2G5CA

Crystal structure of prephenate dehydrogenase from aquifex aeolicus
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
281
structure length
278
Chain Sequence
MQNVLIVGVGFMGGSFAKSLRRSGFKGKIYGYDINPESISKAVDLGIIDEGTTSIAKVEDFSPDFVMLSSPVRTFREIAKKLSYILSEDATVTDQGSVKGKLVYDLENILGKRFVGGHPIAGTEKSGVEYSLDNLYEGKKVILTPTKKTDKKRLKLVKRVWEDVGGVVEYMSPELHDYVFGVVSHLPHAVAFALVDTLIHMSTPEVDLFKYPGGGFKDFAKSDPIMWRDIFLENKENVMKAIEGFEKSLNHLKELIVREAEEELVEYLKEVKIKRMEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Prephenate Dehydrogenase from Aquifex aeolicus: Insights into the Catalytic Mechanism
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
molecule keywords prephenate dehydrogenase
total genus 96
structure length 278
sequence length 281
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.12: Prephenate dehydrogenase.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02153 PDH Prephenate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3660.10 Mainly Alpha Orthogonal Bundle 6-phosphogluconate dehydrogenase C-terminal fold 6-phosphogluconate dehydrogenase C-terminal like domain 2g5cA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2g5cA01
2F1KA 3WGQA 3DBHB 1Y6JA 4HFJA 3LLVA 3IL2A 1PJBA 4DPKA 3FNFA 3AI3A 1I3KA 3NGXA 3PZBA 6ADHA 5I7FA 3D4NA 1DFGA 1VSVA 4BNMA 1EUZA 3WYCA 4AJJA 1BSVA 3JQAB 2PFGA 1PWZA 3SXPA 2D5AA 4LGVA 1CDOA 2BFOA 5KVQA 4LISA 4F46A 1Y8QA 3IKVA 3KYBA 1M6HA 5DP2A 3WLFA 4PVDA 3FHLA 1ADCA 1N92A 1XG5A 2O3SA 1HRDA 1VKNA 2QYTA 3K96A 4PLVA 2PZKA 2O3RA 4M89A 1HE5A 4RVDA 4BMVA 3PHGA 3RUFA 1ZJYA 1UDCA 4U5QA 5A1TA 3GA0A 3RD5A 3RASA 3VTZA 3BTUA 3ORFA 3C3XA 5EINA 1RM0A 2DBQA 1ISMA 8ADHA 3VZPA 1BRMA 4OSOA 4PG7A 1KS9A 4U8GA 4LN1A 3ZWAA 4HADA 3UICA 2EERA 5G0TA 4W9NC 1RYEA 1BG6A 5JY1A 3D5QA 4FFRA 4G81A 5TX7A 1DB3A 4BNLA 4CMBA 2WMDA 5AXAA 2CFCA 4C7JA 5IN4A 1DRUA 1VL6A 3GGOA 1HZZA 2C54A 2BI7A 4BQPA 4R68A 4EUEA 1B7GO 1BWSA 1I30A 3JYOA 1AXEA 4ONEA 2CDCA 1LUAA 1KEUA 1NWHA 3WGZA 4FJ2A 2Q50A 3TSCA 1I0ZA 3PGJA 3PWKA 1U5CA 1HTBA 2I76A 4IXTA 4XWYA 1I8TA 4NU6A 4F3YA 1X1EA 4WKGA 3H5AA 4OAQA 3UF0A 2PNFA 1GTMA 3TL2A 4OOFA 3H6KA 4R4JA 5EMHA 2YZ7A 1DFHA 2V65A 1LSJA 4XQEA 1GYPA 2C7GA 4JBGA 1WXDA 3GEDA 4RVFA 3HDQA 2OFPA 1UDBA 3OF2A 1GV0A 3GVPA 3Q3CA 4XYEA 3O8QB 3DAPA 5AOVA 4D46A 1TA4A 3TOZA 4E2YA 1GV1A 4IBOA 1E7SA 4I5EA 1PQWA 2BLLA 3ZNQA 1P3DA 1SEVA 2IRWA 2HO5A 2A35A 3ENKA 3GAFA 4EEZA 1EQ2A 2X23A 3ZHBA 2CMDA 1V3UA 1YJQA 5ILGA 2PGLA 4R1UA 2GN8A 3WFJA 3KOUA 2I9PA 4JQCA 3SJ7A 3NAQA 1HXHA 1O94A 3E1KA 3AFMA 3IP1A 2I5PO 1PGJA 4GWKA 1ZVMA 4PLTA 4CPDA 1S6YA 3NKLA 1QYCA 2P9EA 4RCVA 1HL3A 4RZHA 1W4ZA 3PIDA 1SCUA 4J6FA 1B2LA 5DCYA 2Z95A 1P31A 4YB8A 1C0PA 5B1YA 2Q1SA 4U6QA 4YQYA 4Z0HO 1Z45A 3CZMA 1GPDG 4K1LA 1ZJZA 1A72A 3WWYA 1R4NB 4J49A 1HDYA 5IXSA 3FTPA 2NV6A 3VH3A 1FDWA 2AEJA 4YJGB 4N5NA 1T2EA 1PJ3A 4CM6A 3EYWA 3NRCA 4M1QA 3ZWNA 1ARZA 4D0RA 3C85A 5DT9A 4YAKA 1NPYA 3RUAA 5CHEA 1OFGA 3LZ6A 2FWMX 1ISHA 4OGWA 2C0CA 2C2YA 4XDZA 1UP7A 3ZHXA 1JQBA 2Q1WA 3OHSX 3AOEC 1BVUA 3LT2A 3BMCA 1ZSVA 1BXKA 3DTYA 1GEEA 1PSDA 3PDUA 2B36A 2OGUA 4R9RA 1WVGA 4QO7A 1ENYA 1OOEA 3MOGA 5COQA 5HA5A 5A3VA 4MVJF 1NQTA 4BQRA 1G0OA 5JDIC 2GRAA 1JAXA 3S2FA 1DAOA 1H94A 4URFA 4YA6A 4FFNA 5I9LA 3ZV6A 1W0CA 2RH4A 3UKOA 3WJ7A 4Z6KA 2ZCVA 3M1AA 2OBNA 1MFPA 1MB4A 1I2CA 1ONNA 4QEDA 4MINA 4LMRA 3KO8A 3PEFA 2P2SA 4O1MA 4WEQA 4WASA 3X2FA 4BKQA 4GX1A 3AW9A 1NTOA 5G4KB 3N74A 4P4LA 4M87A 2JL1A 3IJRA 2E82A 3QWIA 1BXZA 4FFLA 3JQBC 4FDAA 1DXYA 2YY7A 4ALMA 2BRUA 1QORA 4XIYA 3WIEA 3ASUA 1EK6A 1HLDA 3KLPX 3ZWBA 1FDUA 2UVDA 1XHLA 1D7OA 3KLMX 5T57A 1PS8A 1KIFA 5CG1A 2B37A 4XB1A 5JMWA 4MVJP 3HADA 1T2FA 4TWRA 4II3A 3HB4X 4WCFA 2Y93A 4Q3EA 1YONA 2UYYA 1H9BA 1KVQA 4BNVA 4BO1A 5FF9A 1GUZA 3KV3O 3ZW9A 4I1IA 5GMOA 2EP5A 2GN9A 2YQ4A 1IL0A 2PY6A 4DQVA 5KVCA 1LLQA 4OQZA 1X7HA 4PZEA 3N58A 2DVMA 1NHWA 2QG4A 1GU7A 1MGOA 2VCYA 3NYWA 4RLSA 1LBEA 4AJ4A 3AY6A 4H7PA 1XR3A 4WNCA 2PWZA 1UZNA 4R16A 2Y1OA 4BIIA 4ZVVA 3KYCA 2ZATA 4WLFA 1JN0A 3WQRA 4CV2A 1GL3A 1QSGA 1U3UA 4OKIA 5I8WA 2EXXA 3JQ7A 2R00A 3UCFA 3OBBA 3VVCA 2XF8A 4HFMA 3FN4A 3U4HA 1Y8RA 4ZICA 2WYUA 1U4OA 3F5QA 4OYRA 5BSFA 2AW5A 4M49A 1GQ2A 2HUNA 4DQXA 1C1XA 3GPIA 3PTZA 5BNFA 3IC5A 3C8MA 4D3DA 3PIIA 1DHTA 1FDVA 5JAQA 1E3LA 3DL2A 3F3SA 4HWKA 3WR5A 5J23A 1XQ6A 4L4SA 3Q6IA 3OH8A 2FZEA 5U1PA 4D0SA 3HN7A 4AFNA 1ULUA 1BDBA 2BFMA 3WGTA 3AUAA 4R9SA 4CQLB 4BNHA 3H9EO 2A4KA 1D1SA 1V6AA 2P9GA 1YL6A 1UP4A 4NFHA 2Y99A 1R12A 4PZDA 5TT0A 4J2HA 1BTOA 2XXJA 5L40A 5JYEA 5AXDA 3VZSA 1SOWA 3V2GA 4R51A 3WSVA 3MWDB 3C1TA 3NT2A 1ONOA 2JD0A 3I23A 4OMUA 3MEQA 4FD3A 4ND2A 5ES3A 2G0TA 3DMTC 1ZFNA 1CETA 3PJDA 2FN7A 4J90A 4KQWA 2ILTA 3G17A 3JQBA 4KWHA 3WNVA 5JYDA 1FF9A 2JCXA 1LDEA 3RJ5A 2NU8A 5CEJA 1MG0A 1BVRA 3RWBA 1Y5MA 4WOJA 1NR7A 4RORA 1I2ZA 3K31A 1P1KA 1QV7A 1GZ6A 4BO6A 3IDSA 2VYNA 4D41A 3PVZA 2X86A 1RM3A 2FHSA 2NU7A 5AYVA 5L53A 1DLJA 4RPHA 3RROA 1VM6A 1UXGA 2W8ZA 3RUDA 1UXKA 5A03A 1C0LA 3P5SA 4R54A 5DCUA 1VE9A 3U5TA 1P77A 5A5EA 4KDFA 1OAAA 4BO7A 4UEJA 4RPGA 1T1SA 3ZN2A 4Q3AA 1G0NA 1A5ZA 1W8DA 3I9MA 3BHJA 4HNHA 4LRSB 3RUHA 2EGHA 3WGOA 3ZWOA 1U2DA 3ZWMA 1H0KA 4PLCA 5G0WA 1NR1A 5L3ZA 2Q1UA 2YFHA 2PZLA 3PQFA 3EK2A 5TGDA 1DDOA 2BGKA 4L74A 4YR9A 4RQTA 1I24A 1EBUA 3RBXA 2AQIA 9LDBA 3H5RA 1KY4A 1EUDA 4HUJA 4Z9XA 2EW8A 3I9NA 3KSDO 2ZJ0A 1NQOA 2X0JA 3L4BC 4JXKA 3TRIA 1LI4A 3I4CA 4BS9A 3NEPX 4A0SA 3JQFA 1RM4A 1N9GB 4E6PA 4PGFA 4L8VA 5K6AC 1PU2A 4UVGA 3TZCA 1IB6A 4NBUA 4WLVA 4RPLA 3OFSA 5EERA 5ADHA 1LDGA 2NTVA 4GX5A 4IPTA 3WDSA 1AUPA 4Q9NA 4CM8A 4OL9A 1XQ1A 4O6VA 1DOHA 4LRTB 1U7TA 4N5LA 3AUTA 1KVSA 3F9IA 1I33A 4QXMA 1EE2A 3LYLA 4MVJH 5A04A 4IZIA 3GUYA 3ZWPA 3JCZA 1EUCA 2CVOA 4MVJE 3JQ8A 2OBYA 1QRRA 2WD7B 4A7PA 2W90A 2QHXA 4ILKA 2Q49A 4ZHSA 4ND1A 1EZ4A 2J5RA 5A9TA 2EW2A 3DOOA 4OIMA 2AMFA 2NTJA 3AY7A 3DZJA 3MJ4A 4TRMA 1R66A 1ADFA 1HYEA 2UDPA 1YKFA 1VKOA 5B4UA 2V6GA 2VN8A 1TI7A 4BMNA 2BMAA 1ZIDA 1AXGA 3BMQB 3E18A 4FFPA 2ZB4A 3FCOA 3HSKA 5FI3A 4CR8A 4JIGA 4A03A 4RJTA 2SCUA 5IZ4A 1RKXA 2FOIA 1WDLA 3PRJA 4FJ1A 4KUGA 4KUEA 4B8ZA 3GF4A 3GDFA 4TMFA 3N7UA 2V6MA 4CM9D 2FR0A 1HDOA 3E6AA 4J9VA 2HJRA 5A9RA 1GQYA 1PGNA 4L75A 4WGGA 4ZN6A 3C7DB 4GH5A 3K92A 3DBHA 4G2NA 4EJMA 3EAGA 3UH1A 3H9UA 3K30A 4RPKA 3A9WA 3E48A 2IYPA 3JD0A 2Q46A 3DZHA 3AOEA 4L73A 2X0IA 2C2XA 1BXGB 2AQHA 1Q2XA 2JFFA 1YXMA 3F5SA 3I52A 3AM5A 2RCYA 1IE3A 4RF2A 3VPHA 3VPFA 1QYDA 2B69A 5L45A 3K2EA 3WYBA 2X5OA 1MXFA 3GY0A 3EGOA 3TNLA 4CUZA 4RO0A 3NT5A 4IDFA 5EPOA 2IXBA 4JP2A 4YJHB 1LQUA 3OJ0A 3LC1O 2CVZA 3WGHA 4A73A 2RBEA 4PLZA 2IZZA 3DHNA 3LT1A 1NNUA 4JLWA 4BKPA 5KVSA 5LDHA 3Q9NA 3F47A 4TRNA 4I08A 2ZTLA 4M55A 3PHHA 5CG2A 4PLPA 1YBVA 1N7HA 4BO8A 3GK3A 4CM3A 4J0FA 4CM5A 2RHRA 5ER9A 5LDGA 3U62A 5COBA 4BNTA 4XJTA 3JQDA 1X7GA 3M2TA 1P44A 3ZNPA 2C5AA 1LLCA 1Z75A 2IEBA 2W2LA 5U9CA 8LDHA 3I9OA 2NVWA 3DBLA 3L6OO 4DLAA 3TF5A 4XR9A 4AL4A 1XKQA 4UVEA 3W4JA 1VJ1A 2FPPA 2TMGA 2I99A 4RGBA 3DZKA 5FFFA 1NHGA 4FPXA 2Y68A 2YDYA 4EZBA 2C5EA 3F1LA 4BUCA 4YPOA 3DFUA 3JQ9A 3MTGA 5G2OA 2VWPA 1JW9B 4TROA 4D43A 5F1OA 1YVEI 4D3FA 3ONDA 1H6CA 3BAZA 3PLRA 3GEMA 3F4LA 2EP7A 1NBOA 4LVUA 4GVLA 1PIWA 2PK3A 2X9VA 2B83A 4RDIA 1ML3A 1ZUD1 4UUNA 1JA9A 4CMEA 2V6FA 2Q2WA 1FXSA 3D7LA 3GZNB 3WB9A 1N1EA 1XU7A 2O48X 4CUJA 3JYLA 2AG5A 4BKOA 1B3BA 4KDEA 3UVEA 4J43A 1YL5A 4WLOA 1X14A 4NK4A 2C7VA 2O2YA 2Y0CA 1HF3A 4WPGA 3BA1A 1JDJA 5T6BA 3IUPA 2ZB3A 5K9ZA 2NLOA 2X4GA 3C1AA 1CF2O 3CMMA 1K0UA 3ANLA 3PHLA 4QUKA 3IP3A 4EUHA 1D4FA 3DMTA 4FC6A 1LRKA 2XAAA 1GZ4A 4PG8A 4W99A 1U3TA 2VHWA 4NDNE 5CFZA 1TVEA 1WP4A 2CZCA 2Y0DA 4JCOA 4I9UA 4YJFA 3WMXA 3ZU2A 4AJLA 3SJUA 3WSWA 1RYDA 3KUXA 4K28A 1YBAA 3A1NA 4PZCA 2XPCA 4KTTE 3GFGA 2DKNA 2JCVA 2FSVA 4J7UA 2BF7A 2NADA 3CTMA 3RUCA 1ZSNA 3GG9A 1NYTA 3UCXA 1E3JA 1BHSA 3OSUA 4CLRA 1EDZA 3OM9A 1H9AA 3CZRA 1GDHA 3WFIA 4ALIA 4ALNA 2BELA 3S2IA 5COAA 4N5MA 3AI1A 4MOWA 2PGJA 1Z7BA 4J1QA 3LT4A 4YRBA 4DPMA 2O3JA 4UULA 2NVBA 3E9MA 4MKRA 5DNAA 3QJ5A 5EQDA 3GDOA 2HMUA 4HFNA 3MJEA 4B4WA 1BDMA 4BL5A 1ISIA 1YO6A 2UUOA 1HDGO 3DO5A 1IULA 3EZYA 1XYGA 4KP7A 1M76A 1A4UA 1L7DA 1O89A 5T64A 1IUKA 3E82A 4IJVA 4E3ZA 3GN1A 3VH4A 4B3IA 5A9SB 5JAIA 2J8ZA 4NBWA 4DBZA 1BW9A 4BO5A 2VUSA 4XDYA 4MVJA 4WE3A 3W8FA 4AJKA 4DC0A 1N9GA 5BNTA 9LDTA 5JO0A 1P1FA 4YT8A 2GPTA 2HK9A 5JCJD 1WMBA 3ULKA 2Y0EA 3Q11A 1EVZA 3ROPA 1QKIA 3I4FA 3R0IA 4IS2A 1XWFA 1E92A 3U09A 3WBFA 1ENPA 2IZ1A 3L6DA 5CDYA 4AJ2A 3FRJA 5B12A 2G5CA 3FTNA 4KZPA 3DONA 4ROSA 3RFVA 1MP0A 3LC2O 4RF4A 5DP1A 2LDBA 1UDAA 4OHUA 4P4NA 3K9QO 4CMIA 1GYRA 1E3IA 3DAGA 3G0OA 1ULSA 5TLSA 1UXIA 2C07A 1XLTA 2OOSA 4GI2A 4RV9A 3VPGA 4YJFB 1ZW1A 3GRKA 1EDOA 1HYGA 4KUHA 3MCVA 4TZTA 1PQPA 4EJ6A 1E7QA 5F5LA 1QLHA 1WAMA 2W98A 1SB8A 4ALLA 1IYZA 4BO4A 3CH6A 1E1NA 3IS3A 3DZIA 1U5AA 4MIEA 3F4BA 3SBOA 1ZXLA 4KWIA 3AU9A 3GVIA 3JV7A 4R1TA 4GSKA 4BO0A 3RFXA 1SPXA 1ZO8A 2IEDA 5JE8A 4EBFA 1U28A 1MG5A 2O23A 4RQUA 3DZGA 1P9LA 2P4HX 3ST7A 3GGPA 1T4BA 1WMAA 2D59A 3QVXA 3TZQA 2OHXA 5H81A 5A02A 2B5VA 2AA3A 1TXGA 3OIGA 1HYHA 4DREA 4EGFA 5ITVA 3E9NA 2PKQO 4D3SA 3KB6A 3RBZA 3DOCA 4PRKA 1SMKA 4IQ8A 4QO8A 1CRWG 1E7RA 1VJ0A 4KTVE 3RUIA 2HKIA 3G49A 3AM4A 2WWRA 1QYWA 4E12A 2HQ1A 3DZFA 4R3WA 2POQX 4B8WA 3AM3A 4P4GA 1XEAA 3VDQA 3RC2A 1KOLA 4YXFA 2DT5A 2I3GA 1ISFA 2GCGA 4CL8A 5A5FA 1QMGA 4GMGA 5L95A 1N1GA 2UUPA 3DBLB 3O38A 4A26A 1ZKMA 3C1OA 2DPGA 3O26A 4AJPA 1E3SA 3KEQA 4INAA 1EEHA 2VYVA 3QVOA 4GWGA 2O3TA 5F1PA 3G1UA 3JYNA 3QSGA 4ZQFA 3UAGA 3VVBA 3PQEA 1HWYA 4KMSA 1MXHA 3DBRA 4DC1A 3MTJA 2YHIB 4ZRMA 4I5DA 4CV0A 1ZMOA 1EFKA 5JY6A 3BMOA 3RJ9A 3TZKA 4CM4A 4L4XA 3U4DA 4NR0A 3M6IA 4BNJA 2C20A 1C0IA 2GDZA 5EQFA 4YYZA 1V35A 4OXKA 5I8ZA 1KEPA 5HTOA 1PL7A 1UUFA 2O7SA 3TL3A 1T26A 3OICA 3VZRA 1UXHA 1P74A 5I7SA 1I3MA 5IDQA 2FRDA 2Z1NA 3EDMA 3V8BA 4YTEA 3ENNA 3AY3A 4BNWA 1Q0QA 5ICSA 4WJZA 2QIOA 1KEVA 4GMFA 5IDYA 3P2OA 1FJHA 3HUDA 1NQAO 2ZB8A 4YAGA 3LLSA 1FDSA 3MJVA 3KSZO 3QW2A 3S2EA 1VL8A 3ZNOA 1WZEA 4OXYA 1TT5A 4CM4B 2EIHA 2RH8A 3GEGA 2QYSA 5KVVA 1B3RA 2EV9A 3VAZA 5AXBA 4CM9A 3UW3A 2IZ0A 4JROA 5CDGA 2GZ3A 1MUUA 3PQDA 5L9AA 1JKFA 1PJQA 4E21A 2AG8A 3LVFO 3U0BA 1GYQA 1B8UA 4EEXA 3HG7A 5F5NA 1C0KA 2HCTA 4CQMD 4IS3A 2J3JA 4M8SA 1E6WA 1M66A 1NWCA 3L9WA 3Q2KA 1YB5A 4Z0PA 4OSPA 4YWJA 4DRYA 4R5HA 4U0JA 4WLNA 4XR4A 1TT5B 1CJCA 3GQVA 4YAEA 4E30A 2VYVD 3ITDA 3CKYA 5FWNA 2G82A 3K8ZA 1JVSA 1WDKA 1Y8RB 3RKUA 4CMHA 5KJFA 4W82A 2E48A 3WGGA 2DUWA 4UEOA 3JQ7B 4DQUA 2DBVO 4D44A 2FY8A 1C1DA 3MOIA 3QIVA 4XQGA 1V0JA 1QR6A 2YUTA 5GZ6A 4ZQBA 3ZI0A 3NGLA 3ZV4A 1JAYA 1CWUA 3CSDA 3H4VA 3KYDB 1V9LA 4HP8A 4UVHA 1WNTA 4Z3KA 4A10A 4CR7A 2J5KA 4XYLA 2VZ0A 4DA9A 4E2WA 2Z5LA 2XXBA 4CLDA 2GO1A 1HZJA 4CM1A 5CEEA 2PA3A 3GG2A 1GPJA 1A71A 1KVTA 4EITA 1ZEJA 3TZHA 4DLBA 1PJCA 2HSDA 3JQ8B 4GSLA 3OMLA 2FMUA 1GUFA 2YV2A 1YE3A 3IQDB 3DB2A 1E1KA 3ASVA 4J1NA 4BO3A 1ENOA 2ZYDA 3GN2A 4B4VA 2W2LD 4PG4A 3PWZA 1QYXA 1NAHA 1B14A 2A9FA 4QX6A 4B4OA 1D1TA 2WJPA 1O0SA 2D1YA 3H9QA 1IHYA 5DCWA 2NU9A 5ITWA 4EW6A 1ISJA 2FR1A 4HFRA 4IMPA 4PCVA 5A3JA 1PJ4A 2OUIA 4XGNA 3ZNNA 5CP8A 5HM8A 4CM8B 1DIGA 1Y8QB 2A94A 2GASA 1M67A 4NU5A 4GGPA 1DIRA 3WOHA 4ITUA 4XEHA 1M2WA 2NQTA 4L0QA 4TVBA 1Y7TA 1EE9A 3WG9A 1YDEA 2GERA 2WE7A 2WSBA 3QP9A 3KXDA 4L4RA 3KZVA 4TQGA 3SX2A 3GHYA 1IOLA 4LMPA 4AJEA 1BMDA 4O63O 3AU8A 3QWAA 5AXCA 4TKMA 4E31A 1LDBA 3WWZA 1X0VA 3S2GA 2HK8A 3DBRB 3ZU3A 4D45A 1T2DA 3KRTA 4IM7A 1BW9B 4TRJA 3TZ6A 3D4OA 4ND3A 3I6QA 1K2WA 4MVJM 1R6DA 4TZKA 1WW8A 1JU9A 3PFWO 3GNSA 1SBYA 1AHIA 1NM5A 2QZ9A 4FSHA 1W73A 3CIFA 4YRDA 4RF5A 3QVSA 2FR8A 2VT2A 5C7LO 1Z74A 5JFOA 4W6ZA 1CIVA 4JJIA 3TJRA 3DFZA 1YDWA 1Q7CA 2PZMA 5JNLA 3D0OA 1E1LA 4Y98A 1B15A 4Y9DA 3CUKA 2PD6A 3WYEA 3KTDA 4K6FA 2Y05A 1GFSA 1UAGA 3QLJA 4XYMA 2E49A 3GLQA 4BNFA 2BGMA 1HLPA 3CMCO 2BH9A 1AN9A 5L4NA 5I9NA 4NFSA 1QLJA 3ZCXA 1YGYA 3H5NA 4DLLA 4EUFA 1VI2A 1NQ5A 1MFZA 1QG6A 5EIOA 4R41A 2JAHA 4CLHA 1PS0A 4CLEA 2A92A 3JQAA 3LU1A 2EEZA 3GR6A 5K0ZA 3DAFA 3BZUA 3KVOA 3T7CA 2YYYA 1B26A 4FN4A 2AXQA 2BKAA 2PV7A 3C24A 4WK6A 1J0XO 3VH1A 1DBVO 3FR8A 2EKLA 2VZ9A 3WLEA 4ALKA 3PJFA 2VHXA 3DZBA 4QQRA 3VC7A 4GLLA 1AGNA 2X1HA 1ZMTA 1DHRA 3WBBA 4BKRA 4E5YA 4CQLA 3VOSA 5B37A 4IQ0A 1A7KA 3GDGA 1ZCJA 4IJWA 1DPGA 1SNYA 2QRJA 1YL7A 2VOJA 3BMNA 4B4UA 5IF3A 1RWBA 3A06A 1GZ3A 4DMLA 2WDZA 2AE1A 4E32A 4CM7A 5A05A 2JFGA 3LT0A 3ZWCA 3C7AA 1PGQA 2BHLA 2VWQA 2HLPA 2PLAA 1I36A 1UH5A 3RVDA 4XRGA 2XOXA 1LDMA 1MA0A 3K5PA 4BO2A 2ET6A 2GUGA 3JQCA 2JHGA 5L51A 3Q1LA 2IXAA 4NZ9A 3ZWYA 4C7KA 5JCJA 5L4LA 1F06A 1S7CA 1OMOA 1R4NA 5AQ1A 1EMDA 3OJEA 5KJ1A 3W8DA 1ENZA 2HAEA 4MVJD 4A2CA 1A4IA 4MO2A 4BGUA 3K2BA 3EW7A 4M54A 1HEUA 1CQJA 1N5DA 4H3VA 2J5QA 4EDFA 4J4HA 4XYGA 3LF2A 1AE1A 1DSSG 4PLHA 5THKA 1PJSA 4CMCA 1LC0A 1Z7EA 4B7XA 3IUSA 1HDCA 4RLHA 4Z3DA 3FI9A 4PG6A 2ZIZA 3HNPA 4XB2A 1KERA 2B0JA 3GVHA 4NH4A 1R0LA 2VT3A 4NJOA 4YJDA 1NX6A 1PQUA 2DQ4A 4J1SA 5DBGA 3OQ1A 4GBJA 5AVOA 1NFRA 4QTZA 3WGIA 4BNGA 5LCXA 2Y1EA 4Y8VA 4CV3A 3R3JA 4R3NA 1DEHA 5EN4A 5C7IO 3WQQA 1IY8A 5THQA 3DC2A 3JYPA 4BV8A 5CPBA 1KEWA 3PYXA 7MDHA 3WQSB 2OORA 4MP8A 5JXWA 5ER6A 1T25A 1XGKA 1B0AA 4E2ZA 2CD9A 4DBVO 3DTTA 2BI8A 3JD3A 2PTGA 3RCBA 3HQ4O 1E7YA 2PKQP 3RU9A 5T5QA 2FPGA 1R4MB 5T67A 3PJEA 3ROKA 1NP3A 1ZH8A 1LX6A 3BIOA 4FR5A 4S3MA 5G4KA 1T1RA 4ESOA 2JD2A 5F21A 3ETEA 1E0DA 1LQTA 1DLIA 4CLOA 2NNLD 3TN7A 4AJIA 1EFLA 5DBIA 1H93A 5DN9A 1NVGA 4H15A 2YHUA 4OQYA 4QFDA 4UAGA 2ZJ1A 2ZTVA 1PL6A 3NDIA 3K6JA 4L76A 1OBFO 1PGPA 4YEDA 1XA0A 1U3VA 4IJUA 3ZZNA 2Q1TA 3O03A 1ISGA 1FK8A 2ZYAA 5DULA 3QE3A 4UVDA 3V2UA 1I10A 1V3VA 3NDJA 1CERA 1YJ8A 4G5HA 4I8XA 3TFQA 1E5LA 3JD1A 1WDMA 1G6KA 5C3MA 1UZMA 4FJ0A 4R69A 1I5RA 1U3WA 4YDRA 1K6JA 4DYDA 4IINA 4RDHA 2IYOA 3RFTA 4AJOA 3EZLA 4FFOA 4CLOB 4DWVA 2GR9A 5JBIA 1LDYA 5FYDA 4CMKA 1DO8A 3GFBA 3L6EA 3G79A 1HE4A 1YQGA 3F6YA 5HWSA 1DC4A 1TB4A 3NJ8A 4JNKA 4R1NA 3RQSA 3ZV5A 2O7QA 1KBZA 3H2ZA 4BNZA 3X2EA 3NTQA 4DMMA 1DFIA 3HB5X 1F8FA 2H1SA 1DIHA 4CV1A 4AG3A 4HXYA 4LCEA 4KOAA 5TQVA 5TIIA 4IIVA 1Y5RA 2Z1MA 2VQ3A 2JKVA 4PLWA 4E0BA 3I1JA 2YV3A 3VTFA 3WJAA 1E1MA 4TKLA 3S8MA 4J91A 4Z9FA 3T4XA 1GUYA 1H6DA 3FWZA 1K6XA 1ZBQA 2NTNA 4BNXA 4J16A 3PXXA 5F1KA 1PZEA 5L7TA 3GVCA 3IJPA 3MJSA 4BHTA 2C59A 3KM0A 1OC2A 1EK5A 3ZHYA 4Q3NA 1J6UA 4YT5A 4ZQHA 5I7VA 4NNJA 1X15A 4AJ1A 1HE2A 4GX0A 1TT7A 4ZGWA 1ZK4A 1YOVA 5B4TA 3NTRA 2V6BA 5FI5A 1L7EA 3HDYA 4XJSA 1PR9A 4BGEA 3V1YA 2JD1A 2X9NA 2YV1A 4XZ3A 4GAEA 5I9MA 1XU9A 3TQHA 4NBVA 4RZIA 4W9NA 3H2SA 4F45A 3HHPA 4E33A 2I67A 3A4VA 2Y1DA 4MIOA 1EBFA 5FEUA 1P0CA 1R0KA 3RSHA 5T8KA 3FR7A 1A9ZA 5JDCC 1NAIA 3OA0A 2TMDA 4IDCA 1B8PA 1ADBA 5DZSA 4XKJA 1UP6A 2PH3A 4YVFA 3G1TA 4Y67A 1LNQA 3DHEA 1Q0LA 4ZQEA 3WGYA 3OQBA 3B1FA 4UUMA 3H3FA 3WICA 4XYBA 1UAYA 3PGXA 3I9JA 3Q0EA 2RIRA 2CSUA 3GT0A 4GVXA 5T8KC 1ZK3A 3DR3A 3E5RA 3D1LA 1OC4A 3QWHA 4RVSA 2BFPA 2DFVA 3HJAA 4DUPA 4E5KA 1PZHA 2I65A 3JD2A 1I32A 3LF1A 1DIBA 5TNXA 4PIVA 2O4UX 5IXYA 1PS9A 1F0YA 3W4KA 5GY7A 4IUYA 4Q3CA 5EESA 3INGA 4D42A 5CDUA 4HKTA 1Q0HA 4XRRA 3DWFA 4OKNA 3V1UA 2GYYA 4FC7A 2EF1A 3H7AA 1VRWA 4I9HA 4E4YA 5CDTA 4XA8A 1I3NA 1ZK2A 4FS3A 3CPSA 1U9JA 4MPDA 2NWQA 4DXHA 3ITKA 3QRWA 1NFFA 2G76A 2PR2A 1R15A 3PI7A 1LEHA 1PJ2A 2W2KA 3WIDA 1PX0A 3OIFA 4J4TA 5A9SA 4AVYA 3FNGA 2DM6A 4AJNA 5CEFA 1Y9AA 3H3JA 2PGDA 3S55A 3Q2IA 3FNEA 1J5PA 3L07A 3TDKA 2EJVA 3ZH2A 4P22A 4FQ8A 2LDXA 5MGBA 3JQEA 2J3KA 3DQPA 3WTBA 5K6AA 1MV8A 2CNBA 1VPDA 5JAZA 4NK5A 2HK7A 1MC5A 4MP3A 2D8AA 1VLLA 4LSMA 2D3TA 2PD4A 4W7IA 4K6CA 3A14A 3RC9A 4CUKA 3PLNA 3WX0A 3HFSA 1N7GA 1IZ0A 3LSYA 3EC7A 3TPCA 5IFLA 2X9GA 3HWRA 5CDSA 1VSUA 3SLKA 4CJXA 3P7MA 2AE2A 3HFGA 4FIZA 4IMRA 3WXBA 4CMIB 1NVTA 2Q99A 3KYDA 4XCVA 2DLDA 4GL4A 1JKJA 4WEOA 3SC6A 2J6IA 4JBIA 3UFXA 2NACA 2Y66A 4NI5A 4PLFA 5KOIA 1GCUA 5G0SA 1H6AA 2NSDA 3U4IA 3I3OA 4ZD6A 2ZQZA 1RPNA 4YACA 2Q2QA 5GZ1A 1U1IA 4NIMA 5JC8A 2GN4A 1LTHR 3FBGA 3OECA 2OXIA 5GZ3A 2AEFA 3KETA 3UGKA 1WZIA 2OZPA 5IZCC 3GMSA 5G0VA 2ZB7A 3K73O 1RJWA 3PYLA 2NU6A 3WMWA 5JS6A 4M86A 4Y6RA 1SB9A 1LLDA 1CQIA 2WD8A 4FB5A 3GUCA 4XX0A 4YT4A 5CAEA 7ADHA 5L4SA 4YAIA 3ZWXA 4CMGA 2X5KO 4XIJA 3AI2A 1LSOA 1KC3A 2RHCA 5TF4A 5BR7A 2GGSA 1A27A 3ICPA 4IIUA 2EJWA 5DF1A 2Q45A 5JLAA 3CE6A 3QQPA 3A28A 1P1JA 4NHEA 4N7RA 1PZFA 5BSGA 1C14A 2JHFA 3UOGA 4PVCA 2FZWA 1LJ8A 1JWBB 5BNIA 4NMHA 2VTDA 2E6UX 5TSDA 4BKUA 2X7HA 4CMEC 1NPTO 4N54A 1QYVA 1C1DB 4BOYA 2UAGA 1MC4A 2P91A 3ONFA 6LDHA 1X1TA 1E6EA 1Q7GA 1T2CA 1ZEMA 1EQUA 4WLUA 1JVBA 4EI2A 3V2HA 4EYEA 4ZRNA 1YOVB 2GLXA 3B1JA 3BTSA 5IJZA 3DMYA 4P38A 2D0IA 2H9IA 3RAJA 2YHIA 2YDXA 2HU2A 2I3AA 1D3AA 2Q2VA 1VC2A 4I5FA 1HSOA 4RVGA 1ZNQO 3DEYX 3DOJA 3OEWA 4XQCA 4BB6A 2IODA 3ZW8A 3ABIA 2P5YA 4GX2A 1ID1A 2H6EA 1H2BA 4UVIA 1MX3A 3PDJA 2P9CA 1Y1PA 3QVWA 3HDJA 2QX7A 4I9NA 4GQAA 4O0LA 4MIYA 2ZTMA 1GR0A 2BFAA 5KWEA 2OO5A 2R00C 4HX5A 4BNYA 2X22A 4WCFB 3W6UA 4CL3A 4Q39A 4UUPA 3OIDA 4YAJA 5DOVA 1YS4A 1ZK0A 4IXWA 3UN1A 3FNHA 1LDNA 1N8KA 1E7WA 4QFCA 1NVMB 5HBRA 4ZJUA 1M6WA 4Y6SA 2DTXA 2GD1O 1F8GA 4Y6PA 1PJTA 3VPSA 3D3WB 3EUWA 2H5LA 4PFJA 2H63A 3M1LA 2VRCA 4FGSA 1HETA 1WWKA 2Y1GA 3VDRA 1ZZEA 1GD1O 2C82A 3ZWWA 1I2BA 2NM0A 3D5TA 4PLYA 4UUOA 3FSRA 3VKVA 1O6ZA 2DPHA 4L9RA 5BSEA 1GAEO 1P1RA 2Y1FA 4WNIA 4IQGA 3S1LA 2PH5A 3PHIA 3MJTA 3BHMA 3ONEA 1E3WB 4ND4A 1E6UA 4EJ0A 1YQDA 2IE0A 2Q3EA 3INRA 2NQ8A 2DU8A 1UR5A 3O9ZA 2B35A 4R1SA 2QQ5A 5KJEA 4IZHA 4B79A 4CQMA 4DIOA 2VOEA 4DPLA 3GRPA 3D3EA 3ADPA 5IDWA 4HY3A 1LSUA 2I6TA 4J2OA 3VH2A 3UHAA 1HDRA 1H6BA 3E5MA 4BNUA 3AUUA 1UXJA 1Z6ZA 1LA2A 3L4BA 2JJYA 3KHUA 4A5OA 5DDIP 1SAYA 2AQKA 3E8XA 2X58A 3GMDA 2O3QA 2RAFA 3U3XA 3B20A 1N2SA 3LQFA 3HN2A 4JJGA 1R37A 2E37A 1XDWA 3L0DA 3SLGA 2CF6A 1YWGO 4NJMB 4YJGA 3P2YA 2CUKA 4WOKA 2J3HA 4E5NA 3SVTA 2EWMA 3AFNA 3BTOA 5HS4A 3UXYA 4JBHA 1DIAA 3LC7O 4GGOA 4C4OA 4JP3A 4BV9A 2EGGA 2YFQA 3W1VA 1JKIA 3WNQA 1SEPA 3H65A 1I3LA 3I5MA 4J3FA 2HMWA 3I83A 1U7HA 2B4RO 2GNAA 4LVCA 1DC5A 4DGSA 2P4QA 3QV1A 2QRKA 4WECA 1HE3A 5KKCA 4YQZA 1Q1NA 5TT1A 1Z73A 5JO9A 3RKRA 1BXGA 2EKPA 3WTCA 3NT4A 3COSA 4QSMA 1EVJA 2OL4A 2GN6A 3WS7A 3Q9UA 2B5WA 1HDZA 4RPJA 4CR6A 4YT2A 3GOHA 3L9XA 4GKBA 4UEKA 2VHVA 5JDIA 2AHRA 5JC1A 4WCDA 2B4TO 3OA2A 1J4AA 1PR3A 2I66A 2YW9A 4E5MA 2HRBA 2HDHA 4TRRA 1NXQA 1IPEA 3ANNA 4YJHA 4E5PA 3I6IA 1PTJA 1SOVA 3GPDG 1P0FA 3W6ZA 5H82A 3H8VA 1K3TA 1T4DA 4WCFC 3CXRA 2O3UA 1DJQA 1DJNA 3OJOA 2QW8A 3D4PA 3BMNB 3KBOA 4J7XA 3ROQA 3B6ZA 4FW8A 3AOGA 4XQ9A 4I5GA 5TS3A 1A7AA 3GVXA 3ETDA 4K26A 4K9DA 3F46A 2AQ8A 4CQMB 4ZA2A 2DTDA 4XD2A 1IPFA 1I01A 2E4AA 4BB5A 4PLGA 4AICA 1O8CA 5TRTA 2JCYA 1DAPA 3LDHA 3RU7A 2QZZA 4CMJA 4TVOA 1KC1A 2HRZA 2X8LA 1Y9EA 2W4QA 4IDDA 5KJ6A 1GY8A 5IDXA 5C5IA 1O9BA 4BNKA 3SC4A 2V7PA 5A4DA 2O50A 2R2GA 2NVUB 4CLXA 4PN3A 4RL6A 2DFDA 2HMVA 4LK3A 1LU9A 4RVHA 3QHAA 1X13A 4U7WA 2AEMA 1RM5A 4NJMA 1GADO 3P19A 4DL9A 2QRLA 3LK7A 1H5QA 3ZWVA 2X0RA 1XCBA 1Q7BA 3NTOA 3CINA 1T24A 2ZTUA 3OJFA 5TJ9A 4II2A 1YQXA 3JQAD 3ON5A 4CLRB 4J4BA 3OQ6A 4J7CA 5L7WA 2VUTA 3I9LA 3KYCB 1R4MA 1UJMA 5BQFA 3GZNA 3VKUA 4ALJA 5KNLA 3M2PA 2FP4A 1VJTA 2EG9A 3RC1A 4MVJI 1KYQA 1SZJG 2VHZA 1XELA 3PP8A 4H16A 4KQXA 5JCXA 1QP8A 2Y1CA 3VPXA 4MKZA 2JAPA 3PK0A 3ICCA 1X7DA 1U8XX 2HMSA 3GH3A 4IDAA 4FCCA 4B7UA 4NPCA 4MDHA 3JQGA 4RVUA 5HS6A 2CDAA 4F6CA 4ZQGA 5G4LA 2VNSA 4ID9A 3GC6A 1IZ9A 2DC1A 2DBZA 2GSDA 3BTVA 1FMCA 3NV9A 4OOEA 3W8EA 5KTKA 4JGBA 2WM3A 3DDNA 3PJGA 1DRVA 4O5OA 4Q3BA 2WTBA 3FF4A 4DYVA 1KY5A 5LC1A 1C1XB 1SO8A 1JWAB 4MKXA 5U4QA 3ZHZA 1ORRA 3EHEA 5L7YA 2Y67A 1YH3A 2O4CA 3ZGYA 1E3WA 2CDBA 3UUWA 3INTA 4O59O 3D3WA 1DRWA 3BYZA 2UV8A 3RUEA 1U8FO 3JQFC 5BT9A 2YJZA 2VYND 1LLUA 2R6JA 2ZKLA 5JAMA 3PZRA 1V8BA 4U6SA 4QT0A 1IHXA 2HMTA 3JQ6A 4ZU3A 4MJLA 1ONPA 4WLEA 2X5JO 2VZ8A 2VRBA 2OP1A 3RBVA 3H9JA 2HJSA 4UREA 1QV6A 2EHDA 2DUUA 5IZCA 4D7AA 1JTVA 1LXCA 2J3IA 4OXNA 3NDRA 3I9KA 3QVTA 3PPIA 4PRLA 1W6UA 1TEHA 3EY4A 4F6LA 5G0UA 5MDHA 4FOOA 1V3TA 4X54A 3VHRA 3PHJA 3OEYA 4E2XA 4NQZA 2VUUA 4GKVA 5BSHA 3OJLA 4NG5A 2O2SA 1OI7A 5CPFA 5IN5A 3ADOA 4IGEA 3QY9A 3BMOB 3NX4A 3ROMA 2YQ5A 2B4QA 4JN6B 4IJKA 2GZ2A 1K5HA 2P68A 4B7CA 3AK4A 1EVYA 1CEQA 1FDTA 4IDGA 3TFOA 4IDBA 3STHA 3GGGA 4LSWA 3HE3A 1OZAA 4BGVA 5DOZA 3GHHA 5TJHA 5ICMA 1H2HA 3IIEA 5DBFA 2ZYGA 1P45A 1UZLA 4N18A 2Q4BA 2CVQA 1PGOA 4DIBA 1L1FA 3D64A 1KVUA 1ZSYA 3CEAA 1DC3A 1HSZA 1PZGA 2JFHA 1J49A 4YRAA 3FBTA 4AJHA 1F14A 5EL0A 1ZK1A 4J9UE 4OJNA 1E5QA 2W2KB 4MP6A 1P1HA 2X6TA 3T7EA 3BXXA 4DVJA 2G1UA 3FD8A 3ANMA 1AHHA 1MLDA 3EMKA 3BMQA 3HZZA 3PFFA 3UCEA 4G65A 1D8AA 5A06A 3L4SO 4Z0TA 4JK3A 3OETA 2PKRA 3ETGA 4FBGA 5B4VA 2CF5A 3EVNA 1PL8A 3QWBA 2ZQYA 5KCZA 1A9YA 4RF3A 3U49A 2PD3A 4NBTA 3L77A 2IDZA 3R3SA 2GF2A 5F3RA 1E3EA 5C7OO 3MJCA 5JSFA 1NFQA 5ENVA 3JSAA 2ZCUA 4JJFA 2Q4EA 4J1TA 2GZ1A 2OMEA 1HKUA 1ADGA 3MWEB 3QWFA 4LW8A 3U4CA 4B3JA 2G17A 3C7CB 3R6DA 4Z9YA 5KKAA 4IDEA 4NBRA 4B3HA 4TSKA 1XSEA 5ENDA 1X0XA 1PJLA 1WPQA 3ZU4A 4GLOA 1LSSA 3FPLA 4BVAA 1BGVA 1T2AA 4HV4A 3IMFA 2VTEA 2FPIA 3NUGA 1Y81A 1HT0A 2BGLA 4U0KA 3W4IA 2EKQA 1KETA 3QA9A 4IGFA 4LCJA 1B16A 3BHIA 1XIVA 3H9GA 3IOYA 4BNIA 1O95A 1M75A 3G3EA 4A27A 5EJ2A 2WE8A 4JX8A 2VWHA 3AWDA 4MVJG 3IKTA 2WD7A 3JQ9C 5I7EA 2NVUA 3RC7A 4CODB 4FGWA 3NJ4A 1PWXA 2VRCD 3E03A 4OM8A 4DIFA 2D5CA 3FPCA 1E77A 4DTIA 3GNQA 1K6IA 4WUVA 3DXFA 1E7MA 1KVRA 2FSSA 3IAHA 3PWSA 4QECA 1LRLA 3ZDFA 4BGIA 4YBZA 1GCOA 4J0EA 3RI3A 1YBMA 4W4TA 1P1IA 2PZJA 3TWOA 3AJRA 1U2GA 4GPD1 4NFYA 4YCAA 4D79A 1P33A 1C3VA 3PYMA 4FFMA 1NASA 5JW6A 1G1AA 1VL0A 3E9QA 4CMAA 1U4SA 4HBGA 3GZ4A 3JYQA 2OP0A 3JTMA 4FOSA 5H83A 5IAAA 3O8QA 3R1IA 4BO9A 5KIAA 3RIHA 1R16A 3FWNA 3SEFA 3KSUA 3BMCB 2CY0A 3ZV3A 1QXSA 1YB1A 1NPDA 3T4EA 3AUSA 3OP4A 1ZXBA 3B70A 4Q3DA 2WYWA 2DAPA 1F12A 4ND5A 1YB4A 2DBRA 2BD0A 4P8RA 5KJCA 4BMSA 3JD4A 3U9LA 5C37A 1O5IA 5IG2A 3MZ0A 3V1TC 4E13A 5JMPA 2D2IA 4XGKA 2NUAA 5JDCA 1Z82A 3KEOA 1HDXA 4XGIA 1K89A 1GEGA 3HDHA 2P5UA 3V5NA 5HRUA 1SC6A 3GAZA 1LRJA 1PEDA 5ILOA 2WEKA 3F1KA 2D4AA 2VNAA 3B1KA 1DC6A 4S1VA 2DTEA 4W7HA 2VWGA 3ZU5A 1B8VA 4OH1A 2VHYA 4PG5A 1EVIA 3GNTA 5JPIA 5TC4A 3JQGB 4IY1A 1CYDA 1F17A 4R5MA 4BNNA 3VZQA 3DBVO 1GQQA 1JLLA 3DHYA 3EVTA 2C29D 1WLYA 3O4RA 1YRLA 1TLTA 4R01A 4HNGA 1R0SA 4OO3A 2X0NA 1LC3A 2WYVA 3TOXA 2F00A 2ZK7A
chains in the Genus database with same CATH superfamily
4FEGA 2F1KA 1G8YA 2AUTA 3DBHB 3OJWA 4Y2VA 3DNPA 3DC7A 1NYLA 1SIBE 3PXUA 1VB5A 3AI3A 1I3KA 1A9PA 1KJIA 2B61A 4IJMA 2E6KA 1Y5LA 3M4XA 1DFGA 1VSVA 1D2MA 4AJJA 2I2BA 1BSVA 2PZAA 3IP9A 1N6LA 2QD1A 2PFGA 1NP6A 2C5BA 3JQAB 4GZ5A 3OQMA 2BM1A 1RMYA 2CYAA 1CDOA 2BFOA 5KVQA 2BKLA 4F46A 2BISA 1L4BA 2ZSUA 1M6HA 3WLFA 1SU4A 4PVDA 1MQ8B 1M34A 1ADCA 1O6GA 1N92A 1VRVA 1Y3HA 2V7XA 1XG5A 3CRNA 1VKNA 2VH2A 3D2AA 3L41A 4HS9A 4B0OA 3X1DA 5F9HA 3TZLA 3FAZA 4M89A 3AONB 5D8DA 3E0QA 1UDCA 3AHDA 4U5QA 3ROEA 2CW5A 4Z4QA 3GA0A 1E6CA 4MUGA 3RASA 4BMDA 3RT7A 1V9CA 2PKCA 3C3XA 3RS8A 1TDJA 3B2EA 2QP3A 3MWJA 3PFIA 3MNFA 4OSOA 2E7ZA 5M7EA 4X6LA 1KS9A 4UE3S 1X70A 4HADA 3MGAA 1ZNXA 4DMFA 4K88A 5DM60 3R5FA 2KLHA 3I9V1 3DLPX 3R7LA 4IILA 3BXPA 5KX5A 2IOYA 1RLOA 1J70A 3UTCA 3ONVA 3AF0A 1A0OA 3R5SA 3D5QA 2JHAA 3CRQA 4K0KB 1PJ8A 3S7ZA 2CN1A 3NRBA 3EIEA 2WLSA 3LHSA 2CFCA 4C7JA 4XWWA 1AF7A 4UTOA 3MMNA 3NP7A 4B76A 3VYVA 3GW8A 1HZZA 2FW9A 3UC5A 1U3CA 4R68A 3QXGA 1B7GO 1I30A 2W22A 3JYOA 2ZDGA 3TQOA 2XD4A 4ONEA 4V2IA 5JJKA 1DTWA 3D1VA 1Z38A 1PNOA 1Z7YA 1NWHA 2K5UA 5KZMB 1XJ0A 3L06A 2ORVA 4FJ2A 2G6TA 5FUQA 5EQJB 1WXHA 5IABA 5JCZA 3TSCA 1I0ZA 1O9HA 3EXFA 3MXOA 3FTEA 1HTBA 1XN1A 1YZUA 3AVQA 3PXAA 4J0KA 2H17A 5THXA 3ELBA 2HXSA 2IOFA 3IT3A 4F3YA 5E8JA 4P92A 1GNPA 4NCIA 4Y1GA 4KJXA 4L2IB 2YVQA 3TL2A 4OOFA 3VU3A 2OV4A 2HWWA 5EMHA 3UXHA 2V65A 1HLGA 1U9YA 4XQEA 1C3OB 2ZJZA 3AW8A 1WXDA 3AB3A 4LZZA 3CNQS 4MW0A 3AL0C 4JY7A 3GEDA 1FFXA 2X3YA 2YJ6A 3OZRA 1HNXB 3K0BA 4AY4A 2OFPA 2YFYA 4P36A 4CF7A 2YWDA 3QELA 4HJRA 5K99A 3EEBA 1DTWB 1SU7A 2QVYX 4XFDA 4XYEA 3DAPA 3VR4D 3IHLA 4D46A 1ZINA 1TA4A 4G0VA 4DV6B 3TOZA 2PUJA 5FR2A 4KBYA 4PEVA 4JT4A 4QNMA 1EFVB 1PE0A 4I5EA 4JL6A 3GLVA 1P3DA 3KQWA 1FX0A 3QU5A 4II7A 4UMDA 4WZAE 5G1NA 1C8BA 3IQIX 1G1MA 4OL0A 4Q4AA 2PU5A 4NS1A 1T8UA 5ILGA 3AJ9A 1W581 3WGKA 4HZGA 3WLNA 1TKBA 3SJ7A 4DADA 4EJSB 5IHXA 3E1KA 3B1WA 4HPWA 3UHFA 4CPDA 4IUBS 2AZ4A 4L4ZA 3PIDA 1E5VA 1GPYA 3IAS6 1TGYA 4J6FA 1O96B 2PSJA 1P31A 4F21A 3FW1A 3EJWA 1A5AB 4U6QA 1G8GA 2G4CA 1Z45A 4DLXA 3CZMA 1UKVY 3S5JA 1I7SB 4JT8A 1A72A 3LX6A 4X45A 1RLJA 4J49A 4JBXA 2I03A 4LHEA 2WY2D 2JKZA 3HKBA 1HDYA 1OB5A 3MINA 4YUWA 1EGVB 1L5FA 2C2GA 2CHUA 3QU9A 4HCJA 4F4HA 4MB0A 1FDWA 1CLUA 3MYYA 1Z4IA 2D2VA 5B36A 3NOQA 5PNTA 1T2EA 1PJ3A 1X7YB 4RH3A 3QHQA 3EYWA 3ZWNA 1ARZA 4HNAB 4D0RA 4YJ3F 2PGOA 1NPYA 1ZVQA 2X2FA 3KQLA 4X91A 3RUAA 1B93A 1GRCA 3NGMA 1J0AA 2VJLA 3OEHD 2I7TA 3LZ6A 3QW4B 1ISHA 4Q9HA 4OGWA 1E9RA 2C0CA 3G8DA 3U16A 3C3DA 4V2UA 2AFIB 3T9EA 1QIIA 5AIBA 2R48A 4OGGA 2PU7A 3OHSX 4DJAA 4YO7A 1K7YA 1O4WA 1F5SA 2V7TA 2ZE8A 2CL7X 1C80A 4IL5A 1UMCB 2O0HA 4PSCA 1HNZB 1BXKA 4YP0A 4LXIA 1GEEA 3FNQA 1XEXA 4GEKA 1AV7A 3PDUA 2B36A 2OGUA 1U3DA 4OY3A 4IXMA 1OOEA 3MOGA 5KQRA 1Z68A 3OESA 3KDPA 1CJUC 2NO6A 2YMMA 5A3VA 3EXIA 5AW6A 3R7WA 1RIIA 1YR3A 1AD2A 2YZKA 2ZIWB 3I01M 3P1JA 3ZV6A 3D4LA 3LBAA 3OUZA 2O5CA 4UEWA 1JR3D 3K72B 3TLAA 4Z6KA 4U7FA 1HNWB 1SBTA 3YASA 4CIWA 2WG1A 1MFPA 4EM6A 3BULA 3R9WA 4MINA 2WQ6A 3G68A 2PJDA 2YRXA 4LMRA 3NDBB 5CLLA 4E1AA 3GH1A 3VAAA 1XZHA 3JQPA 4WEQA 1KIMA 3NHPA 1ZHOA 5EWMB 3L93A 3AW9A 3OPYA 2KBFA 4LDQA 1EPUA 4F71A 2XQGA 2XBUA 4ASUA 3QFFA 1CUZA 2V55B 4A1OA 3O6VA 3AVOA 3FLBA 1ZIYA 2UZIR 1M5RA 1A82A 2C5GA 4XVCA 3B3JA 3KCQA 4YPVA 4DV2B 2JGKA 1GUAA 2BRUA 2G63A 3JWJA 1VDMA 4LQLA 4XIYA 4JLSA 1JAHA 1Q1AA 4YP5A 4FHEA 4OLJA 1RXCA 2Y9PB 1HLDA 2GKSA 4V1CA 3KLPX 3ZWBA 3DTNA 1EWYA 2WDPA 3KQKA 1P9OA 1RRKA 2UVDA 3D0QA 3IAM1 3WAGA 1GFZA 5T57A 4Y0NA 1PS8A 4HGRA 5CG1A 5JMWA 2W71A 4NFLA 4LTNA 4JDUA 3D8RA 4RFSA 1NSTA 3RIYA 4EI7A 4EB3A 2APJA 3H5LA 1W1WA 4JSRA 2YYZA 1EFAA 4DKJA 1BMFD 1YONA 2JZNA 1H9BA 2P6NA 1QB7A 2UYYA 3BORA 3H1GA 4X00A 3VHQA 3WA6A 4BO1A 1T3LA 2EZ8A 4G4IA 3KV3O 2FOLA 4LJKA 5FV4A 3PGVA 1F2TA 1KO4A 4RKWA 3FDZB 2C61A 1JHAA 4TXJA 3CVXA 2YQ4A 5EFZA 2YWEA 1IL0A 3AHEA 1KK0A 3CUEF 4L28A 4B44A 3LKDA 2EZUA 5C81A 2HDNB 5H5JA 4ZJPA 4L4UA 3BXFA 3O1IC 2HQOA 5EHXA 4YRZA 3I6BA 3NYWA 1TUBB 2BGUA 3T06B 2CFRA 2C03A 2H2AA 3AY6A 3ETLA 4HNRA 4WNCA 4FM9A 3OOHA 2QNIA 2ZB2A 3Q8MA 1ZIOA 4HOYA 1KP2A 5IPFA 1AURA 3AEUA 4H2DA 3FYUA 1DEAA 2ZATA 4WLFA 4CV2A 1XZCA 3C8ZA 1DX4A 1T6BY 4OKIA 5D86A 4DWWA 5I8WA 2R00A 1JYSA 2N47A 4ZOLB 4BZPA 5KOHA 1Q1EA 5FPYA 3FSGA 3HJNA 3QFSA 5FD8A 5ALDA 1TVKA 9ATCA 2BJHA 5KYWB 4D3YA 1W4CA 1RJ9B 1Y8RA 3ACBA 3BL8A 4LE1A 1G41A 3E4DA 3B7PA 4NYIQ 3SKXA 2AW5A 5JYBA 2HUNA 3IR5A 1GZUA 1Q95A 4MQ6A 3HBFA 3R6LA 2SKEA 3X1ZA 3CLUD 1EFTA 4D3DA 4RMIA 3PIIA 1AQYA 3DO6A 3QYAA 4KQ2A 3JASB 1E3LA 3DL2A 3KQMA 4FU0A 4KN6A 4O33A 3P96A 1OI3A 1XQ6A 2VXOA 3F6EX 5J23A 4C3VA 2GK3A 1BD4A 2FZEA 1ACMA 1M54A 3TLMA 4HGQA 3SICE 2EHJA 3HN7A 1BDBA 1L4EA 4NOJA 4DTCA 3AUAA 4Y2JA 2GEUA 3K1TA 5IVPA 5M5BA 1N3BA 2LRHA 3ID6C 2A33A 2UZ1B 1TM7E 2PV0A 4M9UA 4DJDC 5MFZA 3KK0A 5EXDA 5KNBH 1R12A 2OQVA 4ADSG 3PFHA 4J2HA 4L27A 2HBQA 1FTQA 4R8SA 5AXDA 3GUVA 2AT1A 4UJ5A 4R51A 1OH7A 1KZ1A 3Q85A 4OP1A 3WSVA 2PRYA 3NT2A 3FIJA 3ORYA 3TOVA 4ACAA 5JOQA 1CP2A 4AZSA 4N01A 2OM6A 5EI5A 3UG7A 2D5BA 3DHWC 3MEQA 4ND2A 5KU1A 3FUWA 1SK9A 2AC2A 1CETA 2P7IA 3PJDA 1E61A 4CDGA 2JGIA 3G17A 4KQWA 4CF3A 1LJLA 1BMFA 1GZ5A 1QFZA 3C6ZA 3N0RA 5CJPA 2WA2A 3LI2A 2DWUA 2R65A 2ZIXB 4YIKA 1X19A 4UCWA 1XA4A 3V4SA 2DSNA 5ILQA 5F5XA 1Y5MA 1GARA 4ZO6A 4EKEA 5ALEA 1R8XA 1O9GA 4R40A 1V7PC 1BQEA 4L3WA 3RC3A 4C07A 1B6GA 3R5KA 2IOHA 4LDNA 3T7TA 1FMFA 1P1KA 3JRNA 4EA6A 1QBKC 3OFNA 4MQBA 4NEGA 1GZ6A 5HZKA 1CR4A 2Q3JA 3QVUA 2F8LA 3D8NA 4QU9A 4DCUA 2IJGX 5FAKA 3THWB 1Y3BE 1Y5IA 1E2IA 1RM3A 2FHSA 2NU7A 2QDXA 4L7VA 4MW7A 4RPHA 3RR2A 3TX6A 3EXIB 4ZHQA 3A4LA 4G0ZA 3RUDA 4PZUA 1C0LA 3P5SA 1HA3A 1C8KA 2LPMA 5A5EA 3U5TA 4KDFA 5E6RB 4BO7A 4UEJA 2DSTA 4EJSA 1FFGA 1T1SA 4G5OA 2D5LA 1E2GA 1MX5A 3E23A 1A5ZA 4BASA 3I9MA 3PFNA 1TC1A 3BHJA 4KPUA 3JVVA 4LRSB 4AP6A 1SELA 4EB6A 3ZJUA 3RYCA 3ZWMA 2L69A 1K75A 5G0WA 1K6MA 1NR1A 4Y1EA 3CO0S 1ZS9A 3IEIA 4PX3A 3OBIA 2JBHA 4S24A 1KAEA 2R3SA 3BC1A 3RSQA 4N3NA 5K4AA 3RVBA 4FW9A 3DT6A 5MF6A 4YRCA 4I55A 1VOTA 2ZUFA 1YAHA 5HVNA 2ENUA 4QRDA 5DSXA 2Z8XA 5TGDA 3C5EA 3EK2A 4V3CA 4XXHA 1G5RA 1Z63A 4B45A 1Y42X 3DH0A 2PVCA 2RK4A 3PV0A 1EUDA 2Q6OA 2C3YA 3FVWA 5AVXA 1X42A 3I9NA 1U6IA 1FVFA 1IWBB 2AR0A 3L4BC 3IVMA 1YA8A 2HC9A 6REQB 3O1LA 4BS9A 3P52A 1FY2A 6AT1A 1QCZA 2ZBRA 2XMPA 4JUBA 5KQLA 4LHYA 3EZ9A 4ZCPA 5I7RA 1W1IA 2V5AA 4PU0A 1TF7A 3P9XA 3TZCA 3JRWA 3OWHA 4G4SP 5AIAA 4NBUA 1UFVA 3Q9SA 2WUFA 2UUAB 3VDMA 1IHDA 1MN6A 1KKUA 1LDGA 1U9IA 1CDEA 2EOAA 2YN2A 2BE9A 3M9XA 4XVHA 1AUPA 4HLUA 4OL9A 4EKNB 1SULA 3CH4B 4O6VA 2HJHA 4LRTB 4NBLA 1BHO1 5A62A 1XNQB 1HRKA 1I33A 2ZJ7A 3EJ6A 3GB9A 4KKXB 3LWNA 4OBWA 4GE0A 2WSSA 3L01A 4IZIA 5DTJA 1K06A 3RHTA 3MQ2A 1QTQA 2HWYA 4JJAA 1BE8A 4PX9A 4X20B 5I47A 1KO5A 5JVDA 1TFRA 3JQ8A 2OBYA 1QRRA 4QBHA 5ESWA 2A5FA 2QHXA 2DR3A 2Q49A 4MYHA 4YUVA 1KZYC 3U7FB 4QC2A 2R87A 4YP9A 2C7PA 4Q1BA 2YIVX 4MQ4A 5A9TA 3RU3A 1P80A 4Q9DA 4Q4HB 2AMFA 1G2PA 2NTJA 3MJ4A 4NDZA 4TRMA 2J09A 5CXSA 1MH1A 1R66A 4UM5A 3QXCA 1WW2A 3PCXA 4NICA 1SXJA 1I6WA 3LUCA 1VKOA 1JKJB 4ZVTA 3ND8A 5EZ6B 3D7NA 5GADl 1TI7A 4GPEA 4BMNA 1ZIDA 2DWCA 2XDAA 4EHDA 2XUOA 2IHUA 3FCOA 2OAQ1 3HSKA 5FI3A 4JIGA 3RTEA 5BORA 2IGTA 1DC7A 2ZJ3A 5IZ4A 1RKXA 3IE0A 1WDLA 2HBYA 3NH9A 3WKAA 3AUYA 1BFKA 4O1HA 3PLAE 1XTUA 3VU8A 4TMFA 3PDIA 2FR0A 2PKWA 4MLDA 2VXBA 1HDOA 4AY5A 1Z6TA 5FHQA 4AIIA 5A9RA 2O8CA 4MGYR 4ZN6A 4WGGA 5AI6A 1XD2A 1VJ5A 2WHPB 4RJLA 1ABFA 3IHTA 3UWKA 3V9AA 4DXAA 2QUZA 2JGRA 2O8FB 4CKBA 3TINA 3K92A 5LQAA 4EJMA 1YJXA 4IDNA 1OA1A 1PT7A 1B43A 3K0FA 5ALUA 5KAMA 3ZHOA 3FM9A 3ZDQA 2ODTX 4M46A 2PX4A 4OHPA 3VO9A 4HPXB 3TEJA 1K5DA 4BV2A 3OUUA 1I4EB 3LBIA 4H9GA 3O31A 1LGYA 4OXXA 3PSHA 1XWWA 2YJGA 4L73A 2B4YA 3C4QA 4OYYA 5JWOA 2X0IA 2C2XA 3F5SA 3QOFA 4RHXA 1YXMA 3I52A 3N8IA 3O3CA 5CU7A 4RTJA 3GJZA 3Q1KA 3LWZA 3VPHA 3AESB 3H2IA 4DLVA 2QTAA 5JC8A 3PC8C 2LD4A 3VPFA 3E81A 1Z06A 1M6VA 3LUAA 4BLTA 4A15A 2IUYA 2Y0BA 3QKUA 4P6VF 4GOJA 2Q3DA 5CT6A 3NB0A 3PC6A 5EMJA 3WYBA 1MXFA 4ZAZA 4C08A 1A8IA 2H7VA 1W4RA 3O7WA 1A50B 4CUZA 4UNQA 4RH1A 2M1XA 4S2EA 5AJUA 4MV0A 1QAOA 1OF1A 2OA0A 4HDKB 4W5RA 2CVZA 2IKSA 3WGHA 4A73A 4GMDA 4Z1OA 2ZTSA 3EQZA 3K0EA 1EFPB 4QDJA 3MWDA 5BOVA 1XFAA 3DNFA 2HA7A 4K9PA 4MWTA 1V8DA 3F47A 4TRNA 5EG5A 5ERXA 4OBEA 5A4FS 5CG2A 2JJ8A 1I7NA 3GK3A 4RZUA 1NI4A 1VPEA 3LBNA 4TTQA 4H7IA 1JXAA 3RHZA 3DMHA 2CXSA 4QQNA 3U62A 3ESBA 3JQDA 1U8YA 3T61A 1P44A 1X92A 5HQ3B 5H0IA 1IBRA 5JCOA 3GFSA 1NJ6A 2XIQA 4WZBA 5U9CA 5LA6F 2OYRA 5CFLA 2ID8A 2QTCA 5CX1B 3KOOA 1AGYA 2HD4A 2D7DA 3L0IB 1NQWA 2FPPA 4Y3UA 3MS7A 5K3OA 2TMGA 2YQZA 4DQDA 1BH2A 1RDFA 2FSHA 2ZWOA 2IEGA 1R9NA 3A05A 3KWLA 5FFFA 4B5LA 5J59A 1V4VA 2R8OA 3SS7X 5TPWA 3RAFC 3D2BA 3F8TA 3LUPA 4Y30A 1JKMA 2BFWA 3EISA 3RF7A 3RRBA 4C7OA 4Q47A 4QA9A 4C0BA 4CL2A 4BUCA 4JS0A 2C04A 3QK7A 4GBED 3DFUA 5IAGA 2M6KA 3EXAA 3MTGA 5G2OA 2P6MA 3TTSA 2ZRPA 1IWOA 1JW9B 1KPHA 3WLPA 4C6RA 3HO1A 5F1OA 5DGIA 2CLHB 2E4ZA 2PL5A 1YVEI 3CT6A 1JQEA 4D3FA 2NZXA 5JISA 1R9GA 2Q3BA 3DDSA 3PLRA 4A8JA 3GEMA 3W6OA 3F4LA 4X6UA 4YASA 3FROA 1V4BA 3X1XA 2EP7A 2RIPA 3SQOA 1SKAA 4OGFA 5A7GA 3TLGA 4LVUA 3K0KA 5JANA 1PIWA 2X9VA 5E1OA 2CLCX 2DFLA 4CMEA 2V6FA 4MW9A 2NUPA 2Q2WA 3MMZA 2QTZA 3D7LA 3GZNB 1DC8A 5UKDA 1N1EA 1C4WA 1L9XA 1XU7A 3LY9A 4QREA 1N2CE 2YMPA 3CZQA 2B3DA 2ZIGA 4YC7A 3S4YA 5F2EA 3WLIA 2EZTA 1CLEA 1VZ3A 2GMWA 4D2IA 1PYDA 4WAUA 3UQZA 3G82C 1QC5A 1X14A 1WY5A 2XZLA 4M7WA 2RGBA 2O07A 3B85A 3MHPA 2O2YA 4NZMA 2Y0CA 4F9GA 2EQ5A 2NSLA 4EB6B 2NLOA 2X4GA 1EFUA 3C1AA 1BNCA 1CF2O 3CMMA 3GROA 3KVNA 1X2EA 5D5QA 5AW9A 4K86A 2CEAA 2PQ0A 3B8HA 1D4FA 3DMTA 1W94A 1PBTA 1XBTA 2PMCA 4HDSB 4HRYA 5IUKC 5AW5A 4B82A 3BWEA 2NXCA 3IDOA 3NNSA 4JCOA 1V47A 3ZU2A 1P7CA 4YV2A 5K0LA 4BQIA 3N86A 3KUXA 1VTKA 2V03A 4IMJB 4K28A 1H1TA 3ZK7A 1F8UA 1MENA 3MCZA 2XPCA 1S2MA 1QIGA 1Q3HA 3HYLA 4LDRA 4QPZA 3FTDA 1T8YA 5FPSA 1QQBA 3HU5A 1OHHD 4J7UA 4RZ2A 4BU0A 4DR4B 4DB4A 1P2DA 1RI4A 3RUCA 3SZOA 3NPMA 4ZU6X 5IT0A 2ODAA 3EWNA 5GIPE 2YXNA 3X1YA 1XEWY 4RTOA 5BV1A 3OM9A 3GLGE 2WIAA 2AD1A 4WBXC 4QGHA 1Y8CA 1H9AA 3I8SA 1CDZA 3CUTA 4KXXA 1Y4AE 1WXQA 5I4IA 1TJ4A 1Y9ZA 3P0JA 3WFIA 1ZZGA 2ZVJA 1X7ZB 2BELA 4MS1A 5COAA 1OI2A 3S2IA 2RKWA 4ALIA 4B1FA 5JNSA 4X65B 3AI1A 4HDAA 1R0ZA 1T3HA 1TM3E 4MOWA 4GPBA 3UNXA 3RYCB 2WKRA 4J1QA 7YASA 4C9BA 2QG9A 3QENA 3SS9X 4UULA 4RZ3A 3V55A 3IV6A 3CZAA 3E9MA 4YRBA 2IS2A 4PM4A 5JZMA 3RREA 1VHLA 2HSEA 1X80A 1TU3A 1BZYA 4HVLA 3LKBA 3BWXA 1QGDA 1BDMA 1E4YA 1ISIA 1GQSA 1Z7GA 1CIPA 1AZWA 1LPNA 2A1TR 2UUOA 3L2OB 1PWYE 3DO5A 1ZGBA 3ZJ5A 1W30A 2VDRB 5B3JC 1E2KA 2OO7A 5BWMA 4OPMA 3MWLA 3CWCA 4ZAYA 2BGWA 3NETA 3QEMA 5FDFA 4FXPA 1QFSA 3DMRA 2J8ZA 2GRJA 4DBZA 3QZUA 2PXXA 1N5KA 3H05A 5ECGC 1CJMA 3HI6A 1E3QA 2F43A 4MVJA 3M9WA 3PPXA 1S7GA 5HDBB 4AJKA 3SNHA 5A6VA 9LDTA 1S3FA 4YT8A 4BP1A 5JCJD 2OCIA 3HDTA 2VSOA 4TTTS 3CGWA 4XOIA 2J3QA 4WN9A 3C3EA 3R9IA 2PPVA 5J2TB 2IXTA 7REQB 4ERXA 1ICEA 4GI7A 3FVRA 4IS2A 4B9EA 5JEDA 2OD9A 2FPMA 4AMYA 4DG5A 3WBFA 1ENPA 3QU7A 3ELDA 2ZSIA 4HDRB 3T3MB 1W59A 1XJ5A 1CUDA 2AOUB 4KZPA 4RM3A 4ROSA 3RF6A 1ZOIA 1MP0A 2ORIA 2VJOA 3PITA 5DMXA 1U2TA 4KSYA 5FPQA 4UU8A 4JXXA 1SQSA 3LC2O 3LUDA 1YDHA 3QHPA 2LDBA 4HQ6A 1USGA 4KLNA 1X7XA 2A5LA 5DP1A 5EHNA 3ZGXA 1L4GA 2F4VB 2P0AA 4MS3B 4QYSA 5DHUA 3RRFA 1X1BA 1HT2E 4EGAA 1VHTA 4B3FX 4Z4FA 1ULSA 3L8FA 1KTVA 5C35A 2J6CA 4IIHA 2HREA 2VYQA 3VXKA 2QBYA 4RHEA 4YCLA 1ZW1A 3LXXA 4B3RB 4DV0B 4KUHA 3TE6A 5J58A 3G8AA 4TZTA 4CDRA 1SA0B 3JZMA 4Q4LA 1Y82A 4EL5A 4RYLA 1UWKA 3UATA 3CXUA 5F5LA 2N1BA 5BSMA 3PQ6A 5ARBA 3MCUA 4AAYA 4C2UA 1TJNA 4BO4A 1UANA 3IS3A 2E4WA 5B64A 3MD9A 1SVOA 2LCIA 1SCIA 1U5AA 2IP2A 3DZIA 3GUHA 3F4BA 4AS1A 4CGYA 3D7KA 2IVZA 2FQ1A 4KWIA 1V8PA 3GVIA 3MINB 5I7AA 3RFXA 1LLFA 4ZCLA 4UNPA 1TEZA 1BS2A 2O23A 3Q88A 1P9LA 3D8HA 2WA1A 1IQPA 1WMAA 2QL9A 1PDVA 4AYXA 4WX2B 3JR7A 2WJJA 2C2HA 1EU1A 1UT5A 4U2GA 4ZOLA 5C32A 4X7RA 3X2SA 1NF3A 2B5VA 1BE6A 2YH2A 3GO4A 4C3ZA 3B5IA 3EIFA 4DZRA 1B6SA 2WM9B 4DREA 4EGFA 1N77A 2ESRA 5EWMA 1GPMA 3DOCA 1DKNA 4PRKA 3MUNA 1Y80A 3FFAA 4MWDA 4UPVA 1VJ0A 2C4KA 3DBOB 3BGWA 2VAWA 2HKIA 1OXUA 3G49A 3AM4A 5LP6A 1MCZA 1L5VA 2OM2A 1QYWA 4OCZA 2HQ1A 3DZFA 3FHJA 3WMEA 4B43A 5IEJA 4ZPJA 1JA1A 3L0YA 4WADA 2OB1A 3W6NA 5DNCA 1XEAA 2JFUA 1GGKA 2VDJA 3HMQA 4FDMA 4AZVA 1SXPA 2I3GA 1JAZA 4YGXB 1JBQA 4R83A 4B6FA 4G24A 1RU3A 4I4TB 4CL8A 3T1YB 4MKIA 3VR0A 3DBLB 4MI6A 4OGLA 4DY4A 2IOFK 4A26A 5CM8B 3BILA 4GRAA 4FWTA 1EEHA 3GX1A 4IR7A 1U0JA 3NG1A 2I0FA 3WYGA 1M9NA 2JGMA 1N6KA 3JYNA 2OCLA 2QLTA 2Q7OE 1DBIA 5TPWB 4NOMA 4KMSA 3UUFA 5D6OA 3ZC3A 5JSKA 5SZKB 5EYPB 2AZDA 4JASB 4TUYB 4JI7B 3BIJA 5JY6A 1X1QA 2MR5A 4H59A 4L4XA 3U4DA 3AJAA 4L6IA 3WBKA 1I2AA 5DSZA 3U17A 1YMQA 4LXQA 3II6X 2EKDA 3OP1A 1J99A 3PFGA 1RYNA 2B2CA 1KEPA 1U8CB 3CG4A 5HTOA 2WSIA 4RQAA 1IZ8A 1Y3AA 3ELYA 4FR0A 4Z8XA 4AX4A 5KHLB 4I4LA 4MQEB 3QBEA 3DV0A 1T26A 3OICA 2SECE 4RHUA 5I7SA 5IDQA 4FSDA 5LBIA 3REGA 2FRDA 4INOA 4OK3A 3RFCA 3NVMB 2YWHA 2O54A 4BNWA 4C4SA 2WFLA 3U2QA 2C9BA 1KEVA 3FIUA 5ED4A 1LCIA 4QG7A 1TA0A 5HW0A 4R1PA 1FJHA 3C8DA 3HUDA 5F7OA 1MA3A 3P2EA 3S2EA 3QW2A 1C41A 1G9TA 2R7KA 3GGSA 4G36A 5EZYF 2R4QA 1WZEA 2M6LA 3TW4A 1U6JA 4CM4B 3TVDA 1N6RA 3WNZA 2OD2A 3L7NA 3NBKA 3S6JA 3K2IA 5JNTA 4LJYA 5AXBA 2IZ0A 4JROA 2FWNA 4EO4A 4BQOA 1N2OA 2Y2UA 1PUJA 1IJKA 1GLGA 4BLQA 2GZ3A 1CVIA 1MUUA 3PQDA 4C4ZA 5DI3B 1VCMA 2GPJA 5KNCA 2QV0A 5L9AA 3UAZA 1CQXA 1U9CA 2RGWA 1PJQA 3RYIA 5KNCD 2ZUTA 3RTBA 2VZEA 3ROXA 1SIOA 1UC9A 3LHFA 4UCFA 3HG7A 3REOA 1NVVR 3CEHA 4EKGA 3A3NA 4KDCA 1VG9B 4RA9B 4DA8A 1UADA 1IOZA 2CE7A 3NYIA 1Z4PX 3R5TA 2QU7A 4GFDA 4P3XA 4QXPA 1E9VA 2A14A 2WF5A 4U0JA 2CLSA 5DHFA 1YZYA 1TT5B 4MUFA 4JJKA 1UMBB 5F4ZA 1ZJ6A 3WGGA 5DI9A 5FWNA 5CD1A 3THWA 3KR1A 4MW5A 3HA3A 6REQA 3G89A 5KJFA 1ST3A 4I8XA 4CMHA 3N53A 1M1YE 2E48A 4HEHA 3WRYA 2XDWA 2DUWA 4M0PA 3HBJA 3MT9A 3SBXA 1HK7A 1JR6A 4X7MA 4DQUA 3WKEA 1G3MA 3K09A 2G8LA 3QKRA 2OZVA 3J7TA 3KXIA 2HU8A 2FY8A 3MOIA 2Q5OA 3OG9A 2R1VA 2QLFA 3OZXA 1FQOA 3VR2A 4B09A 1QR6A 4B0PA 1EXVA 3H9CA 3ZI0A 4LV8B 4ZQBA 5H80A 4B35A 1NVDA 2WICA 3TQRA 3ZV4A 1CUYA 1V9LA 3RTDA 2FR8C 4FI3C 4JITA 2QAIA 2RI6A 4GLBA 4RGQA 4DLPA 4UAVA 4EJSC 1NJ1A 1L8OA 5FBZA 1ZGAA 1AGPA 2BAGA 2Z5LA 1M8GA 4MQ5A 4R0NA 5FXMA 1XUOA 3HJBA 5BT9A 1YU6A 1CE8B 1GU1A 3WL5A 1GPJA 1F7VA 3A6GA 1ZEJA 3TZHA 1L5HB 1L4NA 5BMVB 4GSLA 2BFEB 4LOKA 1XF1A 2B9VA 4V0OA 3H2YA 4A2WA 1ZPDA 2YV2A 1DWPA 1EX7A 2BMJA 1E1KA 2XB9A 3QOYA 3GN2A 4Z8YA 2W2LD 4ENRA 1KS2A 5JTTA 4B4OA 2IS1A 4UM9D 1JQLB 1O0SA 4M37A 4P0TA 2YJ3A 2D1YA 2RAPA 5FO1A 2NU9A 4Q15A 5DK6A 4LDJA 2ROQA 3BG5A 3UGJA 4MMYB 5IT9A 4CT0A 1ISJA 2IVFA 1RRMA 5GQSA 2FR1A 2GZAA 2YWGA 4ZAVA 1RXWA 4A6PA 3QXHA 1T3TA 4PRYA 2GBPA 3B3AA 4UHCA 5CP8A 5HM8A 1PR2A 3PEUA 1U2QA 5EVCA 3B7GA 1X7WB 3AVUA 2GASA 5K5EA 5LIPA 4BCCA 1M2WA 2R4UA 4L0QA 4DCOA 4TVBA 1FNMA 3BXOA 1DZIA 3BH6A 4Z49A 2WE7A 1RC1A 3KXDA 5A4MS 1RWXA 3WMFA 1Z18A 1BMDA 3D3NA 4JDPA 5CGZA 4IAOA 1SVLA 3ZQJA 3RYFA 1ZH4A 2Y6UA 3QWAA 5AXCA 4E5UA 1FSGA 3G2LA 4KE9A 3WWZA 4BNDB 4ND8B 4AP9A 3WGJA 3BFJA 3ZJYA 2W8BB 5BNWA 1XO1A 4Y2PA 9MHTA 3D4OA 4ND3A 4Z7NB 3I6QA 4FYYA 1NW5A 4MVJM 2DCUA 3CVVA 1WW8A 5CB8A 1JR2A 2HU7A 4MPJA 1O58A 1NM5A 2CNWD 2QZ9A 5ESXA 2FEWB 3VJKA 3VVLA 1L6RA 3AR9A 2DHDA 2OHVA 1BROA 4MZDA 3SZUA 4DT1B 1V16B 4AW9A 3HYRA 5H68A 4BTVA 1VHDA 2PEYA 1TMKA 3ZDRA 5JFOA 1YZHA 1UWLA 2C9ZA 4Y2HA 3F7MA 3TJRA 1VPTA 1XP8A 3EXHA 3LDAA 4JOBA 2EKBA 1F60A 1TOAA 1E1LA 2XMSA 5FWAA 2XUPA 4QUGA 1OXVA 3QY0A 1CR2A 2H2GA 1CJSA 3TR6A 5CNJA 1Z17A 5AJHA 1A77A 2YHBA 1V11A 2WAOA 4WW0A 3W06A 4BYMA 3EGWA 2QMQA 2E49A 3GLQA 4WZAA 2VAMA 1KKLA 4ES6A 5H9VA 2BGMA 3QPUA 3UJDA 4Q6BA 5EWLB 2GF9A 3LTNC 4CT5A 2J41A 1IBKB 1RHKA 2FWAA 3QF7A 5CYGA 1QCCA 4JX9A 1YGYA 3OI7A 3ZCXA 3V3TA 5AVVA 3ILVA 1QG6A 2XSZA 2JGFA 4CLHA 1YHZA 4JVLA 1SHKA 3EXG2 5HCIA 5IJ0B 1XMOB 5CX4A 3JQAA 2HSGA 1KMHA 3HP4A 2FPUA 3V1NA 3FOEC 3DVAB 3RAGA 1QHHA 1AKNA 1QHEA 1DJMA 3PUIA 1B26A 3HXLA 4ANFA 3STUA 1P17A 3NNNA 1UOEA 2DXIA 1MD9A 3AR7A 4WK6A 5K03A 3W3AH 3V4OA 4EYGA 3GIWA 4ALKA 3F2IA 4Q7MB 2C00A 2DETA 4GLLA 5JD6A 3WBBA 4D4LA 3W2TA 1YB2A 3X1KA 5GM1A 3IVXA 4L9SA 1W2GA 4KE8A 1VYTA 2V4ZA 4PIMA 5B37A 5I9TA 1QH1B 3WYNA 4LC9A 4YRKA 4OU5A 4QWMA 4MMXB 4TYMA 2MMCA 2AFVA 2P8JA 3EGCA 3GDGA 4UAUA 2FLVA 3M4JA 3MD0A 3H5IA 2QM8A 5K3BA 2FPLA 1CVRA 5IF3A 2FN9A 1TMGE 3A06A 3OY2A 4QOJA 4E32A 3DOEA 2XCSB 3T1OA 3EPLA 4J0DA 1QIFA 5AKYA 5A05A 3MJDA 1UMCA 3NHMA 2CLFB 3SXJA 4ZYYA 2JFGA 3L7MA 3LT0A 3ZWCA 4MQLA 4KSCA 2BHLA 4G5QA 1ZD8A 4ZVRA 4RK0A 1K98A 1K97A 4COOA 5BV0A 2D62A 2VP0A 1UH5A 1ZNWA 3CUUA 4A0HA 3K0SA 5DGCA 1OU4A 2YWBA 4JMPA 2C1XA 3K5PA 1ZICA 2HDWA 3N2EA 3CZ4A 4I4TA 2ET6A 2GUGA 4D02A 5CA1A 3KPUA 2YJ4A 3VZCA 2PO5A 2FZLA 3JWHA 4KE7A 2OFFA 2AYYA 3ZWYA 2WPDD 1J8DA 3PR3A 3LG2A 1ORTA 5AQ1A 1OMOA 1R4NA 4RKRA 3RIEA 3OJEA 1UZUA 2I2AA 4A2CA 4YDSA 4KITB 4FVTA 3OSZA 4NCKA 1TUGA 2IYUA 3K2BA 3SQNA 1CQJA 1N5DA 5GVRA 4G67A 4XFJA 5K4GA 3WWEA 3LC0A 4A0QA 1UMBA 2YN0A 4AN0A 3SU8A 4CBVA 2CXOA 5KHAA 1FUYB 1A3CA 1MB2A 1XZEA 2C7QA 4RLHA 4BMXA 4JGGA 3OO0A 4IH4A 4RPIA 4U7PB 5ISMA 1FJGB 2ZIEA 1PFUA 3VNBA 7AT1A 1AKRA 4PG6A 4MEBA 4RY8A 2ZIZA 3HNPA 4XB2A 2CXQA 1JZTA 2DT8A 1V11B 4TT3D 4OYHA 1K7XB 3K6SB 4TTAA 4C0SA 4ARIA 3GVHA 3RTAA 3A9SA 4JOCA 4KO1S 1KU0A 2DFNA 3CRW1 4NH4A 2HHCA 4WK0B 4ZAWA 4EO9A 1PQUA 1AHNA 1KAHA 2D13A 2J30A 1SJ9A 1RQXA 1NFRA 3N6VA 5AVOA 3TAUA 3DOHA 1GAWA 4BNGA 3CV3A 5LCXA 4Y8VA 2X3UA 3INYA 4LDAA 2HWXA 2AMJA 2BFBB 3PX2A 3QE9Y 1XRJA 1YA6A 3HJTA 2O0LA 2W37A 4QSHA 5HIMA 2G07A 5ALFA 2OORA 2AKYA 3PDIB 5JXWA 5ER6A 1T25A 2Y27A 1F38A 4M99A 1TYBE 1AO0A 1CX9B 1UBTS 3BJIC 1SCJA 3SXUB 2BI8A 2PTGA 5FWXB 3MCTA 2PWYA 4RC9A 2ECPA 2W70A 1J8YF 3H6GA 4O3MA 2NPIA 1T9DA 5JCOC 3E9RA 2FPGA 4DCGA 5CT4A 3PJEA 5T67A 3ROKA 4P86A 1JHUA 4S3MA 5JATA 3FWYA 4EMUA 1MAUA 4ESOA 1ZD2P 3ETEA 1QV9A 1UJCA 1YRAA 2A1UB 4JGIA 4HEA1 4XJVA 4B6OA 4DMRA 3CA8A 2ZSAA 3GFQA 2GCEA 3FFBA 1FU4A 3TLYA 5AVQA 3KVRA 4S05A 5DN9A 1U9ZA 3TKAA 3RHFA 3N9IA 8GPBA 3DT8A 2ZR7A 4QFDA 2ZTVA 3BVPA 3TW8B 5LXTB 4Y6GB 1EXDA 8OHMA 3P9YA 1SUSA 1XA0A 1YNSA 2BDEA 2JVJA 5TQJA 5HJEA 1VE6A 3EDOA 2Q1TA 1J0BA 1UBSB 1IBMB 3QE3A 4EPXA 1Y3IA 4U39A 2ZETA 1I10A 2C3OA 4PS0A 1CERA 1NQUA 3QX7A 5A7FA 2XNKA 1E5LA 4HTFB 3TFQA 5TY0A 1I2DA 1G6KA 1GTRA 2GXUA 3RS2A 1KDYA 5T7BA 2W2TA 1NE2A 3FA2A 4AN4A 2XJ4A 1U3WA 4A5SA 3LTEA 2PAAA 3PXEA 3NLLA 4NYIR 1QH9A 5BRJA 2OC4A 1UEJA 2ZUEA 5I4CA 1HTTA 1T36A 1FUIA 1Z3IX 3ELWA 5CUQA 1ZM7A 4FFOA 4CLOB 2CVPA 1SY7A 2GR9A 2QSUA 3A4TA 4O4JA 1UJ5A 4ZEVA 4NX2A 5AVWA 3HVRA 2WM2A 2O06A 5D01A 1RXSA 5LQNA 4ITVA 2NP7A 4JC4A 1Q0UA 5LYYA 4RS4A 3AUFA 1HE4A 5C8YA 3VSDA 2GHQA 2GFQA 3T0FA 3TM5A 4EA7A 5EIAA 2O7QA 3QVKA 4IVNA 4MB6A 1L4UA 1KMCA 1CZLA 3X2EA 3NTQA 1UK7A 2FSFA 2EQBA 4M9ZA 4JU8A 4GYJA 2FFHA 3HB5X 5HJ2A 1TK9A 2CLOB 1JEOA 2QAGB 3E35A 4XB6B 4CV1A 4AG3A 1XJCA 1E4OA 1JQAA 3RDPA 4HWRA 2P9TA 4YCBA 3GLFB 1CEYA 1JYEA 2ZPTX 4IIVA 3T3IA 2JIZD 2QMEA 3DOFA 2VQ3A 3ZLVA 5C18A 1S2NA 3DL7A 4GC9A 3WYDA 3ZIDA 4LF4B 3NVKI 4S04A 2WJZB 3KJEA 2YV3A 5C5EA 4CCWA 4FYVA 1E1MA 3E58A 3IXMA 3JSXA 4TKLA 4YCSA 2FVXA 3RQIA 2GAJA 1GUYA 3DAHA 2Q2OA 2Z6AA 5DX8A 3NHBA 3R40A 2NTNA 3CNOA 5DT2A 2WWXA 4BNXA 3PXXA 5AJVB 4DS3A 4Z7QB 1FLAA 3VOBA 1JEYB 1M2HA 5EAIA 2FWPA 2A88A 3CE9A 5AI9A 1OC2A 1USKA 4XOUA 4NNPA 5AVUA 1RWOA 1J6UA 3RO7A 4YT5A 4KMMA 1X15A 2BMWA 3DO8A 3K5WA 4OHVA 3WL8A 4IX1A 3A6EA 1H2YA 4WZ6A 5JRZA