2G51A

Anomalous substructure of trypsin (p1)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Trypsin
total genus 58
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g51A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g51A01
1NROH 1MKWH 1SLVB 2FS9A 1S6HA 3VFEA 4A7IB 1BHXF 2XBVA 3RXVA 2QGRA 2H1UA 2OC0A 2Y5FA 2UUKB 5K7RA 4INHA 2JH5D 1IOEA 1ZTJA 1D3PB 2PGBB 6GCHF 4VGCC 2BZAA 3A85A 2BY7X 2A7JA 4WH8A 3SU5A 3T25A 4UFFH 2FOFA 1SGYE 1EKBB 1LHDH 1SLXB 3LT3A 2ZDNA 1VITG 2ZPRA 3LKWA 1BMLA 1CHOF 4U32A 3MNCA 1W7GH 5CMXH 1Y3XA 3OX7U 4FUIA 1A1RA 1GMDG 1LQEA 1FMGA 1XUFA 2VGCB 2A4QA 2XCFA 2XXLA 1YP9A 2F9PA 1C4Y2 1O2JA 3GY8A 1EJNA 2WPIS 4Y71A 3SV6A 4WXVA 3C1KA 1GHXH 1HAYB 4MPWA 3SBKA 3M5OA 3VXEH 2Z3CA 3E3TA 1EX3A 2BOHB 1Z8IB 2PKSC 2UWOA 2GMTB 5IDKA 3GCHB 1ZJDA 3AAVA 1N8OB 1IQGA 2GMTC 3SJ9A 3RUOA 2OQ5A 2D8WA 4YZUA 2RG3A 3RXEA 1NFXA 2AIQA 4ZKNU 1HYLA 5EXNA 1NPMA 1D3QB 1QURH 3MU1A 2TRMA 1P2OA 1GJDB 1ZGIA 2ZTZA 4CRAA 2P8OC 2AH4X 2ZHQH 1A3EH 1KYNA 2P59A 1G3EA 1O3FA 1TONA 1DS2E 1PPZA 3MU4A 3FP8E 2ODPA 1WAYB 4ISLA 1GBMA 2SGDE 1OWJA 4CHAC 2BZ6H 4A1TA 5JBAS 4D9QA 1HXEH 1P12E 1GI7B 3PO1C 4D8NA 1V2UT 3LJOA 1YPMH 2V6NA 4AFSA 3RMOH 2G00A 2DUCA 1EAWA 3ESTA 1DXPA 2ODYB 1MBQA 3SNDA 2C4FH 1QY6A 1QQUA 1O2YA 2H6MA 3BIUH 2HOBA 3PROA 3WY8A 1AQ7A 3A84A 1ZSJA 4ZHMU 1QRWA 4DJZB 2VH0A 2CXVA 3DD2H 1EQ9A 1O2VA 3TH4H 3VEQB 3QDZB 1PPBH 1T8MA 2ANKH 5DK1A 2C90B 1GG6B 4ZHAA 4H6TA 3M5NA 2TGDA 1BBRH 4I7YH 1GI4A 3GDSA 2GGVB 2WUBA 2FOEA 1W0ZU 4ZHLU 2OD3B 3PMAB 3S9CA 4TWYA 2FYRA 2C3SA 2BX3A 2VWNA 4FVBA 2Y80A 1NFYA 1B0EA 1K28D 1O2RA 2ZG0H 1LDTT 3ZYDA 2OC1A 5ESTE 3CS0A 1QBOA 3SV9A 4WY3A 4O3TA 1PQ7A 1Q3XA 1V2ST 3P8FA 3SO3A 2G4TA 1A7SA 1GBJA 2Z9KA 3R0FA 1H9IE 4B73A 1NS3A 1QL8A 1TPOA 1SGDE 5HGGA 1SQTA 1O31A 1H1BA 4GAWA 2FS8A 5F8TA 1SQAA 2J34A 4XDEA 3A88A 4KTUA 3LGVA 1UK2A 4DY7B 2ANWA 5A8XA 3PM3A 2PKAA 3DA9B 3Q3YA 4X8TH 1G3BA 2F9NA 3RXKA 1P2QA 3LJJA 4ABHA 2ZA5A 1RD3B 4D7GA 2GT8A 1HAZB 1ANCA 6GCHG 2BY9X 2V3OH 3MNSA 5FXLA 2FO9A 3UNQA 2J94A 4NIVA 5HYOA 4Z0KA 1FY4A 3QGJA 1MKWK 1L1JA 2ZFTA 4TY7A 1GBBA 1J16A 5FPTA 1KTTB 1O2ZA 1TPSA 2BD8A 4X8VH 5EPYA 2NU1E 1BUIA 3VB7A 2H5CA 4DW2U 1O34A 1ZR0A 5JPMH 3A7VA 4BAMB 1SG8B 5EXLA 1O2PA 2BY6X 2P93A 1C2DA 1SL3A 4MG3A 2Y7ZA 3GISB 4D7FA 2FIRH 3RXPA 2BVSH 3FZDA 1EZSC 1GJ7B 4KTCA 4WXIA 4Y8YA 4U01A 2AFQB 1EP6A 1GCTB 3TK9A 4CR9A 4ABBA 2WYGA 5HM9A 1P04A 3PLKA 1X7AC 4B75A 5DO4H 1W13U 1W3CA 1ANDA 3D62A 1QQ4A 1L0ZA 2BVRH 5AFYH 1O3BA 4WH6A 5E0GA 2AIPA 1G32B 1Y5AT 1GMDF 1XVOA 3KQDA 4FUCA 3P8NA 3A8AA 1C5LH 3QWCH 4MPXA 3M36A 1DXWA 1MZDA 1J14A 2QAAA 3DHKH 2C8XB 1FY3A 4NIWA 1GHBF 1ZSLA 2ZHDA 5T6FA 1E34B 1F0UA 3SJ8A 1CSOE 3KCGH 2BM2A 4Y79A 2BYAX 2PTCE 1HIAA 2GX4A 1C2FA 1H9HE 1VITF 1MTNB 5GIBA 4CRDA 1DANH 1S85A 1O3IA 3BIVH 1PJPA 1UVOA 2XC5A 1EZXC 3P6ZB 4Y11E 2H5DA 2H9EH 3TGIE 1O5GH 1K1PA 3E90B 3LU9B 4AN7A 2VVVA 4NFEA 4K3JA 3MNXA 1NTPA 1SFIA 3A7WA 1KLTA 4CRGA 1XXDA 4HZHA 1MQ6A 3PMJA 3QZQA 2JKHA 2EA3A 3SU0A 3AW0A 5I46H 3M3TA 5GJ4B 1YKTA 4GHQA 4X1PU 3VB3A 2A5KA 2BHGA 1KLIH 2NU0E 3ZZAA 4IC6A 2J92A 3T5FH 3KIDU 3L3TA 4XBBA 3GCTF 1ELCA 3URCA 3K6YA 2OCVB 3QUMP 1G37A 3EA7A 2AYWA 5EW1H 1TGBA 2FOBA 2VINA 1O38A 1GDQA 2BD9A 2YNAA 3GY3A 1QJ6B 2V35A 5J4SA 3MU8A 4SGBE 1E37B 3NUMA 3SGBE 5TCCA 2W3KA 2CF8H 3KQCA 2C8YB 2J95A 4X6NA 4B2CA 1RTFB 1KTSB 1ZMNA 2CF9H 1Z1IA 4JK5A 1JXPA 1CVWH 2VB0A 3D49H 2BLQA 2Z3DA 1YLDA 3BV9B 2ILNA 2ZNKH 1Y5UT 2R9PA 3A81A 2ANMH 1BB0B 1QL7A 2VVCA 4X1SU 3PWCA 4CH2B 1EJMA 2F9BH 2Y81A 1C5YB 2R2MB 2VNTA 1RFNA 1ARBA 1HJ8A 2D2DA 3NXPA 1ZPBA 3GY7A 1NT1A 2GKVE 1OOKB 1SPJA 1RTLA 1TBQH 1K1NA 3PYHA 1TOMH 3BF6H 4FUBA 1AB9B 1SOZA 1MUEB 3TNTA 3V12A 4K8BA 1K9OE 3U1IB 2W3IA 1A61H 1HJAB 1D3TB 3N7OA 4XE4A 2ZTYA 1UCYK 1ZPZA 2PSXA 2ZO3H 1C1RA 1GHVH 1B0FA 3UWJH 1OX1A 4FU7A 4O97A 1CGHA 4PROA 1S6FA 4ABGA 2A4GA 2D1JA 2BTCE 2F83A 3P8OA 4H4FA 1O2XA 2ZKSA 2P95A 1NFUA 1UTKA 4Q7XA 1GBEA 1AFQC 2RA3A 4X6MA 1ID5H 2OC7A 1LHEH 2KAIA 1HLTH 1DLKB 2VWLA 4JYTA 2O8WA 3DUXH 2AGGX 1UVTH 4BAQB 5GCHF 2FI5E 4A92A 1GMCG 2FDAA 2ZFPH 1P11E 3P8GA 2HVXA 1KXCA 1QNJA 3VB4A 1BA8B 3LH3A 5FCRA 1F92A 4OGXA 1ETTH 5L6NH 1RTKA 1EP5A 1VJ9U 2SFAA 4K1SA 2PUQH 1QR3E 1EATA 2HNTE 4RN6A 1CE5A 7GCHF 1QA7A 1ZTLA 1FLEE 2FEQH 1J15A 3RXMA 1SGFG 1TRMA 3ZZ6A 5TCAA 3U8OH 1K1LA 1FPCH 3A80A 4X0WU 1LPZB 1N8OC 2FX6A 1C5ZB 2FYQA 1V2RT 1FONA 1BTYA 1XVMA 1GBTA 5DP6A 1TALA 4DCDA 1AHTH 4BXSA 4ISNA 1GCTC 2ZCKP 2Y5HA 2AERH 1ZOMA 1TWXB 2DE8A 1K1JA 1GJ5H 4AGKA 3KNXA 2EI7A 1ZTKA 3MU5A 3RXJA 1Y3VA 3TJNA 2AGIX 3BEIB 3U98H 1ANBA 1TA2A 1TBZH 1GJ6A 4A5TS 3LPRA 2IOTA 1FNIA 4KTSA 4DOQA 3LGYA 5FX5A 1GBIA 3Q3KA 1WYKA 1J8AA 3PMHB 4QT8C 1JIRA 1DWBH 2A45B 1OYTH 1L4ZA 2R0KA 1JMOH 2VGCC 1F5LA 1TYNA 1V2JT 4X2VA 1D6WA 4MTBA 2ZDVH 2GV6A 4B71A 2BDAA 3FP6E 1AIXH 1FPHH 2OTVA 1W2KH 3RXSA 2SNVA 2QN5T 1E35B 1SGCA 4I31A 5F8XA 4MNWA 7GCHG 1C2HA 1N6YA 1T7CA 4GLYA 1EAUA 4HTCH 1MH0A 2FOGA 5FCKA 1SGFA 3PO1B 1EAXA 2ZDKA 2SGQE 3PWBA 3KQEA 4ABDA 2GDDA 2GCTB 1BTPA 2VIOA 1GBFA 1SSXA 4MVNA 1G2MA 1UHBB 2BLOA 3SNAA 5FPYA 1FXYA 2OC8A 4IGDA 2ZDAH 1GPZA 1MBMA 1XUKA 3UR9A 1SHHB 3L6PA 3NWUA 1OWEA 1E0FD 1TOCB 4BXWA 3SQEE 1DPOA 1QA0A 2GT7A 3S0NA 3SNEA 1SGQE 5EGMA 3KQBA 4Y6DA 2ASUB 3BTME 2ZHFH 1PQ5A 3MO6A 1H9LB 3QZRA 1ACBE 3O8DA 4X6OA 3RM2H 3KL6A 4Q2KA 1P9SA 1UTNA 1K1IA 2A1DB 1EOJA 4ZAEA 2I6QA 2THFB 1JWTA 1S83A 3RC5A 2A5IA 2A2XH 1DWEH 1WTHD 3FANA 1SB1H 4Y7AA 1RIWB 1AE5A 1XUGA 3GYMA 5E8EH 2W5EA 3I77A 2C93B 1HJ9A 5IYTA 1ZHMA 1YCPH 1HJAC 5JYIA 3SJOA 3ZZ7A 1O36A 1AVXA 1HCGA 2JETB 2G81E 1ZHRA 1C4V2 1HRTH 2XWAA 2AMQA 4MPUA 2SGEE 3E6PH 4DVAU 3MU0A 2KAIB 1FUJA 1MU6B 4TYDA 2DE9A 2ZPQA 2QXHA 3UNRA 2PSYA 4AYYB 1TBRH 2ZWLH 2UWLA 3SUDA 2PKAB 6CHAB 2ODQA 1DDJA 1M9UA 1O2OA 2NU4E 1GI5A 2BD2A 1GMHF 1XMNB 1GBAA 3L33A 2BD5A 3HKJB 5LPFA 4FUEA 5SGAE 1TNGA 1DY8A 4ZKSU 2VU8E 1T8LA 3BTHE 3KN2A 4YESB 2SGPE 1HFDA 1LMWB 2UUJB 3SI4H 1XKBC 1MTVA 1QJ7B 2FOAA 1GI2A 1UMAH 4INKA 1XUJA 1LVBA 3SN8A 3SJIA 2ZU3A 1YBWA 2FPZA 3RU4T 1BMAA 1IAUA 4NA9H 1ZMJA 2BDIA 1E36B 2CV3A 4UEHH 3W94A 4H6SB 1FZZA 2ZI2H 2C8ZB 3F6UH 2CMYA 1GMHG 1C2EA 2B8OH 1NESE 4BNRA 2P3FH 1C5TA 5DKMA 2BXTH 1TMUH 2QV1A 2A4RA 2AGEX 3SU4A 5DP3A 3ZZDA 3TNSA 2WPHS 4AX9H 1VGCB 3GCNA 5A8ZA 1W10U 3OY6U 4E06H 4I8LA 3M3SA 2XWBI 2YOLA 1PPCE 4AFQA 1V3XA 1MQ5A 1OYQA 1DSUA 3R3GB 1FAKH 1GI3A 3V13A 3UIRA 3QTVH 4MNYA 9ESTA 3SW2B 3UPEA 4JK6A 1QGFA 2WPKS 4UD9H 4CREA 3CENA 5HM2A 3SUGA 5C2ZA 1CT2E 3UR6A 1AVGH 3RXDA 1YCPM 1O3KA 4YOJA 1C5OH 4JYUH 2R3YA 1ELAA 1DLEA 1GGDC 1OPHB 1GI9B 3QGNB 3PLPA 2FZZA 2BDCA 3ATMA 2OXSA 4ISHH 1S82A 1GJ4H 3LDXH 2HWLB 1QB6A 5G4BA 3UQOA 5EU8A 1D3DB 4JMYA 5E0HA 4GCHF 2G4UA 4RSPA 1MTWA 1KXFA 2GZ9A 1ZRKA 4X2XA 1BDAA 1EOLA 1GJBB 2J4IA 2A4OA 4FUJA 1ABIH 1O2HA 2P94A 3UTUH 1HIAB 2QC2A 3I29A 8LPRA 1P57B 4YTAA 1TMBH 2TIOA 1B5GH 1K22H 3TITA 3E91A 3JZ2B 1SLWB 1OSSA 3MH7A 3RXRA 1P2NA 3TK5A 3ZZ8A 3UY9A 4FUHA 3T27A 1SGPE 3T26A 3SU2A 2XYAA 4IC5A 1SGTA 4IBLH 1BIOA 1N6XA 2TGPZ 4BTTB 1O2TA 4IW4E 5E2PA 1UHBA 4D76A 1D6RA 1SFQB 1JRTA 3T29A 3IWMA 1WUNH 1O3OA 3HPTB 1DY9A 2ZFRH 4DT7B 3ZZCA 4B2AA 3U8RH 4XOJA 1TE0A 2Z6BD 5BRRE 2FI4E 3HK3B 5C3NA 2O8LA 4K1TA 3F1SB 1Z8GA 1AI8H 3F9EA 3FFGA 2EI8A 2R2WU 1C5UA 1JRSA 1OXGA 2HPPH 5HXFA 1P2KA 1A4WH 1O5AB 1FAXA 3H7OA 2ALPA 1VCWA 1HAVB 3QN7A 1C5SA 2XNIA 4GSOA 2W7SA 3T62A 1K1MA 3RP2A 3U1JB 2VIPA 1QL9A 1P0SH 1PQ8A 3D65E 2ESTE 3S69A 1A5IA 3JZ1B 3ZYEA 3EYDA 4I8HA 2VVUA 1RJXB 1BRAA 2BDGA 1KXAA 1O5CB 2YNBA 2PTNA 4JZIA 1A2CH 1O3EA 5C20A 3TGJE 1FIZA 3QX5H 2ZF0H 1PPGE 1CGJE 1UK4A 2PW8H 3F9FA 1UTMA 4UFGH 1S0RA 2ZFQH 5JBCS 4DG4A 4FVDA 2FP7B 3UOUA 1L2EA 3TJOA 4CRBA 1Y3YA 3Q3XA 1BRBE 3NPSA 1O3HA 1V2OT 3M7UA 1GI8B 1BRCE 1C1NA 2UWPA 1IQMA 1QJ1B 1INCA 4OS2A 2FXRA 5FX6A 3A8DA 5A0BA 3TLOA 2ZC9H 1V2TT 3BN9A 4K60A 2SGFE 3BTDE 1QB9A 3GCTG 1W11U 1YPJH 1CT0E 3DFLA 1C2MA 2Z7FE 1S5SA 1P05A 2BMGB 5GPIB 1UO6A 1SR5C 1ETRH 4K2YA 3ZZ4A 3A8CA 4MLFB 5F6MA 1AMHA 1BTZA 1UTOA 5EQSA 3A7YA 3PTNA 1GWAA 1GCDA 1NN6A 5JB9S 2ZGBH 1UK3A 1Z71A 4YLQH 2J2UA 4TY6A 2ZGCA 3SNBA 4A1XA 1Q31A 1VCPA 5LPEA 1C5MD 2H2ZA 3A86A 1WSSH 4Y8ZA 3RXUA 3HKIB 3UFAA 3M3VA 3MH6A 3GCOA 1C1WH 1PFXC 1MTUA 5AVDA 5EXMA 3SNCA 4ZUHA 3RXFA 2Q1JA 4CRFA 5DP9A 1DVAH 4GHTA 1RIWC 2A0QB 1VITH 2PHBA 1V6DA 1TGCA 1N1LA 3OYPA 2RDLA 5T6DA 2ZU1A 4FU8A 3SZNA 4GPGA 1TA6A 1C5VA 2XW9A 4ABAA 2BB4A 1J17T 1C9PA 1C5QA 1MKXH 4JYVH 1P3EA 1OWHA 1AWFH 5A8YA 1KY9A 5AF9H 3E8LA 1VCQA 4DURA 3GY5A 5L2ZH 3BTWE 1P8VC 1AY6H 1HB0B 1TFXA 2FLRH 1HAPH 1UTPA 3TK6A 3HK6B 4E05H 3VGCC 3PB1E 3SHCH 1HAOH 2GCTC 1P2MA 3MWIU 1O37A 2Q6GA 2TBSA 3ZZ9A 5EQRA 4I8GA 2V3HH 1XX9A 4ASHA 1NZQH 1NFWA 3ELAH 1C1OA 4U30A 4IN2A 1QIXB 2J9NA 5J4QA 2NWNA 4DIIH 1YPHE 2HGTH 3EA9A 4WWYA 2LNCA 1K21H 1HAVA 1MD8A 3SU6A 4Y0YE 3GDUA 3TGKE 4BAOB 1IQJA 2C8WB 3BTFE 2STBE 4GVUA 2BLWA 1SOTA 1O3GA 4XFQA 1OP2A 4K8YA 3UQVA 3EAJA 1THPB 1MZAA 2TGAA 3LGTA 4I32A 4AFZA 1IQHA 2F3CE 3BEUA 1FDPA 3ATLA 3SJKA 5BPEA 4BAHB 2H9TH 5CHAB 1WV7H 1Z6EA 1BHXB 3TH3H 4J2YB 1Z7KA 3RU4E 4MNXA 2GCHG 4R8TB 1CO7E 1V2VT 1NC6A 2WPJS 3BG8A 4INLA 2SNWA 5PTPA 2OINA 2OBQA 3GOVB 4F49A 1NRPH 3ATKA 4FXGH 4YM9A 4NIXA 2PWXA 3ZVCA 3D23A 1WU1A 1GVZA 1SBWA 1CA0B 2OP9A 1ELBA 1DICA 3ZVAA 2XBYA 3K2UA 1C4U2 4THNH 1JOUB 4FUFA 1GDUA 1XXFA 4Y0ZE 4AYVB 2AEIH 3P95A 3E0PB 5FAHA 1TX7A 1F0TA 5TJXA 1T4VH 1W7XH 1S0QA 1DOJA 4Q7ZA 1WQSA 2QA9E 1ZGVA 1SC8U 3GY4A 2BXUH 1Q2WA 1UVUH 1ZLRA 1T4UH 2FOHA 4HI3A 4RKOB 1C2LA 3BG4C 3Q00A 3RMMH 1TLDA 5HMAA 2O8TA 1BOQA 1NRRH 2XCNA 2VIVA 1G3CA 1O0DH 1UCYH 1MKXK 3LGWA 4XBDA 1A0HB 5FBIA 3UUZA 5JBBS 1YPLH 4NSYA 1HPGA 1A0JA 3SU3A 3MNBA 2QXGA 5AFZH 2Z3EA 1OP0A 1IQFA 1C5XB 5CE1A 3LC5A 3M5LA 1ZMLA 4DIHH 1AN1E 5A09A 5LPRA 1GL1A 3TJUA 3S7HB 2A5AA 3BTTE 1G36A 2UUYA 4WMEA 2FTLE 2B7DH 2P16A 5EPNA 3V7TA 5FHTA 1MAYA 1YF4A 2WYJA 2CJIA 1ABJH 5EG4A 3MYWA 2VIWA 1ANEA 3RXQA 3BEFB 3TU7H 3EE0B 4UFDH 4R0IA 1WTGH 2GTBA 4M7GA 1W12U 1EPTB 2BQWB 3GCHC 4XBCA 4BTUB 1KDQA 2F91A 3LGIA 1Z1JA 2Y5GA 2BLVA 3SGQE 3S9AA 4ISIH 1AB9C 1DUAA 3M37A 1O5BB 5EOKA 1V2PT 1A3BH 3ZZ5A 1TNKA 1ETSH 4RKJB 1Y59T 1V2LT 2R3UA 3SV2H 5A0CA 1TNHA 1C1QA 1YC0A 4O9VA 1LVYA 2ZTXA 1O3LA 1P2JA 4ABIA 1C1SA 1E38B 1EB2A 1C5NH 3EGKH 1LO6A 4CHAB 1THSH 1T8OA 4LZ4B 1RGQA 2BQ7B 2ZEBA 1K2I1 2R0LA 2GCHF 1SGRE 1HNEE 1GBLA 1GHAF 2JH0D 3RMLH 1MTNC 3FP7E 4CR5A 5ESBA 3SUEA 4GCHG 1BTXA 2G5NA 2A2QH 2A7CA 2Z9GA 4IN1A 1T31A 1XUHA 2M5TA 3B9FH 3IITA 5EODA 2STAE 2WINI 3P92A 1UJ1A 3U8TH 2BVXH 4E7RG 1C5RA 2ZGJA 2FESH 1TAWA 3NK8A 2H9HA 3ZVDA 3CS7A 3S9BA 4Y76A 2OBOA 2Q6DA 3URDA 1TABE 4NZQA 1GBHA 2GVFA 1YCPK 1KXDA 2IPHA 2Z94A 1C2GA 1BBRE 1P06A 1Z8JB 2BX4A 3OU0A 2OUAA 1G9IE 3VB5A 1F0SA 3W95A 1NU7B 3A83A 4K69A 2F9OA 1DWDH 2CN0H 2J38A 1C1PA 1MCTA 1ELEE 1YLCA 4UFEH 4X1QU 5CHAC 1KLJH 3ATIA 3RM0H 2WPLS 3RXCA 2ZQ1A 4CRCA 3MFJA 1NY22 1OS8A 1DE7H 4AG1A 5EQQA 1V2WT 2GP9B 1C2IA 1TIOA 3BG4B 4KKDA 4UONA 1C1UH 1GHBG 1BZXE 4K5ZA 1CGIE 1P01A 2VWOA 4B1TA 3UREA 1QTFA 2BD3A 2BY5X 3CP7A 4MPVA 7ESTE 1BQYA 1O35A 1LHGH 4NG9H 1DSTA 4BANB 1IQNA 1GI1A 3LOXA 4MQAA 3K6ZA 4NGAH 4LZ1H 1F2SE 5ABWA 4CH8B 3GY2A 1SQOA 1A46H 1V2QT 4AFUA 3A7XA 4WMFA 2AMDA 1MCVA 1U6QA 1ESTA 1V2MT 1YYY1 4LOYH 1AO5A 2ZHWH 1BT7A 4Q7YA 3O8CA 1LTOA 2LPRA 3C27B 1O3JA 4NWKA 1DX5M 2G55A 3RXTA 1Y3UA 2XRCA 1NU9A 2K1QA 3QTOH 2OQUA 5LGOA 4KELA 2QF0A 5A0AE 3ZZBA 2Z9JA 1CHOG 2ALVA 1QBNA 1YPGH 1LPGB 2Y82A 2RCEA 3UOPA 3TJVA 1C1MA 1CU1A 2HALA 4KGAA 2A7HA 3ITIA 3FZZA 2XTTB 2FLBH 3GDVA 1A0LA 1O3MA 2FTMA 1GL0E 3UNSA 2W7UA 4JZDH 4AZ2B 1G3DA 4OGYA 5JBTA 2ZECA 2EI6A 2CGAA 3UWIA 4CBNA 4X2WA 2BD4A 1ELDE 2TGTA 5DGJA 1SHYA 1QRXA 1TGNA 1O3AA 2ZFSA 1O2GH 6ESTA 1C5WB 3A82A 3RXIA 2FMJA 4I33A 1H8DH 2XBXA 1IQLA 2ZHEH 4NZLA 5E0JA 4ISOA 1OWIA 2P3UB 3P17H 1ZSKA 3RMNH 2O8UA 1GJ8B 4E7NA 2ZU4A 4I8KA 2QXJA 1O2KA 3SV7A 1O2MA 1O2QA 1O2IA 4A6LA 2PV9B 1DFPA 2ZU2A 1G30B 2FODA 3VXFH 1SMFE 1O5DH 1EXFA 1TPPA 2GZ8A 1KIGH 2JH6D 1VZQH 2B9LA 1ESBA 3F9HA 4YT7H 3MOCA 4XSKU 3ZV9A 4D9RA 2HNTF 1AVWA 2ZFFH 3VPKA 5C1UA 1CBWC 1J9CH 3SU1A 2V0BA 1W8BH 4AB9A 4LK4A 1O33A 1P2IA 4FU9A 1GJAB 1CBWB 4DGJA 2QYIA 1AKSA 1EPTC 8GCHG 2HNTC 1H8IH 4OS6A 2FOCA 5B6OA 3F68H 1AUTC 5JDUB 1SVPA 2BQ6B 1GBDA 1GVLA 3VGCB 3H7TA 1S81A 1TNIA 3F9GA 4YO9A 3ZZ3A 4ZXXH 1ZZZA 1O2UA 4YOIA 2F9UA 1FY5A 1L4DA 1T8NA 5C1YA 5GDSH 2WUCA 1AE8H 1A5GH 1NRQH 2WV4A 2Y7XA 4Y10E 2FWWA 1W0YH 4BTIB 1NM6A 4JCNA 1K1OA 1QFKH 1W14U 1CT4E 3A89A 3I78A 1JBUH 1P02A 2NU3E 3E16B 5GXPA 1O3PB 1ZJKA 5DP7A 1HAIH 1IQEA 1LKBA 1FI8A 1O30A 1MU8B 1SGIB 3M61U 3P70B 2QIQA 3O8RA 2G51A 3EQ0H 3BTGE 2ZGXH 1HDTH 3DT0H 1LVOA 2FM2A 1H4WA 3QLPH 4ZROA 3MTYA 3MH4A 4IMQA 4YT6H 3VB6A 1GHZA 1DM4B 3FVFB 3ZVEA 3V3MA 5C5OA 1TPAE 1QRZA 5EW2H 2I6SA 4GUXA 1EZQA 5DP5A 3BTKE 3AAUA 3M7QA 5E2OA 1SGEE 2BOKA 5GCHG 9LPRA 4NWLA 2PUXB 5F8ZA 1TQ7B 2W26A 4Q80A 1CHGA 4UE7H 1PPHE 3TVJB 4F4OC 5ETXA 2Z9IA 1Y3WA 1UVSH 2SGAA 1L1NA 3Q77A 3OY5U 4OS1A 2GZ7A 2ZCHP 1CA0C 4HFPB 1VJAU 5C1XA 1FN8A 1CQQA 5A2MH 1DT2A 1RS0A 4SGAE 2A31A 2P3TB 3G01A 3T28A 3ZVBA 3Q76A 5FBEA 1THRH 1BTWA 2TPIZ 1TX8A 1Y8TA 4ZH8A 3V0XA 2QF3A 2Q6FA 3BSQA 5LH8A 4OS5A 1F5RA 3MO9A 2RA0A 4ZMAH 1OP8A 1O5FH 1GBCA 3LH1A 1AU8A 1GI6A 4VGCB 3NZIA 2AS9A 4B74A 5DG6A 1ZPCA 3MMGA 4J1YA 2CHAC 1C1TA 2VJ1A 3NCLA 4U2WA 3QK1A 5DPAA 1SGNE 1AZZA 1HV7A 1BTUA 3T2NA 2ZDMA 2ZPSA 3TIUA 1BMMH 1NRNH 3A8BA 4TWWA 1HAXB 1Y5BT 4K1EA 3RC6A 1RRKA 3HATH 4AB8A 3AW1A 5DP8A 3KF2A 1LKAA 1XKAC 3STJA 1OWKA 2ZIQH 1FV9A 1O2SA 4CBOA 3LGUA 1B7XB 1KSNA 1LQDB 3KHVA 3ZVGA 1AUJA 1UVPA 1UCYE 1UTQA 1PQAA 1YGCH 1HAHH 1L1GA 2P8OB 1ZHPA 4X1RU 4X8SH 1TGSZ 2BDHA 1LPKB 5JB8S 1BMNH 3LC3A 1JIMA 1D4PB 1Z6JH 3SGAE 5T6GA 3E1XB 2EC9H 3U9AH 4JZEH 4IMZA 1ELGA 4YLUA 4AOQA 3O8BA 1BITA 1GJCB 4TPIZ 3MO3A 1V2KT 4X8UH 2ZP0H 3OSYA 2ZU5A 3KEEA 3PMBB 1VR1H 1CA8B 3AVZA 4ZKRU 5T3HA 1VGCC 1DWCH 1P03A 2XC4A 1XM1A 3FAOA 4LXBH 2ULLA 1AZ8A 1BJUA 1TX6A 4NA8A 3BTEE 1P3CA 1O3DA 1QCPA 3A7ZA 4FUDA 1P9UA 4NIYA 1UTLM 4JZFH 3SHAH 3AASA 2PFEA 4BAKB 3RXLA 1P09A 1O2NA 1MTSA 1OWDA 4X6PA 2FOMB 1AFQB 1AKSB 5L30H 1V2NT 1LHFH 4ABEA 2Z9LA 4O3UA 4MNVA 1HBTH 5DJ7A 1BCUH 1YM0A 1EAIA 2PGQB 3SV8A 1EASA 1O2WA 3ZV8A 4B76A 3QO6A 1C1VH 3STIA 1NRSH 3RXHA 1EB1H 1GGDB 1PPEE 4MDSA 5K0HA 1ARCA 1BJVA 1QBVH 1KXEA 1LHCH 1GDNA 5C67A 1MMJN 1PPFE 1Z8RA 8ESTE 1EJAA 4WF8A 3HGPA 2GDEH 5I25A 5H4IB 3RLYH 3A7TA 2AMPA 1C2JA 4Y8XA 3LIWA 3B8JA 3SOSA 2O9QA 1F7ZA 5AHGH 1ELVA 1QHRB 1EPTA 2D26C 1GJ9B 2WPMS 4H42U 3SI3H 1ELFA 1WQVH 1PYTC 8GCHF 3H5CB 5C5NA 1GBKA 3ODDA 2CHAB 1YPEH 1HAGE 3E0NB 2FX4A 3A87A 2HRVA 2IJOB 3SQHE 3SORA 4O03A 2PKSB 1LCYA 4AG2A 2ANYA 4I8JA 1SLUB 1MD7A 1AFEH 2BDBA 1BRUP 1C5PA 1WOFA 1C9TA 2F9VA 2O8MA 3GY6A 2EEKA 4ABFA 1ZRBA 2VIQA 2G5VA 1S84A 7LPRA 1AD8H 3M35A 4AORA 3LONA 2HLCA 1ZYOA 5L2YH 2JETC 1NO9H 4ESTE 1F0RA 6CHAC 1TNJA 3S7KB 1FIWA 3PV4A 5F03A 4IS5A 2NU2E 1EZUC 2WV5A 3K9XB 1ORFA 3RXAA 3DFJA 2PLXA 1D9IA 1O3CA 1AWHB 4JZ1A 2VH6A 1IQIA 1KDQB 3ENSB 2VWMA 4NA7A 3IG6B 4HGCA 2BY8X 1GVKB 4OS7A 3KGPA 2VIDA 2A32A 1OKXA 3SUFA 2B0FA 4NCYA 2QY0B 2QXIA 3RXBA 1AGJA 3TPIZ 2XC0A 3ODFA 4X2YA 1ESAA 1HXFH 1O3NA 4ABJA 2OLGA 3RC4A 2HPQH 1FY8E 1UTJA 1TB6H 4WVPE 1FN6A 1LVMA 3RXOA 1HUTH 4ZXYH 1WCZA 1P10A 1YPHC 1O5EH 8KME2 1O2LA 2PR3A 2GD4B 1YPKH 1TRNA 1TGTA 3K65B 1GHYH 2UUFB 2B5TB 3GYLB 1MAXA 4WJG2 4Y7BA 1EUFA 2ZZUH 1F5KU 3B23B 4AGJA 4YOGA 1RXPA 4BOHA 1IHSH 4FUGA 1TNLA 2GV7A 7KMEH 5DP4A 1DITH 4TPYA 2QCYA 4WMDA 3MHWU 1BTHH 3EA8A 6LPRA 2BDYA 3RLWH 1GHAG 2ZDLA 1T32A 3MH5A 2BD7A 1GG6C 1C2KA 1ELTA 3BTQE 1GHWH 2ZGHA 3GICB 3RU4D 1FY1A 1O39A 1TMTH 1FQ3A 4A1VA 1IHTH 1O32A 2XBWA 1BBRK 3TH2H 3M7TA 3NKKA 4NSVA 5GWZA 2G8TA 2Y6TA 3HGNA 1GI0A 3RXGA 3OTJE 1TQ0B 2FI3E 2IN2A 4NFFA 1GMCF 3MI4A 1IQKA 1XUIA 1DUEA 3M5MA 3PLBA 3EDXB 5FPSA 1WBGB 1PYTD 4KP0A 2ZQ2A 4UDWH 2ZCLP 3U69H 4ZKOU 1FJSA 3RDZA 1G2LA 4X1NU 3PTBA 3ZVFA 2G52A 1SI5H 4B2BA 4Z6AH 1QB1A 3ATWA 1HGTH 1A5HA 1KXBA 4OS4A 1TRYA
chains in the Genus database with same CATH superfamily
1NROH 1MKWH 1SLVB 2FS9A 1S6HA 3VFEA 4A7IB 1BHXF 2XBVA 3RXVA 2QGRA 2H1UA 2OC0A 2Y5FA 2UUKB 5K7RA 4INHA 2JH5D 1IOEA 1ZTJA 1D3PB 2PGBB 6GCHF 4VGCC 2KCYA 2BZAA 3A85A 2BY7X 2A7JA 4WH8A 3SU5A 3T25A 3WWFA 4UFFH 2FOFA 1SGYE 1EKBB 1LHDH 5C17A 1SLXB 3LT3A 2ZDNA 1VITG 2ZPRA 3LKWA 1BMLA 1CHOF 4U32A 3WWBA 3MNCA 3F2HA 1W7GH 5CMXH 1Y3XA 3OX7U 4FUIA 1A1RA 1GMDG 1LQEA 1FMGA 1XUFA 2VGCB 2A4QA 2XCFA 2XXLA 1YP9A 2F9PA 1C4Y2 1O2JA 3GY8A 1EJNA 2WPIS 4Y71A 3SV6A 4WXVA 3C1KA 1GHXH 1HAYB 4MPWA 3SBKA 3M5OA 3VXEH 2Z3CA 3E3TA 1EX3A 2BOHB 1Z8IB 2PKSC 2UWOA 2GMTB 5IDKA 3GCHB 1ZJDA 3AAVA 1N8OB 2K8IA 1IQGA 2GMTC 3SJ9A 3RUOA 2OQ5A 2D8WA 4YZUA 2RG3A 1YLNA 5GNDA 3RXEA 1NFXA 2AIQA 4ZKNU 1HYLA 5EXNA 1NPMA 1D3QB 1QURH 3MU1A 2TRMA 1P2OA 1GJDB 1ZGIA 2ZTZA 4CRAA 2P8OC 2AH4X 2ZHQH 1A3EH 1KYNA 2P59A 1G3EA 1O3FA 1TONA 1DS2E 1PPZA 2PP6A 2WZQA 3MU4A 3FP8E 1WDIA 2ODPA 1WAYB 4ISLA 1GBMA 2SGDE 1OWJA 4CHAC 2BZ6H 4A1TA 5JBAS 4D9QA 1HXEH 1P12E 1GI7B 3F3BA 3PO1C 4D8NA 1V2UT 3LJOA 1YPMH 2V6NA 4AFSA 3RMOH 2G00A 2DUCA 1EAWA 3ESTA 5HIYA 1DXPA 2ODYB 4TT3D 1MBQA 3SNDA 2C4FH 2KCAA 1QY6A 1QQUA 1O2YA 2H6MA 3BIUH 2HOBA 3PROA 3WY8A 1AQ7A 3A84A 1ZSJA 4ZHMU 1QRWA 4DJZB 2VH0A 2CXVA 3DD2H 1EQ9A 1O2VA 3TH4H 3VEQB 3QDZB 1PPBH 1T8MA 2ANKH 5DK1A 2C90B 1GG6B 4ZHAA 4H6TA 3M5NA 2TGDA 1BBRH 4I7YH 1GI4A 3GDSA 2GGVB 2WUBA 2FOEA 1W0ZU 4ZHLU 2OD3B 3PMAB 3S9CA 4TWYA 2FYRA 2C3SA 2BX3A 2VWNA 4FVBA 2Y80A 1NFYA 1B0EA 1K28D 1O2RA 2ZG0H 1LDTT 3ZYDA 2OC1A 5ESTE 3CS0A 1QBOA 3SV9A 4WY3A 3MQKC 4O3TA 1PQ7A 1Q3XA 1V2ST 3P8FA 3SO3A 2G4TA 2WV9A 2JIZD 1A7SA 1GBJA 2Z9KA 3R0FA 1H9IE 4B73A 1NS3A 1QL8A 1TPOA 1SGDE 5HGGA 1SQTA 1O31A 1H1BA 4GAWA 2FS8A 5F8TA 1SQAA 2J34A 4XDEA 3A88A 4KTUA 3LGVA 1UK2A 4DY7B 2ANWA 5A8XA 3PM3A 2PKAA 3DA9B 3Q3YA 4X8TH 1G3BA 2F9NA 3RXKA 3F2FA 1P2QA 3LJJA 4ABHA 2ZA5A 1RD3B 4D7GA 2GT8A 1HAZB 1ANCA 6GCHG 2BY9X 2V3OH 2CK3D 3MNSA 5FXLA 2FO9A 3UNQA 2J94A 4NIVA 5B6LA 5HYOA 4Z0KA 1FY4A 3QGJA 1MKWK 1L1JA 2ZFTA 4TY7A 1GBBA 1J16A 5FPTA 1KTTB 1O2ZA 1TPSA 2BD8A 4X8VH 5EPYA 2NU1E 1BUIA 3VB7A 2H5CA 2KX4A 1O34A 4DW2U 1ZR0A 5JPMH 3A7VA 4BAMB 1SG8B 5EXLA 1O2PA 2BY6X 2P93A 1C2DA 1SL3A 4MG3A 2Y7ZA 3GISB 4D7FA 2FIRH 3RXPA 2BVSH 3FZDA 1EZSC 1GJ7B 4KTCA 4WXIA 4Y8YA 4U01A 2AFQB 1EP6A 2QE7D 1GCTB 3TK9A 4CR9A 4ABBA 2WYGA 5HM9A 1P04A 3PLKA 1X7AC 4B75A 5DO4H 1W13U 1H8HD 1W3CA 1ANDA 3D62A 1QQ4A 1L0ZA 2BVRH 2EY4C 5AFYH 1O3BA 4WH6A 5E0GA 2AIPA 1G32B 1Y5AT 1GMDF 1XVOA 3KQDA 4FUCA 3P8NA 3A8AA 1C5LH 3QWCH 4MPXA 3M36A 1DXWA 1MZDA 1J14A 2QAAA 3DHKH 2C8XB 1FY3A 4NIWA 1GHBF 1ZSLA 2ZHDA 5T6FA 1E34B 1F0UA 3SJ8A 1CSOE 3KCGH 2BM2A 4Y79A 2BYAX 3SYJA 2PTCE 1HIAA 2GX4A 1C2FA 1H9HE 1VITF 1MTNB 5GIBA 4CRDA 1DANH 1S85A 5EJLA 1O3IA 3BIVH 1PJPA 1E1RD 1UVOA 2XC5A 1EZXC 3P6ZB 4Y11E 2H5DA 2H9EH 3TGIE 1O5GH 3FKSD 1K1PA 3E90B 3LU9B 4AN7A 2VVVA 4NFEA 4K3JA 3MNXA 1NTPA 1SFIA 3A7WA 1KLTA 4CRGA 1XXDA 5HIZA 4HZHA 1MQ6A 1KMHB 3PMJA 3QZQA 2JKHA 2EA3A 3SU0A 3AW0A 5I46H 3M3TA 5GJ4B 1YKTA 3F2GA 4GHQA 4X1PU 3VB3A 2A5KA 2BHGA 1KLIH 2NU0E 3ZZAA 4IC6A 2J92A 3T5FH 3KIDU 3L3TA 4XBBA 3GCTF 1ELCA 1NBMD 3URCA 3K6YA 2OCVB 3QUMP 1G37A 3EA7A 2AYWA 5EW1H 1TGBA 2FOBA 2VINA 1O38A 1GDQA 2BD9A 2YNAA 3GY3A 1QJ6B 2V35A 5J4SA 3MU8A 4XD7D 4SGBE 1E37B 3NUMA 3SGBE 5TCCA 2W3KA 2CF8H 3KQCA 2C8YB 2J95A 4X6NA 4B2CA 1RTFB 1KTSB 1ZMNA 2CF9H 1Z1IA 4JK5A 1JXPA 1CVWH 2VB0A 3D49H 2BLQA 3H09A 2Z3DA 1YLDA 3BV9B 2ILNA 2ZNKH 1Y5UT 2R9PA 3A81A 2ANMH 1BB0B 1QL7A 2VVCA 4X1SU 3PWCA 4CH2B 1EJMA 2F9BH 2Y81A 1C5YB 2R2MB 2VNTA 1RFNA 1ARBA 1HJ8A 2D2DA 3NXPA 1ZPBA 3GY7A 1NT1A 2GKVE 2J98A 1OOKB 1SPJA 1RTLA 1TBQH 1K1NA 3PYHA 1TOMH 3BF6H 4FUBA 1AB9B 1SOZA 1MUEB 3TNTA 3V12A 4K8BA 1K9OE 3U1IB 2W3IA 1A61H 1HJAB 1D3TB 3N7OA 4XE4A 2ZTYA 1UCYK 1ZPZA 2PSXA 2ZO3H 1C1RA 1GHVH 1B0FA 3UWJH 1OX1A 4FU7A 4O97A 1CGHA 4PROA 1S6FA 4ABGA 2A4GA 2D1JA 2BTCE 2F83A 3P8OA 4H4FA 4TSFD 1O2XA 2ZKSA 2P95A 1NFUA 1UTKA 4Q7XA 1GBEA 1AFQC 2RA3A 4X6MA 1ID5H 2OC7A 1LHEH 2KAIA 1HLTH 1DLKB 3OE7D 2VWLA 4JYTA 2O8WA 3DUXH 2AGGX 1UVTH 4BAQB 5GCHF 2FI5E 4A92A 1GMCG 2FDAA 2KZ4A 1P11E 2ZFPH 3P8GA 3GS9A 2HVXA 1KXCA 1QNJA 3VB4A 1BA8B 3LH3A 5FCRA 1F92A 4OGXA 1ETTH 5L6NH 1RTKA 1EP5A 1VJ9U 4FOUC 3U28C 2SFAA 2J5UA 2YMSC 4K1SA 2PUQH 1QR3E 1EATA 2HNTE 4RN6A 1CE5A 7GCHF 1QA7A 1ZTLA 1FLEE 4OM9A 2FEQH 1J15A 3RXMA 1SGFG 1TRMA 3ZZ6A 3F0OA 5TCAA 3U8OH 1K1LA 1FPCH 3A80A 4X0WU 1LPZB 1N8OC 2FX6A 1C5ZB 2FYQA 1V2RT 1FONA 1BTYA 1XVMA 1GBTA 5DP6A 1TALA 4DCDA 1AHTH 4BXSA 4ISNA 1GCTC 2ZCKP 2Y5HA 2AERH 1ZOMA 1TWXB 2DE8A 1K1JA 1GJ5H 4AGKA 3KNXA 2EI7A 1ZTKA 3MU5A 3RXJA 1Y3VA 3TJNA 2AGIX 3BEIB 3U98H 1ANBA 1TA2A 1TBZH 1GJ6A 4A5TS 3LPRA 3WW7A 3UB0A 2IOTA 1FNIA 4KTSA 4DOQA 3LGYA 5FX5A 1GBIA 3Q3KA 1WYKA 1J8AA 3PMHB 2YMSD 4QT8C 1JIRA 1DWBH 2A45B 1OYTH 1L4ZA 2R0KA 1JMOH 2VGCC 1F5LA 1TYNA 1V2JT 4X2VA 1D6WA 4MTBA 2ZDVH 2GV6A 4B71A 2BDAA 3FP6E 1AIXH 1FPHH 2OTVA 1W2KH 3RXSA 2SNVA 2QN5T 1E35B 1SGCA 4I31A 5F8XA 4MNWA 7GCHG 1C2HA 1N6YA 1T7CA 4GLYA 1EAUA 4HTCH 1MH0A 2FOGA 5FCKA 1SGFA 3PO1B 1EAXA 2ZDKA 2SGQE 3PWBA 3KQEA 4ABDA 2GDDA 2GCTB 1BTPA 2VIOA 1GBFA 1SSXA 4MVNA 2GJGA 1G2MA 1UHBB 2BLOA 3SNAA 5FPYA 1FXYA 2OC8A 3KQ5A 4IGDA 2ZDAH 1GPZA 1MBMA 1XUKA 3UR9A 1SHHB 3L6PA 3NWUA 1OWEA 1E0FD 1TOCB 4BXWA 3SQEE 1DPOA 1QA0A 2GT7A 3S0NA 3SNEA 1SGQE 5EGMA 3KQBA 4Y6DA 2ASUB 3BTME 2ZHFH 5KGOA 1PQ5A 3MO6A 1H9LB 3QZRA 1ACBE 3O8DA 4X6OA 3RM2H 3KL6A 4Q2KA 1P9SA 1UTNA 4AC9A 1K1IA 2A1DB 1EOJA 4ZAEA 2I6QA 2THFB 1JWTA 1S83A 3RC5A 2A5IA 2A2XH 2IPQX 1DWEH 1WTHD 3FANA 1SB1H 4Y7AA 1RIWB 1AE5A 1XUGA 3GYMA 5E8EH 2W5EA 3I77A 2C93B 1HJ9A 5IYTA 1ZHMA 1YCPH 1HJAC 5JYIA 3SJOA 3ZZ7A 1O36A 1AVXA 1HCGA 2JETB 3DSOA 2G81E 2V3MA 1ZHRA 1C4V2 1HRTH 2XWAA 2AMQA 4MPUA 2SGEE 3E6PH 4DVAU 5C94A 3MU0A 2KAIB 1FUJA 1MU6B 4TYDA 3CNRA 2DE9A 2ZPQA 2QXHA 3UNRA 2PSYA 4AYYB 1TBRH 3KYFA 2ZWLH 2UWLA 3SUDA 2PKAB 6CHAB 2ODQA 1DDJA 1M9UA 1O2OA 2NU4E 1GI5A 2BD2A 1GMHF 1XMNB 1GBAA 3L33A 2BD5A 3HKJB 5LPFA 4FUEA 5SGAE 1TNGA 1DY8A 4ZKSU 2VU8E 1T8LA 3BTHE 3KN2A 4YESB 3PV5A 2SGPE 1HFDA 1LMWB 2UUJB 3SI4H 1XKBC 1MTVA 1QJ7B 2FOAA 1GI2A 1SQRA 1UMAH 4INKA 1XUJA 1LVBA 3SN8A 3SJIA 1WXRA 2ZU3A 1YBWA 2FPZA 3RU4T 1BMAA 1YWUA 1IAUA 4NA9H 1ZMJA 2BDIA 1E36B 2CV3A 3FO8D 4UEHH 1NBME 3W94A 4H6SB 1FZZA 2ZI2H 2C8ZB 3F6UH 2CMYA 5EIYA 1GMHG 1C2EA 2B8OH 1NESE 4BNRA 2P3FH 1C5TA 5DKMA 1EFRD 2BXTH 1TMUH 2QV1A 2A4RA 2AGEX 3SU4A 5DP3A 3ZZDA 3TNSA 2WPHS 4AX9H 1VGCB 3GCNA 5A8ZA 1W10U 3OY6U 4E06H 1FX0B 4I8LA 3N7EA 3M3SA 2XWBI 2YOLA 1PPCE 4AFQA 1V3XA 1MQ5A 1OYQA 1DSUA 3R3GB 1FAKH 1GI3A 3V13A 3UIRA 3QTVH 4MNYA 9ESTA 3SW2B 3UPEA 4JK6A 1QGFA 1W0KD 2WPKS 4UD9H 4CREA 5DN6D 3CENA 5HM2A 3SUGA 5C2ZA 1CT2E 3UR6A 1AVGH 3RXDA 1YCPM 1O3KA 4YOJA 1C5OH 4JYUH 2R3YA 1ELAA 1DLEA 1GGDC 1OPHB 1GI9B 3QGNB 3PLPA 2FZZA 2BDCA 3ATMA 2OXSA 4ISHH 1S82A 1GJ4H 3LDXH 2HWLB 1QB6A 5G4BA 3UQOA 5EU8A 1D3DB 4JMYA 5E0HA 4GCHF 2G4UA 4RSPA 1MTWA 3OTPA 1KXFA 2GZ9A 1ZRKA 4X2XA 1BDAA 1EOLA 1GJBB 2J4IA 2A4OA 4FUJA 1ABIH 1O2HA 2P94A 3UTUH 1HIAB 2QC2A 3I29A 8LPRA 1K0HA 1P57B 4YTAA 1TMBH 2TIOA 4HG6A 1B5GH 1K22H 3TITA 3E91A 3JZ2B 1SLWB 1OSSA 3MH7A 3RXRA 1P2NA 3TK5A 3ZZ8A 3UY9A 4FUHA 3T27A 1SGPE 3T26A 3SU2A 2XYAA 4IC5A 1SGTA 4IBLH 1BIOA 1N6XA 2TGPZ 4BTTB 1O2TA 4YXWD 4IW4E 5E2PA 1UHBA 4D76A 1D6RA 3PRBA 1SFQB 1JRTA 3T29A 3IWMA 1WUNH 1O3OA 3HPTB 1DY9A 2ZFRH 4DT7B 3ZZCA 4B2AA 3U8RH 4XOJA 1TE0A 2Z6BD 5BRRE 2FI4E 3FOAA 3HK3B 5C3NA 2O8LA 4K1TA 3F1SB 1Z8GA 1AI8H 3F9EA 3FFGA 2EI8A 1W0JD 2R2WU 1C5UA 1JRSA 1OXGA 2HPPH 5HXFA 1P2KA 1A4WH 1O5AB 1FAXA 3H7OA 2KFWA 2ALPA 1VCWA 1HAVB 3QN7A 1C5SA 2XNIA 4GSOA 2W7SA 3T62A 1K1MA 3RP2A 3U1JB 2VIPA 1QL9A 1P0SH 1PQ8A 2WPDD 3D65E 2M2AA 2XNDD 3VG8A 4DT4A 2ESTE 3S69A 1A5IA 3JZ1B 2J97A 3ZYEA 3EYDA 4I8HA 2VVUA 1RJXB 1BRAA 2BDGA 1KXAA 1O5CB 2YNBA 2PTNA 4JZIA 1A2CH 1O3EA 5C20A 3TGJE 1FIZA 2EQNA 2ZF0H 3QX5H 1PPGE 1CGJE 1UK4A 2PW8H 3F9FA 1UTMA 4UFGH 1S0RA 2ZFQH 5JBCS 4DG4A 4FVDA 2FP7B 3UOUA 1L2EA 3TJOA 4CRBA 1Y3YA 3Q3XA 1BRBE 3NPSA 1O3HA 1V2OT 3M7UA 1GI8B 1BRCE 1C1NA 2UWPA 1IQMA 1QJ1B 1INCA 4OS2A 2FXRA 5FX6A 3A8DA 3OEED 5A0BA 2KR7A 3TLOA 2ZC9H 1V2TT 3BN9A 4K60A 2SGFE 3BTDE 1MABB 1QB9A 3GCTG 1W11U 1YPJH 1CT0E 3DFLA 1C2MA 2Z7FE 1S5SA 1P05A 2BMGB 5GPIB 1UO6A 1SR5C 1ETRH 4K2YA 3ZZ4A 3A8CA 4MLFB 4ACAA 5F6MA 1AMHA 1BTZA 1UTOA 5EQSA 3A7YA 3PTNA 1GWAA 5C0TA 3W1EA 1GCDA 1NN6A 5JB9S 2ZGBH 1UK3A 1Z71A 4YLQH 2J2UA 4TY6A 2ZGCA 3SNBA 4A1XA 3DCLA 1Q31A 1VCPA 5LPEA 1C5MD 2H2ZA 3A86A 1WSSH 4Y8ZA 3RXUA 3HKIB 3UFAA 3M3VA 3MH6A 5F53A 3GCOA 1C1WH 1PFXC 1MTUA 5AVDA 5EXMA 3SNCA 4ZUHA 3RXFA 2Q1JA 4CRFA 5DP9A 1DVAH 4GHTA 1RIWC 3PRDA 2A0QB 1VITH 2PHBA 1V6DA 1TGCA 1N1LA 3OYPA 2RDLA 5T6DA 2ZU1A 4FU8A 3SZNA 4GPGA 1TA6A 1C5VA 2XW9A 4ABAA 2BB4A 1J17T 1C9PA 1C5QA 1MKXH 4JYVH 1P3EA 1OWHA 1AWFH 5A8YA 1KY9A 5AF9H 3E8LA 1VCQA 4DURA 3GY5A 5L2ZH 3BTWE 1P8VC 2W6ID 2L6OA 1AY6H 1HB0B 1TFXA 2FLRH 1HAPH 4P00A 1UTPA 3TK6A 3HK6B 4E05H 3F0PA 3VGCC 4B6EA 3PB1E 5C0UA 4RT1A 3SHCH 1HAOH 2GCTC 1P2MA 3MWIU 1O37A 2Q6GA 2TBSA 3ZZ9A 2W6JD 5EQRA 4I8GA 2V3HH 2KCOA 1XX9A 4ASHA 1NZQH 1NFWA 3ELAH 1H8ED 1C1OA 4U30A 4IN2A 1QIXB 2J9NA 5J4QA 2NWNA 4DIIH 1YPHE 2HGTH 3EA9A 2YMSB 4WWYA 2LNCA 1K21H 1HAVA 1MD8A 4F55A 3SU6A 4Y0YE 3GDUA 3TGKE 4BAOB 1IQJA 3KYGA 2C8WB 3BTFE 4ACBA 1OHHD 2STBE 4GVUA 2BLWA 1SOTA 1O3GA 4XFQA 1OP2A 4K8YA 3UQVA 3EAJA 1THPB 1MZAA 2TGAA 3LGTA 4I32A 4AFZA 1IQHA 2F3CE 3BEUA 1FDPA 3ATLA 3SJKA 5BPEA 4BAHB 2H9TH 5CHAB 1WV7H 1Z6EA 1BHXB 3TH3H 4J2YB 1Z7KA 3RU4E 4MNXA 2GCHG 4R8TB 1CO7E 1V2VT 1NC6A 2WPJS 3BG8A 4INLA 2SNWA 5PTPA 2OINA 2OBQA 3GOVB 4ASUD 4F49A 1NRPH 3ATKA 4FXGH 4YM9A 4NIXA 2PWXA 3ZVCA 3D23A 1WU1A 1GVZA 1SBWA 1CA0B 2OP9A 5FL7D 1ELBA 4Q4LA 1DICA 3ZVAA 2XBYA 3K2UA 1C4U2 4THNH 1JOUB 4FUFA 1GDUA 1XXFA 4Y0ZE 4AYVB 2AEIH 3P95A 3E0PB 5FAHA 1TX7A 1F0TA 5TJXA 1T4VH 1W7XH 1S0QA 1DOJA 4Q7ZA 1WQSA 2QA9E 1ZGVA 1SC8U 3GY4A 2BXUH 1Q2WA 1UVUH 1ZLRA 1T4UH 2FOHA 4HI3A 4RKOB 1C2LA 3BG4C 3Q00A 3RMMH 1TLDA 5HMAA 2O8TA 1BOQA 1NRRH 2XCNA 2VIVA 1G3CA 1O0DH 1UCYH 4RT0A 1MKXK 3LGWA 4XBDA 1A0HB 5FBIA 3UUZA 5JBBS 1YPLH 4NSYA 1HPGA 1A0JA 3SU3A 3MNBA 2QXGA 1YY3A 5AFZH 2Z3EA 1OP0A 1UW7A 1IQFA 1C5XB 5CE1A 4RI0A 3LC5A 3M5LA 1ZMLA 4DIHH 1AN1E 5A09A 5LPRA 1GL1A 3TJUA 3S7HB 2A5AA 3BTTE 1G36A 2UUYA 4WMEA 2FTLE 2B7DH 2P16A 5EPNA 3V7TA 5FHTA 1MAYA 1YF4A 2WYJA 2CJIA 3DSPA 1ABJH 5EG4A 3MYWA 2VIWA 1ANEA 3RXQA 3BEFB 3TU7H 3EE0B 4UFDH 4R0IA 1WTGH 2GTBA 4M7GA 1W12U 1EPTB 2BQWB 3GCHC 4XBCA 4BTUB 1KDQA 2F91A 3LGIA 1Z1JA 2Y5GA 2BLVA 3OEHD 3SGQE 3S9AA 4ISIH 1AB9C 1DUAA 3M37A 2HLDD 1O5BB 5EOKA 1V2PT 1A3BH 3ZZ5A 1TNKA 1ETSH 4RKJB 1Y59T 1V2LT 2R3UA 3SV2H 5A0CA 1TNHA 1C1QA 1YC0A 4O9VA 5IK2D 1LVYA 2ZTXA 1BMFD 1O3LA 1P2JA 1C1SA 1E38B 4ABIA 1EB2A 1C5NH 3EGKH 1LO6A 4CHAB 1THSH 1T8OA 4LZ4B 1RGQA 2BQ7B 2ZEBA 1K2I1 2R0LA 2GCHF 1SGRE 1HNEE 3NRLA 1GBLA 1GHAF 2JH0D 3RMLH 1MTNC 3FP7E 4CR5A 5ESBA 3SUEA 3OFND 4GCHG 1BTXA 2G5NA 2A2QH 2A7CA 2Z9GA 4IN1A 1T31A 1XUHA 2F4LA 2M5TA 3B9FH 3IITA 5EODA 2STAE 2WINI 3P92A 1UJ1A 3U8TH 2BVXH 4E7RG 1C5RA 2ZGJA 2FESH 1TAWA 3NK8A 2H9HA 3ZVDA 3CS7A 3S9BA 4Y76A 2OBOA 2Q6DA 3URDA 1TABE 4NZQA 2V7QD 1GBHA 2GVFA 1YCPK 4XRNA 1KXDA 2IPHA 2Z94A 1C2GA 1BBRE 1P06A 1Z8JB 2BX4A 3OU0A 2OUAA 1G9IE 3VB5A 1F0SA 3W95A 1NU7B 3A83A 4K69A 2F9OA 1DWDH 2CN0H 2J38A 1C1PA 1MCTA 1ELEE 1YLCA 4UFEH 4X1QU 5CHAC 1KLJH 3ATIA 2F43B 2WPLS 3RM0H 3RXCA 2ZQ1A 4CRCA 3MFJA 1NY22 1OS8A 1DE7H 4AG1A 5EQQA 1V2WT 2GP9B 1C2IA 1TIOA 3BG4B 4KKDA 4UONA 1C1UH 1GHBG 1BZXE 4K5ZA 1CGIE 1P01A 2VWOA 4B1TA 3UREA 1QTFA 2BD3A 2BY5X 3CP7A 4MPVA 7ESTE 1BQYA 1O35A 1LHGH 4NG9H 1DSTA 4BANB 1IQNA 1GI1A 3LOXA 4MQAA 3K6ZA 4NGAH 4LZ1H 1F2SE 5ABWA 4CH8B 3GY2A 1SQOA 1A46H 1V2QT 4AFUA 3A7XA 4WMFA 2AMDA 1MCVA 5EJ1A 1U6QA 1ESTA 1V2MT 1YYY1 4LOYH 1AO5A 2ZHWH 4Q63A 1BT7A 4Q7YA 3O8CA 1LTOA 2LPRA 3C27B 1O3JA 2QF5A 4NWKA 1DX5M 2G55A 3RXTA 1Y3UA 2XRCA 2K1QA 1NU9A 1SKYE 3QTOH 2OQUA 2WHXA 5LGOA 4KELA 2QF0A 5A0AE 3ZZBA 2Z9JA 1CHOG 2ALVA 1QBNA 1YPGH 1LPGB 2Y82A 4ZCNA 2RCEA 3UOPA 3TJVA 1C1MA 3AK5A 1CU1A 2HALA 4KGAA 2A7HA 3ITIA 3FZZA 2XTTB 2FLBH 3GDVA 1A0LA 1O3MA 2FTMA 1GL0E 3UNSA 2W7UA 4JZDH 4AZ2B 1G3DA 4OGYA 3SZEA 2HVYB 5JBTA 2ZECA 2EI6A 2CGAA 3UWIA 4CBNA 4X2WA 2BD4A 1ELDE 2TGTA 5DGJA 1SHYA 1QRXA 1TGNA 1O3AA 2ZFSA 1O2GH 6ESTA 1C5WB 3A82A 4Z1MD 3RXIA 2QF4A 2FMJA 4I33A 1H8DH 2XBXA 1IQLA 2ZHEH 4NZLA 5E0JA 4ISOA 1OWIA 2P3UB 3P17H 1ZSKA 3RMNH 2O8UA 1GJ8B 4E7NA 2ZU4A 4I8KA 2QXJA 1O2KA 3SV7A 1O2MA 1O2QA 1O2IA 4A6LA 2PV9B 1DFPA 2ZU2A 1G30B 2FODA 3VXFH 1SMFE 1O5DH 1EXFA 1TPPA 2GZ8A 2JJ1D 1KIGH 2JH6D 1VZQH 2B9LA 2L74A 1ESBA 3F9HA 4YT7H 3MOCA 4XSKU 3ZV9A 4D9RA 2HNTF 1AVWA 2ZFFH 1QZ8A 3VPKA 5C1UA 1CBWC 1J9CH 3SU1A 2V0BA 1W8BH 4AB9A 4LK4A 1O33A 1P2IA 4FU9A 1GJAB 1CBWB 4DGJA 2QYIA 1AKSA 1EPTC 8GCHG 2HNTC 1H8IH 4OS6A 2FOCA 5B6OA 3F68H 1AUTC 5JDUB 1SVPA 2BQ6B 1GBDA 1GVLA 3VGCB 3H7TA 2K0QA 1S81A 1TNIA 3F9GA 4YO9A 3ZZ3A 4ZXXH 1ZZZA 1O2UA 4YOIA 2F9UA 1FY5A 1L4DA 1T8NA 3UAIC 5C1YA 5GDSH 2WUCA 1AE8H 1A5GH 1NRQH 2WV4A 2Y7XA 4Y10E 2FWWA 1W0YH 4BTIB 1NM6A 4JCNA 1K1OA 1QFKH 3OAAD 1W14U 1CT4E 3A89A 3I78A 1JBUH 1P02A 2NU3E 3E16B 5GXPA 1O3PB 1ZJKA 2AHME 5DP7A 1HAIH 1IQEA 1LKBA 4M9FA 1FI8A 1O30A 2JJ2D 1MU8B 1SGIB 3M61U 3P70B 2QIQA 3O8RA 2G51A 3EQ0H 3BTGE 2ZGXH 2LP6A 1HDTH 3DT0H 1LVOA 2FM2A 1H4WA 3QLPH 4ZROA 3MTYA 3MH4A 4IMQA 4YT6H 3VB6A 1GHZA 1DM4B 3FVFB 3ZVEA 3V3MA 5C5OA 1TPAE 1QRZA 5EW2H 2I6SA 4GUXA 1EZQA 5DP5A 3BTKE 3AAUA 1S6LA 3M7QA 1SGEE 2BOKA 5E2OA 5GCHG 5T1VA 9LPRA 4NWLA 2PUXB 5F8ZA 1TQ7B 2W26A 4Q80A 1CHGA 4UE7H 1PPHE 3TVJB 4F4OC 5ETXA 2Z9IA 1Y3WA 1UVSH 2SGAA 1L1NA 3Q77A 3OY5U 4OS1A 2GZ7A 1COWD 2ZCHP 1CA0C 2WSSD 4HFPB 1VJAU 5C1XA 1FN8A 1CQQA 5A2MH 1DT2A 3EE7A 1RS0A 4SGAE 2A31A 2P3TB 3G01A 3T28A 3ZVBA 3Q76A 5FBEA 1THRH 1BTWA 2TPIZ 1TX8A 1Y8TA 4ZH8A 3V0XA 2QF3A 2Q6FA 3BSQA 5LH8A 4OS5A 1F5RA 1E79D 3MO9A 2RA0A 4ZMAH 1OP8A 1O5FH 1GBCA 3LH1A 1AU8A 1GI6A 4VGCB 3NZIA 2AS9A 4B74A 5DG6A 1ZPCA 3MMGA 4J1YA 2CHAC 1C1TA 2VJ1A 3NCLA 4U2WA 3QK1A 5DPAA 1SGNE 1AZZA 1HV7A 1BTUA 3T2NA 2ZDMA 2ZPSA 3TIUA 1BMMH 1NRNH 3A8BA 4TWWA 5KEDA 1HAXB 1Y5BT 4K1EA 3RC6A 1RRKA 3HATH 4AB8A 3AW1A 5DP8A 3KF2A 1LKAA 1XKAC 3STJA 1OWKA 2ZIQH 1FV9A 1O2SA 4CBOA 3LGUA 1B7XB 1KSNA 1LQDB 3KHVA 3ZVGA 1AUJA 1UVPA 1UCYE 1UTQA 1PQAA 1YGCH 1HAHH 1L1GA 2P8OB 1ZHPA 4X1RU 4X8SH 1TGSZ 2BDHA 1VKYA 1LPKB 5JB8S 1BMNH 3DSGA 3LC3A 1JIMA 1D4PB 1Z6JH 3SGAE 5T6GA 3E1XB 2EC9H 3U9AH 4JZEH 4IMZA 1ELGA 4YLUA 4AOQA 1E1QD 3O8BA 1BITA 1GJCB 4TPIZ 3MO3A 1V2KT 4X8UH 2ZP0H 3OSYA 2ZU5A 3KEEA 3PMBB 1VR1H 1CA8B 3AVZA 4ZKRU 5T3HA 1VGCC 1DWCH 1P03A 2XC4A 1XM1A 3FAOA 4LXBH 2ULLA 1AZ8A 1BJUA 1TX6A 4NA8A 3BTEE 1P3CA 1O3DA 1QCPA 3A7ZA 4FUDA 1P9UA 4NIYA 1UTLM 4JZFH 3SHAH 3AASA 2PFEA 4BAKB 3RXLA 1P09A 1O2NA 1MTSA 1OWDA 4X6PA 2FOMB 1AFQB 1AKSB 5L30H 1V2NT 1LHFH 4ABEA 2Z9LA 2VBCA 4O3UA 4MNVA 1HBTH 5DJ7A 1BCUH 1YM0A 4B6FA 1EAIA 2PGQB 3SV8A 1EASA 1O2WA 3N7DA 3ZV8A 4B76A 5CDFE 3QO6A 1C1VH 3STIA 1NRSH 3RXHA 1EB1H 1GGDB 1PPEE 4MDSA 5K0HA 1ARCA 1BJVA 1QBVH 1KXEA 1LHCH 1GDNA 5C67A 2XOKD 1MMJN 1PPFE 1Z8RA 8ESTE 1EJAA 4WF8A 3HGPA 2GDEH 5I25A 5H4IB 3RLYH 3A7TA 2AMPA 1C2JA 4Y8XA 3LIWA 3B8JA 2LELA 3SOSA 2O9QA 1F7ZA 5AHGH 1ELVA 1QHRB 5KECA 1EPTA 2D26C 1GJ9B 2WPMS 4H42U 3SI3H 1ELFA 1WQVH 1PYTC 8GCHF 3H5CB 5C5NA 1GBKA 3ODDA 2CHAB 1YPEH 1HAGE 3E0NB 2FX4A 3A87A 2HRVA 2IJOB 3SQHE 3SORA 4O03A 2PKSB 1LCYA 4AG2A 2ANYA 4I8JA 1SLUB 1MD7A 1AFEH 2BDBA 1BRUP 1C5PA 1WOFA 1C9TA 2F9VA 2O8MA 3GY6A 5EJZA 2EEKA 4ABFA 1ZRBA 2VIQA 2G5VA 1S84A 7LPRA 1AD8H 3M35A 4AORA 5HKKD 2JDID 4FETA 3LONA 2HLCA 1ZYOA 5L2YH 2JETC 1NO9H 4ESTE 1F0RA 6CHAC 1TNJA 3S7KB 1FIWA 3PV4A 5F03A 4IS5A 3FN8A 2NU2E 1EZUC 2WV5A 4P02A 3K9XB 1ORFA 3RXAA 3DFJA 2PLXA 1D9IA 1O3CA 1AWHB 4JZ1A 2VH6A 1IQIA 1KDQB 3ENSB 2VWMA 4NA7A 3IG6B 4HGCA 2BY8X 1GVKB 4OS7A 3KGPA 2VIDA 2A32A 1OKXA 3SUFA 2B0FA 4I86A 4NCYA 2QY0B 2QXIA 3RXBA 1AGJA 3TPIZ 2XC0A 3ODFA 4X2YA 1ESAA 1HXFH 1O3NA 4ABJA 2OLGA 3RC4A 2HPQH 1FY8E 1UTJA 1TB6H 4WVPE 1FN6A 1LVMA 3RXOA 2IJD1 1HUTH 4ZXYH 1WCZA 1P10A 1YPHC 1O5EH 8KME2 1O2LA 2PR3A 2GD4B 1YPKH 1TRNA 1TGTA 3K65B 2KCPA 1GHYH 2UUFB 2B5TB 2KM0A 1MAXA 3GYLB 4WJG2 4Y7BA 1EUFA 2ZZUH 2J98B 1F5KU 3B23B 4AGJA 2OK5A 4YOGA 1RXPA 4BOHA 1IHSH 4FUGA 1TNLA 2GV7A 7KMEH 5DP4A 1DITH 4TPYA 2QCYA 4WMDA 3MHWU 1BTHH 3EA8A 6LPRA 2BDYA 3RLWH 1GHAG 2ZDLA 1T32A 3MH5A 2BD7A 1GG6C 1C2KA 1ELTA 3BTQE 1GHWH 2ZGHA 3GICB 3RU4D 1FY1A 1O39A 1TMTH 1FQ3A 4A1VA 1IHTH 1O32A 2XBWA 1BBRK 3TH2H 3M7TA 3NKKA 4NSVA 5GWZA 2G8TA 2Y6TA 3HGNA 5DSFA 1GI0A 3RXGA 3OTJE 2RFKC 1TQ0B 2FI3E 2IN2A 4NFFA 1GMCF 3MI4A 1IQKA 1XUIA 1DUEA 3M5MA 3PLBA 3EDXB 5FPSA 1WBGB 1PYTD 4KP0A 2ZQ2A 4UDWH 2ZCLP 3U69H 2RDEA 3ZIAD 5CHBA 4ZKOU 1FJSA 3RDZA 1G2LA 4X1NU 3PTBA 3ZVFA 2G52A 1SI5H 4F48B 4B2BA 4Z6AH 1QB1A 3ATWA 1HGTH 1A5HA 1KXBA 4OS4A 3PV2A 3N99A 1TRYA
chains in the Genus database with same CATH topology
1NROH 1MKWH 1SLVB 2FS9A 1S6HA 3VFEA 4A7IB 1BHXF 2XBVA 3RXVA 2QGRA 2H1UA 2OC0A 2Y5FA 2UUKB 5K7RA 4INHA 2JH5D 1IOEA 1ZTJA 1D3PB 2PGBB 6GCHF 4VGCC 2BZAA 3A85A 2BY7X 2A7JA 4WH8A 3SU5A 3T25A 4UFFH 2FOFA 1SGYE 1EKBB 1LHDH 1SLXB 3LT3A 2ZDNA 1VITG 2ZPRA 3LKWA 1BMLA 1CHOF 4U32A 3MNCA 1W7GH 5CMXH 1Y3XA 3OX7U 4FUIA 1A1RA 1GMDG 1LQEA 1FMGA 1XUFA 2VGCB 2A4QA 2XCFA 2XXLA 1YP9A 2F9PA 1C4Y2 1O2JA 3GY8A 1EJNA 2WPIS 4Y71A 3SV6A 4WXVA 3C1KA 1GHXH 1HAYB 4MPWA 3SBKA 3M5OA 3VXEH 2Z3CA 3E3TA 1EX3A 2BOHB 1Z8IB 2PKSC 2UWOA 2GMTB 5IDKA 3GCHB 1ZJDA 3AAVA 1N8OB 1IQGA 2GMTC 3SJ9A 3RUOA 2OQ5A 2D8WA 4YZUA 2RG3A 3RXEA 1NFXA 2AIQA 4ZKNU 1HYLA 5EXNA 1NPMA 1D3QB 1QURH 3MU1A 2TRMA 1P2OA 1GJDB 1ZGIA 2ZTZA 4CRAA 2P8OC 2AH4X 2ZHQH 1A3EH 1KYNA 2P59A 1G3EA 1O3FA 1TONA 1DS2E 1PPZA 3MU4A 3FP8E 2ODPA 1WAYB 4ISLA 1GBMA 2SGDE 1OWJA 4CHAC 2BZ6H 4A1TA 5JBAS 4D9QA 1HXEH 1P12E 1GI7B 3PO1C 4D8NA 1V2UT 3LJOA 1YPMH 2V6NA 4AFSA 3RMOH 2G00A 2DUCA 1EAWA 3ESTA 1DXPA 2ODYB 1MBQA 3SNDA 2C4FH 1QY6A 1QQUA 1O2YA 2H6MA 3BIUH 2HOBA 3PROA 3WY8A 1AQ7A 3A84A 1ZSJA 4ZHMU 1QRWA 4DJZB 2VH0A 2CXVA 3DD2H 1EQ9A 1O2VA 3TH4H 3VEQB 3QDZB 1PPBH 1T8MA 2ANKH 5DK1A 2C90B 1GG6B 4ZHAA 4H6TA 3M5NA 2TGDA 1BBRH 4I7YH 1GI4A 3GDSA 2GGVB 2WUBA 2FOEA 1W0ZU 4ZHLU 2OD3B 3PMAB 3S9CA 4TWYA 2FYRA 2C3SA 2BX3A 2VWNA 4FVBA 2Y80A 1NFYA 1B0EA 1K28D 1O2RA 2ZG0H 1LDTT 3ZYDA 2OC1A 5ESTE 3CS0A 1QBOA 3SV9A 4WY3A 4O3TA 1PQ7A 1Q3XA 1V2ST 3P8FA 3SO3A 2G4TA 1A7SA 1GBJA 2Z9KA 3R0FA 1H9IE 4B73A 1NS3A 1QL8A 1TPOA 1SGDE 5HGGA 1SQTA 1O31A 1H1BA 4GAWA 2FS8A 5F8TA 1SQAA 2J34A 4XDEA 3A88A 4KTUA 3LGVA 1UK2A 4DY7B 2ANWA 5A8XA 3PM3A 2PKAA 3DA9B 3Q3YA 4X8TH 1G3BA 2F9NA 3RXKA 1P2QA 3LJJA 4ABHA 2ZA5A 1RD3B 4D7GA 2GT8A 1HAZB 1ANCA 6GCHG 2BY9X 2V3OH 3MNSA 5FXLA 2FO9A 3UNQA 2J94A 4NIVA 5HYOA 4Z0KA 1FY4A 3QGJA 1MKWK 1L1JA 2ZFTA 4TY7A 1GBBA 1J16A 5FPTA 1KTTB 1O2ZA 1TPSA 2BD8A 4X8VH 5EPYA 2NU1E 1BUIA 3VB7A 2H5CA 4DW2U 1O34A 1ZR0A 5JPMH 3A7VA 4BAMB 1SG8B 5EXLA 1O2PA 2BY6X 2P93A 1C2DA 1SL3A 4MG3A 2Y7ZA 3GISB 4D7FA 2FIRH 3RXPA 2BVSH 3FZDA 1EZSC 1GJ7B 4KTCA 4WXIA 4Y8YA 4U01A 2AFQB 1EP6A 1GCTB 3TK9A 4CR9A 4ABBA 2WYGA 5HM9A 1P04A 3PLKA 1X7AC 4B75A 5DO4H 1W13U 1W3CA 1ANDA 3D62A 1QQ4A 1L0ZA 2BVRH 5AFYH 1O3BA 4WH6A 5E0GA 2AIPA 1G32B 1Y5AT 1GMDF 1XVOA 3KQDA 4FUCA 3P8NA 3A8AA 1C5LH 3QWCH 4MPXA 3M36A 1DXWA 1MZDA 1J14A 2QAAA 3DHKH 2C8XB 1FY3A 4NIWA 1GHBF 1ZSLA 2ZHDA 5T6FA 1E34B 1F0UA 3SJ8A 1CSOE 3KCGH 2BM2A 4Y79A 2BYAX 2PTCE 1HIAA 2GX4A 1C2FA 1H9HE 1VITF 1MTNB 5GIBA 4CRDA 1DANH 1S85A 1O3IA 3BIVH 1PJPA 1UVOA 2XC5A 1EZXC 3P6ZB 4Y11E 2H5DA 2H9EH 3TGIE 1O5GH 1K1PA 3E90B 3LU9B 4AN7A 2VVVA 4NFEA 4K3JA 3MNXA 1NTPA 1SFIA 3A7WA 1KLTA 4CRGA 1XXDA 4HZHA 1MQ6A 3PMJA 3QZQA 2JKHA 2EA3A 3SU0A 3AW0A 5I46H 3M3TA 5GJ4B 1YKTA 4GHQA 4X1PU 3VB3A 2A5KA 2BHGA 1KLIH 2NU0E 3ZZAA 4IC6A 2J92A 3T5FH 3KIDU 3L3TA 4XBBA 3GCTF 1ELCA 3URCA 3K6YA 2OCVB 3QUMP 1G37A 3EA7A 2AYWA 5EW1H 1TGBA 2FOBA 2VINA 1O38A 1GDQA 2BD9A 2YNAA 3GY3A 1QJ6B 2V35A 5J4SA 3MU8A 4SGBE 1E37B 3NUMA 3SGBE 5TCCA 2W3KA 2CF8H 3KQCA 2C8YB 2J95A 4X6NA 4B2CA 1RTFB 1KTSB 1ZMNA 2CF9H 1Z1IA 4JK5A 1JXPA 1CVWH 2VB0A 3D49H 2BLQA 2Z3DA 1YLDA 3BV9B 2ILNA 2ZNKH 1Y5UT 2R9PA 3A81A 2ANMH 1BB0B 1QL7A 2VVCA 4X1SU 3PWCA 4CH2B 1EJMA 2F9BH 2Y81A 1C5YB 2R2MB 2VNTA 1RFNA 1ARBA 1HJ8A 2D2DA 3NXPA 1ZPBA 3GY7A 1NT1A 2GKVE 1OOKB 1SPJA 1RTLA 1TBQH 1K1NA 3PYHA 1TOMH 3BF6H 4FUBA 1AB9B 1SOZA 1MUEB 3TNTA 3V12A 4K8BA 1K9OE 3U1IB 2W3IA 1A61H 1HJAB 1D3TB 3N7OA 4XE4A 2ZTYA 1UCYK 1ZPZA 2PSXA 2ZO3H 1C1RA 1GHVH 1B0FA 3UWJH 1OX1A 4FU7A 4O97A 1CGHA 4PROA 1S6FA 4ABGA 2A4GA 2D1JA 2BTCE 2F83A 3P8OA 4H4FA 1O2XA 2ZKSA 2P95A 1NFUA 1UTKA 4Q7XA 1GBEA 1AFQC 2RA3A 4X6MA 1ID5H 2OC7A 1LHEH 2KAIA 1HLTH 1DLKB 2VWLA 4JYTA 2O8WA 3DUXH 2AGGX 1UVTH 4BAQB 5GCHF 2FI5E 4A92A 1GMCG 2FDAA 2ZFPH 1P11E 3P8GA 2HVXA 1KXCA 1QNJA 3VB4A 1BA8B 3LH3A 5FCRA 1F92A 4OGXA 1ETTH 5L6NH 1RTKA 1EP5A 1VJ9U 2SFAA 4K1SA 2PUQH 1QR3E 1EATA 2HNTE 4RN6A 1CE5A 7GCHF 1QA7A 1ZTLA 1FLEE 2FEQH 1J15A 3RXMA 1SGFG 1TRMA 3ZZ6A 5TCAA 3U8OH 1K1LA 1FPCH 3A80A 4X0WU 1LPZB 1N8OC 2FX6A 1C5ZB 2FYQA 1V2RT 1FONA 1BTYA 1XVMA 1GBTA 5DP6A 1TALA 4DCDA 1AHTH 4BXSA 4ISNA 1GCTC 2ZCKP 2Y5HA 2AERH 1ZOMA 1TWXB 2DE8A 1K1JA 1GJ5H 4AGKA 3KNXA 2EI7A 1ZTKA 3MU5A 3RXJA 1Y3VA 3TJNA 2AGIX 3BEIB 3U98H 1ANBA 1TA2A 1TBZH 1GJ6A 4A5TS 3LPRA 2IOTA 1FNIA 4KTSA 4DOQA 3LGYA 5FX5A 1GBIA 3Q3KA 1WYKA 1J8AA 3PMHB 4QT8C 1JIRA 1DWBH 2A45B 1OYTH 1L4ZA 2R0KA 1JMOH 2VGCC 1F5LA 1TYNA 1V2JT 4X2VA 1D6WA 4MTBA 2ZDVH 2GV6A 4B71A 2BDAA 3FP6E 1AIXH 1FPHH 2OTVA 1W2KH 3RXSA 2SNVA 2QN5T 1E35B 1SGCA 4I31A 5F8XA 4MNWA 7GCHG 1C2HA 1N6YA 1T7CA 4GLYA 1EAUA 4HTCH 1MH0A 2FOGA 5FCKA 1SGFA 3PO1B 1EAXA 2ZDKA 2SGQE 3PWBA 3KQEA 4ABDA 2GDDA 2GCTB 1BTPA 2VIOA 1GBFA 1SSXA 4MVNA 1G2MA 1UHBB 2BLOA 3SNAA 5FPYA 1FXYA 2OC8A 4IGDA 2ZDAH 1GPZA 1MBMA 1XUKA 3UR9A 1SHHB 3L6PA 3NWUA 1OWEA 1E0FD 1TOCB 4BXWA 3SQEE 1DPOA 1QA0A 2GT7A 3S0NA 3SNEA 1SGQE 5EGMA 3KQBA 4Y6DA 2ASUB 3BTME 2ZHFH 1PQ5A 3MO6A 1H9LB 3QZRA 1ACBE 3O8DA 4X6OA 3RM2H 3KL6A 4Q2KA 1P9SA 1UTNA 1K1IA 2A1DB 1EOJA 4ZAEA 2I6QA 2THFB 1JWTA 1S83A 3RC5A 2A5IA 2A2XH 1DWEH 1WTHD 3FANA 1SB1H 4Y7AA 1RIWB 1AE5A 1XUGA 3GYMA 5E8EH 2W5EA 3I77A 2C93B 1HJ9A 5IYTA 1ZHMA 1YCPH 1HJAC 5JYIA 3SJOA 3ZZ7A 1O36A 1AVXA 1HCGA 2JETB 2G81E 1ZHRA 1C4V2 1HRTH 2XWAA 2AMQA 4MPUA 2SGEE 3E6PH 4DVAU 3MU0A 2KAIB 1FUJA 1MU6B 4TYDA 2DE9A 2ZPQA 2QXHA 3UNRA 2PSYA 4AYYB 1TBRH 2ZWLH 2UWLA 3SUDA 2PKAB 6CHAB 2ODQA 1DDJA 1M9UA 1O2OA 2NU4E 1GI5A 2BD2A 1GMHF 1XMNB 1GBAA 3L33A 2BD5A 3HKJB 5LPFA 4FUEA 5SGAE 1TNGA 1DY8A 4ZKSU 2VU8E 1T8LA 3BTHE 3KN2A 4YESB 2SGPE 1HFDA 1LMWB 2UUJB 3SI4H 1XKBC 1MTVA 1QJ7B 2FOAA 1GI2A 1UMAH 4INKA 1XUJA 1LVBA 3SN8A 3SJIA 2ZU3A 1YBWA 2FPZA 3RU4T 1BMAA 1IAUA 4NA9H 1ZMJA 2BDIA 1E36B 2CV3A 4UEHH 3W94A 4H6SB 1FZZA 2ZI2H 2C8ZB 3F6UH 2CMYA 1GMHG 1C2EA 2B8OH 1NESE 4BNRA 2P3FH 1C5TA 5DKMA 2BXTH 1TMUH 2QV1A 2A4RA 2AGEX 3SU4A 5DP3A 3ZZDA 3TNSA 2WPHS 4AX9H 1VGCB 3GCNA 5A8ZA 1W10U 3OY6U 4E06H 4I8LA 3M3SA 2XWBI 2YOLA 1PPCE 4AFQA 1V3XA 1MQ5A 1OYQA 1DSUA 3R3GB 1FAKH 1GI3A 3V13A 3UIRA 3QTVH 4MNYA 9ESTA 3SW2B 3UPEA 4JK6A 1QGFA 2WPKS 4UD9H 4CREA 3CENA 5HM2A 3SUGA 5C2ZA 1CT2E 3UR6A 1AVGH 3RXDA 1YCPM 1O3KA 4YOJA 1C5OH 4JYUH 2R3YA 1ELAA 1DLEA 1GGDC 1OPHB 1GI9B 3QGNB 3PLPA 2FZZA 2BDCA 3ATMA 2OXSA 4ISHH 1S82A 1GJ4H 3LDXH 2HWLB 1QB6A 5G4BA 3UQOA 5EU8A 1D3DB 4JMYA 5E0HA 4GCHF 2G4UA 4RSPA 1MTWA 1KXFA 2GZ9A 1ZRKA 4X2XA 1BDAA 1EOLA 1GJBB 2J4IA 2A4OA 4FUJA 1ABIH 1O2HA 2P94A 3UTUH 1HIAB 2QC2A 3I29A 8LPRA 1P57B 4YTAA 1TMBH 2TIOA 1B5GH 1K22H 3TITA 3E91A 3JZ2B 1SLWB 1OSSA 3MH7A 3RXRA 1P2NA 3TK5A 3ZZ8A 3UY9A 4FUHA 3T27A 1SGPE 3T26A 3SU2A 2XYAA 4IC5A 1SGTA 4IBLH 1BIOA 1N6XA 2TGPZ 4BTTB 1O2TA 4IW4E 5E2PA 1UHBA 4D76A 1D6RA 1SFQB 1JRTA 3T29A 3IWMA 1WUNH 1O3OA 3HPTB 1DY9A 2ZFRH 4DT7B 3ZZCA 4B2AA 3U8RH 4XOJA 1TE0A 2Z6BD 5BRRE 2FI4E 3HK3B 5C3NA 2O8LA 4K1TA 3F1SB 1Z8GA 1AI8H 3F9EA 3FFGA 2EI8A 2R2WU 1C5UA 1JRSA 1OXGA 2HPPH 5HXFA 1P2KA 1A4WH 1O5AB 1FAXA 3H7OA 2ALPA 1VCWA 1HAVB 3QN7A 1C5SA 2XNIA 4GSOA 2W7SA 3T62A 1K1MA 3RP2A 3U1JB 2VIPA 1QL9A 1P0SH 1PQ8A 3D65E 2ESTE 3S69A 1A5IA 3JZ1B 3ZYEA 3EYDA 4I8HA 2VVUA 1RJXB 1BRAA 2BDGA 1KXAA 1O5CB 2YNBA 2PTNA 4JZIA 1A2CH 1O3EA 5C20A 3TGJE 1FIZA 3QX5H 2ZF0H 1PPGE 1CGJE 1UK4A 2PW8H 3F9FA 1UTMA 4UFGH 1S0RA 2ZFQH 5JBCS 4DG4A 4FVDA 2FP7B 3UOUA 1L2EA 3TJOA 4CRBA 1Y3YA 3Q3XA 1BRBE 3NPSA 1O3HA 1V2OT 3M7UA 1GI8B 1BRCE 1C1NA 2UWPA 1IQMA 1QJ1B 1INCA 4OS2A 2FXRA 5FX6A 3A8DA 5A0BA 3TLOA 2ZC9H 1V2TT 3BN9A 4K60A 2SGFE 3BTDE 1QB9A 3GCTG 1W11U 1YPJH 1CT0E 3DFLA 1C2MA 2Z7FE 1S5SA 1P05A 2BMGB 5GPIB 1UO6A 1SR5C 1ETRH 4K2YA 3ZZ4A 3A8CA 4MLFB 5F6MA 1AMHA 1BTZA 1UTOA 5EQSA 3A7YA 3PTNA 1GWAA 1GCDA 1NN6A 5JB9S 2ZGBH 1UK3A 1Z71A 4YLQH 2J2UA 4TY6A 2ZGCA 3SNBA 4A1XA 1Q31A 1VCPA 5LPEA 1C5MD 2H2ZA 3A86A 1WSSH 4Y8ZA 3RXUA 3HKIB 3UFAA 3M3VA 3MH6A 3GCOA 1C1WH 1PFXC 1MTUA 5AVDA 5EXMA 3SNCA 4ZUHA 3RXFA 2Q1JA 4CRFA 5DP9A 1DVAH 4GHTA 1RIWC 2A0QB