2G51A

Anomalous substructure of trypsin (p1)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
224
Chain Sequence
b'IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g51A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g51A01
5JBBS 1T8MA 4RN6A 3CS0A 1GVKB 4A5TS 3EA8A 1Z6EA 5JDUB 1K9OE 1O2YA 4GPGA 3RXLA 2GCTB 2ZFRH 4MG3A 1CBWC 2A5AA 3ZZDA 1O2VA 3E8LA 5C1XA 1C2FA 1W0YH 4K8YA 1SQOA 1YPMH 5HXFA 1O3FA 3ZVAA 5DP5A 2R3YA 3S7KB 1GMHF 1Y3VA 1DXPA 4NSYA 2ZECA 1A3BH 1AB9B 2ZZUH 3RDZA 3C1KA 2BVXH 2RA3A 1XVOA 5DG6A 3URCA 3OY5U 1CQQA 3OSYA 1AFQB 1WU1A 4ABGA 1C1PA 1XXDA 2R2WU 3AASA 1ANCA 1GI8B 1S5SA 1UTPA 3PMHB 1XVMA 1AVXA 3VB3A 4IN2A 4FUFA 3SUFA 2CGAA 1O3PB 1FUJA 3D49H 1MKWK 4B74A 1IHSH 1P2OA 3P8NA 2FS9A 1LHCH 3PROA 2BM2A 2ZI2H 1FI8A 1VGCC 5AVDA 4CRFA 2BY6X 4E7RG 2PR3A 1A0HB 4DG4A 2ZPSA 1E0FD 3VXFH 3SV6A 1K22H 1V2KT 3CS7A 7GCHF 4ISOA 4TYDA 4YT6H 8GCHG 1J14A 1O36A 1GBEA 5E2OA 1X7AC 4A1XA 2AFQB 1RS0A 1T8NA 2A4QA 2D1JA 3PLPA 1AN1E 4IC6A 4RKOB 4AOQA 1BBRH 4MNWA 1IQIA 1BITA 1OP2A 1GBTA 1SGQE 2QXHA 5T6GA 4ZAEA 2PTNA 1BMNH 3MHWU 5E0HA 3H7OA 1O2TA 3RXAA 1GI4A 2ZU3A 1LVBA 2GMTB 4XE4A 1FN6A 1W10U 3A80A 2Q6GA 4AX9H 3BV9B 4BAMB 2O8WA 4NCYA 1XUHA 2UUKB 2AIQA 1O3NA 2ZP0H 2PWXA 2ANKH 3Q3KA 3F9HA 4K60A 1XUJA 4FU7A 1DX5M 2OUAA 1G36A 3UOUA 3GCHC 2WV5A 4H4FA 3ZV9A 2Y5HA 3EA7A 4J1YA 2UWOA 4AB9A 1SGFG 1CE5A 1J9CH 3RXTA 3HKIB 2VIDA 3V3MA 3P17H 1O30A 1UVOA 2G55A 4BOHA 5FPYA 2GP9B 1J16A 2W3KA 1S83A 3VB5A 1BTYA 1C1NA 1RD3B 4MNYA 5TCAA 1RIWC 1QB9A 2QGRA 3F9GA 2GX4A 1W3CA 3TNSA 1G9IE 3MU0A 3RXOA 2ZFTA 1AFEH 2PTCE 2Z3DA 1TPOA 2TBSA 2ZHFH 1SBWA 2HVXA 4MTBA 2B0FA 3GY8A 2V3HH 2BDGA 6LPRA 4K2YA 2XCNA 3RXQA 3TVJB 2FMJA 1C9TA 4WMFA 4YOGA 2XC5A 2H5DA 3A8AA 1UVUH 1BMLA 1SGTA 1C1SA 4XDEA 1HAVA 2GZ9A 1DWDH 2CF9H 2TGPZ 3U8OH 3TH2H 1TGTA 4WXIA 1BA8B 1ZGVA 3W95A 1GI6A 3OYPA 4THNH 1UHBB 3BG4B 3QTVH 1BZXE 1AO5A 2GVFA 1A5IA 4X6OA 4GLYA 4DURA 1ELBA 3BTGE 1BHXB 2GKVE 1FONA 1YBWA 3SI3H 4A1VA 1YPGH 3A87A 3RLWH 1GJ6A 4XFQA 4WMEA 3PYHA 3K9XB 1TOMH 1FDPA 3P8FA 3GCOA 3LONA 5F03A 1GCTB 2ZNKH 4WF8A 3U1JB 3TLOA 1NPMA 1AVGH 4ISIH 4NIYA 1MD8A 4IMQA 1BHXF 2Z94A 4Y79A 1A46H 1KXFA 1BRAA 1HV7A 3FAOA 4NGAH 3ZZ3A 2HLCA 4YM9A 1UJ1A 1KDQA 1TBRH 1B0EA 1P06A 1V2RT 1EATA 1W12U 2F9UA 1NRRH 5ETXA 3LGVA 4WXVA 5LH8A 1ESTA 4NZQA 4MPUA 4YOIA 2FOMB 4I31A 1JIMA 5FBIA 2AMDA 3ZVEA 3JZ2B 2VGCC 1V2OT 1NRQH 4Y7AA 3R3GB 1RXPA 2QAAA 1QL8A 2NU0E 2WPLS 3I29A 4XBBA 1F92A 1GJBB 1C5YB 4KKDA 1JWTA 2FLBH 1PQ7A 2Z6BD 5LGOA 1RTFB 4DOQA 2A4RA 4CRAA 2JKHA 4I32A 1QHRB 2A7JA 3UFAA 4NIWA 5A8YA 3F9EA 1TAWA 1OP8A 3E91A 5E0JA 3O8CA 1C2DA 4JYVH 1HAOH 2VNTA 1IQNA 3DFJA 3SUEA 1UK3A 3KIDU 2BHGA 3ODFA 2C8ZB 2ESTE 3M35A 4M7GA 1GHBG 1KXCA 1CGIE 1Q31A 1RTLA 2VWLA 2BVRH 2OINA 2EI6A 1P2NA 1C5MD 1CA0C 2VJ1A 3LC3A 1DY8A 2BXUH 3E0NB 4KTUA 4YOJA 1HGTH 1MBQA 1PPHE 1EZQA 1G2LA 3BTDE 2G5VA 1WCZA 2AIPA 3N7OA 3NK8A 5L30H 3HATH 1TNKA 2FOAA 3M3SA 2HWLB 3SU4A 3SV8A 1RTKA 1SGRE 2FM2A 3RMNH 1NROH 4CRGA 1HJAB 2BOKA 1L1NA 2ZDLA 2AYWA 1D6WA 3FP6E 1AQ7A 3PMAB 3ZZ7A 1IHTH 1FLEE 5EW1H 1DSTA 3GY7A 4MNVA 3QUMP 2FZZA 1Z1JA 1OX1A 1K1PA 5DKMA 2PHBA 5T6FA 1EKBB 1ETSH 1O3AA 3U8TH 1TNJA 1GI3A 3UUZA 1THSH 5FAHA 3RLYH 4ISNA 2WYJA 2GCTC 1SGPE 1FPHH 2H2ZA 3SBKA 3QWCH 4CH8B 1O34A 2OLGA 1VZQH 5HMAA 1TGBA 2SGPE 3UR9A 2OC7A 1FY5A 1ZRBA 3ZZ9A 1L1JA 4ZKSU 2BDYA 1CHGA 3B8JA 2OQ5A 1YLCA 3SN8A 1KLTA 1WBGB 3MU1A 1C1QA 3SU2A 1MQ5A 3SNEA 1PPBH 1MD7A 3GY6A 3SW2B 2ZHDA 1AB9C 4O03A 2FEQH 6CHAC 3ZZ4A 1SB1H 1DWEH 2R9PA 2K1QA 1SC8U 1AUJA 1AFQC 3DHKH 1C2JA 4BANB 3KHVA 3MU8A 2FDAA 5F8XA 1C5NH 1EPTA 1G32B 1CSOE 3LGWA 5H4IB 1ZHPA 3HKJB 1TGCA 2VB0A 3A8BA 3FP7E 3RXBA 6GCHF 2DE9A 1EUFA 4MVNA 2ZTZA 3QN7A 1Q2WA 3TK5A 4O9VA 4JCNA 1K1NA 2A4OA 1GJAB 1UCYK 3QLPH 4OS1A 1DT2A 1ANBA 5FX5A 2FWWA 1MQ6A 3SI4H 1D9IA 1IQGA 4BXSA 1SGNE 1HAVB 2WPMS 2GZ7A 5CMXH 2C3SA 1TPAE 1GJ5H 1TALA 3VEQB 3UR6A 1C5PA 4HGCA 3MO3A 2EEKA 1QJ1B 1HNEE 1OWJA 4X1PU 1C2GA 1KTSB 1EOLA 1LPZB 2OXSA 2W5EA 3TJUA 1LQDB 3GCHB 3IG6B 2QV1A 4I8LA 3RXPA 3B9FH 3M7TA 3M7UA 3STIA 4F49A 2BTCE 2Y80A 4XSKU 1TONA 2O8UA 1TPPA 4U2WA 3KEEA 1SOZA 2A7HA 5L2ZH 2HGTH 1L1GA 1V2WT 1T8LA 1YPEH 1C5ZB 2OC8A 5JB8S 3ZZBA 1W13U 4AYVB 1K21H 2GMTC 4YT7H 3ENSB 1DITH 1O5FH 2P3TB 1Y5AT 1GMCF 2ZU4A 3RMLH 5T6DA 3SGAE 7GCHG 1TMUH 3BG8A 3RXRA 1MTVA 2WUBA 5JBTA 1CU1A 2IPHA 1DUAA 4MDSA 2BD9A 1ZHRA 3MNXA 1QB6A 1UMAH 5BPEA 3LKWA 1FY8E 4I8JA 1G37A 1HAGE 1S0QA 3QTOH 4INKA 1NU9A 3WY8A 1NFUA 8ESTE 4WJG2 2P59A 1HBTH 3BTTE 1TBZH 2BQWB 3SHAH 2J4IA 5TJXA 4FVBA 2PSYA 2LPRA 1TNGA 4I33A 4ASHA 3BTWE 4CR9A 2STAE 1EAXA 1A5HA 1P10A 2P94A 3KQEA 3GCNA 1THPB 4YO9A 1GHWH 2NU2E 2BD7A 3U69H 3ITIA 3SJIA 3RXKA 2VIVA 1Y3UA 3GYMA 4JZIA 1GBLA 2A5IA 1WYKA 1THRH 1TIOA 1H9HE 5DP4A 1F0SA 5AFZH 1GDQA 1S0RA 2ANWA 3BG4C 1TB6H 4FUHA 4FUEA 4DW2U 2GDEH 4B71A 1PYTC 1MKXK 4I8GA 2IN2A 5B6OA 1Y5UT 1GL0E 3UOPA 2QY0B 3A82A 3SNBA 7LPRA 2BD4A 1ZZZA 3RUOA 1SSXA 3GY3A 3NKKA 1T4VH 3VB6A 1GL1A 3GYLB 1TFXA 5HM2A 4Q80A 1O3IA 4IS5A 2BX4A 2ZA5A 1GCTC 3RC6A 4NFEA 4AFQA 1XUGA 1K28D 2VIQA 3HK6B 1ABIH 2IJOB 1T8OA 2B9LA 3MNCA 3GICB 3H5CB 1O3BA 4GVUA 2AERH 2AGIX 2BD5A 1A61H 2XNIA 1ZTKA 3A7WA 1G3CA 1Z8GA 1QGFA 2ZTXA 3K6YA 1O3CA 1PFXC 2XBXA 2CV3A 2UWLA 1ZJKA 4NA7A 2J94A 2OTVA 1Z1IA 1AE8H 2BD8A 2G4UA 2ZFSA 3RXDA 5E2PA 3A8CA 1BTPA 1FIWA 1NC6A 1P02A 1CA0B 2JETB 1C5RA 3GCTG 1VITF 1QCPA 3A7YA 2D26C 1PPFE 3A7VA 1GBAA 3PO1C 3ZV8A 4KELA 2QN5T 1CO7E 1C2LA 4JZ1A 3S0NA 1TQ0B 1V2TT 3UY9A 1NRSH 1O2NA 1O2PA 2Q6FA 2A31A 2A45B 2Y7XA 3M3VA 1G3BA 1T31A 2VVCA 1C2IA 1NU7B 1EPTB 5E8EH 3SJKA 4HI3A 1V2QT 4JZFH 1QA0A 2WYGA 1EAUA 3A85A 1EB2A 3STJA 2VH0A 5EXLA 2ZFQH 2QCYA 6ESTA 1W8BH 2ZGHA 1CHOF 1ELAA 1LPGB 5GJ4B 3JZ1B 2C90B 5GCHF 4DY7B 1DE7H 1FZZA 1F0UA 1HJAC 3KQBA 4Q2KA 1DM4B 1GBKA 2GV7A 8LPRA 3RU4T 4F4OC 1MAYA 1IQFA 1LKAA 2H9EH 1C4U2 2A32A 1BJVA 3LGIA 1C2HA 3QO6A 1XX9A 1GJ9B 3UQVA 1C1RA 1JBUH 1HUTH 1DLEA 5DO4H 3SV7A 6CHAB 4CBOA 1W2KH 3P6ZB 3V7TA 4OGXA 3GDVA 1L0ZA 1GMDF 3SO3A 1C1OA 1JMOH 2BYAX 1FY1A 4FUJA 1TA2A 4ZMAH 3R0FA 2NU3E 2GCHF 3A7TA 1YP9A 2C8XB 4GUXA 2R0LA 2ZHQH 2BY7X 1OWIA 1Z8IB 4Y0ZE 2PKSB 1GJ7B 1GI5A 1TMBH 2ODYB 5GPIB 1GVLA 3MTYA 1O3JA 1FIZA 3M36A 4ISLA 1C2EA 3KCGH 3O8RA 1ZR0A 2Z9LA 2NU1E 4IW4E 4NA8A 3UNRA 4CRBA 3HGPA 4O3UA 5I46H 1UK4A 2FOEA 3CP7A 1HIAA 2GTBA 3TPIZ 2ZWLH 3GY5A 1FAXA 1ETRH 1GVZA 2VIPA 3ELAH 1Z8RA 1ACBE 2D2DA 1O33A 3ZVCA 4D76A 4Y0YE 2FYQA 3MH5A 1O35A 3SZNA 1K1JA 2G51A 3S69A 1PQ8A 2ZGXH 1MTSA 1SLWB 3MFJA 4B2CA 3BIVH 3TH3H 3BN9A 1O2RA 3SU6A 3EDXB 3RXGA 1TX8A 2J9NA 4LK4A 3GY4A 1QRWA 4NZLA 2XBVA 3F6UH 4B2AA 4OS7A 1F2SE 2BDCA 1MUEB 1Y3WA 2A0QB 5JBAS 2ZHEH 1YKTA 3FFGA 2C8YB 1FY4A 4DIHH 2BQ6B 3A8DA 3TNTA 4GHTA 4AG2A 1GCDA 4U01A 4O3TA 2FOGA 4MLFB 4OS6A 4WMDA 1EOJA 2VINA 1PYTD 4X8TH 1Y59T 1ORFA 1BT7A 2A7CA 2XYAA 3TIUA 1OWKA 2FPZA 2FOHA 1C1TA 2Y5GA 1GJDB 4X1QU 1V2VT 5FBEA 3L33A 3SGBE 1VCPA 1HB0B 1SLUB 3LH3A 4XBDA 2YNAA 1GDNA 3LIWA 1O5DH 3BTEE 3RXSA 1SGFA 1DXWA 1O32A 1N8OB 4YTAA 2LNCA 1AGJA 1HLTH 2F9NA 5HYOA 2TGDA 1PPCE 1LPKB 2H9TH 2BXTH 3P8GA 1VJ9U 4Y76A 3C27B 1Y3YA 3SU0A 3ZZ8A 3L3TA 1AVWA 5DK1A 4AG1A 2TGTA 5JPMH 4GCHG 5EXMA 4DCDA 1K2I1 2BX3A 1ELFA 2C93B 3RXUA 1HAIH 3ZVBA 1ZYOA 1XM1A 1XKBC 2C8WB 2W7SA 4AFUA 3D62A 1QL7A 4NSVA 5C1UA 3E90B 3ZYEA 4X2YA 4X8VH 1SMFE 3RMMH 5DP9A 2B8OH 2BDHA 4B75A 2ZF0H 3M5NA 1W11U 4HZHA 2AGEX 5DP3A 1QFKH 1GBIA 1GBJA 2XC4A 1ESBA 1Y5BT 3GDUA 3ZVGA 3UWIA 1HPGA 4IN1A 1BOQA 1MAXA 2QA9E 3UNSA 2ZCHP 1HFDA 1GBHA 1B5GH 1AMHA 1F7ZA 4X1RU 1P12E 4JK6A 1SFIA 2FI4E 3CENA 1A0LA 2FTLE 4IC5A 2GGVB 2ZO3H 5ESBA 1QRZA 5FCKA 2ODQA 7KMEH 2P3FH 2ZIQH 4RKJB 3EE0B 3EQ0H 3EYDA 2PKAA 4FUIA 3BEIB 3PO1B 4ZUHA 5HGGA 1GBDA 1P3EA 4NIVA 2FX6A 2GT8A 2A2XH 1EZSC 2VIWA 4XBCA 2Z9JA 1NZQH 4CRDA 2W26A 3A81A 2OP9A 5DPAA 2HNTE 1O2SA 1K1OA 2TGAA 2ASUB 2DUCA 4B76A 1EASA 1SLXB 4E05H 1K1IA 2PFEA 5TCCA 1DDJA 1RJXB 3RXCA 5EOKA 1WQVH 3ATLA 3T27A 3T29A 3MI4A 1IOEA 2JETC 1WUNH 1NFWA 4Y7BA 3A7ZA 1DANH 2CJIA 4A92A 3ATKA 2O9QA 1AWHB 3A83A 3VFEA 1PPZA 4X8SH 1E34B 2Z3EA 1GG6B 5EGMA 2BLOA 1D6RA 1L2EA 1O39A 4ZXXH 1YLDA 3NZIA 2FODA 1GBFA 2PGBB 1O2QA 2HOBA 4AFZA 2I6QA 4ABBA 2ZU1A 4D8NA 1DOJA 1NFYA 1AUTC 4BAOB 1O3GA 1RGQA 1EB1H 4FUGA 4AYYB 1RFNA 3Q3YA 3FANA 1SR5C 5JYIA 2NU4E 1KXDA 3DD2H 1HXFH 4ABHA 2BB4A 3ZZ6A 1DWCH 1T32A 3V0XA 5C2ZA 1TRNA 3M37A 1C1WH 1EPTC 1INCA 2OC1A 3MYWA 2BZAA 3PTBA 3RXEA 1GI9B 2VH6A 1QTFA 2HNTF 2ZDVH 2QXGA 1GGDB 1NRPH 1MZDA 1GBCA 5EPNA 1C5QA 1KXEA 1KY9A 1TNHA 1RRKA 3FVFB 3MNBA 5IDKA 2BLWA 1GWAA 2Z7FE 1S6FA 1EP5A 1S6HA 2D8WA 5LPFA 3QDZB 2AMPA 1E35B 2Z9GA 3Q76A 2F83A 3RXIA 4OS4A 2FOCA 2J2UA 3UREA 1WV7H 3E16B 1DVAH 1E36B 1O2ZA 3LJOA 8GCHF 3W94A 1TABE 2V6NA 3BTQE 1O37A 1JRSA 2Y5FA 1YYY1 1O5EH 1SGCA 1FXYA 1BTHH 4Z0KA 1YPHE 1WSSH 4R0IA 1YM0A 1UCYE 1DICA 3T62A 2EI7A 2QC2A 3QGJA 1TMTH 1Z6JH 3AAVA 2SGDE 1J15A 1GMHG 2PKSC 2ZCKP 1DFPA 4BAQB 3TK9A 1BRBE 4FUBA 3I77A 3SV9A 4X6PA 1BIOA 3RXFA 4CHAB 3U1IB 1V6DA 1ZSLA 4Y8XA 5I25A 3SGQE 2UUFB 1EZUC 1DY9A 4K5ZA 1BUIA 9ESTA 3PWBA 5DJ7A 1O2MA 2FOBA 3RC4A 3RXHA 1SQAA 3U8RH 1YCPH 1XUIA 3RU4E 1OWEA 1TGSZ 3KF2A 3KN2A 4AGJA 2J38A 4ZHAA 3NXPA 9LPRA 1C1VH 3M5LA 3SJOA 1GBMA 3PMBB 2G81E 5LPRA 3TJNA 1UTOA 1J8AA 1NRNH 2ALVA 2ZC9H 1TX6A 1QBNA 2FI5E 1P57B 4CREA 4I8HA 1E38B 2ZU5A 3AW1A 1O3OA 4B73A 3V12A 3IWMA 1UO6A 2FIRH 4UFFH 1KDQB 4OS5A 1J17T 1EAIA 4AORA 2A5KA 1CA8B 3MH6A 4NFFA 1HRTH 4FU9A 3TK6A 4JYTA 3S7HB 2SGAA 3SNDA 4TY6A 1P9UA 2CHAB 1QY6A 1MTWA 1ZPZA 2VWMA 4AFSA 2J92A 2WINI 1KTTB 4TPIZ 1CT0E 1FJSA 1TYNA 1XUFA 5ABWA 4INLA 2R2MB 1A7SA 3T5FH 1DSUA 2ZTYA 4O97A 3A88A 1F0RA 1Q3XA 5EQRA 2O8LA 3M7QA 1N8OC 1A4WH 1ESAA 3SU5A 1P2QA 1FPCH 1O5AB 3MU4A 2PLXA 3HGNA 1AD8H 1A2CH 2NWNA 1C2MA 1C1MA 1L4ZA 1TRYA 1SGIB 3VB4A 2GDDA 5EW2H 1B7XB 1Z8JB 1PPGE 1HJ8A 4U32A 5J4SA 1NFXA 5C67A 3FP8E 2WUCA 3TJOA 3V13A 3NUMA 3UWJH 1GI1A 1MCTA 3AAUA 1XMNB 1O5CB 1D3DB 3A84A 4AGKA 1ABJH 1O2OA 4VGCB 1TGNA 1OPHB 2Z3CA 4DGJA 4GHQA 1S85A 2WPKS 1S82A 3PWCA 1BDAA 1SL3A 1OOKB 1AKSA 2HPPH 4ZHMU 1GHBF 1O3EA 4WH8A 4OGYA 2KAIA 3A89A 2PSXA 1O2LA 2WV4A 1V2NT 4Q7YA 1D3TB 3G01A 1EQ9A 1JIRA 3LC5A 3MWIU 1O2JA 1BTWA 2GV6A 3S9BA 1HJ9A 4BTIB 1D4PB 4U30A 1MTNC 1ZHMA 2ANMH 5C1YA 3UIRA 3T28A 4NA9H 2AS9A 4LOYH 3LGYA 2ZGJA 2J95A 4K3JA 1PQ5A 1ZSJA 4YESB 3DT0H 2OBQA 4MPWA 3U9AH 1N1LA 1AE5A 3SJ9A 1A3EH 3S9CA 4AN7A 1QBVH 4BNRA 1FAKH 2SNVA 3F1SB 3AW0A 3BTME 2F9PA 2ZU2A 3B23B 2H6MA 2GD4B 4BAKB 4B2BA 4K8BA 1B0FA 4I7YH 1ZLRA 1AWFH 2XW9A 4FU8A 1C5XB 5DP7A 1SI5H 2Z9KA 1BQYA 2Y7ZA 2ZCLP 5G4BA 4LZ1H 2ZEBA 1E37B 1ARBA 4CRCA 1VR1H 3EAJA 1W0ZU 4WWYA 1BBRE 2XWBI 3E1XB 1TPSA 1P9SA 1UK2A 1FY3A 3LGUA 1AU8A 2PV9B 1OP0A 5ESTE 2ZDKA 5EQQA 3OU0A 2CXVA 4E7NA 2WPJS 1GDUA 1V2JT 1GG6C 4X1SU 1BBRK 2EI8A 4X2VA 4H6TA 5FX6A 1L4DA 4RSPA 3P8OA 3RC5A 2F9BH 2HNTC 1VITH 4ZROA 1QNJA 1IQJA 1TA6A 5A8XA 3PM3A 5A09A 2PUQH 4NWKA 1V2UT 1F5KU 4A6LA 2Y6TA 3E0PB 2ZDAH 1F5LA 1C5UA 3Q3XA 3MH4A 4CH2B 1LHGH 2ZQ2A 1GHVH 1A0JA 2G4TA 1OYTH 5AF9H 1KLJH 1O2HA 1GHAF 3FZDA 2VU8E 1TX7A 3UPEA 4IGDA 3LDXH 2A2QH 1GGDC 3A86A 2BOHB 3E3TA 3LH1A 1CT4E 3TJVA 5GDSH 1TLDA 1NT1A 4X6NA 1MMJN 1PJPA 1DS2E 1AIXH 3MU5A 1AHTH 1P09A 1EX3A 1QB1A 4K69A 1O5GH 1QR3E 1KIGH 5EG4A 1BTXA 1FNIA 3IITA 1M9UA 1FQ3A 1C5OH 1UVPA 1XUKA 1H1BA 1LO6A 2BDAA 1WTHD 2AH4X 3NCLA 2FX4A 1BMAA 1TOCB 2AGGX 1SVPA 1QRXA 2SGEE 2ZFPH 2XTTB 1BRUP 8KME2 1K1MA 1H9IE 1MU8B 2OC0A 3SU1A 2OCVB 1MU6B 1YPLH 1GI7B 1GI2A 3K2UA 4A1TA 2I6SA 3P92A 2RG3A 5L6NH 1QQ4A 3RP2A 3UNQA 1ZMJA 1ELCA 2G52A 1DWBH 5AHGH 3AVZA 4AB8A 1GBBA 4K1SA 1EJMA 1NY22 4ZXYH 2OBOA 1SG8B 1H8DH 1O2KA 1P03A 5C3NA 5CHAB 1C5WB 4CHAC 4GAWA 3LPRA 5A0AE 4FUCA 2VVVA 2J34A 2P8OB 1P2IA 1D3PB 4ESTE 1YPHC 4ZHLU 3E6PH 1TBQH 1MZAA 2B7DH 6GCHG 2SNWA 1MTUA 2QIQA 2PUXB 1HAPH 1P8VC 3M5OA 4JMYA 3T25A 2W7UA 1G3DA 1ZMLA 1CGHA 2IOTA 1OYQA 1HAZB 2BDIA 3MNSA 1YC0A 1Z7KA 4X6MA 4YLUA 3KQDA 2TRMA 2ZKSA 3SV2H 4GSOA 5E0GA 3ATMA 2FP7B 3MMGA 2BLVA 1GJ8B 1WTGH 3I78A 2JH0D 1UVSH 1WAYB 4ISHH 1AKSB 3KNXA 4TPYA 2GT7A 3U98H 2RA0A 1BB0B 1ELTA 2KAIB 4Q7XA 3P70B 4X8UH 3ESTA 2B5TB 4FVDA 1XXFA 3ODDA 2XWAA 1P11E 4JZEH 4Y10E 3ATWA 2CHAC 4SGBE 2STBE 1C4Y2 1NM6A 1CT2E 3Q77A 4Y8YA 2R0KA 4ABJA 4BTUB 3QX5H 1MKWH 2YNBA 1MCVA 2BD3A 2ZPQA 3RXJA 3QGNB 4UFEH 5C5OA 3TU7H 3EGKH 4JYUH 3OY6U 2XXLA 3MH7A 2ANYA 1BCUH 1OS8A 1Z71A 3TITA 3ZVDA 1G2MA 1GMCG 2RDLA 1ELGA 2P93A 3VGCB 1O3HA 5EXNA 5K0HA 4MPVA 1HAHH 2ZHWH 1YPJH 4ZKRU 4BAHB 1CVWH 5GWZA 1GPZA 4YLQH 3NWUA 4YZUA 5EQSA 1C9PA 4HFPB 5BRRE 2BQ7B 3FZZA 4Y6DA 1G30B 1VJAU 2Q6DA 1FMGA 3MO9A 4INHA 5FPSA 1BTUA 2FS8A 3KQCA 1CGJE 2ZQ1A 3PB1E 2FTMA 4CR5A 1YGCH 2CF8H 3GCTF 3OTJE 3DFLA 3SU3A 2VIOA 3A7XA 2SGQE 2BMGB 4NG9H 1C5VA 5CE1A 3PV4A 1NESE 1MTNB 1PPEE 2BY5X 3ATIA 1SLVB 5C20A 1ETTH 4VGCC 4H6SB 2CMYA 3M3TA 2BVSH 4DVAU 2R3UA 1SGDE 1ELEE 1ANDA 1MBMA 5F6MA 1IQLA 2EC9H 1O3KA 1ZGIA 4BTTB 4QT8C 2HRVA 1SPJA 1LHDH 2ZG0H 3K65B 2V35A 1O2XA 3GOVB 3ZZAA 2FOFA 2OQUA 1O0DH 2Q1JA 4UFGH 1HAYB 3UQOA 1ZSKA 5PTPA 4H42U 7ESTE 2CN0H 1JRTA 1LKBA 3SOSA 3TGKE 4X1NU 2G00A 1SHHB 2AEIH 3SJ8A 4FXGH 3S9AA 5F8ZA 1V3XA 3VPKA 2XBYA 4X2XA 1ELDE 1QURH 3SORA 1SFQB 5JBCS 3VB7A 1HIAB 5J4QA 2FXRA 1Y8TA 1N6YA 4LZ4B 5L2YH 3PLKA 1ZTJA 2F91A 1OKXA 1XKAC 1O5BB 4WH6A 1CBWB 4UEHH 3DUXH 4NWLA 5A2MH 5DGJA 2FYRA 2PGQB 1NS3A 1UTQA 4ABDA 3T2NA 1VITG 1GHZA 1EAWA 5SGAE 1ZTLA 3DA9B 2ZDNA 4HTCH 5A8ZA 1O38A 1H9LB 1YCPK 1O2WA 2FO9A 2THFB 4IMZA 2QYIA 3KGPA 4TWYA 1A1RA 3F68H 5HM9A 1IQEA 1D3QB 1DUEA 1VCQA 2F3CE 3RM2H 1P2JA 1ARCA 1LVMA 1ZPBA 2V3OH 1ZMNA 4WY3A 3SNCA 4ZKNU 2BDBA 1LDTT 4DIIH 1TQ7B 4ABAA 1LHFH 2GZ8A 2G5NA 4JK5A 5DP6A 2SFAA 2Y82A 5K7RA 1WQSA 1P0SH 1W7GH 2XC0A 4LXBH 1CHOG 4KP0A 4DT7B 2AMQA 3TGIE 3ZYDA 2DE8A 2UUYA 3QZQA 1LTOA 5GCHG 2QF3A 1SGEE 1AI8H 2ODPA 4ZKOU 1LHEH 1IQMA 2ZGBH 4DJZB 3ZZ5A 1N6XA 2FLRH 1NN6A 5IYTA 2HALA 1VGCB 2H1UA 2G8TA 1C5TA 2H9HA 1JOUB 1SGYE 3F9FA 2ILNA 1BJUA 1SHYA 1C2KA 5F8TA 1K1LA 4PROA 2ZGCA 1H8IH 1H4WA 3UTUH 1WOFA 1UTKA 3LOXA 1Y3XA 1F0TA 1GHAG 4OS2A 1GMDG 1O2GH 1BMMH 1HDTH 1O2IA 3LJJA 2OD3B 1T4UH 1LCYA 3RXVA 2GCHG 4ABFA 2BY9X 3RU4D 1GJCB 1O3MA 1QJ6B 4FUDA 5JB9S 4Q7ZA 1ZPCA 2QF0A 3MO6A 2BY8X 2XCFA 2VVUA 2BZ6H 1U6QA 2SGFE 2UWPA 4XOJA 1AY6H 1W14U 3TGJE 3URDA 3GDSA 1LQEA 2BLQA 2RCEA 1UVTH 4UONA 5A0BA 1IAUA 2VWOA 2P95A 2QXIA 1QL9A 3SHCH 1G3EA 3QZRA 1OWHA 3BSQA 2ULLA 4MPXA 5CHAC 1UTMA 1HXEH 1GI0A 1LVYA 2P8OC 1A5GH 5LPEA 1TWXB 2TIOA 1OSSA 4MNXA 3T26A 4GCHF 3ZVFA 4MQAA 5T3HA 2PW8H 4X0WU 4UD9H 4D9QA 4Z6AH 1V2LT 1RIWB 1IQKA 1QQUA 2UUJB 1LVOA 1TNLA 4A7IB 2BD2A 1HYLA 1ZRKA 2PKAB 4UDWH 2FI3E 1AZ8A 2ZPRA 4ABEA 1S81A 1O2UA 1JXPA 3SUGA 2YOLA 2JH5D 4WVPE 1O3LA 4Y71A 5A0CA 1C5SA 2WPHS 1NO9H 1C4V2 3PLBA 4E06H 4J2YB 3OX7U 3TH4H 3MOCA 1P05A 1MH0A 3D65E 1P3CA 3O8DA 1UCYH 4B1TA 1IQHA 4UE7H 2W3IA 1UTLM 3QK1A 2VWNA 3BTKE 5AFYH 1AZZA 1HCGA 4K1EA 2EA3A 1LMWB 2Z9IA 3LU9B 3VXEH 3Q00A 3RMOH 3BTHE 2M5TA 3VGCC 1EZXC 3BF6H 4CBNA 3L6PA 4X2WA 1S84A 3HPTB 3D23A 4TWWA 4KTSA 2H5CA 2C4FH 1ANEA 3ZZCA 1ZJDA 1ZOMA 1V2MT 1YCPM 1P2KA 1YF4A 3EA9A 3KL6A 3M5MA 4I8KA 2A4GA 2HPQH 4D7FA 2ZDMA 1QJ7B 5DP8A 1P04A 1GHYH 4IBLH 4K1TA 1FV9A 1VCWA 2F9OA 4R8TB 3GISB 5EPYA 1KXBA 1C5LH 4Y8ZA 2VGCB 4TY7A 3H7TA 1PQAA 3SUDA 1EJAA 1QIXB 3GY2A 1ELVA 3BEFB 3NPSA 1V2ST 1YPKH 1TE0A 1KLIH 1W7XH 2ZFFH 1EJNA 1KYNA 3RM0H 3SQHE 2V0BA 5FPTA 3SNAA 1T7CA 1UTNA 5GXPA 1KSNA 2P3UB 4KTCA 2O8TA 3LGTA 2WPIS 2XRCA 4UFDH 4D9RA 1UTJA 3SQEE 2ALPA 1HAXB 4ZH8A 1EXFA 4SGAE 2FESH 1UHBA 1C1UH 5FHTA 3BEUA 3P95A 5EU8A 4AZ2B 1OXGA 5GIBA 2Y81A 3M61U 5C5NA 1OWDA 3RXMA 3PTNA 1GJ4H 2O8MA 5EODA 1SOTA 1BRCE 1P01A 1V2PT 3BTFE 3O8BA 3K6ZA 1F5RA 2A1DB 1O3DA 1QBOA 1DPOA 3LT3A 1TRMA 4BXWA 2P16A 2F9VA 1FN8A 2JH6D 2QXJA 3BIUH 3HK3B 1BTZA 1NTPA 4Y11E 5FCRA 1P2MA 1EP6A 1QA7A 4JZDH 4D7GA 5FXLA 2XBWA 2TPIZ 1TNIA 1ID5H 1KXAA 4KGAA 4NIXA 1GHXH 1MKXH 1SQTA 1O31A 4ABIA 3PMJA 1DLKB
chains in the Genus database with same CATH superfamily
5JBBS 1T8MA 4RN6A 3CS0A 1GVKB 4A5TS 3EA8A 1Z6EA 5JDUB 1K9OE 1O2YA 4GPGA 3RXLA 2GCTB 2ZFRH 4MG3A 1CBWC 2J98A 2A5AA 3ZZDA 1O2VA 3E8LA 5C1XA 1C2FA 1W0YH 4K8YA 1SQOA 1YPMH 5HXFA 1O3FA 3ZVAA 2VBCA 5DP5A 2R3YA 3S7KB 1GMHF 1Y3VA 1DXPA 4NSYA 2ZECA 1A3BH 1AB9B 2ZZUH 3RDZA 3C1KA 2BVXH 2RA3A 1XVOA 5DG6A 3URCA 3OY5U 1CQQA 3OSYA 1AFQB 1WU1A 4ABGA 1FX0B 1C1PA 1XXDA 2R2WU 3AASA 4P02A 1ANCA 1GI8B 1S5SA 1UTPA 3PMHB 2L74A 1XVMA 1AVXA 1UW7A 3VB3A 4IN2A 4FUFA 3SUFA 2CGAA 3FOAA 1O3PB 1FUJA 1KMHB 3D49H 1MKWK 4B74A 1IHSH 1P2OA 3P8NA 2FS9A 1LHCH 3PROA 2BM2A 2ZI2H 1FI8A 1VGCC 5AVDA 4CRFA 5CDFE 2BY6X 4E7RG 2PR3A 1A0HB 4DG4A 2ZPSA 1E0FD 3VXFH 3SV6A 1K22H 1V2KT 3CS7A 7GCHF 4ISOA 4TYDA 4YT6H 8GCHG 1J14A 1O36A 1GBEA 5E2OA 1X7AC 4A1XA 2AFQB 1RS0A 1T8NA 2A4QA 2D1JA 3PLPA 1AN1E 4IC6A 4RKOB 4AOQA 1BBRH 4MNWA 1IQIA 1BITA 1OP2A 2CK3D 1GBTA 1SGQE 2QXHA 5T6GA 4ZAEA 2PTNA 1BMNH 3MHWU 5E0HA 3H7OA 1O2TA 3F2FA 3RXAA 1GI4A 2ZU3A 1LVBA 2GMTB 4XE4A 1FN6A 1W10U 3A80A 2Q6GA 4AX9H 3BV9B 4BAMB 2O8WA 4NCYA 1XUHA 2UUKB 2AIQA 1O3NA 2ZP0H 2PWXA 2ANKH 3Q3KA 3F9HA 5T1VA 4K60A 1XUJA 4FU7A 1DX5M 2OUAA 1QZ8A 1G36A 3UOUA 3GCHC 2WV5A 4H4FA 3ZV9A 2Y5HA 3EA7A 4J1YA 2UWOA 4AB9A 1SGFG 1CE5A 1J9CH 3RXTA 3HKIB 2VIDA 3V3MA 3P17H 1O30A 1UVOA 2G55A 4BOHA 5FPYA 1WDIA 2GP9B 1J16A 2W3KA 1S83A 3VB5A 1BTYA 1C1NA 1RD3B 3MQKC 4MNYA 5TCAA 1RIWC 1QB9A 2QGRA 3F9GA 2GX4A 1W3CA 3TNSA 1G9IE 3MU0A 3RXOA 2ZFTA 1AFEH 2PTCE 2Z3DA 1TPOA 2TBSA 2ZHFH 1SBWA 2HVXA 4MTBA 2B0FA 3GY8A 2V3HH 2BDGA 6LPRA 4K2YA 2XCNA 3RXQA 3TVJB 2FMJA 1C9TA 2KFWA 4WMFA 4YOGA 2XC5A 2H5DA 3A8AA 1UVUH 1BMLA 1SGTA 1C1SA 4XDEA 4B6EA 1HAVA 2GZ9A 1DWDH 2CF9H 2KCYA 2TGPZ 3U8OH 3TH2H 1TGTA 4WXIA 1BA8B 1ZGVA 3W95A 1GI6A 3OYPA 4THNH 1UHBB 3BG4B 3QTVH 1BZXE 1AO5A 2GVFA 1A5IA 4X6OA 4GLYA 4DURA 1ELBA 3BTGE 1BHXB 2GKVE 1FONA 1YBWA 3SI3H 4A1VA 1YPGH 3A87A 3RLWH 1GJ6A 4XFQA 4WMEA 3PYHA 3K9XB 3FO8D 1TOMH 1FDPA 3P8FA 3GCOA 3LONA 5F03A 1GCTB 2ZNKH 4WF8A 3U1JB 3TLOA 1NPMA 1AVGH 4ISIH 4NIYA 1MD8A 4IMQA 1BHXF 2Z94A 4Y79A 1A46H 1KXFA 1BRAA 1HV7A 3FAOA 4NGAH 3ZZ3A 2HLCA 4YM9A 1UJ1A 1KDQA 1TBRH 1B0EA 1P06A 1V2RT 1EATA 1W12U 2F9UA 1NRRH 5ETXA 3LGVA 4WXVA 5LH8A 1ESTA 4NZQA 3OTPA 4MPUA 4YOIA 2J98B 2FOMB 4I31A 1JIMA 5FBIA 2AMDA 3ZVEA 3JZ2B 2VGCC 1V2OT 1NRQH 4Y7AA 3R3GB 1RXPA 2QAAA 5CHBA 1QL8A 3VG8A 2NU0E 2WPLS 3I29A 4XBBA 1F92A 1GJBB 1C5YB 4KKDA 1JWTA 2FLBH 2QF4A 1PQ7A 2Z6BD 5LGOA 1RTFB 4DOQA 2A4RA 4CRAA 2JKHA 4I32A 1QHRB 2A7JA 3UFAA 4NIWA 5A8YA 3F9EA 1TAWA 1OP8A 3E91A 5E0JA 3O8CA 1C2DA 4JYVH 1HAOH 2VNTA 1IQNA 3DFJA 3SUEA 3PV2A 1UK3A 3KIDU 2BHGA 2K8IA 2C8ZB 2ESTE 3M35A 3ODFA 4M7GA 1GHBG 1KXCA 1CGIE 1Q31A 1RTLA 2VWLA 2BVRH 2OINA 2EI6A 1P2NA 1C5MD 1CA0C 2VJ1A 3LC3A 1DY8A 2BXUH 3E0NB 4KTUA 5GNDA 4YOJA 1HGTH 1MBQA 1PPHE 1EZQA 1G2LA 3BTDE 2G5VA 1WCZA 2AIPA 3N7OA 3NK8A 5L30H 3HATH 1TNKA 2FOAA 4RI0A 3F2HA 3M3SA 2HWLB 3SU4A 3SV8A 1RTKA 1SGRE 2FM2A 3RMNH 1NROH 4CRGA 1HJAB 2BOKA 1L1NA 2ZDLA 2AYWA 1D6WA 3FP6E 1AQ7A 3PMAB 3ZZ7A 1IHTH 4RT0A 1FLEE 5EW1H 1DSTA 3GY7A 4MNVA 3W1EA 3QUMP 2FZZA 1Z1JA 1OX1A 1K1PA 5DKMA 2PHBA 5T6FA 1EKBB 1ETSH 1O3AA 3U8TH 1TNJA 1GI3A 3UUZA 1THSH 5FAHA 3RLYH 4ISNA 2WYJA 2GCTC 1SGPE 1FPHH 2H2ZA 3SBKA 3QWCH 3F0OA 4CH8B 1O34A 2OLGA 1VZQH 5HMAA 1TGBA 2SGPE 3UR9A 5KECA 2OC7A 1FY5A 1ZRBA 3ZZ9A 1L1JA 4ZKSU 2BDYA 1CHGA 3B8JA 2OQ5A 1YLCA 3SN8A 1KLTA 1WBGB 3MU1A 1C1QA 3SU2A 1MQ5A 2LP6A 3SNEA 1PPBH 1MD7A 5C0TA 3GY6A 3SW2B 2KZ4A 2ZHDA 1AB9C 4O03A 2FEQH 6CHAC 3ZZ4A 1SB1H 1DWEH 2R9PA 2K1QA 1SC8U 1AUJA 1AFQC 3DHKH 1C2JA 4BANB 3KHVA 3MU8A 2FDAA 5F8XA 1C5NH 1EPTA 1G32B 1CSOE 3LGWA 5H4IB 1ZHPA 3HKJB 1TGCA 2VB0A 3A8BA 3FP7E 3RXBA 6GCHF 2DE9A 1EUFA 4MVNA 2ZTZA 3QN7A 4FETA 1Q2WA 3TK5A 4O9VA 4JCNA 1K1NA 2A4OA 1GJAB 1UCYK 3QLPH 4OS1A 1DT2A 1ANBA 3F3BA 5FX5A 2FWWA 1MQ6A 3SI4H 1D9IA 1IQGA 4BXSA 1SGNE 1HAVB 2WPMS 2GZ7A 5CMXH 2C3SA 1TPAE 1GJ5H 1TALA 3VEQB 3UR6A 1C5PA 4HGCA 4F55A 3MO3A 2EEKA 1QJ1B 1HNEE 1OWJA 4X1PU 1C2GA 1KTSB 1EOLA 1LPZB 2OXSA 2W5EA 3TJUA 1LQDB 3GCHB 3IG6B 2QV1A 4I8LA 3RXPA 3B9FH 3M7TA 4M9FA 3M7UA 4F48B 3STIA 4F49A 2BTCE 2Y80A 4XSKU 1TONA 2O8UA 1TPPA 4U2WA 3KEEA 1SOZA 2A7HA 5L2ZH 2HGTH 1L1GA 1V2WT 1T8LA 1YPEH 1C5ZB 2OC8A 5JB8S 3ZZBA 1W13U 4AYVB 1K21H 2GMTC 4YT7H 3ENSB 1DITH 1O5FH 2P3TB 1Y5AT 1GMCF 2ZU4A 3RMLH 5T6DA 3SGAE 7GCHG 1TMUH 3BG8A 4DT4A 3RXRA 2KCOA 1MTVA 3F2GA 2WUBA 5JBTA 1CU1A 2IPHA 1DUAA 4MDSA 2BD9A 1ZHRA 3MNXA 1QB6A 1UMAH 5BPEA 3LKWA 1FY8E 4I8JA 1G37A 1HAGE 1S0QA 3QTOH 4INKA 1NU9A 3WY8A 1NFUA 8ESTE 4WJG2 2P59A 1HBTH 3BTTE 5C0UA 1TBZH 2BQWB 3SHAH 2J4IA 5TJXA 4FVBA 2PSYA 3KQ5A 2LPRA 1TNGA 4I33A 4ASHA 3BTWE 4CR9A 4Z1MD 2STAE 1EAXA 1A5HA 1P10A 2P94A 3FN8A 3KQEA 3GCNA 1THPB 4YO9A 1GHWH 2NU2E 2BD7A 3U69H 3ITIA 3SJIA 3RXKA 2VIVA 1Y3UA 3GYMA 4JZIA 1GBLA 2A5IA 1WYKA 1THRH 1TIOA 1H9HE 5DP4A 1F0SA 5AFZH 3SZEA 1GDQA 1S0RA 2ANWA 3BG4C 1TB6H 4FUHA 4FUEA 4DW2U 2GDEH 4B71A 1PYTC 1MKXK 4I8GA 2IN2A 5B6OA 1Y5UT 1GL0E 3UOPA 2QY0B 3A82A 3SNBA 7LPRA 2BD4A 1ZZZA 3RUOA 1SSXA 3GY3A 3NKKA 1T4VH 3VB6A 1GL1A 3GYLB 1TFXA 5HM2A 4Q80A 1O3IA 4IS5A 2J97A 2BX4A 2ZA5A 1GCTC 3RC6A 4NFEA 4AFQA 1XUGA 1K28D 2VIQA 3HK6B 1ABIH 2IJOB 1T8OA 2B9LA 3MNCA 4AC9A 3GICB 3H5CB 1O3BA 4GVUA 2AERH 2AGIX 2BD5A 1A61H 3ZIAD 2XNIA 5DN6D 1ZTKA 3A7WA 1G3CA 1Z8GA 1QGFA 2ZTXA 3K6YA 1O3CA 1PFXC 2XBXA 2CV3A 2UWLA 1ZJKA 4NA7A 2J94A 2OTVA 1Z1IA 1AE8H 2M2AA 2BD8A 2G4UA 2ZFSA 3RXDA 5E2PA 3A8CA 1BTPA 1FIWA 1NC6A 1P02A 1CA0B 2W6JD 2JETB 1C5RA 3GCTG 1VITF 1QCPA 3A7YA 5F53A 2D26C 1PPFE 3A7VA 1GBAA 3PO1C 3ZV8A 4KELA 2QN5T 1CO7E 1C2LA 4JZ1A 3S0NA 1TQ0B 1V2TT 2QF5A 3UY9A 1NRSH 1O2NA 1O2PA 2Q6FA 2A31A 2A45B 2Y7XA 3M3VA 1G3BA 1T31A 2VVCA 1C2IA 1NU7B 1EPTB 2KX4A 5E8EH 3SJKA 4HI3A 1V2QT 4JZFH 1QA0A 2WYGA 1EAUA 3A85A 1EB2A 3STJA 2VH0A 5EXLA 2ZFQH 2QCYA 6ESTA 1W8BH 2ZGHA 1CHOF 1ELAA 1LPGB 5GJ4B 3JZ1B 2C90B 5GCHF 4DY7B 1DE7H 1FZZA 4RT1A 1F0UA 1HJAC 3KQBA 5HIYA 3AK5A 4Q2KA 1DM4B 1GBKA 2GV7A 8LPRA 3RU4T 4F4OC 1MAYA 1IQFA 1LKAA 2H9EH 1C4U2 2A32A 1BJVA 3LGIA 1C2HA 3QO6A 1XX9A 1GJ9B 3UQVA 1C1RA 1JBUH 1HUTH 1DLEA 5DO4H 3SV7A 6CHAB 4CBOA 1W2KH 3P6ZB 3V7TA 4OGXA 3GDVA 1L0ZA 1GMDF 3SO3A 1C1OA 1JMOH 2BYAX 1FY1A 4FUJA 1TA2A 4ZMAH 3R0FA 2NU3E 2GCHF 3A7TA 1YP9A 2C8XB 4GUXA 2R0LA 2ZHQH 2BY7X 1OWIA 1Z8IB 4Y0ZE 2PKSB 1GJ7B 1GI5A 1TMBH 1COWD 2ODYB 3PV5A 5GPIB 2W6ID 1GVLA 3MTYA 1O3JA 1FIZA 3M36A 4ISLA 1C2EA 3KCGH 3O8RA 1ZR0A 2Z9LA 2NU1E 4IW4E 4NA8A 3UNRA 4CRBA 3HGPA 4O3UA 5I46H 1UK4A 2FOEA 3CP7A 1HIAA 2GTBA 3TPIZ 2ZWLH 3GY5A 1FAXA 1ETRH 1GVZA 2VIPA 3ELAH 1Z8RA 1ACBE 2D2DA 1O33A 5KGOA 3ZVCA 4D76A 4Y0YE 2FYQA 3MH5A 1O35A 3SZNA 1K1JA 2G51A 3S69A 1PQ8A 2ZGXH 1MTSA 1SLWB 3MFJA 4B2CA 3BIVH 3TH3H 3BN9A 1O2RA 3SU6A 3EDXB 3RXGA 1TX8A 2J9NA 4LK4A 3GY4A 1QRWA 4NZLA 2XBVA 3F6UH 4B2AA 4OS7A 1F2SE 2BDCA 1MUEB 1Y3WA 2A0QB 5JBAS 2ZHEH 1YKTA 3FFGA 2C8YB 1FY4A 4DIHH 2BQ6B 3A8DA 3TNTA 4GHTA 4AG2A 1GCDA 4U01A 4O3TA 2FOGA 4MLFB 4OS6A 4WMDA 1EOJA 3PRBA 2VINA 1PYTD 4X8TH 1Y59T 1ORFA 1BT7A 2A7CA 2XYAA 3TIUA 1OWKA 2FPZA 2FOHA 1C1TA 2Y5GA 1GJDB 4X1QU 1V2VT 5FBEA 3L33A 3SGBE 1VCPA 1HB0B 1SLUB 3LH3A 4XBDA 2YNAA 1GDNA 3LIWA 1O5DH 3BTEE 3RXSA 1SGFA 1DXWA 1O32A 1N8OB 4YTAA 2LNCA 1AGJA 1HLTH 2F9NA 5HYOA 2TGDA 1PPCE 1K0HA 1LPKB 2H9TH 2BXTH 3P8GA 1VJ9U 2L6OA 4Y76A 3C27B 1Y3YA 3SU0A 3ZZ8A 3L3TA 1AVWA 5DK1A 4AG1A 2TGTA 5JPMH 4GCHG 5EXMA 4DCDA 1K2I1 2BX3A 1ELFA 2C93B 3RXUA 1HAIH 3ZVBA 1ZYOA 1XM1A 1XKBC 2C8WB 2W7SA 4AFUA 3D62A 1QL7A 4NSVA 5C1UA 3E90B 3ZYEA 4X2YA 4X8VH 1SMFE 3RMMH 5DP9A 2B8OH 2BDHA 4B75A 2ZF0H 3M5NA 1W11U 4HZHA 2AGEX 5DP3A 1QFKH 1GBIA 1GBJA 2GJGA 2XC4A 1ESBA 1Y5BT 3GDUA 3ZVGA 3UWIA 1HPGA 4IN1A 1BOQA 1MAXA 2QA9E 3UNSA 2ZCHP 1HFDA 1GBHA 1B5GH 1AMHA 1F7ZA 4X1RU 1P12E 4JK6A 1SFIA 2FI4E 3CENA 1A0LA 2FTLE 4IC5A 2GGVB 2ZO3H 5ESBA 1QRZA 5FCKA 2ODQA 7KMEH 2P3FH 3NRLA 2ZIQH 4RKJB 3EE0B 3EQ0H 3EYDA 3UAIC 2LELA 2PKAA 4FUIA 3BEIB 3PO1B 4ZUHA 5HGGA 1GBDA 1P3EA 4NIVA 2FX6A 2GT8A 2A2XH 1EZSC 2VIWA 4XBCA 2Z9JA 1NZQH 2YMSB 4CRDA 2W26A 3A81A 2OP9A 5DPAA 2HNTE 1O2SA 1K1OA 2TGAA 2ASUB 2DUCA 4B76A 1EASA 1SLXB 4E05H 1K1IA 2PFEA 5TCCA 1DDJA 1RJXB 3RXCA 5EOKA 1WQVH 2IJD1 3ATLA 3T27A 3T29A 3MI4A 1IOEA 2JETC 1WUNH 1NFWA 4Y7BA 3A7ZA 1DANH 2CJIA 4A92A 3ATKA 2O9QA 1AWHB 3A83A 3VFEA 1PPZA 4X8SH 1E34B 2Z3EA 1GG6B 5EGMA 2BLOA 1D6RA 1L2EA 1O39A 4ZXXH 1YLDA 3NZIA 2FODA 1GBFA 2PGBB 1O2QA 2HOBA 4AFZA 2I6QA 2JJ1D 4ABBA 2ZU1A 4D8NA 1DOJA 1NFYA 1AUTC 4BAOB 1O3GA 1RGQA 1EB1H 4FUGA 4AYYB 1RFNA 3Q3YA 3FANA 1SR5C 5JYIA 2NU4E 1KXDA 3DD2H 1HXFH 4ABHA 2BB4A 3ZZ6A 1DWCH 1T32A 3V0XA 5C2ZA 1TRNA 3M37A 1C1WH 1EPTC 1NBME 1INCA 2OC1A 3MYWA 2BZAA 5HKKD 3PTBA 3RXEA 1GI9B 2VH6A 1QTFA 2HNTF 2ZDVH 4ASUD 2QXGA 1GGDB 1NRPH 1MZDA 1GBCA 2RFKC 3EE7A 5EPNA 1C5QA 1KXEA 1KY9A 1TNHA 1RRKA 3FVFB 3MNBA 5IDKA 2BLWA 1GWAA 2Z7FE 1S6FA 1EP5A 1S6HA 2D8WA 5LPFA 3QDZB 2AMPA 1E35B 2Z9GA 3KYGA 3Q76A 2F83A 3RXIA 4OS4A 2FOCA 2J2UA 3UREA 1WV7H 3E16B 1DVAH 1VKYA 1E36B 1O2ZA 3LJOA 8GCHF 3W94A 1TABE 2V6NA 3BTQE 1O37A 1JRSA 2Y5FA 1YYY1 1O5EH 1SGCA 1FXYA 1BTHH 4Z0KA 2WV9A 1YPHE 1WSSH 4R0IA 1YM0A 1E79D 1UCYE 1DICA 4ACAA 3T62A 2EI7A 2QC2A 3QGJA 1TMTH 1Z6JH 3AAVA 2SGDE 1WXRA 1J15A 1GMHG 2PKSC 2ZCKP 2KCPA 1DFPA 4BAQB 3TK9A 1BRBE 4ACBA 4FUBA 3WWFA 3I77A 3SV9A 4X6PA 5C94A 1BIOA 3RXFA 4CHAB 3U1IB 1V6DA 1ZSLA 4Y8XA 4P00A 5I25A 3SGQE 2UUFB 1EZUC 1DY9A 4K5ZA 1BUIA 9ESTA 3PWBA 5DJ7A 1O2MA 2FOBA 3RC4A 3RXHA 1SQAA 3U8RH 1YCPH 1XUIA 3RU4E 1OWEA 1TGSZ 3KF2A 3KN2A 4AGJA 2J38A 4ZHAA 3NXPA 9LPRA 1C1VH 3M5LA 3SJOA 1GBMA 3PMBB 2G81E 5LPRA 3TJNA 1UTOA 1J8AA 1NRNH 2ALVA 2ZC9H 1TX6A 1QBNA 2FI5E 1P57B 1MABB 4CREA 4I8HA 1E38B 2ZU5A 3AW1A 1O3OA 4B73A 3V12A 3IWMA 4B6FA 1UO6A 2FIRH 4UFFH 1KDQB 4OS5A 1J17T 1EAIA 2JIZD 4AORA 2A5KA 1CA8B 3MH6A 4NFFA 1HRTH 4FU9A 3TK6A 4JYTA 3S7HB 2SGAA 3SNDA 4TY6A 1P9UA 2CHAB 1QY6A 1MTWA 1ZPZA 2VWMA 5EIYA 4AFSA 2J92A 2WINI 1KTTB 4TPIZ 1CT0E 2F4LA 1FJSA 1TYNA 1XUFA 5ABWA 4INLA 3DCLA 2R2MB 1A7SA 3T5FH 1DSUA 2ZTYA 4O97A 3A88A 1F0RA 1Q3XA 5EQRA 2O8LA 1E1RD 3M7QA 1N8OC 1A4WH 1ESAA 3SU5A 1P2QA 1FPCH 1O5AB 3MU4A 2PLXA 3HGNA 1AD8H 1A2CH 2NWNA 1C2MA 1C1MA 1L4ZA 1TRYA 1SGIB 3VB4A 2GDDA 5EW2H 1B7XB 1Z8JB 1PPGE 1HJ8A 4U32A 2RDEA 5J4SA 1NFXA 5C67A 3FP8E 2WUCA 3TJOA 3V13A 3NUMA 3UWJH 1GI1A 1MCTA 3AAUA 1XMNB 1O5CB 2HVYB 1D3DB 3A84A 4AGKA 1ABJH 1E1QD 1O2OA 5IK2D 4VGCB 1TGNA 1OPHB 2Z3CA 4DGJA 4GHQA 2WHXA 1S85A 2WPKS 3GS9A 1S82A 3PWCA 1BDAA 5B6LA 1SL3A 1OOKB 1AKSA 2HPPH 4ZHMU 1GHBF 1O3EA 4WH8A 4OGYA 3H09A 2KAIA 3A89A 2PSXA 1O2LA 2WV4A 1V2NT 4Q7YA 1D3TB 3G01A 1EQ9A 1JIRA 3LC5A 3MWIU 4OM9A 1O2JA 1BTWA 2GV6A 3S9BA 1HJ9A 4Q4LA 4BTIB 1D4PB 4U30A 1MTNC 1ZHMA 2ANMH 5C1YA 3UIRA 3T28A 4NA9H 2AS9A 4LOYH 3LGYA 2ZGJA 1OHHD 2J95A 4K3JA 1PQ5A 1ZSJA 2XOKD 4YESB 3DT0H 2OBQA 4MPWA 3U9AH 1N1LA 1AE5A 2WPDD 3SJ9A 1A3EH 3S9CA 4AN7A 1QBVH 4BNRA 1FAKH 2SNVA 3F1SB 3AW0A 3BTME 2F9PA 2ZU2A 3B23B 2H6MA 2GD4B 2YMSC 4BAKB 4B2BA 4K8BA 1B0FA 4I7YH 1ZLRA 1AWFH 2XW9A 4FU8A 1C5XB 3N99A 5DP7A 1SI5H 2Z9KA 1BQYA 2Y7ZA 2ZCLP 5G4BA 2HLDD 4LZ1H 2ZEBA 1E37B 1ARBA 4CRCA 3CNRA 1VR1H 3EAJA 1W0ZU 3N7DA 4WWYA 1BBRE 2XWBI 3E1XB 1TPSA 1P9SA 1UK2A 1FY3A 4I86A 3LGUA 1AU8A 2PV9B 1OP0A 1YLNA 5ESTE 2ZDKA 5FL7D 5EQQA 3OU0A 2CXVA 4E7NA 2WPJS 1GDUA 1V2JT 1GG6C 4X1SU 1BBRK 2EI8A 4X2VA 4H6TA 5FX6A 3KYFA 1L4DA 4RSPA 3PRDA 3P8OA 3RC5A 2F9BH 2HNTC 1VITH 4ZROA 1QNJA 1IQJA 1TA6A 5A8XA 3PM3A 5A09A 2IPQX 2PUQH 4NWKA 1V2UT 1F5KU 5EJ1A 4A6LA 2Y6TA 3E0PB 2ZDAH 1F5LA 1C5UA 3Q3XA 3MH4A 4CH2B 1LHGH 2ZQ2A 1GHVH 1A0JA 2G4TA 1OYTH 5AF9H 3F0PA 1KLJH 1YY3A 1O2HA 1GHAF 3FZDA 2VU8E 1TX7A 3UPEA 4IGDA 3LDXH 2A2QH 1GGDC 3A86A 2BOHB 3E3TA 3LH1A 1CT4E 3TJVA 5GDSH 1TLDA 1NT1A 4X6NA 3WWBA 1MMJN 1PJPA 1DS2E 2AHME 1AIXH 3MU5A 1AHTH 1P09A 1EX3A 1QB1A 4K69A 1O5GH 1QR3E 1KIGH 4ZCNA 5EG4A 1BTXA 1FNIA 3IITA 2WSSD 1M9UA 1FQ3A 1C5OH 1UVPA 1XUKA 1H1BA 1LO6A 2BDAA 1SQRA 2V7QD 1WTHD 2AH4X 3NCLA 2XNDD 2FX4A 1BMAA 1TOCB 2AGGX 1SVPA 1QRXA 2SGEE 2ZFPH 2XTTB 1BRUP 8KME2 1K1MA 1H9IE 1MU8B 2OC0A 3SU1A 2OCVB 1MU6B 4TSFD 1YPLH 1GI7B 1GI2A 3K2UA 5DSFA 4A1TA 2I6SA 3P92A 2RG3A 5L6NH 1QQ4A 3RP2A 3UNQA 1ZMJA 1ELCA 2G52A 1DWBH 5AHGH 3AVZA 4AB8A 1GBBA 4K1SA 1EJMA 1NY22 4ZXYH 2OBOA 1SG8B 1H8DH 1O2KA 1P03A 5C3NA 5CHAB 4XD7D 1C5WB 4CHAC 4GAWA 2JDID 3LPRA 5A0AE 4FUCA 1W0JD 2VVVA 2J34A 2P8OB 1P2IA 1D3PB 4ESTE 1YPHC 4ZHLU 3E6PH 1TBQH 2EY4C 1MZAA 2B7DH 6GCHG 2SNWA 1MTUA 2QIQA 2PUXB 1HAPH 1P8VC 3FKSD 3M5OA 4JMYA 3T25A 2W7UA 1G3DA 1ZMLA 1CGHA 2IOTA 1OYQA 1HAZB 2BDIA 3MNSA 1YC0A 1Z7KA 4X6MA 4YLUA 3KQDA 2TRMA 2ZKSA 3SV2H 4GSOA 5E0GA 3ATMA 2FP7B 3MMGA 2BLVA 1GJ8B 1WTGH 3I78A 2JH0D 1UVSH 1WAYB 4ISHH 1AKSB 3KNXA 4TPYA 2GT7A 3U98H 2JJ2D 2RA0A 1BB0B 1ELTA 2KAIB 4Q7XA 3P70B 4X8UH 2KR7A 3ESTA 2B5TB 4FVDA 1XXFA 3ODDA 2XWAA 1P11E 4JZEH 4Y10E 3ATWA 2CHAC 4SGBE 2STBE 1C4Y2 1NM6A 1CT2E 3Q77A 4Y8YA 2R0KA 4ABJA 4BTUB 3QX5H 1MKWH 2YNBA 1MCVA 2BD3A 2ZPQA 3RXJA 3QGNB 4UFEH 5C5OA 3TU7H 3EGKH 1SKYE 2F43B 4JYUH 3OY6U 2XXLA 3MH7A 2ANYA 1BCUH 1OS8A 1Z71A 3TITA 3ZVDA 1G2MA 1GMCG 2RDLA 1ELGA 2P93A 3VGCB 1O3HA 5EXNA 5K0HA 4MPVA 1HAHH 2ZHWH 1YPJH 4ZKRU 4BAHB 5HIZA 1CVWH 5GWZA 1GPZA 4YLQH 3NWUA 4YZUA 5EQSA 1C9PA 4HFPB 5BRRE 2YMSD 2BQ7B 3FZZA 4Y6DA 1G30B 1VJAU 2Q6DA 4XRNA 1FMGA 3MO9A 4INHA 5FPSA 3DSGA 1BTUA 2EQNA 2FS8A 1CGJE 2ZQ1A 3KQCA 3PB1E 2FTMA 4CR5A 1YGCH 2CF8H 3GCTF 3OTJE 3DFLA 2PP6A 3SU3A 2VIOA 3A7XA 1W0KD 2SGQE 2BMGB 4NG9H 1C5VA 5CE1A 3PV4A 1NESE 1MTNB 1PPEE 2BY5X 3ATIA 1SLVB 5C20A 1ETTH 4VGCC 4H6SB 2CMYA 3M3TA 2BVSH 4DVAU 2R3UA 1SGDE 1ELEE 1ANDA 1MBMA 5F6MA 1IQLA 2EC9H 1O3KA 1ZGIA 4BTTB 4QT8C 2HRVA 1SPJA 1LHDH 2ZG0H 3K65B 2V35A 1O2XA 3GOVB 3ZZAA 2FOFA 2OQUA 1O0DH 2Q1JA 4UFGH 1HAYB 3UQOA 1ZSKA 5PTPA 4H42U 7ESTE 2CN0H 1JRTA 3UB0A 1LKBA 3SOSA 3TGKE 4X1NU 2G00A 1SHHB 2AEIH 3SJ8A 4FXGH 5EJZA 3S9AA 5F8ZA 1V3XA 3VPKA 4HG6A 2XBYA 4X2XA 1ELDE 1QURH 3SORA 2OK5A 1SFQB 5JBCS 3VB7A 1HIAB 5J4QA 2FXRA 1Y8TA 1N6YA 4LZ4B 5L2YH 3PLKA 1ZTJA 2F91A 3OAAD 1OKXA 3SYJA 1XKAC 1NBMD 1O5BB 4WH6A 1H8HD 1CBWB 3N7EA 4UEHH 3DUXH 4NWLA 5A2MH 5DGJA 2FYRA 2WZQA 2PGQB 1NS3A 1UTQA 4ABDA 3T2NA 1VITG 1GHZA 1EAWA 5SGAE 1ZTLA 3DA9B 2ZDNA 4HTCH 3U28C 1O38A 5A8ZA 1H9LB 1YCPK 1O2WA 2FO9A 2THFB 4IMZA 2QYIA 2V3MA 3KGPA 4TWYA 4YXWD 1A1RA 3F68H 5HM9A 1IQEA 1D3QB 1DUEA 1VCQA 2F3CE 3RM2H 1P2JA 1ARCA 1LVMA 1ZPBA 2V3OH 1ZMNA 4WY3A 3SNCA 4ZKNU 2BDBA 1LDTT 4DIIH 1TQ7B 4ABAA 1LHFH 2GZ8A 2G5NA 4JK5A 5DP6A 2SFAA 2Y82A 5C17A 5K7RA 1WQSA 1P0SH 1W7GH 2XC0A 4LXBH 1CHOG 4KP0A 4DT7B 2AMQA 3TGIE 3ZYDA 1H8ED 2DE8A 2UUYA 3OEED 1S6LA 3QZQA 1LTOA 5GCHG 2QF3A 1SGEE 1AI8H 2ODPA 4ZKOU 1LHEH 1IQMA 2ZGBH 4DJZB 3ZZ5A 1N6XA 2FLRH 1NN6A 5IYTA 2HALA 1VGCB 2H1UA 2G8TA 5EJLA 1C5TA 2H9HA 1JOUB 1SGYE 3F9FA 2ILNA 1BJUA 1SHYA 1C2KA 5F8TA 1K1LA 4PROA 2ZGCA 1H8IH 1H4WA 3UTUH 1WOFA 1UTKA 3LOXA 1Y3XA 1F0TA 1GHAG 4OS2A 1GMDG 1O2GH 1BMMH 1HDTH 1O2IA 3LJJA 2OD3B 1T4UH 1LCYA 3RXVA 2GCHG 4ABFA 2BY9X 3RU4D 1GJCB 1O3MA 1QJ6B 4FUDA 5JB9S 4Q7ZA 1ZPCA 2QF0A 3MO6A 2BY8X 2XCFA 2VVUA 2BZ6H 1U6QA 2SGFE 2UWPA 4XOJA 1AY6H 1W14U 3TGJE 3URDA 3GDSA 1LQEA 2BLQA 3DSPA 2RCEA 1UVTH 4UONA 5A0BA 1IAUA 2VWOA 2P95A 2QXIA 1QL9A 3SHCH 1G3EA 3QZRA 1OWHA 3BSQA 2ULLA 4MPXA 2KM0A 5CHAC 1UTMA 1HXEH 1GI0A 1LVYA 2P8OC 1A5GH 5LPEA 1TWXB 2TIOA 1OSSA 4MNXA 3T26A 4GCHF 3ZVFA 4MQAA 5T3HA 2PW8H 4X0WU 4UD9H 4D9QA 4Z6AH 1V2LT 1RIWB 1IQKA 1QQUA 2UUJB 1LVOA 1TNLA 4A7IB 2BD2A 1HYLA 1ZRKA 2PKAB 4UDWH 2FI3E 1AZ8A 2ZPRA 4ABEA 1S81A 1O2UA 1JXPA 3WW7A 3SUGA 2YOLA 2JH5D 4WVPE 1O3LA 4Y71A 5A0CA 1C5SA 2WPHS 1NO9H 2K0QA 1C4V2 3PLBA 4E06H 4J2YB 3OX7U 3TH4H 3MOCA 1P05A 1MH0A 3D65E 1P3CA 3O8DA 3DSOA 1UCYH 4B1TA 1IQHA 4UE7H 2W3IA 1UTLM 3QK1A 2VWNA 3BTKE 5AFYH 1AZZA 4FOUC 1HCGA 4K1EA 2EA3A 1LMWB 2Z9IA 3LU9B 3VXEH 3Q00A 3OFND 3RMOH 3BTHE 2M5TA 3VGCC 1EZXC 3BF6H 4CBNA 3L6PA 4X2WA 1S84A 3HPTB 3D23A 4TWWA 4KTSA 2H5CA 3OE7D 2C4FH 1ANEA 3ZZCA 1ZJDA 1ZOMA 1V2MT 1YCPM 1P2KA 1YF4A 3EA9A 3KL6A 1EFRD 3M5MA 4I8KA 2A4GA 2HPQH 4D7FA 2ZDMA 1QJ7B 5DP8A 1P04A 1GHYH 4IBLH 4K1TA 1FV9A 1VCWA 2F9OA 4R8TB 3GISB 5EPYA 1KXBA 2J5UA 1C5LH 4Y8ZA 2VGCB 4TY7A 3H7TA 1PQAA 3SUDA 1EJAA 1QIXB 3GY2A 1ELVA 3BEFB 3NPSA 1V2ST 1YPKH 1TE0A 1KLIH 1W7XH 2ZFFH 1EJNA 1KYNA 3RM0H 3SQHE 2V0BA 5FPTA 3SNAA 1T7CA 1UTNA 1BMFD 5GXPA 1KSNA 2P3UB 4KTCA 2QE7D 2O8TA 3LGTA 2WPIS 2XRCA 4UFDH 4D9RA 1UTJA 3SQEE 4Q63A 2ALPA 1HAXB 4ZH8A 5KEDA 1EXFA 4SGAE 2FESH 1UHBA 1C1UH 5FHTA 3BEUA 3P95A 5EU8A 4AZ2B 1OXGA 5GIBA 2Y81A 3M61U 5C5NA 1OWDA 3RXMA 1YWUA 3PTNA 1GJ4H 2O8MA 5EODA 1SOTA 3OEHD 1BRCE 1P01A 1V2PT 3BTFE 3O8BA 3K6ZA 1F5RA 2A1DB 1O3DA 1QBOA 1DPOA 3LT3A 1TRMA 4BXWA 2P16A 2F9VA 1FN8A 2JH6D 2QXJA 3BIUH 3HK3B 1BTZA 1NTPA 2KCAA 4Y11E 5FCRA 1P2MA 1EP6A 1QA7A 4JZDH 4D7GA 5FXLA 2XBWA 2TPIZ 1TNIA 1ID5H 1KXAA 4KGAA 4NIXA 1GHXH 1MKXH 1SQTA 1O31A 4TT3D 4ABIA 3PMJA 1DLKB
chains in the Genus database with same CATH topology
5JBBS 1T8MA 4RN6A 3CS0A 1GVKB 4A5TS 3EA8A 1Z6EA 5JDUB 1K9OE 1O2YA 4GPGA 3RXLA 2GCTB 2ZFRH 4MG3A 1CBWC 2A5AA 3ZZDA 1O2VA 3E8LA 5C1XA 1C2FA 1W0YH 4K8YA 1SQOA 1YPMH 5HXFA 1O3FA 3ZVAA 5DP5A 2R3YA 3S7KB 1GMHF 1Y3VA 1DXPA 4NSYA 2ZECA 1A3BH 1AB9B 2ZZUH 3RDZA 3C1KA 2BVXH 2RA3A 1XVOA 5DG6A 3URCA 3OY5U 1CQQA 3OSYA 1AFQB 1WU1A 4ABGA 1C1PA 1XXDA 2R2WU 3AASA 1ANCA 1GI8B 1S5SA 1UTPA 3PMHB 1XVMA 1AVXA 3VB3A 4IN2A 4FUFA 3SUFA 2CGAA 1O3PB 1FUJA 3D49H 1MKWK 4B74A 1IHSH 1P2OA 3P8NA 2FS9A 1LHCH 3PROA 2BM2A 2ZI2H 1FI8A 1VGCC 5AVDA 4CRFA 2BY6X 4E7RG 2PR3A 1A0HB 4DG4A 2ZPSA 1E0FD 3VXFH 3SV6A 1K22H 1V2KT 3CS7A 7GCHF 4ISOA 4TYDA 4YT6H 8GCHG 1J14A 1O36A 1GBEA 5E2OA 1X7AC 4A1XA 2AFQB 1RS0A 1T8NA 2A4QA 2D1JA 3PLPA 1AN1E 4IC6A 4RKOB 4AOQA 1BBRH 4MNWA 1IQIA 1BITA 1OP2A 1GBTA 1SGQE 2QXHA 5T6GA 4ZAEA 2PTNA 1BMNH 3MHWU 5E0HA 3H7OA 1O2TA 3RXAA 1GI4A 2ZU3A 1LVBA 2GMTB 4XE4A 1FN6A 1W10U 3A80A 2Q6GA 4AX9H 3BV9B 4BAMB 2O8WA 4NCYA 1XUHA 2UUKB 2AIQA 1O3NA 2ZP0H 2PWXA 2ANKH 3Q3KA 3F9HA 4K60A 1XUJA 4FU7A 1DX5M 2OUAA 1G36A 3UOUA 3GCHC 2WV5A 4H4FA 3ZV9A 2Y5HA 3EA7A 4J1YA 2UWOA 4AB9A 1SGFG 1CE5A 1J9CH 3RXTA 3HKIB 2VIDA 3V3MA 3P17H 1O30A 1UVOA 2G55A 4BOHA 5FPYA 2GP9B 1J16A 2W3KA 1S83A 3VB5A 1BTYA 1C1NA 1RD3B 4MNYA 5TCAA 1RIWC 1QB9A 2QGRA 3F9GA 2GX4A 1W3CA 3TNSA 1G9IE 3MU0A 3RXOA 2ZFTA 1AFEH 2PTCE 2Z3DA 1TPOA 2TBSA 2ZHFH 1SBWA 2HVXA 4MTBA 2B0FA 3GY8A 2V3HH 2BDGA 6LPRA 4K2YA 2XCNA 3RXQA 3TVJB 2FMJA 1C9TA 4WMFA 4YOGA 2XC5A 2H5DA 3A8AA 1UVUH 1BMLA 1SGTA 1C1SA 4XDEA 1HAVA 2GZ9A 1DWDH 2CF9H 2TGPZ 3U8OH 3TH2H 1TGTA 4WXIA 1BA8B 1ZGVA 3W95A 1GI6A 3OYPA 4THNH 1UHBB 3BG4B 3QTVH 1BZXE 1AO5A 2GVFA 1A5IA 4X6OA 4GLYA 4DURA 1ELBA 3BTGE 1BHXB 2GKVE 1FONA 1YBWA 3SI3H 4A1VA 1YPGH 3A87A 3RLWH 1GJ6A 4XFQA 4WMEA 3PYHA 3K9XB 1TOMH 1FDPA 3P8FA 3GCOA 3LONA 5F03A 1GCTB 2ZNKH 4WF8A 3U1JB 3TLOA 1NPMA 1AVGH 4ISIH 4NIYA 1MD8A 4IMQA 1BHXF 2Z94A 4Y79A 1A46H 1KXFA 1BRAA 1HV7A 3FAOA 4NGAH 3ZZ3A 2HLCA 4YM9A 1UJ1A 1KDQA 1TBRH 1B0EA 1P06A 1V2RT 1EATA 1W12U 2F9UA 1NRRH 5ETXA 3LGVA 4WXVA 5LH8A 1ESTA 4NZQA 4MPUA 4YOIA 2FOMB 4I31A 1JIMA 5FBIA 2AMDA 3ZVEA 3JZ2B 2VGCC 1V2OT 1NRQH 4Y7AA 3R3GB 1RXPA 2QAAA 1QL8A 2NU0E 2WPLS 3I29A 4XBBA 1F92A 1GJBB 1C5YB 4KKDA 1JWTA 2FLBH 1PQ7A 2Z6BD 5LGOA 1RTFB 4DOQA 2A4RA 4CRAA 2JKHA 4I32A 1QHRB 2A7JA 3UFAA 4NIWA 5A8YA 3F9EA 1TAWA 1OP8A 3E91A 5E0JA 3O8CA 1C2DA 4JYVH 1HAOH 2VNTA 1IQNA 3DFJA 3SUEA 1UK3A 3KIDU 2BHGA 3ODFA 2C8ZB 2ESTE 3M35A 4M7GA 1GHBG 1KXCA 1CGIE 1Q31A 1RTLA 2VWLA 2BVRH 2OINA 2EI6A 1P2NA 1C5MD 1CA0C 2VJ1A 3LC3A 1DY8A 2BXUH 3E0NB 4KTUA 4YOJA 1HGTH 1MBQA 1PPHE 1EZQA 1G2LA 3BTDE 2G5VA 1WCZA 2AIPA 3N7OA 3NK8A 5L30H 3HATH 1TNKA 2FOAA 3M3SA 2HWLB 3SU4A 3SV8A 1RTKA 1SGRE 2FM2A 3RMNH 1NROH 4CRGA 1HJAB 2BOKA 1L1NA 2ZDLA 2AYWA 1D6WA 3FP6E 1AQ7A 3PMAB 3ZZ7A 1IHTH 1FLEE 5EW1H 1DSTA 3GY7A 4MNVA 3QUMP 2FZZA 1Z1JA 1OX1A 1K1PA 5DKMA 2PHBA 5T6FA 1EKBB 1ETSH 1O3AA 3U8TH 1TNJA 1GI3A 3UUZA 1THSH 5FAHA 3RLYH 4ISNA 2WYJA 2GCTC 1SGPE 1FPHH 2H2ZA 3SBKA 3QWCH 4CH8B 1O34A 2OLGA 1VZQH 5HMAA 1TGBA 2SGPE 3UR9A 2OC7A 1FY5A 1ZRBA 3ZZ9A 1L1JA 4ZKSU 2BDYA 1CHGA 3B8JA 2OQ5A 1YLCA 3SN8A 1KLTA 1WBGB 3MU1A 1C1QA 3SU2A 1MQ5A 3SNEA 1PPBH 1MD7A 3GY6A 3SW2B 2ZHDA 1AB9C 4O03A 2FEQH 6CHAC 3ZZ4A 1SB1H 1DWEH 2R9PA 2K1QA 1SC8U 1AUJA 1AFQC 3DHKH 1C2JA 4BANB 3KHVA 3MU8A 2FDAA 5F8XA 1C5NH 1EPTA 1G32B 1CSOE 3LGWA 5H4IB 1ZHPA 3HKJB 1TGCA 2VB0A 3A8BA 3FP7E 3RXBA 6GCHF 2DE9A 1EUFA 4MVNA 2ZTZA 3QN7A 1Q2WA 3TK5A 4O9VA 4JCNA 1K1NA 2A4OA 1GJAB 1UCYK 3QLPH 4OS1A 1DT2A 1ANBA 5FX5A 2FWWA 1MQ6A 3SI4H 1D9IA 1IQGA 4BXSA 1SGNE 1HAVB 2WPMS 2GZ7A 5CMXH 2C3SA 1TPAE 1GJ5H 1TALA 3VEQB 3UR6A 1C5PA 4HGCA 3MO3A 2EEKA 1QJ1B 1HNEE 1OWJA 4X1PU 1C2GA 1KTSB 1EOLA 1LPZB 2OXSA 2W5EA 3TJUA 1LQDB 3GCHB 3IG6B 2QV1A 4I8LA 3RXPA 3B9FH 3M7TA 3M7UA 3STIA 4F49A 2BTCE 2Y80A 4XSKU 1TONA 2O8UA 1TPPA 4U2WA 3KEEA 1SOZA 2A7HA 5L2ZH 2HGTH 1L1GA 1V2WT 1T8LA 1YPEH 1C5ZB 2OC8A 5JB8S 3ZZBA 1W13U 4AYVB 1K21H 2GMTC 4YT7H 3ENSB 1DITH 1O5FH 2P3TB 1Y5AT 1GMCF 2ZU4A 3RMLH 5T6DA 3SGAE 7GCHG 1TMUH 3BG8A 3RXRA 1MTVA 2WUBA 5JBTA 1CU1A 2IPHA 1DUAA 4MDSA 2BD9A 1ZHRA 3MNXA 1QB6A 1UMAH 5BPEA 3LKWA 1FY8E 4I8JA 1G37A 1HAGE 1S0QA 3QTOH 4INKA 1NU9A 3WY8A 1NFUA 8ESTE 4WJG2 2P59A 1HBTH 3BTTE 1TBZH 2BQWB 3SHAH 2J4IA 5TJXA 4FVBA 2PSYA 2LPRA 1TNGA 4I33A 4ASHA 3BTWE 4CR9A 2STAE 1EAXA 1A5HA 1P10A 2P94A 3KQEA 3GCNA 1THPB 4YO9A 1GHWH 2NU2E 2BD7A 3U69H 3ITIA 3SJIA 3RXKA 2VIVA 1Y3UA 3GYMA 4JZIA 1GBLA 2A5IA 1WYKA 1THRH 1TIOA 1H9HE 5DP4A 1F0SA 5AFZH 1GDQA 1S0RA 2ANWA 3BG4C 1TB6H 4FUHA 4FUEA 4DW2U 2GDEH 4B71A 1PYTC 1MKXK 4I8GA 2IN2A 5B6OA 1Y5UT 1GL0E 3UOPA 2QY0B 3A82A 3SNBA 7LPRA 2BD4A 1ZZZA 3RUOA 1SSXA 3GY3A 3NKKA 1T4VH 3VB6A 1GL1A 3GYLB 1TFXA 5HM2A 4Q80A 1O3IA 4IS5A 2BX4A 2ZA5A 1GCTC 3RC6A 4NFEA 4AFQA 1XUGA 1K28D 2VIQA 3HK6B 1ABIH 2IJOB 1T8OA 2B9LA 3MNCA 3GICB 3H5CB 1O3BA 4GVUA 2AERH 2AGIX 2BD5A 1A61H 2XNIA 1ZTKA 3A7WA 1G3CA 1Z8GA 1QGFA 2ZTXA 3K6YA 1O3CA 1PFXC 2XBXA 2CV3A 2UWLA 1ZJKA 4NA7A 2J94A 2OTVA 1Z1IA 1AE8H 2BD8A 2G4UA 2ZFSA 3RXDA 5E2PA 3A8CA 1BTPA 1FIWA 1NC6A 1P02A 1CA0B 2JETB 1C5RA 3GCTG 1VITF 1QCPA 3A7YA 2D26C 1PPFE 3A7VA 1GBAA 3PO1C 3ZV8A 4KELA 2QN5T 1CO7E 1C2LA 4JZ1A 3S0NA 1TQ0B 1V2TT 3UY9A 1NRSH 1O2NA 1O2PA 2Q6FA 2A31A 2A45B 2Y7XA 3M3VA 1G3BA 1T31A 2VVCA 1C2IA 1NU7B 1EPTB 5E8EH 3SJKA 4HI3A 1V2QT 4JZFH 1QA0A 2WYGA 1EAUA 3A85A 1EB2A 3STJA 2VH0A 5EXLA 2ZFQH 2QCYA 6ESTA 1W8BH 2ZGHA 1CHOF 1ELAA 1LPGB 5GJ4B 3JZ1B 2C90B 5GCHF 4DY7B 1DE7H 1FZZA 1F0UA 1HJAC 3KQBA 4Q2KA 1DM4B 1GBKA 2GV7A 8LPRA 3RU4T 4F4OC 1MAYA 1IQFA 1LKAA 2H9EH 1C4U2 2A32A 1BJVA 3LGIA 1C2HA 3QO6A 1XX9A 1GJ9B 3UQVA 1C1RA 1JBUH 1HUTH 1DLEA 5DO4H 3SV7A 6CHAB 4CBOA 1W2KH 3P6ZB 3V7TA 4OGXA 3GDVA 1L0ZA 1GMDF 3SO3A 1C1OA 1JMOH 2BYAX 1FY1A 4FUJA 1TA2A 4ZMAH 3R0FA 2NU3E 2GCHF 3A7TA 1YP9A 2C8XB 4GUXA 2R0LA 2ZHQH 2BY7X 1OWIA 1Z8IB 4Y0ZE 2PKSB 1GJ7B 1GI5A 1TMBH 2ODYB 5GPIB 1GVLA 3MTYA 1O3JA 1FIZA 3M36A 4ISLA 1C2EA 3KCGH 3O8RA 1ZR0A 2Z9LA 2NU1E 4IW4E 4NA8A 3UNRA 4CRBA 3HGPA 4O3UA 5I46H 1UK4A 2FOEA 3CP7A 1HIAA 2GTBA 3TPIZ 2ZWLH 3GY5A 1FAXA 1ETRH 1GVZA 2VIPA 3ELAH 1Z8RA 1ACBE 2D2DA 1O33A 3ZVCA 4D76A 4Y0YE 2FYQA 3MH5A 1O35A 3SZNA 1K1JA 2G51A 3S69A 1PQ8A 2ZGXH 1MTSA 1SLWB 3MFJA 4B2CA 3BIVH 3TH3H 3BN9A 1O2RA 3SU6A 3EDXB 3RXGA 1TX8A 2J9NA 4LK4A 3GY4A 1QRWA 4NZLA 2XBVA 3F6UH 4B2AA 4OS7A 1F2SE 2BDCA 1MUEB 1Y3WA 2A0QB 5JBAS 2ZHEH 1YKTA 3FFGA 2C8YB 1FY4A 4DIHH 2BQ6B 3A8DA 3TNTA 4GHTA 4AG2A 1GCDA 4U01A 4O3TA 2FOGA 4MLFB 4OS6A 4WMDA 1EOJA 2VINA 1PYTD 4X8TH 1Y59T 1ORFA 1BT7A 2A7CA 2XYAA 3TIUA 1OWKA 2FPZA 2FOHA 1C1TA 2Y5GA 1GJDB 4X1QU 1V2VT 5FBEA 3L33A 3SGBE 1VCPA 1HB0B 1SLUB 3LH3A 4XBDA 2YNAA 1GDNA 3LIWA 1O5DH 3BTEE 3RXSA 1SGFA 1DXWA 1O32A 1N8OB 4YTAA 2LNCA 1AGJA 1HLTH 2F9NA 5HYOA 2TGDA 1PPCE 1LPKB 2H9TH 2BXTH 3P8GA 1VJ9U 4Y76A 3C27B 1Y3YA 3SU0A 3ZZ8A 3L3TA 1AVWA 5DK1A 4AG1A 2TGTA 5JPMH 4GCHG 5EXMA 4DCDA 1K2I1 2BX3A 1ELFA 2C93B 3RXUA 1HAIH 3ZVBA 1ZYOA 1XM1A 1XKBC 2C8WB 2W7SA 4AFUA 3D62A 1QL7A 4NSVA 5C1UA 3E90B 3ZYEA 4X2YA 4X8VH 1SMFE 3RMMH 5DP9A 2B8OH 2BDHA 4B75A 2ZF0H 3M5NA 1W11U 4HZHA 2AGEX 5DP3A 1QFKH 1GBIA 1GBJA 2XC4A 1ESBA 1Y5BT 3GDUA 3ZVGA 3UWIA 1HPGA 4IN1A 1BOQA 1MAXA 2QA9E 3UNSA 2ZCHP 1HFDA 1GBHA 1B5GH 1AMHA 1F7ZA 4X1RU 1P12E 4JK6A 1SFIA 2FI4E 3CENA 1A0LA 2FTLE 4IC5A 2GGVB 2ZO3H 5ESBA 1QRZA 5FCKA 2ODQA 7KMEH 2P3FH 2ZIQH 4RKJB 3EE0B 3EQ0H 3EYDA 2PKAA 4FUIA 3BEIB 3PO1B 4ZUHA 5HGGA 1GBDA 1P3EA 4NIVA 2FX6A 2GT8A 2A2XH 1EZSC 2VIWA 4XBCA 2Z9JA 1NZQH 4CRDA 2W26A 3A81A 2OP9A 5DPAA 2HNTE 1O2SA 1K1OA 2TGAA 2ASUB 2DUCA 4B76A 1EASA 1SLXB 4E05H 1K1IA 2PFEA 5TCCA 1DDJA 1RJXB 3RXCA 5EOKA 1WQVH 3ATLA 3T27A 3T29A 3MI4A 1IOEA 2JETC 1WUNH 1NFWA 4Y7BA 3A7ZA 1DANH 2CJIA 4A92A 3ATKA 2O9QA 1AWHB 3A83A 3VFEA 1PPZA 4X8SH 1E34B 2Z3EA 1GG6B 5EGMA 2BLOA 1D6RA 1L2EA 1O39A 4ZXXH 1YLDA 3NZIA 2FODA 1GBFA 2PGBB 1O2QA 2HOBA 4AFZA 2I6QA 4ABBA 2ZU1A 4D8NA 1DOJA 1NFYA 1AUTC 4BAOB 1O3GA 1RGQA 1EB1H 4FUGA 4AYYB 1RFNA