2WA 1QL7A 1MQ6A 2RA0A 1KXDA 2Z9GA 1LQEA 1DXPA 1AKSB 2C3SA 4RKJB 3S7HB 1V2UT 2JETC 3RUOA 3PTBA 1XX9A 5EGMA 1G3CA 4NGAH 4AGJA 2WUBA 4BAHB 4Y6DA 4YESB 1DPOA 4GLYA 2PW8H 4NZLA 1C1SA 1S83A 3K6ZA 4K69A 2EC9H 2OXSA 1VITG 2BLOA 1EJAA 1L0ZA 2FI4E 4ABBA 4IBLH 4XFQA 5FAHA 2ZA5A 1ZTKA 3RMNH 3SGAE 5FPTA 2WPMS 4DURA 5J4SA 3GCOA 3UY9A 5DP3A 4H4FA 1SR5C 3FANA 1ZMNA 2UWPA 1MAYA 1BT7A 2THFB 4IMZA 3AW0A 1ZRBA 3LGYA 2BD8A 1GL1A 1ZTJA 1FAKH 3BSQA 5K0HA 3TGKE 2B5TB 1O2VA 2CHAB 4U30A 2PWXA 2BXTH 5F8TA 1TRNA 1EASA 2A0QB 2GZ8A 1SGIB 2Z94A 2VWMA 2Y5FA 1LDTT 1MZAA 4ZXYH 1BRUP 1IQMA 4XBBA 2TRMA 3RXOA 1EX3A 2GTBA 2VH0A 3RXKA 1SQTA 3OY6U 1C1VH 3F9EA 1DFPA 2AEIH 1EAIA 1MQ5A 3STJA 3F9GA 3RXSA 1TQ7B 1OWEA 3D23A 6LPRA 1FIWA 1O3AA 3ZYEA 1TNKA 4YTAA 1LPKB 5A8ZA 4IC5A 1T4UH 1H9IE 1KLIH 1SGCA 1W0YH 3K2UA 3T26A 2GZ7A 3T62A 1V2ST 5C3NA 2G8TA 2BB4A 1MUEB 1MTNC 1OXGA 1GBAA 1O2SA 2BDIA 3LKWA 3HK3B 5GCHG 2A4GA 2QXHA 1T31A 3SU4A 2Y5HA 1UCYK 1HJ8A 1SBWA 5A2MH 4GCHF 4O97A 5FBEA 1P2QA 1TRYA 1T8OA 5T6GA 4A1TA 3V0XA 1EB1H 3KQDA 1YP9A 3LGVA 4TPIZ 1DDJA 1VCQA 1SLXB 2ZFRH 3PO1B 1SI5H 3TLOA 4Y7BA 1JMOH 3GISB 1O5AB 1QRZA 2P94A 2Z3DA 1IHSH 3E91A 3A7TA 1ZTLA 3PLBA 1AB9C 1P57B 1THRH 4XBDA 2ZGJA 1K1LA 2KAIB 3TU7H 2P8OC 2BOHB 3TH4H 2FODA 1NROH 3I78A 2BD3A 3MOCA 5GIBA 1L1JA 2GV6A 1SC8U 2W5EA 2J38A 2BTCE
chains in the Genus database with same CATH superfamily
2P3FH 1O2OA 1CU1A 4Z6AH 3S9CA 4XD7D 2ZQ2A 1O5FH 5C67A 3GY8A 1GBJA 1O2ZA 1TABE 1C5YB 2ILNA 3IG6B 1H4WA 2A4RA 1DS2E 1AVGH 3O8CA 2UUFB 6CHAB 1C2JA 1DWEH 4X2VA 2LNCA 1B5GH 2SGAA 1A0JA 1LPZB 1V2OT 1SKYE 5A0CA 3E3TA 2C90B 2CN0H 4WH8A 1TIOA 1S6FA 3ZYDA 1BCUH 4NA8A 1ZHRA 2V7QD 2GT8A 2BQ6B 3QWCH 3SUGA 1O3EA 2BLQA 2FESH 1G2LA 1HBTH 4ASUD 3F9FA 1YWUA 1EZSC 1G3BA 3MYWA 2ZDKA 4Q80A 3TJOA 1BTYA 1BTZA 2PTNA 1BITA 1LCYA 4INKA 1Z8RA 4GPGA 1NU7B 2OCVB 4FETA 2BQWB 1YLCA 1EJNA 1ARBA 1GHWH 1QHRB 1CGHA 4IGDA 3A80A 1C5SA 2WHXA 1UTPA 2Y6TA 2BDHA 1ANBA 1HAHH 1C2KA 4K5ZA 2AIQA 2IJD1 4YT7H 2R3UA 1GI7B 4CBOA 1OP8A 2ZCKP 1ELGA 2JETB 4E06H 2GV7A 1DOJA 4IW4E 4UFDH 1C1PA 1N8OB 1MCTA 1WSSH 2ESTE 4IS5A 1MKWH 4WWYA 1C5OH 4K3JA 2SGQE 1SLWB 2H5CA 1UVOA 3GICB 1NT1A 2QYIA 1AGJA 3VEQB 1JOUB 1QBNA 1NU9A 1D9IA 3TNSA 3RXJA 1IQHA 1EOJA 2A31A 1VCWA 4I8KA 1C4U2 3HATH 2Z7FE 1IQNA 1RTKA 4F4OC 5GJ4B 2RA3A 1TGNA 1KLJH 3BTME 3ENSB 2YMSB 5JPMH 1AO5A 1L4DA 3VFEA 1LHGH 1KDQA 2W26A 1SGPE 1S0QA 3UUZA 1KMHB 3PB1E 1O2PA 1BBRK 2PUQH 2D1JA 1C2MA 4B73A 1K0HA 2XBVA 2HLDD 3TH2H 4ABFA 1O5DH 3KN2A 2J9NA 3ATWA 4KTSA 5JDUB 4A5TS 5EW2H 1O3IA 4H42U 3RXTA 2P3UB 2BDCA 2BD9A 3FFGA 1DM4B 3BTQE 1YPGH 1EZXC 3T28A 2PSYA 3OE7D 4IC6A 2GGVB 1XUIA 4RKOB 2ZZUH 1AUJA 4TY7A 1ELCA 2ZWLH 5C2ZA 4D7GA 1U6QA 3LOXA 1ARCA 1Y3XA 1MD8A 2A5AA 1HJAC 3Q3XA 3SUFA 4BOHA 4KTCA 1GCDA 2BY5X 4UDWH 2H9TH 3LGUA 2WPIS 3SGBE 4X1NU 4B76A 4DGJA 3K65B 5FHTA 1XKBC 4DY7B 3RC5A 4X1SU 3O8RA 1TOMH 2YNAA 4ZROA 2SNWA 3ZZBA 1XUKA 2H5DA 1UTNA 1P04A 4AN7A 4GVUA 1ESTA 2KCYA 2HNTE 4XRNA 3ZZ8A 1T8LA 5BRRE 2ZPQA 4ZKNU 3VB3A 1JRTA 2K8IA 2V6NA 2A45B 2AIPA 2H2ZA 1O5CB 3D49H 4TSFD 1UTLM 5F03A 1FY5A 1Y3YA 4NZQA 2BVXH 4WMDA 3MTYA 1BQYA 4UE7H 2TGTA 3OAAD 1AB9B 3M61U 4KTUA 2CJIA 2P8OB 5E2PA 2FO9A 3V13A 3I29A 3Q00A 3M7QA 1TA2A 2BVRH 4D76A 1DE7H 1GMCF 1KLTA 1IAUA 5EU8A 3M5LA 2VINA 5EW1H 1Y8TA 3F2GA 2CK3D 3MH7A 4MLFB 4M7GA 2QE7D 3DUXH 4YO9A 2GCHG 4YOIA 3ITIA 3FOAA 2R2WU 1TNGA 2BDAA 3RXEA 5F8ZA 3CNRA 3V7TA 3O8BA 3EYDA 2TBSA 5E0HA 5DJ7A 5FX6A 4R8TB 2OC0A 4YLQH 3M37A 1HV7A 4GHQA 3KF2A 4B2BA 1N6YA 1YPJH 3MH6A 1LMWB 1DVAH 1UMAH 5PTPA 1GCTB 1QL8A 1GDQA 1P2IA 1HB0B 1D3QB 4OGYA 1KY9A 2Z6BD 1CGJE 4K1SA 1FUJA 1LHCH 3EA7A 1GHBF 2FTMA 4FUBA 1CT2E 1P09A 3DCLA 4DCDA 5LPFA 1E0FD 2GJGA 2HLCA 2EQNA 3SJKA 5HIZA 1EQ9A 1HJ9A 1O34A 2BD2A 1ZSJA 4WMFA 1ELFA 1SGTA 1C5ZB 1F0TA 1CQQA 1UTKA 1QA7A 1YBWA 2ZP0H 4ZHLU 4CRDA 5GPIB 1WQVH 1WAYB 2WSSD 1O2XA 2VJ1A 2PKAB 3NXPA 3OY5U 4BXSA 2ZFSA 1H1BA 5E0JA 2TIOA 2ODPA 1TWXB 3GDSA 1AFQB 3U69H 2FX6A 6ESTA 1W14U 1O5EH 2AFQB 1A0LA 3GDUA 3SV8A 1EB2A 3UOPA 1CHOF 2Q1JA 4INHA 3QN7A 3SV7A 1SGNE 3MH5A 3UR6A 2TGDA 1C5RA 4MPWA 1TA6A 3SQHE 1E38B 2QV1A 3QUMP 1J15A 2BD4A 5AVDA 2XWBI 5KECA 2XRCA 4LZ4B 2GMTB 3BTFE 3PLPA 1MZDA 1W7XH 2XWAA 1QB9A 2PHBA 2ZHEH 3CENA 1ZRKA 1UTJA 2Z9KA 3UREA 1EOLA 2Z9LA 2J97A 1FIZA 1Y5UT 3OTJE 1L4ZA 1ELBA 1G3DA 4P00A 3UTUH 1E1RD 2FXRA 2ANMH 2JDID 3PWCA 3F1SB 1A61H 1G3EA 3MWIU 3ATKA 3NK8A 5GDSH 2ZTZA 1FAXA 1FXYA 4ZHMU 3STIA 3S9AA 1NPMA 1E1QD 2ZO3H 1GVKB 3QTOH 3F9HA 3RXGA 2L6OA 4P02A 1DSUA 4CHAB 2HNTC 2FI3E 4DVAU 4BTTB 4I8LA 1GJ8B 1PPGE 3U8RH 3MO3A 2VB0A 1FPCH 2J95A 2BYAX 3P8OA 4NFFA 3ZVDA 1KXCA 4TT3D 1V6DA 4M9FA 3DD2H 3DFLA 2ANYA 3DT0H 4Q4LA 2QA9E 1GJ5H 3E1XB 1F2SE 1GBDA 3KQ5A 1OWKA 4B74A 1F5KU 2QAAA 3ZZDA 2F9NA 1OWDA 4GHTA 2G4TA 1ABJH 2ZECA 3P17H 3TIUA 3W95A 4BAQB 1OYTH 2I6SA 1RS0A 1EJMA 2AHME 2PGQB 3VB6A 1RXPA 4XBCA 1SOTA 2ZFQH 2P59A 2A32A 5T6FA 5IK2D 1P11E 3RLWH 3LIWA 3NKKA 1GL0E 4FVDA 1QTFA 2G5NA 2V35A 2CXVA 1QBOA 2OLGA 2O8UA 1HUTH 4O03A 1YYY1 5DSFA 1QJ1B 1KYNA 1EKBB 3ODDA 5FPSA 3V3MA 3UAIC 3SU3A 3DSPA 3M3SA 1RD3B 7GCHG 3M35A 3SU5A 4ZKSU 1G2MA 1GHAF 1AWHB 1Y5BT 1QJ7B 3R3GB 1F7ZA 1ID5H 1PQ7A 2SNVA 2TGAA 3CS7A 1QNJA 1HXFH 3TNTA 4I86A 3UIRA 2GKVE 3MU8A 5CHAC 6GCHG 1GG6C 5HM9A 1P10A 2ZCHP 3SNCA 1HRTH 1X7AC 1ETSH 6CHAC 2FIRH 4CRFA 1WV7H 1V2WT 3U1JB 2FLRH 3MNXA 1ELVA 4CR5A 1CGIE 1NFYA 2ZU2A 1S5SA 2HPPH 3ELAH 2Y7ZA 3FO8D 2ZG0H 3Q76A 3UNSA 2W3IA 2AGGX 4QT8C 1ZPCA 1BTUA 5F8XA 2PKSB 1QJ6B 1UHBA 2D2DA 1LVMA 2WPHS 1D6WA 5FBIA 2F3CE 3M5MA 2AH4X 5C5NA 1GVLA 1C9PA 2YMSD 4Y7AA 4IN1A 2XBWA 3OU0A 1VJAU 1UCYE 5KGOA 1KXAA 2DE9A 1UJ1A 3BN9A 4XDEA 1TALA 3ZZCA 1W0ZU 1YPHC 1DUAA 1C2GA 1GBFA 3RXUA 2FP7B 1N8OC 1SPJA 3PWBA 5DP9A 2KR7A 3RMMH 2QIQA 1GMHG 4X1QU 5E0GA 4LXBH 4FUGA 1IHTH 1CA0C 1NZQH 4X8UH 2BX4A 2OP9A 3UQOA 5T6DA 7LPRA 4AFZA 3FP6E 1TB6H 2Y82A 2OC8A 1XUJA 1PFXC 4WH6A 2Z3CA 1GBTA 1ZOMA 5EJ1A 1AWFH 3TGJE 4ZHAA 4TWWA 4UONA 3TK5A 1NRRH 2WYGA 3K6YA 2ZKSA 2V3OH 4YZUA 2YMSC 5DKMA 1W0JD 1RIWC 3MO9A 4YT6H 2ZI2H 1RJXB 2AMQA 2BY7X 3SJ9A 3UNQA 4OS7A 1GI4A 1MTVA 4X6OA 2FM2A 3QO6A 1MKXH 3ODFA 1ELTA 5L2ZH 3GY3A 4K8YA 5C1XA 1O3GA 2OBOA 1AUTC 1V2KT 1KIGH 1RGQA 2QN5T 1P3CA 4Q7XA 4ASHA 5JYIA 3TVJB 2W6JD 1BOQA 5HIYA 3OFND 4LK4A 2ZU1A 4DOQA 3RC4A 1Q31A 1ANEA 1W10U 2IPHA 1GJ7B 5AFYH 3M5NA 5EPNA 3ZVGA 2ZDLA 4Y10E 5SGAE 1TGCA 1VITF 3HKIB 1HPGA 5A09A 1NFWA 3LC5A 1AFEH 1QQUA 5FL7D 3PYHA 1AKSA 4ISOA 3MI4A 1ESBA 3M7TA 3I77A 2NU1E 3GY4A 5H4IB 3SNEA 1ESAA 1OKXA 1C9TA 3HPTB 1NY22 3QZQA 1TYNA 4FUHA 4ZH8A 2BY9X 3P6ZB 1PPFE 3T27A 2KCAA 1UVPA 1MKWK 3QTVH 3H7TA 1GI9B 2VIDA 3Q77A 1OS8A 5EXNA 1GHVH 5G4BA 2GCTC 2VU8E 1HIAB 1K1JA 2ZNKH 1MTUA 3GCNA 1J14A 2NU2E 4I33A 3SJIA 3BTDE 1V2JT 1FY8E 2HVYB 1TNLA 3NPSA 1T4VH 2VVUA 1L2EA 4AC9A 1O2HA 1D6RA 1C5NH 1P8VC 1QURH 2VGCC 3FP7E 4K1TA 5GWZA 2JJ2D 1FY1A 4NSVA 1AY6H 1XXDA 4D9QA 4NCYA 4ZKRU 1O5BB 4FU8A 1ELEE 3WY8A 1GGDC 4X8VH 2ZHQH 2G52A 4ZCNA 1O2RA 1QIXB 1ZZZA 1KXEA 1KSNA 1S0RA 2O8TA 4I31A 1YC0A 3BEFB 5GCHF 2AMDA 2A4QA 2A1DB 1S81A 5CHAB 3RU4T 3O8DA 1GG6B 4RN6A 1GMDG 2ZGCA 2G00A 2XC4A 1BRAA 1Y59T 3BEIB 3M7UA 3TJUA 1QB6A 3B8JA 4FVBA 4MNVA 2R0KA 1SHHB 5A0AE 1P05A 1GCTC 3PV4A 4I8HA 2ZQ1A 1NS3A 4D8NA 1SGFA 1B7XB 2ZTXA 1GJ9B 1Y3UA 4K2YA 4A7IB 2F9VA 1N1LA 3SU2A 1P12E 5HXFA 4ZKOU 2UUKB 1IQEA 1HAOH 2R2MB 8ESTE 1GBCA 2ZGBH 3GS9A 1EAWA 4JZDH 3AK5A 4NFEA 3MU5A 4H6SB 3ATLA 1P2JA 4ABHA 1NFUA 4D7FA 5EG4A 2QGRA 5EQRA 1RTFB 5JBAS 1A3EH 1O39A 1L1NA 1C5XB 4X8SH 2NU0E 5HM2A 1IQGA 2Y81A 5DPAA 1D3PB 2TPIZ 3SYJA 3RXBA 1PPBH 3SZNA 2KAIA 1C1NA 1DT2A 2QF3A 1SQAA 1AFQC 1UW7A 4X1PU 3BTEE 3RXMA 1Z8GA 3U8OH 2Q6GA 3W1EA 3UWIA 1IQLA 1CA0B 1ZSKA 1VR1H 1E36B 3BIUH 2IPQX 4YLUA 1A5GH 3LJOA 3Q3KA 1J9CH 2FS8A 1VITH 3RC6A 2ZFTA 3NCLA 2QY0B 2GMTC 2H9HA 2ZPRA 1GBEA 1H9LB 5DP7A 5ESTE 1H8IH 1F5LA 1RIWB 2PFEA 1THPB 4F49A 1ZMLA 3GDVA 4I32A 2AMPA 1EZQA 3VB4A 3VPKA 3PMAB 1TGTA 4RI0A 4X6NA 1BTPA 1EPTB 4NWKA 3SHAH 1TBRH 1HXEH 3SHCH 1NN6A 1C5VA 4HG6A 5T3HA 9LPRA 3TPIZ 1UK3A 1XMNB 4O3UA 3FKSD 1AN1E 3FZZA 4ZMAH 2P93A 4A1XA 4CHAC 1XVOA 1GI8B 2CF9H 4AOQA 2XNDD 1S82A 4X6MA 4ABGA 3LGWA 1D3TB 4OS6A 4MDSA 3SU1A 3B9FH 4U01A 1DUEA 3SW2B 3EAJA 4VGCC 1HAVB 2H6MA 4JK6A 2ULLA 3TJVA 3SZEA 3RP2A 1BMAA 3P70B 1UVUH 4AFUA 2OC1A 3ZZAA 1YGCH 4AYYB 1C5UA 3KL6A 1AIXH 2Z9IA 1YCPH 2JH0D 4U2WA 3V12A 3U1IB 3GY2A 5DG6A 1O3PB 1UK4A 5L2YH 1EATA 1UTQA 2CMYA 1GMCG 1J16A 4YOGA 4RT1A 1A2CH 4Z1MD 1NO9H 2A2QH 2GCTB 4E7RG 1FMGA 1P03A 4Z0KA 4XE4A 3RXAA 3TH3H 1PQ8A 1DY9A 2FWWA 2A5IA 2YNBA 1P01A 1NFXA 4CREA 2QF0A 1ZPBA 1QA0A 4KP0A 1PPCE 2PGBB 1BMFD 8GCHG 5JBTA 1A46H 2EI7A 2EA3A 3A8CA 2L74A 2VGCB 1T8MA 2ZFPH 3A8BA 5HYOA 1P02A 1MU6B 2JH5D 1AZ8A 1YLDA 1BTHH 4AZ2B 3RXFA 3T5FH 1FX0B 1GVZA 1Q2WA 2OTVA 3EA8A 3SBKA 2BHGA 5A0BA 4JZ1A 3URDA 5JBCS 3AAUA 4KELA 1GGDB 1T32A 2V3HH 3L3TA 1OWIA 1GJ6A 2OUAA 3GCTG 2V3MA 1W7GH 1MCVA 3HK6B 3N7DA 4AB9A 3G01A 2BX3A 1F92A 1JWTA 1HAPH 2F91A 4Q7YA 1IQKA 2OINA 3LH3A 2FS9A 1SLVB 2UUYA 2XCNA 1WXRA 3MH4A 1CT4E 2WV9A 1HAVA 2FYQA 3H7OA 2PKSC 5ESBA 2AS9A 3QLPH 2G81E 1EP5A 2A2XH 4Y71A 4TYDA 2WUCA 1D4PB 5EXLA 4NA7A 2QXGA 4JYVH 4MNYA 1ABIH 3K9XB 4XSKU 2WPLS 4AFSA 3A7ZA 3WWBA 1CE5A 3RXQA 5TJXA 1WUNH 4OS1A 5AF9H 1YCPM 1OSSA 1W11U 2VVCA 1O3JA 1LVYA 2HNTF 3BTKE 4FU7A 2XC5A 1BMMH 2CGAA 4UFGH 3P8FA 1V2VT 1TONA 3SU0A 3TK6A 2IOTA 1BRCE 4ABAA 1P0SH 3A81A 3UQVA 2ZPSA 2BOKA 4OM9A 4I8JA 4ACAA 3BTTE 3P8GA 3A83A 2G51A 2TGPZ 3FVFB 3E6PH 1LPGB 1WYKA 2J34A 1Y3VA 9ESTA 3ZV9A 2JJ1D 4CH8B 1CBWB 1B0EA 1W3CA 2GCHF 5FCRA 3GOVB 3RXHA 3LGIA 1DICA 3M3VA 1SGEE 1O3FA 1T7CA 3MU1A 2FDAA 3D62A 2G55A 1TPAE 4UD9H 3QDZB 5AFZH 4MPXA 1MTSA 1TOCB 1N6XA 2F9OA 4R0IA 2WINI 2OBQA 5DN6D 2Q6DA 1LTOA 3SV6A 4UEHH 3LONA 4ACBA 1NRQH 3LH1A 5C1YA 1XUGA 2VBCA 5ETXA 2NWNA 3ATIA 4K1EA 1V2NT 5KEDA 3JZ1B 1CSOE 2FOEA 2UWOA 4BAMB 1DX5M 1C5QA 3SUEA 3SGQE 3T29A 1Y3WA 4HFPB 1FN6A 1LVBA 1EFRD 3W94A 3UNRA 2ALPA 2PV9B 1TNIA 4MQAA 2IN2A 1UTMA 5DP5A 3OSYA 4ABEA 4A1VA 3KQCA 1BJVA 3QX5H 4MNXA 2EI6A 4VGCB 2HPQH 3SORA 1VZQH 4MG3A 4OS2A 2G4UA 3SV9A 3MQKC 2VIWA 4BTIB 1WQSA 1ETTH 2PKAA 3E8LA 4O3TA 2J92A 4ABDA 2FEQH 2RG3A 2KM0A 3IWMA 1DWCH 1FY4A 2XC0A 2VIQA 1GBKA 1QCPA 2M2AA 5DK1A 2VIVA 1Z8IB 1O2UA 1PPHE 1XKAC 2Z9JA 3KIDU 1TFXA 1Z71A 2JH6D 3OEHD 1C1OA 2ALVA 3ATMA 1O36A 2RCEA 1TBQH 4DT7B 4INLA 2FX4A 4AG1A 3C27B 4FUJA 3RMLH 2KZ4A 2ASUB 3SQEE 1O2QA 1OWJA 1A0HB 1G9IE 1QQ4A 1UVTH 3ZZ6A 3MU0A 3ZVFA 1PPZA 3IITA 1MKXK 4AB8A 5K7RA 2B0FA 2NU3E 5DP8A 4ISIH 2BM2A 2QXJA 2HVXA 1LVOA 2I6QA 3EDXB 3SOSA 3NWUA 2STAE 2HOBA 3MNBA 2ZFFH 2KCPA 3WW7A 1GDUA 1AE5A 2HGTH 2SGPE 5EXMA 3PLKA 1A3BH 4U32A 3RM2H 3SJOA 1DY8A 1TMUH 3EE0B 4AORA 1GI2A 1TX8A 3UR9A 3BG4B 1CHGA 1V2TT 3A85A 4B2AA 2ZDNA 3SO3A 4UFFH 3FAOA 2J4IA 3ZVEA 1GJDB 4DIIH 3U9AH 1SB1H 1MMJN 2K0QA 2ZGHA 3LJJA 5EOKA 1ZJDA 1OHHD 2J98B 1S6LA 2GD4B 1V2QT 4CBNA 1O2JA 1YM0A 4NIYA 2B9LA 3PMJA 1GI5A 2NU4E 1QR3E 2STBE 7GCHF 1O33A 3NZIA 1E35B 1DITH 1CO7E 1EXFA 5DO4H 4ABIA 3SNBA 2F9BH 3LDXH 2DUCA 3VB5A 1TAWA 3P8NA 4MTBA 4DIHH 1V2RT 1K1PA 2BVSH 5LH8A 6GCHF 1QZ8A 1FONA 1J17T 1XVMA 2C8YB 4WJG2 1QRXA 2ZHWH 1TLDA 3RXCA 1SSXA 1SG8B 8LPRA 1S6HA 4JZIA 2OQ5A 7KMEH 1AVWA 3FP8E 3GY5A 1Z6JH 3A7WA 2GP9B 4LZ1H 3AAVA 2PUXB 4NIWA 2O8WA 3T25A 2QF4A 3P95A 5EODA 1XXFA 1YF4A 4SGAE 1F5RA 1C4Y2 2W7SA 2OC7A 3RXPA 3MNCA 1TPOA 3LT3A 2HALA 2ODQA 3MMGA 5HMAA 1ZYOA 3HKJB 1EPTC 2O9QA 4BNRA 5GXPA 3KYFA 2WV4A 3DSGA 4BXWA 1A4WH 4K8BA 4HTCH 1O3CA 1YPKH 4GCHG 3BIVH 4JK5A 4ISHH 1O35A 1YKTA 1SMFE 2ZC9H 1RRKA 1O0DH 1ZSLA 3RXIA 2J2UA 1HAGE 1YY3A 4B2CA 3ESTA 1A7SA 1GJCB 1NRSH 2A7HA 4I7YH 1O3NA 1WTGH 1K22H 1AU8A 1GMHF 1P3EA 2HRVA 2XNIA 4FUDA 2P95A 4HZHA 3RU4E 4JZEH 2FYRA 1SLUB 4YXWD 1BTWA 3S69A 1JIRA 3MU4A 2H1UA 3PRBA 1Z8JB 1S84A 1NRPH 3DHKH 1W2KH 1O32A 3E16B 5A8XA 2VWOA 1HLTH 1OOKB 1BRBE 2ZEBA 3A7XA 1C2IA 3EA9A 2BY6X 2F9UA 4WY3A 4FUCA 1LKAA 2PR3A 2FOFA 2ANKH 1SVPA 4IN2A 1C1MA 1Z1JA 4Q7ZA 1F0RA 1BA8B 1C2HA 1P2OA 4GUXA 1S85A 4CRGA 5L6NH 5DP4A 1O38A 3QGNB 2BQ7B 2O8MA 1O3MA 1FPHH 3A84A 3SUDA 1C2EA 1C1WH 1AMHA 2ZIQH 3LU9B 1HYLA 1ZHPA 1O3HA 1SOZA 1QRWA 3GCHC 1T8NA 1BMNH 2BXUH 1KTTB 2PP6A 1K1OA 2WYJA 2F9PA 2FI5E 3BTWE 1JXPA 2VWNA 4MNWA 1O30A 2PTCE 1ZHMA 1SQRA 3A7VA 5T1VA 5TCCA 1MH0A 1TRMA 2BY8X 4B1TA 5A8YA 3MFJA 3LGTA 3PV5A 4ISLA 2F83A 3JZ2B 2ANWA 1WBGB 2J94A 2KX4A 1BDAA 1H9HE 2XW9A 3KGPA 2BMGB 4NIVA 5DP6A 3FZDA 1BBRE 1O37A 4Y79A 3TITA 1C5WB 1M9UA 1TNJA 1YPLH 2RDEA 3AVZA 4MVNA 4AX9H 2QCYA 3F3BA 1Q3XA 2ZDAH 4O9VA 1CA8B 2W3KA 4WF8A 1EAXA 1TBZH 1O3LA 1V2PT 4KGAA 1EAUA 3F68H 2BDGA 3SNDA 4SGBE 4ZUHA 5C5OA 2SGFE 1YCPK 2AYWA 2Q6FA 3RXRA 2J5UA 1PQ5A 1QL9A 1IQJA 1SGDE 4Y8ZA 1KDQB 1GJBB 1KXFA 3D65E 3L33A 5IDKA 3P92A 1ZLRA 4GAWA 3VGCC 2ZTYA 2C8XB 3SJ8A 3RU4D 4JZFH 1EP6A 1CVWH 2FPZA 3KQEA 1ORFA 2Y80A 1HIAA 2A7CA 1FLEE 2SGDE 3DFJA 4K60A 3MHWU 3SI3H 1UO6A 5FX5A 1AVXA 4JYTA 3GYMA 1PYTD 1OX1A 2GVFA 3E0PB 3RXLA 1UVSH 3ZVBA 1DANH 1HAIH 1O3OA 1FN8A 4NG9H 3UWJH 3A7YA 1CBWC 4CRCA 2FOHA 2BD5A 2VIPA 2VWLA 2ZU3A 2ZU5A 2BLWA 2C8WB 3QZRA 1K2I1 1GMDF 3N99A 4FUFA 2XBXA 4UFEH 3OX7U 1NBME 3A8AA 2GDEH 1JIMA 2PSXA 3URCA 1NESE 1HCGA 1UCYH 3PM3A 1BJUA 3EQ0H 4JCNA 3A88A 3VXEH 1Z1IA 3F0PA 4NWLA 1BHXB 4CR9A 3SI4H 1ACBE 5C94A 2W7UA 1FI8A 2FOBA 1H8DH 2A4OA 2O8LA 3ZZ5A 2BDBA 2FTLE 2EEKA 1GI6A 1AI8H 1K9OE 4E7NA 1IOEA 1TX6A 1PYTC 3MNSA 3RM0H 3L6PA 1O2GH 1O2LA 3BEUA 4YM9A 1LKBA 3PTNA 4FUEA 3Q3YA 3KNXA 5L30H 2LELA 1F0UA 1FY3A 1V2LT 4Q2KA 2ZGXH 1HFDA 5EIYA 1GBIA 3S0NA 3T2NA 2RFKC 4HI3A 1P06A 2P3TB 1SGQE 3EGKH 3SU6A 1F0SA 1TMTH 3A8DA 3VG8A 1W0KD 1TPPA 1C5MD 1UTOA 1EUFA 1SGRE 1TMBH 1KTSB 2FMJA 3UB0A 3DSOA 4B75A 3FN8A 2ZCLP 3N7OA 2FOMB 4WXIA 3UPEA 4WXVA 2IJOB 3WWFA 2V0BA 4ZAEA 3RXVA 1W13U 1MABB 1GHXH 2R0LA 5FXLA 4DG4A 1GBBA 1HDTH 2DE8A 4WVPE 1XUHA 1J8AA 1H8HD 1WCZA 3PMBB 4FUIA 1L1GA 3M5OA 4F48B 1NC6A 2ZHDA 1C4V2 4X2YA 5AHGH 2B8OH 1C1UH 1FJSA 1MTNB 1O2TA 1ANCA 2ZF0H 2D26C 1HGTH 3AASA 4H6TA 2BLVA 2VIOA 3PROA 5E2OA 5EPYA 7ESTE 1DXWA 1P2KA 1MBQA 3ZZ4A 3A86A 1G37A 1BMLA 3BTGE 4X2XA 1LHEH 2R9PA 2XYAA 3GCHB 4JYUH 1AHTH 2BD7A 3F2FA 2XTTB 3HGNA 1TE0A 3ZVCA 4CH2B 1E34B 4XOJA 3U98H 4B6EA 3TGIE 5B6LA 1DLEA 1EPTA 5C17A 1DLKB 1P2NA 1NBMD 2GX4A 1VJ9U 1C1RA 1H8ED 1MD7A 3ZZ3A 4NSYA 3GYLB 1GHBG 5JB8S 3LC3A 1GI0A 5EQQA 4RT0A 5EQSA 1FZZA 4BANB 1BUIA 3U8TH 1A1RA 1SGFG 4Y0ZE 4X1RU 1TQ0B 4BAKB 1JBUH 3PMHB 5CMXH 1NRNH 3BG4C 1GDNA 1WTHD 1TX7A 5I46H 2UWLA 2EI8A 1P9UA 2A5KA 4TY6A 2XCFA 3M36A 1FQ3A 1OPHB 5C20A 1C2FA 5F53A 1TGSZ 1SQOA 1ZR0A 2F43B 1RTLA 3ZV8A 1MU8B 2VVVA 1ELDE 1CHOG 1QB1A 1QFKH 4AG2A 1BBRH 4NA9H 1SL3A 8GCHF 1VCPA 2QC2A 3VGCB 1QY6A 8KME2 5LGOA 1VGCC 1EZUC 4Q63A 3A82A 4FXGH 1NM6A 1AD8H 2WZQA 1D3DB 4AGKA 1GHYH 1SHYA 1ZGVA 5EJLA 1CT0E 3OEED 3GCTF 1C1TA 2YOLA 3E0NB 1SGYE 3VXFH 3A89A 1O2YA 3KQBA 4I8GA 1SFQB 4X6PA 1K28D 1O2IA 2SFAA 2QXIA 1O2KA 1ELAA 2CV3A 1B0FA 2PLXA 4OS4A 1XUFA 3B23B 3NRLA 1HAYB 4DW2U 4WMEA 4B71A 2K1QA 1O31A 4X8TH 3QK1A 1ZMJA 4MPUA 2KFWA 2C93B 3SV2H 1TGBA 3M3TA 1G30B 2B7DH 1QGFA 4NIXA 1Z6EA 1V2MT 1HAZB 2AERH 1FNIA 1ZGIA 2XXLA 5HGGA 3TK9A 2AGIX 3GY7A 4CRBA 2D8WA 1LHFH 5J4QA 1K1MA 3R0FA 2LPRA 1XM1A 4FOUC 5HKKD 1FDPA 1BZXE 1YPHE 4AYVB 2CHAC 1GJAB 5FPYA 2GT7A 3RXDA 1BB0B 1O3BA 2R3YA 2C4FH 2BZ6H 2JKHA 3BF6H 2WV5A 3GY6A 1P2MA 4D9RA 4ESTE 4THNH 1LO6A 2FOAA 1Z7KA 3RMOH 3F6UH 3NUMA 1WDIA 5JBBS 3LPRA 2WPKS 1OP2A 4PROA 5DGJA 1GI1A 1YPMH 1GBHA 2XBYA 2ZDMA 4Y0YE 3CP7A 4KKDA 1GBMA 2Z3EA 1W8BH 1ZJKA 2VNTA 5C1UA 3ZZ7A 1DWDH 1O3DA 3DA9B 1V3XA 1C5LH 1IQFA 3VB7A 4B6FA 4E05H 4RSPA 1QBVH 1O2MA 1AZZA 1FV9A 4X0WU 2F4LA 1ZPZA 5F6MA 3S9BA 1GHAG 1GWAA 2P16A 5C0TA 2H9EH 3UOUA 3ZZ9A 1HNEE 4Y8XA 2ZU4A 4BTUB 3CS0A 4Y11E 1A5HA 4Y8YA 2OD3B 3AW1A 5CE1A 1SFIA 4J1YA 3ZVAA 4CRAA 5JB9S 1INCA 1COWD 4FU9A 1AQ7A 3C1KA 1IQIA 4DT4A 3HGPA 1GPZA 1HJAB 1MTWA 1RFNA 1OP0A 4OGXA 4OS5A 3BV9B 1GI3A 1UHBB 4TPYA 1TPSA 1O5GH 3KCGH 4TWYA 1PQAA 4LOYH 1PPEE 3RLYH 4BAOB 4J2YB 2UUJB 4A92A 4A6LA 3QGJA 5B6OA 1E79D 1C2DA 2WPJS 3RDZA 4ABJA 2OQUA 4ISNA 3S7KB 3SNAA 4HGCA 1AE8H 3PO1C 1C2LA 1WOFA 1MAXA 2SGEE 1HAXB 3BTHE 1P9SA 5BPEA 5TCAA 2VH6A 5C0UA 2CF8H 4MPVA 1G32B 3PV2A 2FOGA 1OWHA 4Y76A 3SN8A 2HWLB 1O2NA 1ANDA 1BHXF 1DWBH 3F0OA 2FZZA 5LPEA 1O3KA 1GJ4H 4JMYA 1G36A 1K1IA 1WU1A 4ZXXH 2Y7XA 3PRDA 1TNHA 2FOCA 3E90B 2C8ZB 2OK5A 2A7JA 1ETRH 2G5VA 1NTPA 3OTPA 1C5TA 1LHDH 4X2WA 1PJPA 1THSH 2W6ID 3TJNA 5CDFE 2M5TA 4IMQA 2ZHFH 3A87A 1UK2A 3UFAA 5ABWA 3OYPA 2RDLA 5IYTA 1C5PA 1KXBA 2JIZD 2BZAA 1BIOA 3H5CB 3BG8A 1E37B 2EY4C 2ZDVH 4AFQA 1K21H 3MO6A 1DSTA 1W12U 1GHZA 2AGEX 3KHVA 1GBLA 1MBMA 2GZ9A 5FCKA 1OYQA 2ODYB 2BDYA 3F2HA 1C1QA 1BTXA 2Y5GA 1JRSA 2WPDD 1LQDB 2FLBH 2KCOA 5LPRA 1VGCB 5E8EH 4DJZB 1A5IA 5I25A 1Y5AT 3KEEA 4YOJA 4GSOA 2GDDA 1K1NA 1YPEH 1O2WA 1QL7A 1MQ6A 2QF5A 2RA0A 1KXDA 2Z9GA 1LQEA 3KYGA 1DXPA 1AKSB 2C3SA 4RKJB 3EE7A 3S7HB 1V2UT 2JETC 3RUOA 3PTBA 3H09A 1XX9A 5EGMA 1G3CA 4NGAH 4AGJA 2WUBA 4BAHB 4Y6DA 4YESB 1DPOA 4GLYA 2PW8H 4NZLA 1C1SA 1S83A 3K6ZA 4K69A 2EC9H 2OXSA 3U28C 1VITG 2BLOA 1EJAA 1L0ZA 2FI4E 5CHBA 4ABBA 4IBLH 4XFQA 5FAHA 2ZA5A 1ZTKA 3RMNH 3SGAE 5FPTA 2WPMS 4DURA 5J4SA 3GCOA 3UY9A 1VKYA 5DP3A 4H4FA 1SR5C 3FANA 1ZMNA 2UWPA 1MAYA 1BT7A 2THFB 4IMZA 3AW0A 1ZRBA 3LGYA 2BD8A 1GL1A 1ZTJA 1FAKH 3BSQA 3ZIAD 5K0HA 3TGKE 2B5TB 1O2VA 2CHAB 4U30A 2PWXA 2BXTH 3N7EA 5F8TA 1TRNA 1EASA 2A0QB 2GZ8A 1SGIB 2Z94A 2J98A 2VWMA 2Y5FA 1LDTT 1MZAA 4ZXYH 1BRUP 1IQMA 4XBBA 2TRMA 3RXOA 1EX3A 2GTBA 2VH0A 3RXKA 1YLNA 1SQTA 3OY6U 1C1VH 3F9EA 1DFPA 2AEIH 1EAIA 1MQ5A 3STJA 3F9GA 3RXSA 1TQ7B 1OWEA 3D23A 6LPRA 1FIWA 1O3AA 3ZYEA 1TNKA 4YTAA 1LPKB 5A8ZA 4IC5A 1T4UH 1H9IE 1KLIH 1SGCA 1W0YH 3K2UA 3T26A 2GZ7A 3T62A 1V2ST 5C3NA 2G8TA 2BB4A 1MUEB 1MTNC 1OXGA 1GBAA 1O2SA 2BDIA 3LKWA 3HK3B 5GCHG 2A4GA 2QXHA 1T31A 3SU4A 2Y5HA 1UCYK 1HJ8A 1SBWA 5A2MH 4GCHF 4O97A 5FBEA 1P2QA 2XOKD 1TRYA 1T8OA 5T6GA 4A1TA 3V0XA 1EB1H 3KQDA 1YP9A 3LGVA 4TPIZ 1DDJA 1VCQA 5GNDA 1SLXB 2ZFRH 3PO1B 1SI5H 3TLOA 5EJZA 4Y7BA 1JMOH 3GISB 1O5AB 1QRZA 2P94A 2Z3DA 1IHSH 3E91A 3A7TA 1ZTLA 3PLBA 1AB9C 1P57B 1THRH 4XBDA 2ZGJA 2LP6A 1K1LA 2KAIB 3TU7H 2P8OC 2BOHB 3TH4H 2FODA 4F55A 1NROH 3I78A 2BD3A 3MOCA 5GIBA 1L1JA 2GV6A 1SC8U 2W5EA 2J38A 2BTCE
chains in the Genus database with same CATH topology
2P3FH 1O2OA 1CU1A 4Z6AH 3S9CA 2ZQ2A 1O5FH 5C67A 3GY8A 1GBJA 1O2ZA 1TABE 1C5YB 2ILNA 3IG6B 1H4WA 2A4RA 1DS2E 1AVGH 3O8CA 2UUFB 6CHAB 1C2JA 1DWEH 4X2VA 2LNCA 1B5GH 2SGAA 1A0JA 1LPZB 1V2OT 5A0CA 3E3TA 2C90B 2CN0H 4WH8A 1TIOA 1S6FA 3ZYDA 1BCUH 4NA8A 1ZHRA 2GT8A 2BQ6B 3QWCH 3SUGA 1O3EA 2BLQA 2FESH 1G2LA 1HBTH 3F9FA 1EZSC 1G3BA 3MYWA 2ZDKA 4Q80A 3TJOA 1BTYA 1BTZA 2PTNA 1BITA 1LCYA 4INKA 1Z8RA 4GPGA 1NU7B 2OCVB 2BQWB 1YLCA 1EJNA 1ARBA 1GHWH 1QHRB 1CGHA 4IGDA 3A80A 1C5SA 2Y6TA 1UTPA 2BDHA 1ANBA 1HAHH 1C2KA 4K5ZA 2AIQA 4YT7H 2R3UA 1GI7B 4CBOA 1OP8A 2ZCKP 1ELGA 2JETB 4E06H 2GV7A 1DOJA 4IW4E 4UFDH 1C1PA 1N8OB 1MCTA 1WSSH 2ESTE 4IS5A 1MKWH 4WWYA 1C5OH 4K3JA 2SGQE 1SLWB 2H5CA 1UVOA 3GICB 1NT1A 2QYIA 1AGJA 3VEQB 1JOUB 1QBNA 1NU9A 1D9IA 3TNSA 3RXJA 1IQHA 1EOJA 2A31A 1VCWA 4I8KA 1C4U2 3HATH 2Z7FE 1IQNA 1RTKA 4F4OC 5GJ4B 2RA3A 1TGNA 1KLJH 3BTME 3ENSB 5JPMH 1AO5A 1L4DA 3VFEA 1LHGH 1KDQA 2W26A 1SGPE 1S0QA 3UUZA 3PB1E 1O2PA 1BBRK 2PUQH 2D1JA 1C2MA 4B73A 2XBVA 3TH2H 4ABFA 1O5DH 3KN2A 2J9NA 3ATWA 4KTSA 5JDUB 4A5TS 5EW2H 1O3IA 4H42U 3RXTA 2P3UB 2BDCA 2BD9A 3FFGA 1DM4B 3BTQE 1YPGH 1EZXC 3T28A 2PSYA 4IC6A 2GGVB 1XUIA 4RKOB 2ZZUH 1AUJA 4TY7A 1ELCA 2ZWLH 5C2ZA 4D7GA 1U6QA 3LOXA 1ARCA 1Y3XA 1MD8A 2A5AA 1HJAC 3Q3XA 3SUFA 4BOHA 4KTCA 1GCDA 2BY5X 4UDWH 2H9TH 3LGUA 2WPIS 3SGBE 4X1NU 4B76A 4DGJA 3K65B 5FHTA 1XKBC 4DY7B 3RC5A 4X1SU 3O8RA 1TOMH 2YNAA 4ZROA 2SNWA 3ZZBA 1XUKA 2H5DA 1UTNA 1P04A 4AN7A 4GVUA 1ESTA 2HNTE 3ZZ8A 1T8LA 5BRRE 2ZPQA 4ZKNU 3VB3A 1JRTA 2V6NA 2A45B 2AIPA 2H2ZA 1O5CB 3D49H 1UTLM 5F03A 1FY5A 1Y3YA 4NZQA 2BVXH 4WMDA 3MTYA 1BQYA 4UE7H 2TGTA 1AB9B 3M61U 4KTUA 2CJIA 2P8OB 5E2PA 2FO9A 3V13A 3I29A 3Q00A 3M7QA 1TA2A 2BVRH 4D76A 1DE7H 1GMCF 1KLTA 1IAUA 5EU8A 3M5LA 2VINA 5EW1H 1Y8TA 3MH7A 4MLFB 4M7GA 3DUXH 4YO9A 2GCHG 4YOIA 3ITIA 2R2WU 1TNGA 2BDAA 3RXEA 5F8ZA 3V7TA 3O8BA 3EYDA 2TBSA 5E0HA 5DJ7A 5FX6A 4R8TB 2OC0A 4YLQH 3M37A 1HV7A 4GHQA 3KF2A 4B2BA 1N6YA 1YPJH 3MH6A 1LMWB 1DVAH 1UMAH 5PTPA 1GCTB 1QL8A 1GDQA 1P2IA 1HB0B 1D3QB 4OGYA 1KY9A 2Z6BD 1CGJE 4K1SA 1FUJA 1LHCH 3EA7A 1GHBF 2FTMA 4FUBA 1CT2E 1P09A 4DCDA 5LPFA 1E0FD 2HLCA 3SJKA 1EQ9A 1HJ9A 1O34A 2BD2A 1ZSJA 4WMFA 1ELFA 1SGTA 1C5ZB 1F0TA 1CQQA 1UTKA 1QA7A 1YBWA 2ZP0H 4ZHLU 4CRDA 5GPIB 1WQVH 1WAYB 1O2XA 2VJ1A 2PKAB 3NXPA 3OY5U 4BXSA 2ZFSA 1H1BA 5E0JA 2TIOA 2ODPA 1TWXB 3GDSA 1AFQB 3U69H 2FX6A 6ESTA 1W14U 1O5EH 2AFQB 1A0LA 3GDUA 3SV8A 1EB2A 3UOPA 1CHOF 2Q1JA 4INHA 3QN7A 3SV7A 1SGNE 3MH5A 3UR6A 2TGDA 1C5RA 4MPWA 1TA6A 3SQHE 1E38B 2QV1A 3QUMP 1J15A 2BD4A 5AVDA 2XWBI 2XRCA 4LZ4B 2GMTB 3BTFE 3PLPA 1MZDA 1W7XH 2XWAA 1QB9A 2PHBA 2ZHEH 3CENA 1ZRKA 1UTJA 2Z9KA 3UREA 1EOLA 2Z9LA 1FIZA 1Y5UT 3OTJE 1L4ZA 1ELBA 1G3DA 3UTUH 2FXRA 2ANMH 3PWCA 3F1SB 1A61H 1G3EA 3MWIU 3ATKA 3NK8A 5GDSH 2ZTZA 1FAXA 1FXYA 4ZHMU 3STIA 3S9AA 1NPMA 2ZO3H 1GVKB 3QTOH 3F9HA 3RXGA 1DSUA 4CHAB 2HNTC 2FI3E 4DVAU 4BTTB 4I8LA 1GJ8B 1PPGE 3U8RH 3MO3A 2VB0A 1FPCH 2J95A 2BYAX 3P8OA 4NFFA 3ZVDA 1KXCA 1V6DA 3DD2H 3DFLA 2ANYA 3DT0H 2QA9E 1GJ5H 3E1XB 1F2SE 1GBDA 1OWKA 4B74A 1F5KU 2QAAA 3ZZDA 2F9NA 1OWDA 4GHTA 2G4TA 1ABJH 2ZECA 3P17H 3TIUA 3W95A 4BAQB 1OYTH 2I6SA 1RS0A 1EJMA 3VB6A 2PGQB 1RXPA 4XBCA 1SOTA 2ZFQH 2P59A 2A32A 5T6FA 1P11E 3RLWH 3LIWA 3NKKA 1GL0E 4FVDA 1QTFA 2G5NA 2V35A 2CXVA 1QBOA 2OLGA 2O8UA 1HUTH 4O03A 1YYY1 1QJ1B 1KYNA 1EKBB 3ODDA 5FPSA 3V3MA 3SU3A 3M3SA 1RD3B 7GCHG 3M35A 3SU5A 4ZKSU 1G2MA 1GHAF 1AWHB 1Y5BT 1QJ7B 3R3GB 1F7ZA 1ID5H 1PQ7A 2SNVA 2TGAA 3CS7A 1QNJA 1HXFH 3TNTA 3UIRA 2GKVE 3MU8A 5CHAC 6GCHG 1GG6C 5HM9A 1P10A 2ZCHP 3SNCA 1HRTH 1X7AC 1ETSH 6CHAC 2FIRH 4CRFA 1WV7H 1V2WT 3U1JB 2FLRH 3MNXA 1ELVA 4CR5A 1CGIE 1NFYA 2ZU2A 1S5SA 2HPPH 3ELAH 2Y7ZA 2ZG0H 3Q76A 3UNSA 2W3IA 2AGGX 4QT8C 1ZPCA 1BTUA 5F8XA 2PKSB 1QJ6B 1UHBA 2D2DA 1LVMA 2WPHS 1D6WA 5FBIA 2F3CE 3M5MA 2AH4X 5C5NA 1GVLA 1C9PA 4Y7AA 4IN1A 2XBWA 3OU0A 1VJAU 1UCYE 1KXAA 2DE9A 1UJ1A 3BN9A 4XDEA 1TALA 3ZZCA 1W0ZU 1YPHC 1DUAA 1C2GA 1GBFA 3RXUA 2FP7B 1N8OC 1SPJA 3PWBA 5DP9A 3RMMH 2QIQA 1GMHG 4X1QU 5E0GA 4LXBH 4FUGA 1IHTH 1CA0C 1NZQH 4X8UH 2BX4A 2OP9A 3UQOA 5T6DA 7LPRA 4AFZA 3FP6E 1TB6H 2Y82A 2OC8A 1XUJA 1PFXC 4WH6A 2Z3CA 1GBTA 1ZOMA 1AWFH 3TGJE 4ZHAA 4TWWA 4UONA 3TK5A 1NRRH 2WYGA 3K6YA 2ZKSA 2V3OH 4YZUA 5DKMA 1RIWC 3MO9A 4YT6H 2ZI2H 1RJXB 2AMQA 2BY7X 3SJ9A 3UNQA 4OS7A 1GI4A 1MTVA 4X6OA 2FM2A 3QO6A 1MKXH 3ODFA 1ELTA 5L2ZH 3GY3A 4K8YA 5C1XA 1O3GA 2OBOA 1AUTC 1V2KT 1KIGH 1RGQA 2QN5T 1P3CA 4Q7XA 4ASHA 5JYIA 3TVJB 1BOQA 4LK4A 2ZU1A 4DOQA 3RC4A 1Q31A 1ANEA 1W10U 2IPHA 1GJ7B 5AFYH 3M5NA 5EPNA 3ZVGA 2ZDLA 4Y10E 5SGAE 1TGCA 1VITF 3HKIB 1HPGA 5A09A 1NFWA 3LC5A 1AFEH 1QQUA 3PYHA 1AKSA 4ISOA 3MI4A 1ESBA 3M7TA 3I77A 2NU1E 3GY4A 5H4IB 3SNEA 1ESAA 1OKXA 1C9TA 3HPTB 1NY22 3QZQA 1TYNA 4FUHA 4ZH8A 2BY9X 3P6ZB 1PPFE 3T27A 1UVPA 1MKWK 3QTVH 3H7TA 1GI9B 2VIDA 3Q77A 1OS8A 5EXNA 1GHVH 5G4BA 2GCTC 2VU8E 1HIAB 1K1JA 2ZNKH 1MTUA 3GCNA 1J14A 2NU2E 4I33A 3SJIA 3BTDE 1V2JT 1FY8E 1TNLA 3NPSA 1T4VH 2VVUA 1L2EA 1O2HA 1D6RA 1C5NH 1P8VC 1QURH 2VGCC 3FP7E 4K1TA 5GWZA 1FY1A 4NSVA 1AY6H 1XXDA 4D9QA 4NCYA 4ZKRU 1O5BB 4FU8A 1ELEE 3WY8A 1GGDC 4X8VH 2ZHQH 2G52A 1O2RA 1QIXB 1ZZZA 1KXEA 1KSNA 1S0RA 2O8TA 4I31A 1YC0A 3BEFB 5GCHF 2AMDA 2A4QA 2A1DB 1S81A 5CHAB 3RU4T 3O8DA 1GG6B 4RN6A 1GMDG 2ZGCA 2G00A 2XC4A 1BRAA 1Y59T 3BEIB 3M7UA 3TJUA 1QB6A 3B8JA 4FVBA 4MNVA 2R0KA 1SHHB 5A0AE 1P05A 1GCTC 3PV4A 4I8HA 2ZQ1A 1NS3A 4D8NA 1SGFA 1B7XB 2ZTXA 1GJ9B 1Y3UA 4K2YA 4A7IB 2F9VA 1N1LA 3SU2A 1P12E 5HXFA 4ZKOU 2UUKB 1IQEA 1HAOH 2R2MB 8ESTE 1GBCA 2ZGBH 1EAWA 4JZDH 4NFEA 3MU5A 4H6SB 3ATLA 1P2JA 4ABHA 1NFUA 4D7FA 5EG4A 2QGRA 5EQRA 1RTFB 5JBAS 1A3EH 1O39A 1L1NA 1C5XB 4X8SH 2NU0E 5HM2A 1IQGA 2Y81A 5DPAA 1D3PB 2TPIZ 3RXBA 1PPBH 3SZNA 2KAIA 1C1NA 1DT2A 2QF3A 1SQAA 1AFQC 4X1PU 3BTEE 3RXMA 1Z8GA 3U8OH 2Q6GA 3UWIA 1IQLA 1CA0B 1ZSKA 1VR1H 1E36B 3BIUH 4YLUA 1A5GH 3LJOA 3Q3KA 1J9CH 2FS8A 1VITH 3RC6A 2ZFTA 3NCLA 2QY0B 2GMTC 2H9HA 2ZPRA 1GBEA 1H9LB 5DP7A 5ESTE 1H8IH 1F5LA 1RIWB 2PFEA 1THPB 4F49A 1ZMLA 3GDVA 4I32A 2AMPA 1EZQA 3VB4A 3VPKA 3PMAB 1TGTA 4X6NA 1BTPA 1EPTB 4NWKA 3SHAH 1TBRH 1HXEH 3SHCH 1NN6A 1C5VA 5T3HA 9LPRA 3TPIZ 1UK3A 1XMNB 4O3UA 1AN1E 3FZZA 4ZMAH 2P93A 4A1XA 4CHAC 1XVOA 1GI8B 2CF9H 4AOQA 1S82A 4X6MA 4ABGA 3LGWA 1D3TB 4OS6A 4MDSA 3SU1A 3B9FH 4U01A 1DUEA 3SW2B 3EAJA 4VGCC 1HAVB 2H6MA 4JK6A 2ULLA 3TJVA 3RP2A 1BMAA 3P70B 1UVUH 4AFUA 2OC1A 3ZZAA 1YGCH 4AYYB 1C5UA 3KL6A 1AIXH 2Z9IA 1YCPH 2JH0D 4U2WA 3V12A 3U1IB 3GY2A 5DG6A 1O3PB 1UK4A 5L2YH 1EATA 1UTQA 2CMYA 1GMCG 1J16A 4YOGA 1A2CH 1NO9H 2A2QH 2GCTB 4E7RG 1FMGA 1P03A 4Z0KA 4XE4A 3RXAA 3TH3H 1PQ8A 1DY9A 2FWWA 2A5IA 2YNBA 1P01A 1NFXA 4CREA 2QF0A 1ZPBA 1QA0A 4KP0A 1PPCE 2PGBB 8GCHG 5JBTA 1A46H 2EI7A 2EA3A 3A8CA 2VGCB 1T8MA 2ZFPH 3A8BA 5HYOA 1P02A 1MU6B 2JH5D 1AZ8A 1YLDA 1BTHH 4AZ2B 3RXFA 3T5FH 1GVZA 1Q2WA 3SBKA 2OTVA 3EA8A 2BHGA 5A0BA 4JZ1A 3URDA 5JBCS 3AAUA 4KELA 1GGDB 1T32A 2V3HH 3L3TA 1OWIA 1GJ6A 2OUAA 3GCTG 1W7GH 1MCVA 3HK6B 4AB9A 3G01A 2BX3A 1F92A 1JWTA 1HAPH 2F91A 4Q7YA 1IQKA 2OINA 3LH3A 2FS9A 1SLVB 2UUYA 2XCNA 3MH4A 1CT4E 1HAVA 2FYQA 3H7OA 2PKSC 5ESBA 2AS9A 3QLPH 2G81E 1EP5A 2A2XH 4Y71A 4TYDA 2WUCA 1D4PB 5EXLA 4NA7A 2QXGA 4JYVH 4MNYA 1ABIH 3K9XB 4XSKU 2WPLS 4AFSA 3A7ZA 1CE5A 3RXQA 5TJXA 1WUNH 4OS1A 5AF9H 1YCPM 1OSSA 1W11U 2VVCA 1O3JA 1LVYA 2HNTF 3BTKE 4FU7A 2XC5A 1BMMH 2CGAA 4UFGH 3P8FA 1V2VT 1TONA 3SU0A 3TK6A 2IOTA 1BRCE 4ABAA 1P0SH 3A81A 3UQVA 2ZPSA 2BOKA 4I8JA 3BTTE 3P8GA 3A83A 2G51A 2TGPZ 3FVFB 3E6PH 1LPGB 1WYKA 2J34A 1Y3VA 9ESTA 3ZV9A 4CH8B 1CBWB 1B0EA 1W3CA 2GCHF 5FCRA 3GOVB 3RXHA 3LGIA 1DICA 3M3VA 1SGEE 1O3FA 1T7CA 3MU1A 2FDAA 3D62A 2G55A 1TPAE 4UD9H 3QDZB 5AFZH 4MPXA 1MTSA 1TOCB 1N6XA 2F9OA 4R0IA 2WINI 2OBQA 2Q6DA 1LTOA 3SV6A 4UEHH 3LONA 1NRQH 3LH1A 5C1YA 1XUGA 5ETXA 2NWNA 3ATIA 4K1EA 1V2NT 3JZ1B 1CSOE 2FOEA 2UWOA 4BAMB 1DX5M 1C5QA 3SUEA 3SGQE 3T29A 1Y3WA 4HFPB 1FN6A 1LVBA 3W94A 3UNRA 2ALPA 2PV9B 1TNIA 4MQAA 2IN2A 1UTMA 5DP5A 3OSY