The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
96
|
sequence length |
255
|
structure length |
255
|
Chain Sequence |
b'PLQENKDFYILDTHTQKKISFEDMILELLKADVILLGEKHDEVKHKISQVMIFNALEGNLSSQNINFDVALEMLASTEQNHLDKAFKNKKTIKANELTNALNWDKVWKWKDYEQFVNVVFYSKSKILGANLSRSEITSIYNGAQPLKGYVSTTNEVKKQLFDIISLSHKLNPEENKELLDKLVEIQQFKDRRMADVLVHHVNKVLLLAGSYHTSKKIGIPLHIQDFKSSKKIVVVNLSYGEIDLKDSDYVLIYKG'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Cofacial Heme Binding is Linked to Dimerization by a Bacterial Heme Transport Protein.
pubmed doi rcsb |
| molecule keywords |
putative lipoprotein
|
| source organism |
Campylobacter jejuni subsp. jejuni
|
| molecule tags |
Transport protein
|
| total genus |
96
|
| structure length |
255
|
| sequence length |
255
|
| ec nomenclature | |
| pdb deposition date | 2006-02-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| X | PF04187 | Cofac_haem_bdg | Haem-binding uptake, Tiki superfamily, ChaN |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Helicase, Ruva Protein; domain 3 | Helicase, Ruva Protein; domain 3 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
