2G4UA

Anomalous substructure of porcine pancreatic elastaase (ca)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords elastase-1
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g4uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g4uA01
4UEHH 1VCWA 3PB1E 5JPMH 4BTIB 4BAMB 1D3DB 4UFFH 2HRVA 2WPKS 3QWCH 2ZECA 1DDJA 1HJ9A 4I8GA 1O2HA 1TRMA 2BXTH 4X2XA 3BTDE 3SNBA 2A2XH 1FIZA 2W3KA 2FLBH 4MG3A 2PUXB 1NC6A 3LC5A 2VGCB 2G00A 1SQTA 1QL7A 5FCKA 1D6RA 2B9LA 2WINI 1AZ8A 1IHSH 2G4UA 3SUGA 1FI8A 5DP8A 3MNCA 2G81E 3SU3A 2PGQB 1EJAA 1P11E 1F5KU 4D76A 1P04A 2D8WA 2VIWA 4OS5A 3T27A 1ETRH 4ABAA 2SNWA 2ZHFH 1BBRE 4IC5A 2RDLA 1F2SE 2P3FH 3OY6U 1C2HA 2GDDA 4OS6A 4YOGA 1FONA 4HTCH 3RM0H 3GY3A 1C2LA 1XUFA 1DXPA 1O3GA 1TPAE 4CRBA 2EEKA 1YGCH 1HLTH 4U2WA 1NPMA 2WPHS 6LPRA 1O36A 1YPJH 2OINA 1FUJA 2A7JA 2IJOB 1C1UH 1C1PA 1MBMA 3ZZ9A 3TGKE 4ISOA 2ZQ2A 4BAKB 1UTKA 2ZA5A 3BTQE 3PTBA 2HVXA 1IAUA 3TU7H 1XUHA 3QLPH 1TMBH 1BTHH 6CHAC 1ZSLA 3FFGA 2A31A 2ZWLH 1MD7A 3D65E 1K1MA 3F6UH 1GDUA 1O2WA 4Q7XA 1H9HE 2VIOA 3ATLA 2BTCE 4NWLA 2O8TA 4CBNA 1Z7KA 2QXJA 3F9FA 3H5CB 4Q2KA 3TK6A 2ALPA 1C1MA 3GYLB 4CRAA 1TA2A 3ZV8A 4CRDA 4D8NA 5T6GA 4ZH8A 4IMZA 2FEQH 4ISHH 4YZUA 2QYIA 1CSOE 1DITH 1JMOH 1OWKA 4K8YA 3VB4A 4UONA 1SB1H 4B73A 1RJXB 1V2VT 2Q1JA 1F5LA 2SFAA 1H4WA 2C8WB 1GJ6A 4GAWA 4Z0KA 2OCVB 1Y8TA 2Y6TA 3BTFE 1HAPH 1TIOA 2IPHA 3M3VA 1HXFH 2FOEA 4FUEA 1BJVA 1SOZA 3U1JB 1EATA 3D23A 5ABWA 3Q3KA 3ZZ5A 2K1QA 8GCHG 1DSTA 5EODA 1HUTH 1VGCB 1MCVA 3SGAE 4DJZB 4ZKOU 1PQ7A 5DK1A 4TY6A 3K6YA 2BD9A 2FOCA 6ESTA 1C2DA 3PMJA 1IQHA 4NFFA 4Q7YA 1NY22 1AQ7A 1L1NA 2CJIA 1UTLM 1TNHA 1MH0A 2XBVA 2BDIA 1KXFA 4FU9A 3ELAH 2A4GA 1C5XB 3FANA 1MQ5A 4FUHA 4ABJA 1AMHA 1AI8H 1Y3XA 2F83A 1O3FA 4MNVA 5A8YA 1UVOA 2FI3E 4H4FA 3PO1C 3LGUA 4K1EA 3TLOA 3BTGE 5JBAS 4NSYA 1MKXH 2Z9LA 4XBBA 1Y59T 2O9QA 4HGCA 2QCYA 1ESAA 3H7OA 3Q00A 2QXIA 3RM2H 1ELDE 2JETC 1V2JT 1C5YB 3HKIB 3MH7A 1TNJA 2Q6FA 1Q31A 3VB3A 5LPFA 2G55A 3F9HA 2A45B 2XYAA 3PLKA 1THSH 5ETXA 8LPRA 1JWTA 1S83A 5DG6A 2G5VA 4OGXA 3SNEA 4X1NU 5A8XA 2FOMB 2PKSB 3UNSA 4AB8A 1LTOA 2UUKB 3WY8A 3TK5A 4OGYA 1GI9B 3ZVEA 1KY9A 1HAYB 7LPRA 1C5ZB 3KL6A 4FVDA 1C2FA 9ESTA 5B6OA 1PYTD 1B7XB 3T28A 3UPEA 4B1TA 4OS2A 1GJBB 3OYPA 2Z6BD 1O3OA 1B0EA 1GI4A 3BTEE 1A3BH 4ZXYH 3TGIE 3BSQA 3PROA 1RIWC 4NA7A 4LOYH 2ZGJA 3URCA 1V2NT 2W26A 3BIUH 4JZFH 5JBTA 1MTNB 2XTTB 1WTHD 4I8LA 2A4RA 3IG6B 1SQOA 1XVOA 5EU8A 3SBKA 2OC7A 5FX6A 1J9CH 3KGPA 1L2EA 4CHAB 1SL3A 2FM2A 1DWDH 2GKVE 1AD8H 2PWXA 4DOQA 1O3CA 2PLXA 1MU6B 5I46H 4FUJA 2UUFB 1DUAA 2H9EH 1BDAA 1DSUA 1O39A 3E6PH 1XX9A 1C2MA 1SFQB 1W12U 1CGHA 3T2NA 1TAWA 4DW2U 2ZCLP 2ILNA 2XC4A 1FMGA 3EDXB 2ZDAH 1C5RA 2GMTC 3SNDA 4CR9A 4KKDA 4CH8B 2QAAA 2Y5FA 4Y10E 4QT8C 4B2BA 1ELCA 2OP9A 1AN1E 1K1NA 3E90B 4TYDA 1YPEH 3CS7A 1YM0A 4AGKA 6CHAB 3PLPA 1O2YA 3A88A 1L1JA 4UE7H 2ZU4A 4DT7B 1C1RA 2ZEBA 1M9UA 1Z1IA 3TH4H 1ELTA 1OOKB 1TLDA 2GCTB 3KHVA 4FUFA 3M5MA 1GHBG 4AG1A 4FXGH 1LVMA 3GCTG 1C5SA 2ULLA 2Z9IA 4O3UA 4Y7AA 3LH3A 1TONA 3SZNA 1O2QA 2JH5D 4NIXA 2ODPA 2ZNKH 3LT3A 3LGTA 2BVXH 3PTNA 4Y8XA 1PQ8A 3RXAA 1AKSB 1Z8IB 4UD9H 1QFKH 2TGAA 1LMWB 3TJNA 1V2QT 4Y79A 4AYVB 4WY3A 3P8FA 7GCHF 1KLTA 3ZVDA 5DP5A 5DP9A 1GI2A 2PSYA 3M3TA 4ABIA 2A5IA 4A1XA 5EG4A 1HV7A 1ACBE 3P70B 2HOBA 4BTUB 3I78A 1PFXC 3BF6H 1DXWA 1O2VA 2P3UB 1NFXA 1PPBH 1IQGA 4ZHAA 2VIPA 3BV9B 2XC5A 1BTWA 3RXVA 1P57B 4K3JA 2GX4A 1NRRH 1TOMH 3JZ2B 3KQBA 1BTZA 1TNKA 2PV9B 5DP3A 1BITA 1RFNA 2PTNA 1LKBA 4CHAC 4K69A 1BTPA 2F9BH 3M7TA 4GVUA 2VGCC 1DY9A 2ZTZA 1D3QB 1ZPCA 1PPEE 3L33A 3M37A 3ZZ8A 1C5LH 1EPTC 1FY5A 2XNIA 1WTGH 3KQEA 2R2WU 2YOLA 1T4UH 2GV7A 2B5TB 1NTPA 4ABEA 2WUCA 1GVKB 3FP8E 3T25A 1TALA 1O37A 2WYGA 5C20A 1GGDC 3RXOA 3B8JA 4B76A 1H9IE 2FS9A 4MPVA 4XSKU 1HBTH 1IQKA 1GHAG 2ZCHP 1O3NA 1TBRH 2G51A 4HZHA 2Z9KA 1GG6C 1Y5AT 2PFEA 2FP7B 5T6DA 1J15A 1T32A 2OC0A 1F0SA 1BMMH 1C2IA 1KXBA 1YKTA 4MPUA 1QA7A 3QTVH 1PJPA 5DKMA 2GV6A 1IOEA 4K2YA 2B0FA 5F8XA 4ZUHA 3GCNA 3RMLH 2ZFQH 2O8MA 1TYNA 2H9HA 1PPZA 2SGQE 5L6NH 3QZRA 4Y0YE 4ZMAH 1JRSA 1GBAA 2FMJA 1TGTA 1DS2E 1QBVH 2J2UA 2GTBA 3A7YA 2FOAA 1TB6H 3TITA 1WV7H 3S7HB 1C5VA 3EA9A 5EQRA 3LGWA 3SV6A 4E06H 2P8OB 3LONA 3M61U 3KN2A 1O5CB 2SGDE 3NWUA 1HNEE 3PMBB 5DGJA 3RMNH 3D62A 4Y11E 5BPEA 2RCEA 3DFLA 4INLA 2VWMA 2BQ7B 1O2GH 1E0FD 3U8TH 2CN0H 3SJIA 1C5QA 1AU8A 1G3CA 4FU7A 1K1JA 1KXCA 1Z6JH 4X8TH 3SJ9A 5EQSA 1O5DH 4AFZA 1GBMA 5TJXA 4ABBA 4R8TB 2VWNA 2ANMH 1LPKB 1OPHB 1GBFA 2BXUH 3ATIA 3U9AH 2SNVA 4PROA 1Z6EA 3QN7A 2Z3CA 5EXNA 1WYKA 2EI6A 2NU1E 1G37A 1A3EH 3MO9A 1V6DA 3AAUA 5EXMA 5LGOA 3E8LA 3ODFA 4NG9H 1O3DA 4Y76A 1BOQA 4O3TA 1DWCH 2JKHA 2OC1A 3A87A 1E35B 1N6YA 2ZTXA 3NKKA 2ZHQH 1P2QA 3CS0A 2ZU5A 1EUFA 1GMCF 1FPCH 1LVYA 5CE1A 3FAOA 3I77A 2FWWA 4BANB 1VJAU 2C93B 1S6HA 4BAQB 1YPHE 1BCUH 4X8SH 4D9QA 1NU7B 3ZZ3A 1V3XA 4WJG2 1SGIB 1T31A 1O2KA 1TBQH 2H6MA 1HAHH 1V2LT 5E0GA 1ZHMA 3VB7A 1THPB 1TA6A 1NROH 2ZDLA 4NGAH 2FOGA 4ZAEA 1HYLA 1KDQA 1P2IA 1G2MA 1ZMNA 2CV3A 2PKSC 4CBOA 1NRSH 2BDCA 3MHWU 1GMDF 1G36A 1TGBA 2ALVA 2JH0D 1TX6A 3DD2H 3QUMP 2JH6D 1TNGA 2ZP0H 3A7WA 4FUCA 1EX3A 4IW4E 1P9SA 2VWOA 1RTLA 1EJMA 1JIMA 2A4OA 1ZGVA 3PLBA 2C8ZB 3ZZ7A 1DANH 3LPRA 4B2CA 2V3OH 2FYQA 1O3MA 2GVFA 2BYAX 4F49A 1GDQA 3R3GB 1O3IA 2Q6GA 3ZVCA 1VCPA 2OUAA 1CBWB 2B7DH 4AGJA 2VJ1A 1O31A 3P92A 3S9CA 1UTMA 1O0DH 1AY6H 2ZU3A 1P3EA 1LPZB 1LQEA 1F0RA 3LKWA 4JZDH 4ABFA 1DLKB 1O5GH 1LHEH 3V3MA 1QJ6B 1HFDA 1WU1A 4A6LA 1HAVA 2J9NA 2BLOA 1EKBB 2TPIZ 4X8UH 1ZPZA 2BQ6B 2PSXA 1THRH 2WV4A 2BVSH 1C9PA 4GLYA 5FAHA 3U1IB 3KIDU 1MBQA 1BIOA 3BG4B 1DE7H 3GY7A 3E0NB 4IGDA 1YPLH 1TQ7B 2FX6A 3SNCA 1KYNA 3A89A 1ELEE 3SW2B 1GHYH 1C2EA 3CP7A 1AVGH 1MTWA 1RD3B 2XC0A 3K65B 3QZQA 1BB0B 1LHFH 2ZGCA 1FY3A 4MTBA 3A85A 3OU0A 1K1PA 4X6OA 3ZVAA 1W0YH 4U30A 4K8BA 1HDTH 1EOLA 1MAYA 1BA8B 3R0FA 4BTTB 1V2PT 1GCDA 5GXPA 3AVZA 4XOJA 1QB9A 3UUZA 2F9NA 2OQUA 1QRWA 3B9FH 5AFZH 3OY5U 1VITF 1A61H 1Y5UT 1GBJA 4ISIH 2AGIX 4ISLA 1L1GA 1UVSH 1C5WB 1JXPA 4VGCB 3LDXH 2AERH 1S0QA 1GI3A 2BLVA 4ISNA 1J14A 1ESTA 4GPGA 1C9TA 1SQAA 4JYTA 1GCTB 1YPKH 2PHBA 4GSOA 2GGVB 3RLYH 1EB1H 2ZDKA 1AGJA 2H2ZA 2ZI2H 3RU4E 4SGAE 5EW2H 1AWFH 3UR9A 1WUNH 3NUMA 1RIWB 1K28D 1IQEA 1AVWA 4FU8A 1D4PB 1EB2A 1KIGH 1N8OC 2GD4B 3S0NA 2H5CA 1Z1JA 1V2RT 2XWAA 2V0BA 3Q77A 4AOQA 1DLEA 2BX4A 4WMDA 1V2MT 2RG3A 1FAKH 1O2XA 3DUXH 3P8OA 3SU4A 1EZSC 1ZMJA 3MU8A 3M5LA 5F8TA 1GPZA 3VXFH 4HI3A 4RSPA 1S85A 1F0UA 1DUEA 1OWEA 2CHAC 4JYUH 2XCFA 1A0HB 3E16B 1ZSKA 1QURH 1EAUA 3DT0H 4B71A 3S9BA 3ENSB 4AZ2B 3UREA 2BDHA 3GY8A 3RXTA 4AFUA 3HPTB 2BD2A 5E2OA 1NRQH 3L6PA 1ZTLA 1XXDA 1PPFE 8KME2 1TE0A 1UK3A 2WPLS 1HXEH 3ZZ4A 1MUEB 2ZO3H 2QY0B 1UK4A 7KMEH 5A09A 3BTME 3RXEA 2FI4E 2C4FH 1KTSB 2CF8H 1AKSA 1IQMA 2QC2A 3E0PB 2BLWA 1GBEA 1NFWA 2HLCA 1BBRK 1HIAB 1AUJA 4I8KA 2BB4A 1QJ7B 3KQDA 1EPTB 1BMNH 1TPPA 1MZDA 3TNTA 5H4IB 3SU5A 2BD7A 1SGQE 1ZLRA 4X6PA 3RXGA 2F3CE 1O2ZA 5LPRA 3TGJE 1IQJA 1P2MA 3TK9A 1TX8A 4GHQA 5JB8S 4X1QU 2R9PA 4LZ1H 1GHXH 3PWCA 3U8RH 2FI5E 4GHTA 1LPGB 1GHBF 2ZF0H 1JIRA 5ESTE 1SLWB 3VGCC 4YT6H 1FY8E 1LDTT 5L2ZH 1CGJE 2Y82A 3AW1A 5C1UA 1TPSA 1DM4B 1C4V2 5DP6A 1BBRH 2UWPA 2Y7ZA 1AE5A 3I29A 3F9GA 3O8BA 4MNWA 2VIQA 2KAIA 1GBCA 2A32A 2XWBI 1FQ3A 1GWAA 1OP2A 2BY9X 6GCHG 1P12E 3UNRA 3RXCA 3SV2H 1D6WA 1T8OA 5L2YH 3B23B 1SI5H 3MNXA 2BLQA 1O5AB 2AGGX 5HMAA 1AB9C 2ASUB 1CA0C 2AMPA 1LO6A 4U01A 4NA9H 2CXVA 2I6SA 3W94A 3BTHE 2Z9GA 3RXBA 2H1UA 1HB0B 4AG2A 2ZDVH 5E2PA 3RXUA 2HNTC 3VEQB 4GUXA 2YNAA 1Y3VA 1A0JA 3A8AA 3SI4H 1TGCA 1BHXF 1ORFA 1C2KA 3HGPA 1C1OA 1GBTA 4E7NA 1CHGA 1GL1A 2OTVA 1BRAA 1CE5A 2QXGA 1LQDB 1Y5BT 1UCYK 1S0RA 1HAIH 4E7RG 1UTNA 1YF4A 1EZXC 3EGKH 4MVNA 2GP9B 3GOVB 1GBDA 3ZYDA 2BY5X 3ATKA 1NRPH 3K9XB 1O3JA 1UVUH 3G01A 2V3HH 4TPIZ 1EAWA 5C5NA 3MI4A 2JETB 2VVCA 4LK4A 3T62A 1QA0A 3M5OA 3RXSA 3RDZA 1ID5H 1O30A 1BHXB 1TMTH 4YM9A 2ZHDA 4MNYA 2VB0A 2FODA 5GIBA 1ZRKA 3V0XA 4Y0ZE 2GCHF 4THNH 1XUGA 3A7ZA 2XXLA 3UOUA 1FV9A 4YESB 3K6ZA 4JK5A 1BT7A 1HRTH 1ETSH 1CGIE 2WPMS 3TVJB 3SV8A 2BHGA 3DA9B 5A0CA 1SSXA 2P16A 1PYTC 2BD5A 2BD3A 4B74A 1JBUH 4FVBA 2W3IA 1QQUA 1V2KT 1NN6A 3RC5A 2ZPQA 3C1KA 2FYRA 2EI7A 3SU1A 1K1OA 1CBWC 5GJ4B 4WMEA 1C5OH 3VGCB 4KGAA 2QF3A 1GJDB 2ZFPH 3LU9B 1N8OB 4I8JA 1N1LA 1F5RA 1H9LB 3GCHC 4WMFA 2PR3A 1O3BA 3A7TA 1UTJA 3A81A 1O5EH 3VXEH 1SLXB 2VVUA 3N7OA 4O9VA 3GISB 1NESE 2STBE 1ZOMA 3QO6A 3A7VA 3SQEE 1S82A 5C2ZA 1AB9B 3KNXA 1C2GA 1O33A 3RC6A 1YCPK 3TNSA 2G4TA 1GJ9B 1T8MA 4FUBA 3MH6A 5FBEA 1C5MD 1C1QA 1MKXK 2ZQ1A 2BZAA 4KTCA 3O8RA 3NPSA 2BY7X 4UFGH 1Z8GA 2ZHWH 8GCHF 4I31A 4ABHA 2HNTF 1NRNH 3LH1A 5EPYA 1VITH 1VGCC 3PWBA 1DVAH 4TY7A 4XDEA 1SMFE 4I8HA 1QR3E 4GCHG 2R0LA 1GMHG 1NS3A 3STJA 2ZPRA 2QV1A 6GCHF 3BG4C 1UVPA 4IN2A 4DGJA 2C8YB 1LVOA 1ZHPA 2ZU1A 1BRUP 3V7TA 3KCGH 5GCHF 5L30H 2NWNA 1HAGE 4DURA 4ZXXH 1F92A 1MTVA 1RS0A 1UK2A 3SGQE 3UR6A 5JDUB 2RA3A 2NU4E 1GCTC 2WPJS 3A86A 1IQFA 4AFQA 2A5KA 1A5HA 2W5EA 1K9OE 1P2KA 1SR5C 5C1YA 3RXHA 1ZJDA 3LGIA 1ZYOA 3SU2A 5E8EH 5DP7A 1P2NA 1S5SA 3T29A 3MO3A 3BTWE 1TBZH 1JRTA 3TJVA 4IBLH 5IYTA 1TFXA 1VCQA 2D1JA 5DPAA 1SHHB 1ZPBA 4YLQH 4D7GA 1INCA 3ATWA 1CVWH 3A8CA 1YBWA 4K1SA 1GI7B 3EAJA 4BAHB 1DX5M 2CMYA 3OTJE 1QRXA 2ZFSA 3RU4D 2WUBA 2F91A 4CR5A 5K7RA 1WQSA 3UTUH 1WCZA 1OYTH 1ZTJA 5CHAC 4X1PU 2F9UA 1KTTB 2VVVA 4E05H 5BRRE 2WV5A 1SLUB 3ZZBA 4ASHA 1DWEH 3A8DA 4Z6AH 3OX7U 3ZVFA 2AMDA 5C1XA 1O5BB 3RXJA 2ZTYA 2HWLB 5LPEA 1P03A 1K21H 3Q3YA 3NK8A 1EP5A 1TNIA 5C67A 3QTOH 5PTPA 1BMAA 1QL9A 1A46H 3RLWH 2BD8A 1O5FH 3E3TA 3GDUA 3MYWA 3U98H 1SVPA 1CT0E 5A0AE 1DPOA 3M5NA 2BDAA 5FPTA 1KDQB 7ESTE 1WBGB 3CENA 4WVPE 1ZMLA 1LHGH 2FESH 2FS8A 3GY4A 1P02A 3SJOA 1TX7A 1K1IA 2LPRA 1Z71A 3RP2A 2HPQH 3SUDA 3SNAA 5FX5A 1CU1A 3GYMA 1V2WT 4LXBH 5C3NA 2UWLA 3GDSA 5AF9H 2BZ6H 1A0LA 3RXPA 3RXLA 4NIYA 1WQVH 1SPJA 3BEUA 2ZC9H 3MH5A 1SGPE 4BNRA 4AFSA 1EXFA 3ODDA 3EA7A 1HJAC 1HAOH 3LC3A 2BM2A 2RA0A 4ZKSU 1EZQA 1O2LA 4MLFB 1A5IA 2Z9JA 5EOKA 5FBIA 3M7QA 5J4SA 5F8ZA 1A1RA 3ITIA 3P95A 2CGAA 1O2IA 1ZTKA 4XBDA 1MD8A 2Q6DA 1W14U 2XCNA 5HGGA 2QF0A 4X6MA 3MFJA 2IOTA 1YCPM 1ANEA 1KSNA 1W11U 5CMXH 1EQ9A 5I25A 1YCPH 3KF2A 2ZFTA 1H8DH 4NIWA 3A8BA 1HIAA 1XKBC 4JZEH 2THFB 1ARCA 3EYDA 1UHBB 4YOIA 3UWJH 5SGAE 1QIXB 3MTYA 3SU6A 1G3BA 2CF9H 1UO6A 2XW9A 1XXFA 3MWIU 1FNIA 2J95A 2PTCE 1O3HA 1GI6A 1O2UA 1EOJA 1ZJKA 2GCHG 4OS1A 1DOJA 1MAXA 3VFEA 3TIUA 2BX3A 4NWKA 2EA3A 3NCLA 3PV4A 1CA0B 2PKAB 1V2OT 2HALA 1GHWH 1BMLA 4SGBE 2TBSA 2FPZA 3SHCH 4INKA 3ZZ6A 2TGPZ 1SGYE 2BD4A 1W10U 1QB6A 1IQNA 1C2JA 1NFYA 2BDBA 2R3UA 4RKJB 1Q3XA 1O35A 3E1XB 3SHAH 3SJ8A 3T5FH 2FTLE 5DP4A 2NU3E 3MNBA 3SGBE 2SGEE 4TWWA 5LH8A 3P6ZB 2FDAA 4ABGA 2ODYB 3DFJA 3BIVH 9LPRA 5J4QA 1XUIA 1MKWH 2KAIB 1GGDB 1FXYA 1T8LA 1YP9A 5EQQA 5AVDA 1ANBA 2ZFFH 1TGSZ 1P05A 4IS5A 3S69A 1TRNA 2SGPE 1LKAA 5AFYH 1G3DA 4Y71A 3U8OH 1J16A 3FP6E 5JYIA 1LCYA 3BEFB 1GBKA 1WSSH 1DICA 1ETTH 3MOCA 1IQLA 1PPHE 2GZ9A 4AN7A 1GBBA 4Y8YA 3RXIA 1HJAB 1O2OA 1ELFA 1P2OA 2STAE 2ZGXH 4YTAA 1RTKA 4YO9A 1OWIA 2W7UA 1QRZA 4NZQA 3NXPA 1OS8A 1MKWK 1YYY1 1E38B 1XMNB 1MMJN 3LOXA 2AS9A 5G4BA 1GI5A 1N6XA 1VZQH 1ZHRA 5EGMA 1FN6A 4BAOB 1HAVB 1XKAC 1BTUA 4MNXA 1KXEA 1QCPA 1QY6A 2P8OC 1SFIA 1O34A 1W0ZU 1AO5A 1O2RA 4Y8ZA 2AIPA 3QDZB 3F68H 1W8BH 4H6TA 5EW1H 4FUIA 1IHTH 1BQYA 4O97A 3V13A 2UWOA 5TCCA 1KLJH 1A4WH 1FJSA 3W95A 3ZZDA 1LHCH 4MDSA 3ZVBA 2P95A 2F9PA 1QB1A 1GI1A 2R2MB 5E0HA 1P10A 2G5NA 3LJOA 1QBOA 4DCDA 2QA9E 2SGAA 3M3SA 3RC4A 1GBIA 3PO1B 1DWBH 3TH2H 1Y3WA 2PW8H 5T3HA 3ZZAA 3SO3A 3E91A 1S81A 2BY6X 2FXRA 2C3SA 1RTFB 1C5TA 1UTOA 1YPGH 2UUJB 4K5ZA 2XRCA 4TWYA 3LIWA 1ABIH 2BDGA 2D2DA 1AFQB 1HAZB 2BY8X 1HPGA 2BMGB 4BXSA 1A2CH 2TIOA 4ESTE 3P8NA 4J1YA 5FPYA 1GJ8B 2Z7FE 1P01A 3MO6A 3URDA 1EAIA 1HAXB 2ZG0H 1GL0E 4K1TA 5FCRA 2OQ5A 3PMHB 1SGFA 4HFPB 4BXWA 2OBQA 3HK3B 2A5AA 2ZPSA 5GDSH 5E0JA 1GJCB 1GHAF 1OSSA 1G30B 2J4IA 3AAVA 3JZ1B 2F9OA 3FZZA 1OXGA 1NU9A 2B8OH 2BVRH 3SN8A 2GT7A 1XM1A 1P0SH 1C4Y2 3KQCA 3RMMH 1QNJA 1SG8B 4KTSA 1C4U2 2OD3B 4A1TA 1O3PB 3HGNA 2P3TB 3BEIB 1SGDE 1MU8B 2DE8A 3HATH 3Q76A 2V6NA 4WXVA 3MNSA 1UTQA 3SUFA 1ELGA 1GHZA 2Y5HA 1TPOA 4U32A 3PMAB 1O2JA 1O38A 1TGNA 1ELAA 5JBCS 5FXLA 3O8CA 2OBOA 1MQ6A 1SGEE 4NFEA 5T6FA 4IMQA 1CO7E 2VINA 2FOBA 3L3TA 4CH2B 2ZGBH 1C1WH 1X7AC 4X0WU 2BQWB 1UTPA 1C5UA 1O32A 1YLDA 2P94A 3GY2A 4R0IA 2AH4X 1BZXE 4Q80A 1C5NH 1W13U 3PYHA 4AX9H 1TABE 2FTMA 4ZROA 7GCHG 1G3EA 2TGDA 1UVTH 4WF8A 2Y5GA 3UY9A 4ZHLU 4DIIH 2QXHA 1CT2E 3QX5H 3M36A 1AIXH 1PQ5A 3TJUA 3MU1A 5GCHG 3UNQA 5K0HA 2YNBA 4CRGA 2ANWA 4X6NA 2J94A 1F0TA 1GMHF 4GCHF 2AGEX 5FPSA 2GCTC 4TPYA 3AW0A 3HK6B 1GVLA 3SU0A 3EE0B 4MPXA 3GCTF 2F9VA 1Y3UA 1A7SA 1W7XH 2OXSA 1IQIA 5HM2A 1FN8A 4ZHMU 1G32B 1A5GH 4NZLA 3SI3H 4DG4A 3TH3H 1EP6A 2GT8A 3RU4T 1FPHH 4KP0A 4RKOB 1J8AA 1C1TA 1W3CA 2PKAA 2SGFE 3ZZCA 1U6QA 1OWDA 3DHKH 4FUGA 1O3AA 1E34B 1H1BA 1ZR0A 3RXRA 5CHAB 2GDEH 3OSYA 4JK6A 3GCOA 2QN5T 1OWHA 3RXDA 3EQ0H 4UFDH 4X1SU 3HKJB 5GWZA 2GZ7A 1BUIA 1DY8A 2TRMA 1B0FA 2OC8A 4LZ4B 1QL8A 2A4QA 1FZZA 4Q7ZA 1C1NA 2DUCA 2ZHEH 3AASA 4RN6A 4NCYA 2A7HA 2H9TH 1CQQA 1T8NA 2QGRA 1GMDG 2M5TA 4I32A 3STIA 1CHOF 1ELVA 1AE8H 5C5OA 2OLGA 1KXDA 2HPPH 4KTUA 3NZIA 1FDPA 2A1DB 1VJ9U 4DVAU 5JB9S 2ESTE 1SC8U 2W7SA 2A2QH 5JBBS 1GI0A 3RXQA 2EC9H 1Z8RA 1RGQA 4JCNA 4X2YA 3UOPA 2ZCKP 1Z8JB 4YT7H 2XBYA 3RMOH 3PM3A 5AHGH 1T4VH 1LHDH 1CA8B 1GMCG 1C1VH 3BTTE 3FP7E 1AHTH 1RXPA 2TGTA 1O2PA 2ZZUH 1J17T 4BOHA 4X2WA 4XFQA 2Y7XA 2BOKA 4ZKNU 1ZSJA 3ATMA 2O8UA 1C5PA 3UQVA 3FVFB 4X2VA 5EXLA 1SGCA 1Q2WA 2FLRH 1KLIH 2AEIH 4XBCA 5DJ7A 2G8TA 1HJ8A 1QHRB 3TPIZ 3U69H 2VIVA 4YOJA 1P2JA 2Z3DA 5ESBA 3UWIA 1DFPA 2AMQA 4UFEH 1VR1H 1H8IH 2HNTE 5IDKA 1UHBA 4B75A 2ANYA 3ZV9A 2VWLA 1SGRE 2FO9A 2NU0E 2PGBB 4AB9A 1TWXB 3VB6A 4B2AA 4WXIA 3MU4A 1Y3YA 2ZFRH 4F4OC 1GJ5H 4OS4A 2DE9A 2BOHB 4VGCC 1O3KA 2FOFA 2Y81A 1CHOG 1GBLA 1UCYH 3QK1A 1LVBA 1ANDA 2O8LA 2VH6A 4FUDA 4H6SB 4D9RA 5A0BA 3ESTA 3MMGA 1O2TA 1SHYA 2Z3EA 3K2UA 1P8VC 5TCAA 1BRCE 3S7KB 1EPTA 2CHAB 3BN9A 2XBXA 2P93A 3A82A 2ZIQH 2GZ8A 1V2TT 3O8DA 4I33A 3RXKA 1HGTH 1AZZA 1FAXA 1YC0A 1KXAA 3LJJA 2A7CA 3M35A 5EPNA 2QIQA 3F9EA 1OKXA 2Z94A 2WYJA 1OX1A 3IITA 1SGNE 1EAXA 1XUJA 1NO9H 4UDWH 2J34A 4AYYB 1GBHA 1SOTA 3KEEA 3SORA 1EASA 4AORA 4MQAA 1PQAA 2FIRH 3T26A 2C90B 3IWMA 1E37B 3P17H 1YPHC 1GJ7B 3BTKE 2ODQA 1BRBE 2J38A 3VB5A 2AIQA 4A1VA 1FLEE 1AUTC 1O2NA 1S6FA 3GDVA 2FOHA 2VH0A 1BJUA 1YPMH 1K22H 1FIWA 1QGFA 2HGTH 5F03A 3UIRA 1AWHB 2FZZA 3C27B 1MTSA 2EI8A 4MPWA 8ESTE 3RXMA 4IN1A 5HYOA 3GY6A 1GHVH 1V2ST 1PPGE 5FHTA 1O2MA 1TOCB 1O2SA 2PUQH 1ZGIA 1ARBA 3ZYEA 1P09A 4D7FA 3LGVA 1GDNA 3TJOA 3BG8A 4X1RU 2IN2A 4NA8A 4CRCA 1UMAH 1QQ4A 4CRFA 1ESBA 3RXFA 1ANCA 3D49H 1JOUB 5A2MH 3QGNB 2ZDMA 3FZDA 1T7CA 2WPIS 3H7TA 4ZKRU 1RRKA 1SBWA 1FY1A 1UJ1A 4JZ1A 1DT2A 2XBWA 3MU0A 5F6MA 3SOSA 1EZUC 2Y80A 1L4DA 1QBNA 1AVXA 1MCTA 1P3CA 5HM9A 1W7GH 1L0ZA 1MTNC 2A0QB 4Y7BA 1O3LA 2AYWA 3VPKA 1D9IA 1TQ0B 4O03A 4OS7A 2G52A 3SQHE 1AFQC 1GVZA 3A7XA 4WH8A 4DY7B 1GJ4H 1K1LA 3P8GA 4WWYA 3UFAA 1WAYB 4WH6A 2UUYA 3RUOA 1B5GH 1O3EA 2BDYA 1SLVB 2R0KA 2AFQB 1D3TB 1MZAA 1V2UT 1F7ZA 3SV7A 1OP0A 2H5DA 1EJNA 1D3PB 2ZU2A 4I7YH 1NT1A 2I6QA 1ELBA 3UQOA 1XVMA 1TMUH 1GI8B 5A8ZA 1GJAB 4DIHH 3SJKA 1G2LA 1QTFA 3S9AA 2C8XB 3Q3XA 3MU5A 4IC6A 2VNTA 2D26C 3A80A 3M7UA 1TRYA 2GMTB 1FY4A 1ZZZA 2ZGHA 2ZKSA 2P59A 3ZVGA 1YLCA 4NIVA 3F1SB 4M7GA 3A84A 3SV9A 5GPIB 2ANKH 5DO4H 3V12A 5HXFA 4JYVH 2ZDNA 1P06A 2R3YA 4JMYA 4JZIA 4K60A 4A92A 4CREA 1XUKA 1OYQA 2V35A 1S84A 4A7IB 1AFEH 1P9UA 4XE4A 1UCYE 1C1SA 1NFUA 3GICB 4Y6DA 1NM6A 4YLUA 3SUEA 1MTUA 1ZRBA 2O8WA 1VITG 4INHA 4KELA 2LNCA 1QJ1B 1SGTA 3EA8A 1OWJA 1NZQH 3MH4A 3A83A 1WOFA 2VU8E 4J2YB 1BTXA 1HCGA 1G9IE 2NU2E 2FX4A 4H42U 1CT4E 1W2KH 4X8VH 3LGYA 4NSVA 1TNLA 2J92A 3QGJA 4A5TS 1OP8A 1ABJH 1GG6B 1PPCE 1K2I1 4ABDA 1BTYA 3GY5A 1E36B 1L4ZA 1SGFG 2VIDA 3GCHB
chains in the Genus database with same CATH superfamily
4UEHH 1VCWA 3PB1E 5JPMH 4BTIB 4BAMB 1D3DB 4UFFH 2HRVA 5CDFE 2WPKS 3QWCH 2ZECA 1DDJA 1HJ9A 4I8GA 1O2HA 1TRMA 2BXTH 4X2XA 3BTDE 3SNBA 2A2XH 1FIZA 2W3KA 2FLBH 3KQ5A 4MG3A 2PUXB 1NC6A 3LC5A 2VGCB 2G00A 1SQTA 1QL7A 5FCKA 1D6RA 2B9LA 2WINI 1AZ8A 3W1EA 1IHSH 2G4UA 3SUGA 1FI8A 5DP8A 3MNCA 2G81E 3SU3A 2PGQB 1EJAA 1P11E 1F5KU 3OTPA 4D76A 1P04A 2D8WA 2VIWA 4OS5A 5GNDA 1ETRH 3T27A 4ABAA 2SNWA 2ZHFH 1BBRE 5FL7D 4IC5A 2RDLA 2XNDD 1F2SE 2P3FH 4XRNA 3OY6U 1C2HA 2GDDA 4OS6A 4YOGA 1FONA 4HTCH 3RM0H 5C0TA 3GY3A 1C2LA 3ZIAD 1XUFA 1DXPA 1O3GA 1TPAE 4CRBA 3FOAA 4RT1A 2EEKA 1YGCH 1HLTH 4U2WA 1NPMA 2WPHS 6LPRA 1O36A 1YPJH 2OINA 1FUJA 2A7JA 2IJOB 2K8IA 1C1UH 1C1PA 1MBMA 3ZZ9A 3TGKE 4ISOA 2ZQ2A 4BAKB 1UTKA 2ZA5A 3BTQE 3PTBA 2HVXA 1IAUA 3TU7H 1XUHA 3QLPH 1TMBH 1BTHH 6CHAC 1ZSLA 3FFGA 2A31A 2ZWLH 1MD7A 4RT0A 3D65E 1K1MA 3F6UH 1GDUA 1O2WA 3KYGA 4Q7XA 1H9HE 2VIOA 3ATLA 2BTCE 4NWLA 2O8TA 4CBNA 1Z7KA 2QXJA 3F9FA 3H5CB 4Q2KA 3TK6A 2ALPA 1C1MA 2M2AA 1W0JD 3GYLB 4CRAA 1TA2A 3ZV8A 4CRDA 4D8NA 5T6GA 4ZH8A 4IMZA 2FEQH 4ISHH 4YZUA 2QYIA 1CSOE 1DITH 1JMOH 1OWKA 4K8YA 3VB4A 4UONA 1SB1H 4B73A 1RJXB 1V2VT 2F43B 2Q1JA 1F5LA 2SFAA 1H4WA 2C8WB 1GJ6A 4GAWA 4Z0KA 2OCVB 1Y8TA 2Y6TA 3BTFE 1HAPH 4Z1MD 1TIOA 2IPHA 3M3VA 1HXFH 2FOEA 4FUEA 1BJVA 1SOZA 3U1JB 1EATA 3D23A 5ABWA 3Q3KA 3ZZ5A 2K1QA 8GCHG 2L6OA 1DSTA 1YWUA 5EODA 1HUTH 1VGCB 1MCVA 1SQRA 5HIYA 3SGAE 4DJZB 4ZKOU 3H09A 1PQ7A 5DK1A 4TY6A 3K6YA 2BD9A 2FOCA 6ESTA 1C2DA 3PMJA 1IQHA 4NFFA 4Q7YA 1NY22 1AQ7A 1L1NA 2CJIA 1UTLM 1TNHA 1MH0A 2XBVA 2BDIA 1KXFA 4FU9A 3ELAH 2A4GA 1C5XB 3FANA 1MQ5A 4FUHA 1VKYA 4ABJA 1AMHA 1AI8H 4B6EA 1Y3XA 2F83A 1O3FA 4MNVA 5A8YA 1UVOA 2FI3E 2AHME 4H4FA 3PO1C 3LGUA 4K1EA 3TLOA 3BTGE 5JBAS 4NSYA 1MKXH 2Z9LA 4XBBA 1Y59T 2O9QA 4HGCA 2QCYA 1ESAA 3H7OA 3Q00A 2QXIA 3RM2H 1ELDE 2JETC 1V2JT 1C5YB 3HKIB 3MH7A 1TNJA 2Q6FA 1Q31A 3VB3A 5LPFA 2G55A 3F9HA 2A45B 2XYAA 3PLKA 1THSH 5ETXA 8LPRA 1JWTA 2VBCA 1S83A 5DG6A 2G5VA 4OGXA 3SNEA 4X1NU 5A8XA 2FOMB 2PKSB 3UNSA 4AB8A 1LTOA 2UUKB 3WY8A 3TK5A 4OGYA 1GI9B 3ZVEA 1KY9A 1HAYB 7LPRA 1C5ZB 3KL6A 4FVDA 1C2FA 9ESTA 5B6OA 1PYTD 2WV9A 1B7XB 3T28A 3UPEA 4B1TA 4OS2A 4HG6A 1GJBB 3OYPA 2Z6BD 4FOUC 1O3OA 1B0EA 1GI4A 4DT4A 3BTEE 1A3BH 4ZXYH 3TGIE 3BSQA 3PROA 1RIWC 4NA7A 4LOYH 2ZGJA 3URCA 1V2NT 2W26A 3BIUH 4JZFH 5JBTA 1MTNB 2XTTB 1WTHD 4I8LA 2A4RA 3IG6B 1SQOA 1XVOA 5EU8A 3SBKA 2OC7A 5FX6A 1J9CH 3KGPA 1L2EA 4CHAB 1SL3A 2FM2A 1DWDH 2GKVE 1AD8H 2PWXA 4DOQA 1O3CA 2PLXA 1MU6B 5I46H 4FUJA 2UUFB 1DUAA 2H9EH 3N7DA 1BDAA 1DSUA 1O39A 3E6PH 1XX9A 1C2MA 1SFQB 1W12U 1CGHA 3T2NA 1TAWA 4I86A 4DW2U 2ZCLP 2ILNA 2XC4A 1FMGA 3EDXB 2ZDAH 1C5RA 2GMTC 3SNDA 4CR9A 4KKDA 4CH8B 2QAAA 2JIZD 2Y5FA 4Y10E 4QT8C 4B2BA 1ELCA 2OP9A 3F2GA 1AN1E 1K1NA 3E90B 4TYDA 1YPEH 3CS7A 1YM0A 4AGKA 6CHAB 3PLPA 1O2YA 3A88A 1L1JA 4UE7H 2KCOA 2ZU4A 4DT7B 1C1RA 2ZEBA 1M9UA 1Z1IA 3TH4H 1ELTA 1OOKB 1TLDA 2GCTB 3KHVA 4FUFA 3M5MA 1GHBG 4AG1A 4FXGH 1LVMA 3GCTG 1C5SA 2ULLA 2Z9IA 4O3UA 4Y7AA 3LH3A 1TONA 3SZNA 1O2QA 2JH5D 4NIXA 2ODPA 2ZNKH 3LT3A 3LGTA 2BVXH 5KECA 2WSSD 3PTNA 4Y8XA 1PQ8A 3RXAA 1AKSB 1Z8IB 4UD9H 1QFKH 2TGAA 1LMWB 3TJNA 1V2QT 4Y79A 4AYVB 4WY3A 3P8FA 7GCHF 1KLTA 3ZVDA 5DP5A 5DP9A 1GI2A 2PSYA 3M3TA 4ABIA 2A5IA 4A1XA 5EG4A 1HV7A 1ACBE 3P70B 2HOBA 4BTUB 3I78A 1PFXC 3BF6H 3PV2A 1DXWA 1O2VA 2P3UB 1NFXA 1PPBH 1IQGA 4ZHAA 2VIPA 4TSFD 3BV9B 2XC5A 1BTWA 3RXVA 1P57B 4K3JA 2GX4A 1NRRH 1TOMH 3JZ2B 3KQBA 1BTZA 1TNKA 2PV9B 5DP3A 1BITA 1RFNA 2PTNA 1LKBA 4CHAC 4K69A 1BTPA 1SKYE 2F9BH 3M7TA 2VGCC 1DY9A 2ZTZA 4GVUA 1D3QB 1ZPCA 1PPEE 3L33A 3M37A 3ZZ8A 1C5LH 1EPTC 1FY5A 2XNIA 1WTGH 3KQEA 1E1QD 2R2WU 2YOLA 1T4UH 2GV7A 2B5TB 1NTPA 4ABEA 2WUCA 1GVKB 3FP8E 3T25A 1TALA 1O37A 2WYGA 5C20A 1GGDC 3RXOA 3OE7D 3B8JA 4B76A 1WDIA 1H9IE 2FS9A 4MPVA 4XSKU 1HBTH 1IQKA 1GHAG 2ZCHP 1O3NA 1TBRH 2G51A 4HZHA 2Z9KA 1GG6C 1Y5AT 2PFEA 2FP7B 5T6DA 1J15A 1T32A 3OAAD 2J5UA 1F0SA 2OC0A 1BMMH 1C2IA 1KXBA 1YKTA 4MPUA 1QA7A 3QTVH 3FN8A 1PJPA 5DKMA 2GV6A 1IOEA 4K2YA 2B0FA 5F8XA 4ZUHA 3GCNA 4TT3D 3RMLH 2ZFQH 2O8MA 1TYNA 2H9HA 1PPZA 2SGQE 5L6NH 3QZRA 3PRBA 4Y0YE 4ZMAH 1JRSA 1GBAA 2FMJA 1TGTA 1DS2E 1QBVH 2J2UA 2GTBA 3A7YA 2FOAA 1TB6H 3TITA 1WV7H 3S7HB 1C5VA 3EA9A 5EQRA 3LGWA 3SV6A 1S6LA 4E06H 2P8OB 1NBMD 3LONA 3M61U 3KN2A 1O5CB 2SGDE 3NWUA 1HNEE 3PMBB 5DGJA 3RMNH 3D62A 4Y11E 5BPEA 2RCEA 3DFLA 4INLA 2VWMA 2BQ7B 1O2GH 1E0FD 3U8TH 2CN0H 1W0KD 1C5QA 1AU8A 1G3CA 4FU7A 3SJIA 1K1JA 1KXCA 1Z6JH 4X8TH 3SJ9A 1BMFD 5EQSA 2OK5A 1O5DH 4AFZA 1GBMA 5TJXA 4ABBA 4R8TB 2VWNA 2ANMH 1LPKB 1OPHB 1GBFA 2BXUH 3ATIA 3U9AH 2SNVA 2RDEA 4PROA 1Z6EA 3QN7A 2Z3CA 5EXNA 1WYKA 1FX0B 2EI6A 2NU1E 1G37A 1A3EH 2WZQA 2F4LA 3MO9A 1V6DA 3AAUA 5EXMA 5LGOA 3E8LA 3ODFA 3DSPA 4NG9H 1O3DA 4Y76A 1BOQA 4O3TA 1DWCH 2JKHA 2OC1A 3A87A 1E35B 1N6YA 2ZTXA 3NKKA 2ZHQH 1P2QA 3CS0A 2ZU5A 1EUFA 1GMCF 1FPCH 1LVYA 5CE1A 3FAOA 3I77A 2FWWA 4BANB 1VJAU 2C93B 1S6HA 4BAQB 1YPHE 1BCUH 4X8SH 4D9QA 1NU7B 3ZZ3A 1V3XA 4WJG2 1SGIB 1T31A 1O2KA 1TBQH 2H6MA 1HAHH 1V2LT 5E0GA 1ZHMA 3OFND 3VB7A 1THPB 1TA6A 1NROH 2ZDLA 4NGAH 2FOGA 4ZAEA 1HYLA 1KDQA 1P2IA 1G2MA 1ZMNA 2CV3A 2PKSC 4CBOA 1NRSH 2BDCA 3MHWU 1GMDF 1G36A 1TGBA 2ALVA 2JH0D 1TX6A 3DD2H 3QUMP 1H8HD 2JH6D 2HLDD 1TNGA 2ZP0H 3A7WA 4FUCA 1EX3A 4IW4E 1P9SA 2VWOA 1RTLA 1EJMA 1JIMA 2A4OA 1ZGVA 3PLBA 2C8ZB 3ZZ7A 1DANH 3LPRA 4B2CA 2V3OH 2FYQA 1O3MA 2GVFA 2BYAX 4F49A 1GDQA 3R3GB 1O3IA 2Q6GA 3ZVCA 1VCPA 3F2HA 2OUAA 1CBWB 2B7DH 4AGJA 2VJ1A 1O31A 3P92A 3S9CA 1UTMA 1O0DH 1AY6H 2ZU3A 1P3EA 1LPZB 1LQEA 3CNRA 1F0RA 3LKWA 4JZDH 4ABFA 4F48B 1DLKB 1O5GH 1LHEH 3V3MA 1QJ6B 1HFDA 1WU1A 4A6LA 1HAVA 2J9NA 2BLOA 1EKBB 2TPIZ 4X8UH 1ZPZA 2BQ6B 2PSXA 1THRH 2WV4A 2BVSH 1C9PA 4GLYA 5FAHA 3U1IB 3KIDU 1MBQA 1BIOA 3BG4B 1DE7H 3GY7A 3E0NB 4IGDA 1YPLH 1TQ7B 2FX6A 3SNCA 1KYNA 3A89A 1ELEE 3SW2B 1GHYH 4ZCNA 1C2EA 3CP7A 1AVGH 1MTWA 1RD3B 2XC0A 3K65B 3QZQA 1BB0B 1LHFH 2ZGCA 1FY3A 4MTBA 3A85A 3OU0A 1K1PA 4X6OA 3ZVAA 1W0YH 4U30A 4K8BA 4AC9A 1HDTH 1EOLA 1MAYA 1BA8B 3R0FA 4BTTB 1V2PT 2K0QA 1GCDA 5GXPA 3AVZA 4XOJA 1QB9A 3UUZA 2F9NA 2OQUA 1QRWA 3B9FH 4P00A 5AFZH 3OY5U 1VITF 1A61H 1Y5UT 1GBJA 4ISIH 2AGIX 4ISLA 1L1GA 1UVSH 1C5WB 1JXPA 4VGCB 3LDXH 2AERH 1S0QA 1GI3A 2BLVA 4ISNA 1J14A 1ESTA 4GPGA 1C9TA 1SQAA 5C17A 4JYTA 1GCTB 1YPKH 2PHBA 4GSOA 2GGVB 3RLYH 1EB1H 2ZDKA 1AGJA 2H2ZA 2ZI2H 3RU4E 4SGAE 5EW2H 1AWFH 3UR9A 1WUNH 3NUMA 5DN6D 1RIWB 1K28D 1IQEA 1AVWA 4FU8A 1D4PB 1EB2A 1KIGH 1N8OC 2GD4B 3S0NA 2H5CA 1Z1JA 1V2RT 2W6ID 2XWAA 2V0BA 1UW7A 3Q77A 4AOQA 1DLEA 2BX4A 4WMDA 1V2MT 2RG3A 1FAKH 1O2XA 3DUXH 3P8OA 3SU4A 1EZSC 1ZMJA 3MU8A 3M5LA 5F8TA 1GPZA 5IK2D 3VXFH 4HI3A 4RSPA 1S85A 1F0UA 1DUEA 1OWEA 2CHAC 4JYUH 2XCFA 1A0HB 3E16B 1ZSKA 1QURH 1EAUA 3DT0H 4B71A 3S9BA 3ENSB 4AZ2B 3OEED 3UREA 2BDHA 3GY8A 3RXTA 4AFUA 3HPTB 2BD2A 5E2OA 2QF5A 1NRQH 3L6PA 1ZTLA 1XXDA 1PPFE 8KME2 1TE0A 1UK3A 2WPLS 1HXEH 3ZZ4A 1MUEB 2ZO3H 2QY0B 1UK4A 3F2FA 7KMEH 5A09A 3BTME 3RXEA 2FI4E 2C4FH 1KTSB 3UB0A 2CF8H 1AKSA 1IQMA 2QC2A 3E0PB 2BLWA 1GBEA 1NFWA 2HLCA 1BBRK 1MABB 1HIAB 1AUJA 4I8KA 2BB4A 1QJ7B 3KQDA 1EPTB 1BMNH 1TPPA 1MZDA 3TNTA 5H4IB 3SU5A 2BD7A 1SGQE 1ZLRA 4X6PA 3RXGA 2F3CE 1O2ZA 5LPRA 3TGJE 1IQJA 1P2MA 3TK9A 1TX8A 4GHQA 5JB8S 4X1QU 5EJZA 2R9PA 4LZ1H 1GHXH 3PWCA 3U8RH 2FI5E 4GHTA 1LPGB 1GHBF 2ZF0H 1JIRA 2RFKC 5ESTE 1SLWB 3VGCC 4YT6H 1FY8E 5KGOA 1LDTT 5L2ZH 1CGJE 2Y82A 3AW1A 5C1UA 1TPSA 1DM4B 1C4V2 5DP6A 1BBRH 2UWPA 2Y7ZA 1AE5A 3I29A 3F9GA 3O8BA 4MNWA 2VIQA 2KAIA 1GBCA 2A32A 2XWBI 1FQ3A 1GWAA 1OP2A 2BY9X 2V7QD 1P12E 6GCHG 3UNRA 3RXCA 3SV2H 1D6WA 1T8OA 5L2YH 3B23B 1SI5H 3MNXA 2BLQA 1O5AB 2AGGX 5HMAA 1AB9C 2ASUB 1CA0C 2AMPA 1LO6A 4U01A 4NA9H 2PP6A 2CXVA 2I6SA 3W94A 3BTHE 3N7EA 2KZ4A 2Z9GA 3RXBA 2H1UA 1HB0B 4AG2A 2ZDVH 5E2PA 3RXUA 2HNTC 3VEQB 4GUXA 2YNAA 3UAIC 1Y3VA 1A0JA 3A8AA 3SI4H 1TGCA 1BHXF 1ORFA 1C2KA 3HGPA 1C1OA 1GBTA 4E7NA 1CHGA 1GL1A 2LELA 2OTVA 1BRAA 1CE5A 2QXGA 1COWD 1LQDB 1UCYK 1Y5BT 1S0RA 1HAIH 4E7RG 1UTNA 1YF4A 1EZXC 3EGKH 4MVNA 2GP9B 3GOVB 1GBDA 3ZYDA 2BY5X 3ATKA 1NRPH 3K9XB 1O3JA 1UVUH 3G01A 2V3HH 4TPIZ 1EAWA 5C5NA 3MI4A 2JETB 2VVCA 4LK4A 3T62A 1QA0A 3M5OA 3RXSA 3RDZA 1ID5H 1O30A 1BHXB 1TMTH 4YM9A 2ZHDA 4MNYA 2VB0A 2FODA 2KR7A 5GIBA 1ZRKA 3V0XA 4Y0ZE 2GCHF 4THNH 2WHXA 1XUGA 3A7ZA 2XXLA 3UOUA 1FV9A 4YESB 3K6ZA 4JK5A 1BT7A 1HRTH 4OM9A 1ETSH 1CGIE 2WPMS 3TVJB 3SV8A 2BHGA 3DA9B 5A0CA 1SSXA 2P16A 1PYTC 2BD5A 2BD3A 4B74A 1JBUH 4FVBA 2W3IA 1QQUA 1V2KT 1NN6A 3RC5A 2ZPQA 3C1KA 2FYRA 2EI7A 3SU1A 1K1OA 1CBWC 5GJ4B 4WMEA 1C5OH 1YY3A 4KGAA 3VGCB 2QF3A 1GJDB 3MQKC 2ZFPH 3LU9B 1N8OB 2J98B 4I8JA 1N1LA 1F5RA 1H9LB 3GCHC 4WMFA 2PR3A 1O3BA 3A7TA 1UTJA 3A81A 1O5EH 3F3BA 3VXEH 1SLXB 4XD7D 2VVUA 4RI0A 3N7OA 4O9VA 3GISB 1NESE 2STBE 1ZOMA 3QO6A 3A7VA 3SQEE 1S82A 5C2ZA 1AB9B 3KNXA 1C2GA 1O33A 3RC6A 1YCPK 3TNSA 2G4TA 1GJ9B 2EQNA 1T8MA 4FUBA 3MH6A 5FBEA 3WWBA 1C5MD 1C1QA 1MKXK 2ZQ1A 5HKKD 2BZAA 4KTCA 3O8RA 3NPSA 2BY7X 4UFGH 1Z8GA 2ZHWH 8GCHF 4I31A 4ABHA 2HNTF 1NRNH 3LH1A 5EPYA 1VITH 2V3MA 3DSGA 2HVYB 5DSFA 1VGCC 3PWBA 2KCAA 1DVAH 4TY7A 4XDEA 1SMFE 4I8HA 1QR3E 4GCHG 2R0LA 1GMHG 1NS3A 3STJA 2ZPRA 2QV1A 6GCHF 3BG4C 1UVPA 4IN2A 4DGJA 2C8YB 1LVOA 1ZHPA 2ZU1A 1BRUP 3V7TA 3KCGH 5GCHF 5L30H 2NWNA 1HAGE 4DURA 4ZXXH 2KCYA 1F92A 1MTVA 1RS0A 1UK2A 3SGQE 3UR6A 5JDUB 2RA3A 2NU4E 1GCTC 2WPJS 3A86A 1IQFA 4AFQA 2A5KA 1A5HA 2W5EA 1K9OE 1P2KA 1SR5C 5C1YA 3RXHA 1ZJDA 3LGIA 1ZYOA 3SU2A 5E8EH 5DP7A 1P2NA 1S5SA 3T29A 3MO3A 3BTWE 3F0PA 1TBZH 1JRTA 3TJVA 4IBLH 5IYTA 1TFXA 1VCQA 2D1JA 5DPAA 1SHHB 1ZPBA 4YLQH 4D7GA 1INCA 3ATWA 4P02A 1CVWH 3A8CA 1YBWA 4K1SA 1GI7B 3EAJA 4BAHB 1DX5M 2CMYA 3OTJE 2J98A 1QRXA 2ZFSA 3RU4D 2WUBA 2CK3D 2F91A 4CR5A 5K7RA 1WQSA 3UTUH 1WCZA 1OYTH 2KCPA 1E79D 1ZTJA 5CHAC 4X1PU 2F9UA 5EIYA 1KTTB 2VVVA 4E05H 5BRRE 2WV5A 1SLUB 3ZZBA 4ASHA 1DWEH 3A8DA 4Z6AH 3OX7U 3ZVFA 2AMDA 5C1XA 1O5BB 3RXJA 2ZTYA 2HWLB 5LPEA 1P03A 1K21H 3Q3YA 3NK8A 4FETA 1EP5A 1TNIA 5C67A 3QTOH 5PTPA 1BMAA 1QL9A 1A46H 3RLWH 2BD8A 1O5FH 3E3TA 3GDUA 3MYWA 2W6JD 3U98H 1SVPA 1CT0E 5A0AE 1DPOA 3M5NA 2BDAA 5FPTA 1KDQB 7ESTE 1WBGB 3CENA 4WVPE 1ZMLA 1LHGH 2FESH 2FS8A 5F53A 3GY4A 1P02A 3SJOA 1TX7A 1K1IA 2LPRA 1Z71A 1WXRA 3RP2A 2JJ2D 2HPQH 3SUDA 3SNAA 5FX5A 1CU1A 3GYMA 1V2WT 4LXBH 5C3NA 2UWLA 3GDSA 5AF9H 2BZ6H 1A0LA 3RXPA 3RXLA 4NIYA 1WQVH 2KM0A 1SPJA 3BEUA 2ZC9H 3MH5A 1SGPE 4BNRA 4AFSA 1EXFA 3ODDA 3EA7A 1HJAC 1HAOH 3LC3A 2BM2A 2RA0A 4ZKSU 4F55A 1EZQA 1O2LA 4MLFB 1A5IA 2Z9JA 5EOKA 5FBIA 3M7QA 5J4SA 5F8ZA 1A1RA 3ITIA 3P95A 2CGAA 1O2IA 1ZTKA 4XBDA 5KEDA 1MD8A 2Q6DA 1W14U 2XCNA 2YMSB 3PRDA 5HGGA 2QF0A 4X6MA 3MFJA 2IOTA 1YCPM 1ANEA 1KSNA 1W11U 5CMXH 1EQ9A 5I25A 1YCPH 3KF2A 2ZFTA 1H8DH 4NIWA 3A8BA 1HIAA 1XKBC 3EE7A 4JZEH 2THFB 1ARCA 3EYDA 1UHBB 4YOIA 3UWJH 5SGAE 1QIXB 3MTYA 3SU6A 1G3BA 2CF9H 1UO6A 1XXFA 2XW9A 3MWIU 1FNIA 2J95A 2PTCE 1O3HA 1GI6A 1O2UA 1EOJA 1ZJKA 1QZ8A 2GCHG 4OS1A 1DOJA 1MAXA 3VFEA 3TIUA 2BX3A 4NWKA 2EA3A 3NCLA 3PV4A 1CA0B 2PKAB 1V2OT 2HALA 1GHWH 1BMLA 4SGBE 2TBSA 2FPZA 3SHCH 4INKA 3ZZ6A 2TGPZ 1SGYE 2BD4A 1W10U 1QB6A 4Q63A 1IQNA 1C2JA 1NFYA 2BDBA 2R3UA 4RKJB 1Q3XA 1O35A 3E1XB 3SHAH 3SJ8A 3T5FH 2FTLE 5DP4A 2NU3E 3MNBA 3SGBE 2SGEE 4TWWA 5LH8A 3P6ZB 2FDAA 4ABGA 2ODYB 3DFJA 3BIVH 9LPRA 5J4QA 1XUIA 1MKWH 2KAIB 1GGDB 1FXYA 1T8LA 1YP9A 5EQQA 5AVDA 1ANBA 2ZFFH 1TGSZ 1P05A 4IS5A 3S69A 1TRNA 2SGPE 1LKAA 3NRLA 1G3DA 5AFYH 4Y71A 3U8OH 1J16A 3FP6E 5JYIA 1LCYA 3BEFB 1GBKA 1WSSH 1DICA 1ETTH 3MOCA 1IQLA 1PPHE 2GZ9A 4AN7A 1GBBA 4Y8YA 3RXIA 1HJAB 1EFRD 1O2OA 3U28C 1ELFA 1P2OA 2STAE 2ZGXH 4YTAA 1RTKA 4YO9A 2JJ1D 1OWIA 2W7UA 1QRZA 4NZQA 3NXPA 1OS8A 1MKWK 1YYY1 3KYFA 1E38B 1XMNB 1MMJN 3LOXA 2AS9A 5G4BA 1GI5A 1N6XA 1VZQH 1ZHRA 5EGMA 1FN6A 4BAOB 1HAVB 1XKAC 1BTUA 5EJLA 4MNXA 1KXEA 1QCPA 1QY6A 2P8OC 4YXWD 1SFIA 1O34A 1W0ZU 1AO5A 1O2RA 4Y8ZA 2AIPA 3QDZB 3F68H 1W8BH 4H6TA 5EW1H 4FUIA 1IHTH 1BQYA 4O97A 3V13A 2UWOA 5TCCA 1KLJH 1A4WH 1FJSA 3W95A 3ZZDA 1LHCH 4MDSA 3ZVBA 2P95A 1OHHD 2F9PA 1K0HA 1QB1A 1GI1A 2R2MB 5E0HA 4ACAA 1P10A 2G5NA 3DCLA 3LJOA 1QBOA 4DCDA 2QA9E 2SGAA 4B6FA 3M3SA 3RC4A 1GBIA 3PO1B 1DWBH 3TH2H 1Y3WA 2PW8H 5T3HA 3ZZAA 3SO3A 3E91A 1S81A 2BY6X 2FXRA 2C3SA 1RTFB 1C5TA 1UTOA 1YPGH 2XOKD 2UUJB 4K5ZA 2XRCA 4TWYA 3LIWA 4Q4LA 1ABIH 2BDGA 2D2DA 1AFQB 1HAZB 2BY8X 1HPGA 2BMGB 4BXSA 1A2CH 2TIOA 4ESTE 3P8NA 4J1YA 5FPYA 1GJ8B 2Z7FE 1P01A 3MO6A 3URDA 1EAIA 1HAXB 2ZG0H 1GL0E 2GJGA 4K1TA 5FCRA 5C94A 2OQ5A 3PMHB 1SGFA 4HFPB 4BXWA 2OBQA 3HK3B 2A5AA 2ZPSA 5GDSH 5E0JA 1GJCB 1GHAF 1OSSA 1G30B 2J4IA 3AAVA 3JZ1B 5C0UA 2F9OA 3FZZA 1OXGA 1NU9A 2B8OH 2BVRH 3SN8A 2GT7A 1XM1A 1P0SH 1C4Y2 2LP6A 3KQCA 3RMMH 1QNJA 1SG8B 4KTSA 1C4U2 2OD3B 4A1TA 1O3PB 3HGNA 2P3TB 3BEIB 1SGDE 1MU8B 2QF4A 2DE8A 3HATH 3Q76A 2V6NA 4WXVA 3MNSA 1UTQA 3SUFA 1ELGA 1GHZA 2Y5HA 1TPOA 4U32A 3PMAB 1O2JA 1O38A 1TGNA 1ELAA 5JBCS 5FXLA 3O8CA 2OBOA 1MQ6A 3PV5A 1SGEE 4NFEA 5T6FA 4IMQA 1CO7E 3GS9A 2VINA 2FOBA 3L3TA 4CH2B 2ZGBH 1C1WH 5HIZA 1X7AC 4X0WU 2BQWB 1UTPA 1C5UA 1O32A 1YLDA 2P94A 3GY2A 4R0IA 2AH4X 1BZXE 4Q80A 1C5NH 1W13U 3PYHA 4AX9H 1TABE 2FTMA 4ZROA 2KX4A 7GCHG 1G3EA 2TGDA 1UVTH 4WF8A 2Y5GA 3UY9A 4ZHLU 4DIIH 2QXHA 1CT2E 3QX5H 3M36A 1AIXH 1PQ5A 3TJUA 3MU1A 5GCHG 3UNQA 5K0HA 2YNBA 4CRGA 2ANWA 4X6NA 2J94A 1F0TA 1GMHF 4GCHF 2AGEX 5FPSA 2GCTC 4TPYA 3AW0A 3HK6B 3FO8D 1GVLA 3SU0A 3EE0B 4MPXA 3GCTF 2F9VA 1Y3UA 1A7SA 1YLNA 1W7XH 2OXSA 1IQIA 5HM2A 1FN8A 4ZHMU 1G32B 1A5GH 4NZLA 3SI3H 4DG4A 3TH3H 1EP6A 2GT8A 3RU4T 1FPHH 4KP0A 4RKOB 1J8AA 1H8ED 1C1TA 1W3CA 2PKAA 2SGFE 3ZZCA 1U6QA 2YMSC 1OWDA 3DHKH 4FUGA 1O3AA 5EJ1A 1E34B 1H1BA 1ZR0A 3RXRA 5CHAB 2GDEH 3OSYA 4JK6A 3GCOA 2QN5T 1OWHA 3RXDA 3EQ0H 4UFDH 4X1SU 3HKJB 5GWZA 2GZ7A 1BUIA 1DY8A 2TRMA 1B0FA 2OC8A 4LZ4B 1QL8A 2A4QA 1FZZA 2IJD1 4Q7ZA 1C1NA 2DUCA 2L74A 2ZHEH 3AASA 4RN6A 4NCYA 2A7HA 2H9TH 1CQQA 1T8NA 2QGRA 1GMDG 2M5TA 4I32A 3STIA 1CHOF 1ELVA 1AE8H 5C5OA 2OLGA 1KXDA 2HPPH 4KTUA 3NZIA 1FDPA 2A1DB 1VJ9U 4DVAU 5JB9S 2ESTE 1SC8U 2W7SA 2A2QH 5JBBS 1GI0A 3RXQA 2EC9H 1Z8RA 1RGQA 4JCNA 4X2YA 3UOPA 2ZCKP 1Z8JB 4YT7H 2XBYA 3RMOH 3PM3A 5AHGH 4ASUD 1T4VH 1LHDH 1CA8B 1GMCG 1C1VH 3BTTE 3FP7E 1AHTH 1RXPA 2TGTA 1O2PA 2ZZUH 1J17T 4BOHA 4X2WA 4XFQA 2Y7XA 2BOKA 4ZKNU 1ZSJA 3ATMA 2O8UA 1C5PA 3UQVA 3FVFB 4X2VA 5EXLA 4ACBA 1SGCA 1Q2WA 2FLRH 5CHBA 1KLIH 2AEIH 4XBCA 5DJ7A 2G8TA 1HJ8A 1QHRB 3TPIZ 3U69H 2VIVA 4YOJA 1P2JA 2Z3DA 5ESBA 3UWIA 1DFPA 2AMQA 4UFEH 1VR1H 1H8IH 2HNTE 5IDKA 1UHBA 4B75A 2ANYA 3ZV9A 2VWLA 1SGRE 2FO9A 2NU0E 2PGBB 4AB9A 1TWXB 3VB6A 4B2AA 4WXIA 3MU4A 1Y3YA 2ZFRH 4F4OC 2J97A 1GJ5H 4OS4A 2DE9A 2BOHB 4VGCC 1O3KA 2FOFA 2Y81A 1CHOG 1GBLA 1UCYH 3QK1A 1LVBA 1ANDA 2O8LA 2VH6A 4FUDA 4H6SB 4D9RA 5A0BA 3ESTA 3MMGA 1O2TA 1SHYA 2Z3EA 3K2UA 1P8VC 5TCAA 1BRCE 3S7KB 1EPTA 2CHAB 3BN9A 2XBXA 3WW7A 2P93A 3A82A 2ZIQH 2GZ8A 1V2TT 3O8DA 4I33A 3RXKA 1HGTH 1AZZA 1FAXA 1YC0A 1KXAA 3LJJA 2A7CA 3M35A 5EPNA 2QIQA 3F9EA 1OKXA 2Z94A 2WYJA 1OX1A 3IITA 1SGNE 1EAXA 2KFWA 1XUJA 1NO9H 4UDWH 2J34A 4AYYB 1GBHA 1SOTA 3KEEA 3SORA 1EASA 5B6LA 4AORA 4MQAA 1PQAA 2FIRH 3T26A 2C90B 3IWMA 1E37B 3P17H 1E1RD 1YPHC 1GJ7B 3BTKE 2ODQA 1BRBE 2J38A 3VB5A 2AIQA 4A1VA 1FLEE 1AUTC 1O2NA 1S6FA 3GDVA 2FOHA 2VH0A 1BJUA 1YPMH 1K22H 1FIWA 1QGFA 2HGTH 5F03A 3UIRA 1AWHB 2FZZA 3C27B 3F0OA 1MTSA 2EI8A 4MPWA 8ESTE 3RXMA 4IN1A 5HYOA 3GY6A 1GHVH 1V2ST 1PPGE 5FHTA 1O2MA 1TOCB 1O2SA 2PUQH 1ZGIA 1ARBA 3ZYEA 1P09A 3WWFA 4D7FA 3LGVA 1GDNA 3TJOA 3BG8A 4X1RU 2IN2A 4NA8A 4CRCA 1UMAH 1QQ4A 4CRFA 1ESBA 3RXFA 1ANCA 3D49H 1JOUB 5A2MH 3QGNB 2ZDMA 3FZDA 1T7CA 3AK5A 2WPIS 3H7TA 4ZKRU 1RRKA 1SBWA 1FY1A 1UJ1A 4JZ1A 1DT2A 2XBWA 3MU0A 5F6MA 3SOSA 1EZUC 2Y80A 1L4DA 1QBNA 1AVXA 1MCTA 1P3CA 5HM9A 1W7GH 1L0ZA 1MTNC 2A0QB 4Y7BA 1O3LA 2AYWA 3VPKA 1D9IA 1TQ0B 4O03A 4OS7A 2G52A 3SQHE 1AFQC 1GVZA 3A7XA 4WH8A 4DY7B 1GJ4H 1K1LA 3P8GA 4WWYA 3UFAA 1WAYB 4WH6A 2UUYA 3RUOA 1B5GH 1O3EA 2BDYA 2IPQX 2WPDD 1SLVB 4M9FA 2R0KA 2AFQB 1D3TB 1MZAA 1V2UT 1F7ZA 3SV7A 1OP0A 2H5DA 1EJNA 1D3PB 2ZU2A 4I7YH 1NT1A 2I6QA 1ELBA 3UQOA 1XVMA 1TMUH 1GI8B 5A8ZA 1GJAB 4DIHH 5T1VA 3OEHD 3SJKA 1G2LA 1QTFA 3S9AA 2C8XB 3Q3XA 3MU5A 4IC6A 2VNTA 2D26C 3A80A 3M7UA 1TRYA 1KMHB 1NBME 2GMTB 1FY4A 1ZZZA 2YMSD 2ZGHA 2P59A 2ZKSA 3ZVGA 1YLCA 4NIVA 3F1SB 4M7GA 3A84A 3SV9A 3N99A 5GPIB 2ANKH 5DO4H 3V12A 5HXFA 4JYVH 2ZDNA 1P06A 2QE7D 2R3YA 4JMYA 4JZIA 4K60A 4A92A 4CREA 1XUKA 1OYQA 2V35A 1S84A 4A7IB 1AFEH 1P9UA 3FKSD 4XE4A 1UCYE 3SZEA 1C1SA 1NFUA 3GICB 4Y6DA 1NM6A 4YLUA 3SUEA 1MTUA 1ZRBA 3DSOA 2O8WA 1VITG 4INHA 4KELA 3VG8A 2LNCA 2JDID 1QJ1B 1SGTA 3EA8A 1OWJA 1NZQH 3MH4A 3A83A 1WOFA 2VU8E 4J2YB 3SYJA 1BTXA 1HCGA 1G9IE 2NU2E 2FX4A 4H42U 1CT4E 1W2KH 4X8VH 3LGYA 4NSVA 1TNLA 2J92A 3QGJA 4A5TS 1OP8A 1ABJH 1GG6B 1PPCE 1K2I1 4ABDA 1BTYA 3GY5A 2EY4C 1E36B 1L4ZA 1SGFG 2VIDA 3GCHB
chains in the Genus database with same CATH topology
4UEHH 1VCWA 3PB1E 5JPMH 4BTIB 4BAMB 1D3DB 4UFFH 2HRVA 2WPKS 3QWCH 2ZECA 1DDJA 1HJ9A 4I8GA 1O2HA 1TRMA 2BXTH 4X2XA 3BTDE 3SNBA 2A2XH 1FIZA 2W3KA 2FLBH 4MG3A 2PUXB 1NC6A 3LC5A 2VGCB 2G00A 1SQTA 1QL7A 5FCKA 1D6RA 2B9LA 2WINI 1AZ8A 1IHSH 2G4UA 3SUGA 1FI8A 5DP8A 3MNCA 2G81E 3SU3A 2PGQB 1EJAA 1P11E 1F5KU 4D76A 1P04A 2D8WA 2VIWA 4OS5A 3T27A 1ETRH 4ABAA 2SNWA 2ZHFH 1BBRE 4IC5A 2RDLA 1F2SE 2P3FH 3OY6U 1C2HA 2GDDA 4OS6A 4YOGA 1FONA 4HTCH 3RM0H 3GY3A 1C2LA 1XUFA 1DXPA 1O3GA 1TPAE 4CRBA 2EEKA 1YGCH 1HLTH 4U2WA 1NPMA 2WPHS 6LPRA 1O36A 1YPJH 2OINA 1FUJA 2A7JA 2IJOB 1C1UH 1C1PA 1MBMA 3ZZ9A 3TGKE 4ISOA 2ZQ2A 4BAKB 1UTKA 2ZA5A 3BTQE 3PTBA 2HVXA 1IAUA 3TU7H 1XUHA 3QLPH 1TMBH 1BTHH 6CHAC 1ZSLA 3FFGA 2A31A 2ZWLH 1MD7A 3D65E 1K1MA 3F6UH 1GDUA 1O2WA 4Q7XA 1H9HE 2VIOA 3ATLA 2BTCE 4NWLA 2O8TA 4CBNA 1Z7KA 2QXJA 3F9FA 3H5CB 4Q2KA 3TK6A 2ALPA 1C1MA 3GYLB 4CRAA 1TA2A 3ZV8A 4CRDA 4D8NA 5T6GA 4ZH8A 4IMZA 2FEQH 4ISHH 4YZUA 2QYIA 1CSOE 1DITH 1JMOH 1OWKA 4K8YA 3VB4A 4UONA 1SB1H 4B73A 1RJXB 1V2VT 2Q1JA 1F5LA 2SFAA 1H4WA 2C8WB 1GJ6A 4GAWA 4Z0KA 2OCVB 1Y8TA 2Y6TA 3BTFE 1HAPH 1TIOA 2IPHA 3M3VA 1HXFH 2FOEA 4FUEA 1BJVA 1SOZA 3U1JB 1EATA 3D23A 5ABWA 3Q3KA 3ZZ5A 2K1QA 8GCHG 1DSTA 5EODA 1HUTH 1VGCB 1MCVA 3SGAE 4DJZB 4ZKOU 1PQ7A 5DK1A 4TY6A 3K6YA 2BD9A 2FOCA 6ESTA 1C2DA 3PMJA 1IQHA 4NFFA 4Q7YA 1NY22 1AQ7A 1L1NA 2CJIA 1UTLM 1TNHA 1MH0A 2XBVA 2BDIA 1KXFA 4FU9A 3ELAH 2A4GA 1C5XB 3FANA 1MQ5A 4FUHA 4ABJA 1AMHA 1AI8H 1Y3XA 2F83A 1O3FA 4MNVA 5A8YA 1UVOA 2FI3E 4H4FA 3PO1C 3LGUA 4K1EA 3TLOA 3BTGE 5JBAS 4NSYA 1MKXH 2Z9LA 4XBBA 1Y59T 2O9QA 4HGCA 2QCYA 1ESAA 3H7OA 3Q00A 2QXIA 3RM2H 1ELDE 2JETC 1V2JT 1C5YB 3HKIB 3MH7A 1TNJA 2Q6FA 1Q31A 3VB3A 5LPFA 2G55A 3F9HA 2A45B 2XYAA 3PLKA 1THSH 5ETXA 8LPRA 1JWTA 1S83A 5DG6A 2G5VA 4OGXA 3SNEA 4X1NU 5A8XA 2FOMB 2PKSB 3UNSA 4AB8A 1LTOA 2UUKB 3WY8A 3TK5A 4OGYA 1GI9B 3ZVEA 1KY9A 1HAYB 7LPRA 1C5ZB 3KL6A 4FVDA 1C2FA 9ESTA 5B6OA 1PYTD 1B7XB 3T28A 3UPEA 4B1TA 4OS2A 1GJBB 3OYPA 2Z6BD 1O3OA 1B0EA 1GI4A 3BTEE 1A3BH 4ZXYH 3TGIE 3BSQA 3PROA 1RIWC 4NA7A 4LOYH 2ZGJA 3URCA 1V2NT 2W26A 3BIUH 4JZFH 5JBTA 1MTNB 2XTTB 1WTHD 4I8LA 2A4RA 3IG6B 1SQOA 1XVOA 5EU8A 3SBKA 2OC7A 5FX6A 1J9CH 3KGPA 1L2EA 4CHAB 1SL3A 2FM2A 1DWDH 2GKVE 1AD8H 2PWXA 4DOQA 1O3CA 2PLXA 1MU6B 5I46H 4FUJA 2UUFB 1DUAA 2H9EH 1BDAA 1DSUA 1O39A 3E6PH 1XX9A 1C2MA 1SFQB 1W12U 1CGHA 3T2NA 1TAWA 4DW2U 2ZCLP 2ILNA 2XC4A 1FMGA 3EDXB 2ZDAH 1C5RA 2GMTC 3SNDA 4CR9A 4KKDA 4CH8B 2QAAA 2Y5FA 4Y10E 4QT8C 4B2BA 1ELCA 2OP9A 1AN1E 1K1NA 3E90B 4TYDA 1YPEH 3CS7A 1YM0A 4AGKA 6CHAB 3PLPA 1O2YA 3A88A 1L1JA 4UE7H 2ZU4A 4DT7B 1C1RA 2ZEBA 1M9UA 1Z1IA 3TH4H 1ELTA 1OOKB 1TLDA 2GCTB 3KHVA 4FUFA 3M5MA 1GHBG 4AG1A 4FXGH 1LVMA 3GCTG 1C5SA 2ULLA 2Z9IA 4O3UA 4Y7AA 3LH3A 1TONA 3SZNA 1O2QA 2JH5D 4NIXA 2ODPA 2ZNKH 3LT3A 3LGTA 2BVXH 3PTNA 4Y8XA 1PQ8A 3RXAA 1AKSB 1Z8IB 4UD9H 1QFKH 2TGAA 1LMWB 3TJNA 1V2QT 4Y79A 4AYVB 4WY3A 3P8FA 7GCHF 1KLTA 3ZVDA 5DP5A 5DP9A 1GI2A 2PSYA 3M3TA 4ABIA 2A5IA 4A1XA 5EG4A 1HV7A 1ACBE 3P70B 2HOBA 4BTUB 3I78A 1PFXC 3BF6H 1DXWA 1O2VA 2P3UB 1NFXA 1PPBH 1IQGA 4ZHAA 2VIPA 3BV9B 2XC5A 1BTWA 3RXVA 1P57B 4K3JA 2GX4A 1NRRH 1TOMH 3JZ2B 3KQBA 1BTZA 1TNKA 2PV9B 5DP3A 1BITA 1RFNA 2PTNA 1LKBA 4CHAC 4K69A 1BTPA 2F9BH 3M7TA 4GVUA 2VGCC 1DY9A 2ZTZA 1D3QB 1ZPCA 1PPEE 3L33A 3M37A 3ZZ8A 1C5LH 1EPTC 1FY5A 2XNIA 1WTGH 3KQEA 2R2WU 2YOLA 1T4UH 2GV7A 2B5TB 1NTPA 4ABEA 2WUCA 1GVKB 3FP8E 3T25A 1TALA 1O37A 2WYGA 5C20A 1GGDC 3RXOA 3B8JA 4B76A 1H9IE 2FS9A 4MPVA 4XSKU 1HBTH 1IQKA 1GHAG 2ZCHP 1O3NA 1TBRH 2G51A 4HZHA 2Z9KA 1GG6C 1Y5AT 2PFEA 2FP7B 5T6DA 1J15A 1T32A 2OC0A 1F0SA 1BMMH 1C2IA 1KXBA 1YKTA 4MPUA 1QA7A 3QTVH 1PJPA 5DKMA 2GV6A 1IOEA 4K2YA 2B0FA 5F8XA 4ZUHA 3GCNA 3RMLH 2ZFQH 2O8MA 1TYNA 2H9HA 1PPZA 2SGQE 5L6NH 3QZRA 4Y0YE 4ZMAH 1JRSA 1GBAA 2FMJA 1TGTA 1DS2E 1QBVH 2J2UA 2GTBA 3A7YA 2FOAA 1TB6H 3TITA 1WV7H 3S7HB 1C5VA 3EA9A 5EQRA 3LGWA 3SV6A 4E06H 2P8OB 3LONA 3M61U 3KN2A 1O5CB 2SGDE 3NWUA 1HNEE 3PMBB 5DGJA 3RMNH 3D62A 4Y11E 5BPEA 2RCEA 3DFLA 4INLA 2VWMA 2BQ7B 1O2GH 1E0FD 3U8TH 2CN0H 3SJIA 1C5QA 1AU8A 1G3CA 4FU7A 1K1JA 1KXCA 1Z6JH 4X8TH 3SJ9A 5EQSA 1O5DH 4AFZA 1GBMA 5TJXA 4ABBA 4R8TB 2VWNA 2ANMH 1LPKB 1OPHB 1GBFA 2BXUH 3ATIA 3U9AH 2SNVA 4PROA 1Z6EA 3QN7A 2Z3CA 5EXNA 1WYKA 2EI6A 2NU1E 1G37A 1A3EH 3MO9A 1V6DA 3AAUA 5EXMA 5LGOA 3E8LA 3ODFA 4NG9H 1O3DA 4Y76A 1BOQA 4O3TA 1DWCH 2JKHA 2OC1A 3A87A 1E35B 1N6YA 2ZTXA 3NKKA 2ZHQH 1P2QA 3CS0A 2ZU5A 1EUFA 1GMCF 1FPCH 1LVYA 5CE1A 3FAOA 3I77A 2FWWA 4BANB 1VJAU 2C93B 1S6HA 4BAQB 1YPHE 1BCUH 4X8SH 4D9QA 1NU7B 3ZZ3A 1V3XA 4WJG2 1SGIB 1T31A 1O2KA 1TBQH 2H6MA 1HAHH 1V2LT 5E0GA 1ZHMA 3VB7A 1THPB 1TA6A 1NROH 2ZDLA 4NGAH 2FOGA 4ZAEA 1HYLA 1KDQA 1P2IA 1G2MA 1ZMNA 2CV3A 2PKSC 4CBOA 1NRSH 2BDCA 3MHWU 1GMDF 1G36A 1TGBA 2ALVA 2JH0D 1TX6A 3DD2H 3QUMP 2JH6D 1TNGA 2ZP0H 3A7WA 4FUCA 1EX3A 4IW4E 1P9SA 2VWOA 1RTLA 1EJMA 1JIMA 2A4OA 1ZGVA 3PLBA 2C8ZB 3ZZ7A 1DANH 3LPRA 4B2CA 2V3OH 2FYQA 1O3MA 2GVFA 2BYAX 4F49A 1GDQA 3R3GB 1O3IA 2Q6GA 3ZVCA 1VCPA 2OUAA 1CBWB 2B7DH 4AGJA 2VJ1A 1O31A 3P92A 3S9CA 1UTMA 1O0DH 1AY6H 2ZU3A 1P3EA 1LPZB 1LQEA 1F0RA 3LKWA 4JZDH 4ABFA 1DLKB 1O5GH 1LHEH 3V3MA 1QJ6B 1HFDA 1WU1A 4A6LA 1HAVA 2J9NA 2BLOA 1EKBB 2TPIZ 4X8UH 1ZPZA 2BQ6B 2PSXA 1THRH 2WV4A 2BVSH 1C9PA 4GLYA 5FAHA 3U1IB 3KIDU 1MBQA 1BIOA 3BG4B 1DE7H 3GY7A 3E0NB 4IGDA 1YPLH 1TQ7B 2FX6A 3SNCA 1KYNA 3A89A 1ELEE 3SW2B 1GHYH 1C2EA 3CP7A 1AVGH 1MTWA 1RD3B 2XC0A 3K65B 3QZQA 1BB0B 1LHFH 2ZGCA 1FY3A 4MTBA 3A85A 3OU0A 1K1PA 4X6OA 3ZVAA 1W0YH 4U30A 4K8BA 1HDTH 1EOLA 1MAYA 1BA8B 3R0FA 4BTTB 1V2PT 1GCDA 5GXPA 3AVZA 4XOJA 1QB9A 3UUZA 2F9NA 2OQUA 1QRWA 3B9FH 5AFZH 3OY5U 1VITF 1A61H 1Y5UT 1GBJA 4ISIH 2AGIX 4ISLA 1L1GA 1UVSH 1C5WB 1JXPA 4VGCB 3LDXH 2AERH 1S0QA 1GI3A 2BLVA 4ISNA 1J14A 1ESTA 4GPGA 1C9TA 1SQAA 4JYTA 1GCTB 1YPKH 2PHBA 4GSOA 2GGVB 3RLYH 1EB1H 2ZDKA 1AGJA 2H2ZA 2ZI2H 3RU4E 4SGAE 5EW2H 1AWFH 3UR9A 1WUNH 3NUMA 1RIWB 1K28D 1IQEA 1AVWA 4FU8A 1D4PB 1EB2A 1KIGH 1N8OC 2GD4B 3S0NA 2H5CA 1Z1JA 1V2RT 2XWAA 2V0BA 3Q77A 4AOQA 1DLEA 2BX4A 4WMDA 1V2MT 2RG3A 1FAKH 1O2XA 3DUXH 3P8OA 3SU4A 1EZSC 1ZMJA 3MU8A 3M5LA 5F8TA 1GPZA 3VXFH 4HI3A 4RSPA 1S85A 1F0UA 1DUEA 1OWEA 2CHAC 4JYUH 2XCFA 1A0HB 3E16B 1ZSKA 1QURH 1EAUA 3DT0H 4B71A 3S9BA 3ENSB 4AZ2B 3UREA 2BDHA 3GY8A 3RXTA 4AFUA 3HPTB 2BD2A 5E2OA 1NRQH 3L6PA 1ZTLA 1XXDA 1PPFE 8KME2 1TE0A 1UK3A 2WPLS 1HXEH 3ZZ4A 1MUEB 2ZO3H 2QY0B 1UK4A 7KMEH 5A09A 3BTME 3RXEA 2FI4E 2C4FH 1KTSB 2CF8H 1AKSA 1IQMA 2QC2A 3E0PB 2BLWA 1GBEA 1NFWA 2HLCA 1BBRK 1HIAB 1AUJA 4I8KA 2BB4A 1QJ7B 3KQDA 1EPTB 1BMNH 1TPPA 1MZDA 3TNTA 5H4IB 3SU5A 2BD7A 1SGQE 1ZLRA 4X6PA 3RXGA 2F3CE 1O2ZA 5LPRA 3TGJE 1IQJA 1P2MA 3TK9A 1TX8A 4GHQA 5JB8S 4X1QU 2R9PA 4LZ1H 1GHXH 3PWCA 3U8RH 2FI5E 4GHTA 1LPGB 1GHBF 2ZF0H 1JIRA 5ESTE 1SLWB 3VGCC 4YT6H 1FY8E 1LDTT 5L2ZH 1CGJE 2Y82A 3AW1A 5C1UA 1TPSA 1DM4B 1C4V2 5DP6A 1BBRH 2UWPA 2Y7ZA 1AE5A 3I29A 3F9GA 3O8BA 4MNWA 2VIQA 2KAIA 1GBCA 2A32A 2XWBI 1FQ3A 1GWAA 1OP2A 2BY9X 6GCHG 1P12E 3UNRA 3RXCA 3SV2H 1D6WA 1T8OA 5L2YH 3B23B 1SI5H 3MNXA 2BLQA 1O5AB 2AGGX 5HMAA 1AB9C 2ASUB 1CA0C 2AMPA 1LO6A 4U01A 4NA9H 2CXVA 2I6SA 3W94A 3BTHE 2Z9GA 3RXBA 2H1UA 1HB0B 4AG2A 2ZDVH 5E2PA 3RXUA 2HNTC 3VEQB 4GUXA 2YNAA 1Y3VA 1A0JA 3A8AA 3SI4H 1TGCA 1BHXF 1ORFA 1C2KA 3HGPA 1C1OA 1GBTA 4E7NA 1CHGA 1GL1A 2OTVA 1BRAA 1CE5A 2QXGA 1LQDB 1Y5BT 1UCYK 1S0RA 1HAIH 4E7RG 1UTNA 1YF4A 1EZXC 3EGKH 4MVNA 2GP9B 3GOVB 1GBDA 3ZYDA 2BY5X 3ATKA 1NRPH 3K9XB 1O3JA 1UVUH 3G01A 2V3HH 4TPIZ 1EAWA 5C5NA 3MI4A 2JETB 2VVCA 4LK4A 3T62A 1QA0A 3M5OA 3RXSA 3RDZA 1ID5H 1O30A 1BHXB 1TMTH 4YM9A 2ZHDA 4MNYA 2VB0A 2FODA 5GIBA 1ZRKA 3V0XA 4Y0ZE 2GCHF 4THNH 1XUGA 3A7ZA 2XXLA 3UOUA 1FV9A 4YESB 3K6ZA 4JK5A 1BT7A 1HRTH 1ETSH 1CGIE 2WPMS 3TVJB 3SV8A 2BHGA 3DA9B 5A0CA 1SSXA 2P16A 1PYTC 2BD5A 2BD3A 4B74A 1JBUH 4FVBA 2W3IA 1QQUA 1V2KT 1NN6A 3RC5A 2ZPQA 3C1KA 2FYRA 2EI7A 3SU1A 1K1OA 1CBWC 5GJ4B 4WMEA 1C5OH 3VGCB 4KGAA 2QF3A 1GJDB 2ZFPH 3LU9B 1N8OB