2G5GX

Cofacial heme binding to chan of campylobacter jejuni
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
255
structure length
255
Chain Sequence
PLQENKDFYILDTHTQKKISFEDMILELLKADVILLGEKHDEVKHKISQVMIFNALEGNLSSQNINFDVALEMLASTEQNHLDKAFKNKKTIKANELTNALNWDKVWKWKDYEQFVNVVFYSKSKILGANLSRSEITSIYNGAQPLKGYVSTTNEVKKQLFDIISLSHKLNPEENKELLDKLVEIQQFKDRRMADVLVHHVNKVLLLAGSYHTSKKIGIPLHIQDFKSSKKIVVVNLSYGEIDLKDSDYVLIYKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative lipoprotein
publication title Cofacial Heme Binding is Linked to Dimerization by a Bacterial Heme Transport Protein.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Transport protein
total genus 96
structure length 255
sequence length 255
ec nomenclature
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF04187 Cofac_haem_bdg Haem-binding uptake, Tiki superfamily, ChaN
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.760 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2g5gX02
3.40.50.11550 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2g5gX01
2EC5A 2EBFX 2EBHX 2G5GX
chains in the Genus database with same CATH superfamily
2VEOA 2HCRA 1TUIA 2BMDA 1DFIA 4TTQA 3DVRX 3DEIA 1P9WA 3T38A 4RCVA 4CEHB 1JXMA 1ZK4A 2VJDA 4J94A 3AVXA 4D4MA 1JPUA 2PKEA 3QEMA 5I9MA 1H9BA 4ACBA 5FFNA 4DY6A 2NPFA 5CITA 4O2LA 1ZPDA 2HAKA 3R7SA 2GAFA 4EX6A 4I81A 4WOCA 2GCGA 2YFKA 1JZSA 5EP4A 4ZOBA 1X74A 3EVBA 4E94A 5H59A 1P3Y1 2JGEA 3RVOA 1DC8A 3CVWA 3ZY3A 1CX9B 4OX9B 1RXSA 2DCMA 1B16A 2GUGA 4OFWA 5JSUA 3KT8A 1JR3A 3LT5A 3U09A 1J2TA 4RVOA 2ZK7A 2BEWA 3IBSA 2EDAA 4B8ZA 4HDMA 4DR3M 4B2LA 3OESA 4Z9BA 2HEGA 4YHHM 3M34A 2GXQA 5HCNA 4PG7A 3ND7A 1AN0A 4YRGA 3HU3A 1QNFA 4R2HA 4RTPA 3R3VA 3VM6A 2HRBA 4HNTA 4B8WA 4C14A 1DIHA 2X7XA 1F6DA 4XEUA 1VKJA 1QUSA 1GNLA 3DKKA 2OD7A 5AMXA 1LSSA 3G68A 2XUAA 2BTOA 3OEED 2DAMA 1PFYA 2FVXA 2AXNA 5KOIA 1C9KA 1D0IA 4NJMB 1FFCA 3LU1A 1P7PA 2OGTA 5H02A 1NLFA 5JSHA 4RF3A 1YZYA 2LVBA 2RK6A 1NX9A 1ZH2A 5F9MA 4OATA 4KITB 3DZFA 4XVUA 3KT0A 1NJ6A 4FDUA 4O1HA 2DWNA 1TM4E 4UBOA 4F2GA 3DMGA 1F2UA 3RH0A 1GRRA 3PDIB 1SVWA 1GLVA 2GJ9A 3VR5H 3HK2A 4DV6B 3D0RA 1KZYC 3Q3CA 1XWIA 3BRQA 1OJLA 2Z9DA 4AXXA 5LYJF 2AOTA 3CEJA 3NBZC 1VJDA 3GLGE 4MITA 3BMQA 4GVPA 1QPBA 1EKXA 5DGIA 3UC5A 1Y1PA 3D1LA 3RSOA 3HR7A 1A8QA 4WBXC 4DUPA 4GICA 3V6MA 5EMJA 3NTRA 3SF0A 1WWKA 3RNLA 4DPMA 4KXQA 1E2QA 1AUAA 2H2AA 2QXYA 4A92A 2B94A 1DU4A 1T0PA 4EKYA 3H4JA 2DQKA 3L5KA 3WSWA 4IFTA 2OYCA 1E18A 3RE8A 3TCXB 2C5RA 4IJ5A 1UMBB 4R1PA 1N5LA 5KYUA 4TYYA 2ZJ0A 5G4LA 2ZE6A 3H7AA 3X0DA 3SFTA 5IZ4A 3KTAA 3MUEA 3GLGB 4R8VA 2Z2ZA 1PRBA 5AOAA 5LBIA 1DWOA 5CB6A 1ZESA 3A06A 4P82A 3D6JA 1ZIXA 1ODJA 4LKOA 5IYZA 2XGGA 1BX3A 4FD2A 5F2KA 1ECPA 2ZB4A 3VHXA 5GOTA 4QXPA 2P5TA 4K26A 2Q99A 4FZ5A 2RHWA 5SYNA 4NOMA 5JQGF 3QW2A 1VCNA 1YZUA 1TQ4A 1HWYA 3PLRA 1OT3A 1E2JA 3DTVD 2P0AA 3NYWA 2NZYA 1EVKA 4HS4A 3UJ3X 3LKBA 1BXRA 4QEZA 4AJ4A 5CVEA 3STYA 4GLOA 4Y2GA 3P0JA 2XA1A 3UCXA 3F8TA 4JYPA 1OGYA 2PMFA 1OB5A 1WZIA 1WLSA 4F9GA 2ZRBA 4JSRA 2O3JA 5LQUA 2F43A 4ILEA 1G8MA 2P4SA 4JK3A 3RDPA 3IP7A 3V1MA 4G24A 3HCDA 1JLMA 5IP5A 1V4VA 3KNZA 1NXOA 1YV9A 1QRRA 5L3SB 3EQZA 1YR1A 4RKUF 3BFPA 3G2NA 3VNUA 3LX5A 4N7RA 2QV0A 2VO1A 3HZOA 5I7VA 4E03A 3LBFA 3RASA 5ELMA 5CXQA 2NGRA 4PAGA 3D3KA 4M7WA 3CH6A 4HYYA 1ECGA 3PICA 4EHNA 2QDXA 5EWLA 1QCDA 3MRXA 4R3UC 3H99A 3BYZA 2P69A 2GTIA 4JA2A 1QR2A 4F4UA 4IJVA 4BQOA 3NUGA 2PMWB 4MCIA 3F6BX 1K3FA 4Z9FA 1SQGA 1QZXA 1NM5C 5HW0A 2KLHA 1JIIA 3V8QA 4F5DA 5L4LA 1F3LA 3W04A 1GTMA 3WWPA 2WVHA 4R40A 1FA9A 3C5VA 1NQVA 2V6BA 1MGOA 2E4VA 4HN2A 4X9XA 3BFXA 4GBED 1YLAA 2CLIB 2CUTA 3BA1A 4UHFA 1EP2B 4EUFA 4KWTA 3P2OA 1QG4A 4LY0A 4C0LA 3AT1A 3AI1A 2QZPA 1Z56C 2AL7A 3P4UA 1SPBS 3Q7RA 2DG2A 1LLFA 2QVZX 1P9OA 2YWFA 4O4HB 2TECE 1OKKA 2SKEA 2OEPA 5JD6A 2QORA 4RXMA 4GR4A 4ZMBA 3TL4X 1XAJA 3EZFA 4NESA 5DCLA 1JTFA 2H51A 4M9SA 3HM2A 3GJTA 3SY8A 3T5PA 1SKUA 4WLEA 2C4UA 4DLRA 3L7KA 1VL5A 3H97A 4Z51A 4O08A 4HG2A 3PQDA 1XMOM 1FFXA 2WY2D 4EY5A 1G8FA 1GSIA 1CR2A 5CVVA 2GPSA 2O3UA 2NUTA 4FWHA 2JLVA 1W0KD 4B85A 3TOSA 2QTCA 2AXEA 2D5BA 3FMVA 3MJEA 3WLLA 3GQ5A 3LRTA 5I7SA 1N5JA 2QTVA 4BX9A 2ZIXB 4ODIA 3DXYA 2QY6A 1QPGA 5KYWA 4X1OA 2X8JB 4TN5A 3ZV7A 3BXPA 1H1LB 3P8ZA 4M1OA 5AYVA 3BORA 4YRZA 2G7ZA 5M34A 2H31A 4L78A 1JAXA 3SMPA 4CKZA 2DHDA 3KYCB 2JFYA 1U4SA 3B6EA 1B73A 4US1R 1VEKA 3W5CA 4DADA 3UMGA 4AYTA 3GFTA 4CL2A 4OKSA 1ZZEA 3V5NA 4JI8B 2VI5A 1J5EM 5PNTA 1R3DA 1NTRA 3U0VA 4QM7A 1DGFA 1Y8GA 1MA0A 1BKDR 3H19A 4KU4A 2JGJA 3I73A 5JJCA 5E6UB 1ESNA 3AWIA 3VNQA 5JD5A 1I24A 1UMCB 1KFCB 4N18A 3V2IA 2WIFA 1ORIA 4QVKA 3PZBA 3UAGA 3AR9A 4MV3A 3EDQA 2WFAA 5DRTA 3WB2A 4W7HA 2W2LA 1THGA 8ABPA 4GSLA 4I1UA 3G0IA 3O8CA 3VOAA 5AM2A 3ET5A 3O38A 1JV2B 3SJBA 2XYHA 4QBIA 3RS9A 3VHQA 3NTLA 4P4LA 4CMGA 2B1RA 4MVWA 5EHNA 3ZZ1A 3C7DB 1XEWX 4A0RA 4ES6A 1YE9A 4LWPA 4PDGA 2J9GA 4KUHA 1ACMA 3JVIA 4AU1A 1L3IA 4XQEA 1CUFA 1NNUC 1NP3A 3VKWA 4U2EA 4RCZA 4GPAA 4KOEC 4MM3B 1D3AA 3F6YA 2JY8A 3DXXA 3MAAC 1T9DA 1P74A 4QPJC 3SZMA 4QTYA 5KPZA 4Z7NB 1D4AA 3H05A 4I46A 3SBOA 2X5JO 4HLDA 2JPDA 4AAYA 4ECAA 5D3QA 2WSYB 2O0LA 3WKAA 2WBLC 1YOVB 3HB1A 4TROA 4BNGA 3CLKA 4Q00A 5CURA 4BZQA 3EXG1 4Y9RA 2XT6A 4GVXA 1UXJA 4B71A 2YW9A 5C81A 3MVEA 2FSIA 3AYZB 2NX2A 3RIMA 1HQCA 4ER7A 5LL6P 2GWRA 4LF4M 4LRQA 4D0GA 2HMWA 1UM9A 2DM6A 3LPMA 1UR5A 1WR1B 3A4MA 5THQA 4DTIA 3TIXB 5DK4A 5DYTA 3FMGA 1YUNA 1FP2A 2C88A 4JGGA 3FVQA 1WABA 3T4UA 3DE4X 3D31A 2JWSA 4MUMA 1OILA 3C45A 3O26A 4ZTBA 4XJTA 4C5BA 2EATA 5TRTA 4EA9A 5TQ2A 2JIDA 1Z26A 2HLDD 1KVSA 4D9JA 4D43A 1F7VA 5JJLA 3FB1A 3P2EA 2DBVO 2OP0A 2REOA 4AO7A 3HHYA 4UEWA 3K9WA 1N1GA 3NIDB 5GADl 3RIYA 1BYIA 3P4YA 4Q3LA 4FFMA 4FGLA 1Z4NA 1JQ5A 2YNMD 5L7WA 4URZR 1QO7A 5JISA 4QDOA 3TQRA 3M6WA 4OKNA 2I3AA 4MQLA 3IPLA 1G66A 1JX6A 2A57A 5CHEA 4LOLA 4Y30A 3QWBA 1ZCAA 1K5DA 4F85A 4WUVA 2EFJA 3OFSA 1CUKA 4KPYA 2DUMA 3LBHA 4KYVA 2JLCA 3CF2A 1PHPA 4UMFA 2AQIA 4JH0A 2CL5A 3T8YA 4B79A 4EFDA 1N7JA 2QUIA 2OOBA 4FXPA 2QR2A 3DW3X 3GB9A 2KBEA 2O01F 5GKNA 3KIPA 3I9V1 2YUTA 5L95A 5A5EA 4H1HA 1PFQA 4J9UE 4FSHA 3DBRB 1T4MA 4BASA 4EPWA 2IZZA 4GPD1 1VB5A 5K0JA 1DZIA 1EH5A 5DF1A 3BWCA 3MGGA 3W2FA 2GLXA 3PQEA 2XMBA 1R0WA 2BONA 1LA2A 1II0A 4AYXA 2O8BA 2GCPA 5F77A 3C7CB 2FV8A 1L7BA 1SC4A 4PO8A 1PUXA 1QUEA 3LY5A 2BFPA 4OMUA 2Y0TA 1QQ6A 4IKPA 1KHHA 4OQ4A 4AZVA 4HL6A 3ANYB 3RSGA 2D0OB 4S0XA 5MN5A 4O2BF 1P2DA 3NRCA 4GEKA 4XR4A 4CEIB 4NBVA 2EWWA 3LH5A 2PD3A 4GMXA 3TXAA 1PJRA 4RD6A 4DXDA 2C9YA 4KW7A 4BNMA 3KHUA 1OH8A 6ADHA 2HCJB 4YRKA 2K9DA 2FR8C 3T0GA 2PFKA 5TLSA 3M5WA 2YDYA 1AKTA 4HV4A 2JJQA 4XSVA 1Y42X 5JXIA 3H1GA 4LJAA 3A58B 2LW7A 1UPTA 3FPEA 5A7HA 5JPCA 4KXFB 4DCJA 1U28C 3OZIA 4W5TA 2PRKA 4IDPA 5AKYA 1ZD9A 2X5NA 3EIXA 3OTOB 1Z39A 5KC8A 2HU2A 2PLWA 1XHFA 3KR1A 3R8CA 4JVSB 2A9JA 1XUOA 3A1EA 3D7KA 1XDZA 4HUJA 4RENA 4BKUA 4A8HA 5EMHA 3BIWA 4DUYB 1FUIA 2O4UX 4L3VA 4AKGA 2CSUA 3A7DA 1QRDA 1BNCA 3H8SA 1TFRA 4QNNA 1GFWA 1GUYA 2LIPA 3EZ7A 4GNRA 2JI7A 3HGMA 2YNMC 3FA2A 2GX6A 5B37A 3ICWA 1W25A 5JAQA 4CT4B 4OLJA 1YASA 4EDHA 5AUQA 1GSOA 1NKTA 3NEJA 1NAHA 1VBKA 1VE1A 3MJHA 2R4UA 5J5CA 3M9WA 2A1TS 5D00A 3RJ9A 4LRSB 3IERA 2C1XA 3WSTA 2WYIA 2R8PA 1U5BA 2F59A 3KEFA 3FHOA 1Z47A 4I55F 2EZTA 3RSSA 2IP1A 3GLFA 1M6WA 4PNPA 3GJ7A 5F7OA 3AUJB 5AWFC 5MHTA 3TQQA 1E0KA 5SY4A 3ENKA 1M66A 1NLMA 2JEYA 3PDUA 2NSLA 4LBVA 1SCKA 2HNBA 1KOFA 1UBGA 2QTGA 1CJUC 2MYNA 3LZ6A 4YRBA 2QM7A 4BO8A 1VL8A 2BYTA 3CN9A 2ZATA 1NC1A 4DMHA 2UXCB 4NFSA 4RGBA 3NATA 3LVQE 1RKBA 2H0AA 1T2UA 1E59A 4CCYB 1G291 2JD2A 4YRIA 3UTCA 4OTZA 2C3YA 9LDBA 1ZW6A 4Q9JA 3FOWA 1PQPA 4BMSA 4HVCA 3DKPA 5J4LA 3MUNA 3VR3A 5A9SA 4HT3B 1OY1A 2RKBA 1A4RA 5EZYA 3SZ3A 1YQQA 2E6KA 4MLZA 1OX4B 3VPBA 4CMCA 1Z6GA 3EXIB 3CLRC 1QCZA 1GPMA 2X8LA 5IEBA 4D80A 2XQGA 4I4NA 4DLAA 1FFAA 3D3NA 3F9IA 3EVAA 2O0KA 5IJAA 4CMAA 1QC5A 2BFNA 4AO6A 4GRIA 4AP6A 3CPJB 1PEKE 3LQFA 9ABPA 2G5PA 3G5AA 3QK7A 3G2HA 4RKEA 4EKEA 5ESWA 1R4AA 2PA3A 4L8GA 3RAGA 5EIBD 3B78A 2VR1A 1UJ6A 3UMJA 4PW0A 4E08A 3J7BA 5LMUM 3AK4A 4COKA 3NBKA 2CFRA 2Q5OA 4KQ9A 3PE4A 1FVHA 2RIPA 3AI7A 1VIDA 4DV2M 4HOYA 2JUJA 3SE7A 2R0QC 4LSWA 4OW0A 4Q7JA 3MB5A 3P9NA 4K7JA 4XCVA 4D1YA 2VIIA 3DE6X 3C7KA 4AMVA 4CQMB 4TTIA 3WGMA 5TQJA 1ZXXA 3MJ4A 2RHDA 3GPLA 3OQIB 2IYVA 3AFMA 1QV9A 4TUYA 3W5JA 2XDQB 1SU8A 4CU5A 3AEKA 3B9BA 1OR8A 2ZTSA 3CZAA 4X20A 3S70A 4DL9A 3WLMA 1J25A 4LMRA 4ZAGA 3L07A 3I1FA 1DT3A 5LXTF 3U4CA 1C0IA 4IINA 3S1AB 5J5AA 1IJEA 5KREA 2QHOB 5I9NA 2B20A 3SHFA 4KPGA 3C41J 5T3UA 2M6RA 2FK7A 4WURA 1DIGA 1Z3CA 3U6KA 1J09A 2XCUA 1AHPA 3U6MA 4JFRA 3AKZA 3D8SA 3AF2A 3VNVA 3TD9A 3PWKA 3DNFA 3Q5GA 2XZUA 4KQ1A 3U80A 4FMCF 4HLUA 3UWSA 3STUA 3IDZA 2EERA 2IYAA 1GO5A 2P62A 1NP6A 5KOJA 2ACKA 2ZS8A 2PPLA 3M7IA 2BMWA 1RWNA 5LKAA 1FX0B 1O6GA 1HNZM 1E6MA 5EZQA 5AP9A 2C8VA 5BSTA 3B52X 2NYUA 2CMDA 1KHTA 2L7IA 5FI1B 4CQJA 4PLHA 3CE9A 2XB8A 1S5PA 3EMKA 1H2WA 3O5AA 1ECBA 1XTQA 4PC7A 1W2WB 1Z5BA 2VK4A 5FUBA 1A69A 1W4AA 5DFAA 4CF5A 5JARA 1GRVA 3T7RA 3IAHA 1JFFB 1S1MA 2F64A 4IH4A 1BW9A 4LV8B 2IXGA 5CT9A 2CXQA 3HP1A 3MMSA 4Q3NA 1V37A 2OTCA 5KSWB 1OLOA 5I7RA 1U0BB 1ZDMA 2PUCA 3FOZA 4UTNA 2P2DA 4QAQA 5JADA 3KUUA 3DP7A 4IH9A 3BD8A 3GYGA 5HBGA 4XYGA 1DEXA 3U7EB 4PZDA 3F4LA 3MTBA 1AZSC 5AJYA 1X70A 1AMUA 1K7YA 2ZB2A 4B74A 3IQXA 5EJ5A 4Q01A 2XCIA 3QZUA 5DM1A 3SP1A 5JPIA 1YBMA 1T8TA 2JLYA 3VU9A 1JG6A 2CK3D 3DD5A 2Z56A 2IHUA 4IBKA 4KQEA 3ZH2A 3EH1A 3EW7A 3W0FA 4E07A 1RZ3A 4D26A 3QWAA 4U3JA 3SIPA 3EB9A 1HORA 5IX8A 2X2FA 4W8GA 3E9DA 4OXKA 1JDJA 2IEZA 1PX0A 3EVTA 4CG3A 4EHAA 4KIJA 4YMGA 4G0VA 2YJ3A 3BL8A 5DX0A 1W36B 4E1BA 1W9MA 2PGXA 4N49A 1T8WA 2VHWA 3BXZA 1Q91A 2M5ZA 3D8NA 1U0EA 3V4LA 3CCFA 4EGFA 2I6UA 3KQVA 2P2CA 3PUHA 2PUBA 3RT1A 3TB6A 4LGVA 1AQJA 5EWMA 3AVYA 4H1VA 2NUPA 3TUJC 1UOOA 5F2EA 1IYZA 2FK8A 4OQZA 3SICE 5EXTA 3O3MB 3E5RA 2G0AA 1F6BA 2XH9A 4IO0A 1T1EA 3OH8A 3BD9A 3IIKA 5G0WA 3GWGA 1NR5A 2DP4E 3HUTA 4OA5A 4ZAWA 4ME6A 4MEBA 3EBOA 2CC2A 3RRMA 1WV0A 4BO3A 1Z4KA 1D8AA 2HC9A 1ZMWA 1I2BA 3OLYA 3P9CA 1RYFA 4MW7A 2FHSA 3M9LA 4DCCA 2ZUVA 4TOIA 4RS4A 2R46A 4MUEA 1DTWA 3HSYA 4MUFA 4KODA 1N36M 2QPAA 1CRPA 2IK8A 1ILWA 1K6MA 3UT0A 2WJ6A 4Y2RA 1S1CA 1A04A 3UFXA 3EOAI 5DNAA 2JKVA 3PITA 1WMAA 3C16C 4JLDA 2RH4A 4HXEB 1ZMBA 2GKOA 5DNDA 1PW5A 4DLNA 2RGOA 4LGYA 1KZ6A 1T0HB 2Z6AA 4R68A 3AILA 1FYWA 3JQCA 4YJ2F 2FPXA 3C15C 1XZLA 1L2CA 1GPDG 4LF5M 3L28A 3QTLA 4U2DA 4W63A 2ZJFA 5JNTA 2IEDA 4AY5A 1SC9A 2AMJA 3EVGA 3GNLA 2JAPA 2RJ3A 2BT4A 2QSUA 3ZDAA 1TO2E 4DQDA 3QVOA 4QA9A 4NZ9A 2WMDA 4TRMA 3GLVA 3K1YA 1Q20A 1MG5A 1Z4JA 2AH5A 1E2LA 3H9JA 5JCPA 3KKZA 2QU8A 3VO9A 1PGYA 3D6MA 1EGHA 3RU9A 2I6QA 1EFDN 3U9LA 4LXHA 3H1PA 4C76A 2YN4A 1N34B 5H9WA 4E21A 1RM5A 1TZJA 4JLBA 2ECKA 1NVEA 5G53C 1RRMA 3R9XA 1EAMA 2DWQA 5IC6A 2VOEA 4EMSA 2IF2A 4NJEB 4MI6A 4QQRA 1AKQA 1CXZA 3GHHA 3Q72A 1CZOA 5J43A 1O5TA 4AKSA 1W6UA 1AB5A 3RC7A 3WLJA 1VSTA 3IV7A 5EJ7A 1W5EA 3R6TA 2V8BA 1ZBDA 4ZJYA 2WJ4A 1VDZA 2DQSA 1TK2A 3W34A 3COWA 3FFTA 2WHRA 2XVZA 2WSCF 3PVCA 4I1PA 4HGQA 3M6FA 4Q37A 1J1UA 3FGPA 3ABOB 2DULA 4DA0A 3D3EA 2BKLA 3VYVA 4CVNA 2H2DA 3IDSA 5I7FA 3WISA 5E0OA 5AHWA 5GV7A 1WY7A 2QX8A 3I1IA 1M0TA 5G0VA 4DC0A 4MGZE 4CKBA 3PDHA 1Z2OX 4EUHA 4FBGA 4C01A 3T35A 1N3IA 1BS9A 1U0JA 4EJMA 4IAOA 2DFLA 1JQ3A 1GN8A 5C53B 2AFIE 3UQYS 2GVZC 2X2OA 1N57A 1D1QA 2V1UA 1W88A 3B6JA 2AUTA 3MRTA 5F52A 3Q12A 4HZGA 1ZMUA 2AX4A 1N3LA 1N78A 2UZAA 3DDWA 3O8QA 2R45A 1Z6PA 3A1CA 1Y89A 3FNIA 1I32A 4RHCA 2LVNC 2FSVA 1IC6A 6GPBA 1ECJA 3LRPA 4FX5A 1W85A 1QYCA 5CJPA 2VPXA 1OAOA 3D3WB 1OYVA 1RTKA 3HXMA 3PE6A 5F5LA 5E3JA 3DMTA 4YRPA 3GFPA 5KMGB 4BMZA 2GD2A 4N8SA 2GBFA 3OMWA 4K9SA 4M9RA 4KO4S 2DSNA 1ZOPA 1QP8A 2ZYHA 3CR7A 4RH0A 4UHEA 3AF4A 2CV2A 2IW3A 3G82C 3K4HA 4EY4A 1L8LA 2GPNA 1HQYE 1V43A 1O8BA 2YV3A 3L27A 3OAAD 3NC4A 4M98A 3WWEA 1SVUA 4NI5A 4YAFA 4J9VA 3OHPA 4O4IF 4D6XA 4R2WA 4GW3A 1KF0A 2Z4SA 4G4IA 1T9AA 3S7ZA 4MGYR 1IBMB 1UBCA 4RORA 4YC7A 1BCRB 4FQ5A 1L9XA 3GRZA 3FPCA 3GRVA 5IDQA 1M2FA 3X1ZA 3J81k 2IOYA 2F1HA 4WXEA 2PBLA 5JH7B 5JDIC 4ALNA 2KNAA 2GSWA 2WV9A 2VBIA 3C58A 2ZSBA 3H1BA 1F2VA 2J5BA 4CM4A 4ZRNA 2CXOA 3CY6A 1MTOA 4TM7A 2I33A 3ME5A 1QQBA 5EXDA 4OHUA 1QX3A 1SVLA 1G6OA 1JZQA 1FRVA 1H8ED 4Q3KA 4IVPA 2N1MA 1NBHA 1RYDA 3EAQA 1DKUA 4MLPA 4QODA 1JIJA 1NR7A 5F4ZA 3WLNA 1YRLA 5IF3A 1G60A 4Z3OA 1TADA 3NHYA 1K6EA 4HLQB 4PLZA 5K99A 4FKZA 2FXIA 4MR7A 3ORYA 2V6ZM 2J45A 1RACA 1LRJA 5IUKC 5FTJA 3N5KA 3WMWA 4FE4A 2ZBKB 3P0RA 4PRLA 1XZMA 2IBMA 1IONA 4U63A 3DDCA 4ZYZA 2QVXX 3OTQA 4M86A 4X94A 4AWXA 3QP9A 5AVUA 4HQ6A 5CW1A 1D6MA 5GTDA 1MVLA 1Z82A 2X9NA 2OV1A 4L0DA 4CIYA 3EDOA 3H5OA 2N35A 2OCLA 1NN1A 4GLJA 4ENPA 1MJGM 3SQNA 3WK6A 4G85A 4AMZA 2R6JA 2P4HX 3CX4A 3DBIA 2AGVA 3G8CA 4EF5A 1DJMA 1L7AA 4IOJA 1UKBA 4I9FA 3LHSA 5C2JB 1V34A 1JWBB 3D7SA 3OX2A 4LF6M 2R00A 4ONEA 5H37D 3O4JA 3SAWA 1SVSA 2LCFA 4NF2A 5FV7A 4KPFC 3IHLA 1LXCA 2KX7A 4PO9A 1KVRA 4IHKA 3EGXA 3PSAA 1TCBA 3KM0A 1D0MA 5BVGA 4JVOA 1JT2A 5EP2A 1KI8A 1IOVA 1SNYA 3ZH9B 2RH8A 5EHQA 5HOQA 4CW7A 3KWMA 4RLHA 1T8SA 4XTCS 1WXXA 2R25B 4AJLA 4YT8A 4PAWA 4PTYA 4JI4B 3PENA 2EL7A 1PNQA 2HD4A 4BNWA 1YBAA 5LB4A 1V35A 4A8JB 5DTMA 2F17A 4BWFB 4DSTA 1E0DA 2D1RA 4G41A 3R5HA 4IP0A 1GKKA 1CE8B 3GY0A 3KHSA 4ND8A 4DV3M 2O8NA 1BRMA 3TX6A 1L1ZA 2CLLB 2N3ZA 3T4XA 3TZLA 3OE1A 1M5RA 3OJOA 5AW5A 3L7MA 4R8SA 2HFJA 1JEEA 1EA5A 1O0SA 3UUFA 2V9PA 4H4CA 1JKMA 3NCTA 3WGZA 1X7ZB 1J0EA 2DMRA 4DMLA 2Z1NA 2G1JA 1J8YF 5EJ9A 3EIUA 1L6IA 3G88A 4GC9A 2E89A 3U4HA 1TNDA 1IZ8A 4TYWA 3GLHA 2C1EA 2MSDB 3A05A 1ZK0A 1P1HA 3GCXA 5F1YA 3UA3A 2J9ZB 1RLJA 4UZSA 3ROXA 1WDWB 4C43A 4NE2A 2IPOA 3CLUC 3RW9A 2EKZA 1K8ZB 1NQAO 7REQA 3E81A 4C87A 2PL1A 3L8MA 4EB8A 4YJ3F 3WB1A 2C04A 3NIFB 3IUPA 3U2QA 2Q3HA 1N4DA 1WCYA 1R0YA 2CJWA 3F97A 2XKAA 3I2KA 2HLHA 2WHQA 2D2EA 5FPTA 1H42A 3ZE1B 4RK0A 3UPUA 4N6NA 5CAEB 2RC5A 5AI0A 4EGSA 2BEUA 3OT1A 3RVJA 3AW9A 3HH8A 2J0UB 4OGFA 2B34A 2KLBA 2WTUA 4K9RA 1KEZA 5D8DA 4M36A 2XDWA 1BDIA 1NVDA 1VEGA 3FSRA 1HE5A 2QRHA 1O6FA 3A1NA 1GADO 4PSKA 3ZIDA 1VBFA 5K9ZA 2O0MA 5LA6F 4OHBA 3E84A 2EZ9A 3PUZA 1TTHA 4WIAA 5C1OA 4G9BA 4D3SA 3O1HB 1GVNA 1GTZA 4C0JA 2BSQA 4PGMA 2R6DA 1F6WA 1TT5B 2UUPA 1CUXA 3D2LA 5AJVB 5C5DA 4RSGA 1PR9A 3RYHB 1AV6A 4JEIA 4AN0A 4LRTA 3QOYA 1EE9A 2G9UA 1DV2A 3OFND 5JMOA 2UAGA 5K8TA 3CTPA 5DYNA 3HABA 1F4PA 3QBTA 4RV5A 1I5RA 1NJGA 1KEVA 1E3WA 2FWBA 2XYGA 1EBFA 5A9RA 3VYSB 3ZCSA 1DJNA 3ZVKA 2BUCA 1ZLYA 2BR5A 4FJ2A 3LO8A 4XB6B 4D81A 2LKDA 1P73A 1P1CA 5KJCA 2VXCA 3NWOA 2O2GA 1IU9A 2DEUA 5I4IA 3PFNA 4DHEA 4G5GA 1GZDA 2VPZA 4OU4A 3K31A 4MVJD 4X7PA 1LFAA 4EHBA 4EEKA 2HF9A 4IJFA 1MVNA 4KDEA 4ECEA 3EA4A 5AR1A 1PBTA 2V4MA 3KPUA 1HYQA 3CR3C 4YQZA 2GPTA 1GZ4A 1ONPA 1VJTA 2VK8A 3CPEA 2P67A 5AM4A 5HRAA 4B48A 3AC0A 4JVNA 3N3AC 3WGJA 2JZNA 2F1RA 2G4LA 3CMMA 5E8JA 4DWJA 5AI9A 3TD2A 1KIAA 3QKRB 4WKNA 1PCXA 4K5QA 1YC5A 4G5OA 3KS8A 1WB9A 2I4IA 4GPTA 4MYRA 4BXOA 3SQDA 4FYVA 4DXHA 3O8BA 1IOZA 3M81A 1EFPA 3QKWA 3K5WA 1UBUS 2Q3BA 2VZEA 3ZGYA 5FNZA 4BBAA 3CUYA 5DHFA 4ZOAA 5EC8A 2HKJA 2O06A 2WPDD 4PZ9A 2E5LM 4OQPA 1W35A 2OG2A 3LFTA 1PYDA 3BZWA 4YAIA 3QMWA 4XUDA 2PPVA 1VI6A 1TKRA 1DB3A 4WBSA 1KS2A 3AGPA 3EWSA 4W82A 1OFGA 3WNDA 1C7FA 3DD1A 2H9AA 4EW6A 3EGVA 1QTIA 2OOKA 1F1BA 2RAFA 5EXEA 3FYUB 3I53A 1ML4A 3DEAA 2CNLA 3ORSA 3PJFA 3T3NA 5LU9A 2OQ4A 1TKBA 5EQJB 2GF0A 4JVMA 3UB4A 5AXBA 5D7NA 2X8WA 1UADA 4DBLE 4GZ6A 3KQSA 4CV1A 2Z5LA 4AN4A 2QRVB 2I2XB 2WP8J 3PFBA 1XDBA 1RZUA 2O2EA 2GCEA 4J29A 1WAMA 3JD0A 3AIOA 2B7BA 3VR6H 2YS7A 3BSWA 1EUZA 4HXFB 5JZBA 4RPKA 3BE6A 1TH2A 1WETA 3MNFA 4YP5A 3ZJ5A 2G83A 4Z53A 2D62A 1CJBA 3M6LA 1MB3A 1YBHA 2L09A 5E4JA 1T35A 4KT0F 2QOEA 1DJLA 3DAFA 3E9EA 1JNXX 1Q14A 4O0MA 1Y4DE 2HDNB 5EJGA 4MHSA 4C0KA 4BJ5A 3U5ZA 1NW6A 2C9DA 3IAS1 4JLOA 4PZUA 1WXHA 5LDHA 4OL0A 3GAAA 2ODPA 1UXGA 4KV7A 2V45A 4Y2HA 2QL9A 2PUVA 3C8ZA 4KUGA 3ANTA 3KJXA 2KEBA 3A9CA 1HLFA 3VKVA 3QA9A 2PU7A 3I1YA 2UYQA 3EVNA 1FNCA 1OI4A 2FYTA 4UDNA 1YZ3A 2OM6A 3UMBA 4BEJA 1SVNA 3PV0A 1T0UA 3S28A 3LF2A 3ROGA 3TQHA 3V8RA 1HT1E 2H7VA 2ERCA 1Z16A 3A3KA 2DSTA 1BJRE 3NRBA 1EFUA 3HCWA 2PS9A 1ZEJA 2I6TA 2WMNB 2IV3A 3GCGA 1ZD4A 1M34B 4LQLA 5HKOA 3BFJA 2R7AA 4RA9B 2DFNA 3G7NA 2B3TA 4YCAA 1TJYA 1U8TA 2VZ9A 4WOPA 2IVFA 3T3OA 3A1DA 1LD3A 2CL7X 4B6SA 3CPSA 1V7ZA 5KDOA 4JXXA 2R85A 5K8JB 2EBWA 1G5PA 3IQGX 4KO8A 1YRHA 5IDWA 3CUSA 1HEYA 1YONA 4C1NA 2FA9A 5DLQC 5AVRA 4B6EA 1UFQA 1HY3A 3ZLTA 1G20B 4U1RA 5JYEA 1NOIA 1WBDA 5JY6A 1JHPA 1QHSA 3P52A 1FYDA 3ZLVA 3WK9A 2FSPA 3JR5A 3OY2A 1PLJA 3EVCA 2DECA 3AU9A 1R15A 1RTTA 3CRVA 4MNTA 4YYEA 2NTJA 5AVJA 4LC9A 4FB5A 3HKEB 1C5KA 2YWCA 4HWTA 3GOQA 4CHTA 1R3UA 4AJHA 3RHZA 1I0LA 4B1FA 3PWTA 1T2DA 3INYA 3O2QB 3DL7A 3L0YA 1TZKA 5JYDA 3U61A 2JRLA 4M0UA 4BYGA 1VM6A 4Z7OB 2WB2A 1YZNA 3H2KA 3RE1A 2SHKA 2GS9A 1T8YA 1DGGA 4BEBA 1HUQA 5C32A 3HUDA 5LQCA 1D0VA 4IIJA 2CLKB 2HMSA 5E3HA 4KZKA 5KX5B 3JQ7B 4L73A 4FDAA 1FNBA 5KNLA 2CZGA 4F71A 4LHZA 2LVQD 1FNMA 1FZQA 4BMYA 1W8IA 2VF4X 1X2EA 5LDDC 3HCEA 4WKOA 4B3TB 3IR7A 4KGDA 2QP9X 1Q57A 2YMPA 5JWRA 2QYOA 3RSLA 3T54A 1V33A 1MAUA 5JYCA 4PC2A 2I1VB 3CRRA 4JT8A 1V9SA 1YFKA 3WHIA 5KVVA 3IELA 1F8UA 2PH1A 4GAEA 3VSBA 3T9CA 2MYUA 2YASA 3JW8A 3ZK8A 4CDMA 2FPSA 1HT2E 3TTXA 3QQPA 4C08A 5KU7A 2HWYA 4RHFA 4CDGA 4WW0A 2FCAA 2OCXA 2RHBA 5TT1A 3M6MD 4MQEB 3I72A 2GLTA 2YL2A 3KK0A 3ECAA 3KXIA 1KRXA 4IOLA 3ZI7A 3CEMA 2DZNB 4M1TA 4HFRA 1Z37A 4QG7A 3BILA 4A8TA 3QYAA 3REFA 5HQ3B 4BE9A 1HX7A 2I99A 3A9WA 4BFYA 3KB1A 1WVGA 3W7VA 4IBCA 1YXMA 3KSDO 4FLFA 2LBPA 3ZJUA 1U7XA 2R6HA 3AR7A 4HNRA 3JWEA 2BZGA 3RFVA 3VPCA 4ZYWA 1KPHA 2Y20A 2ZT7A 1MB4A 1TTEA 5IH7A 3ZDDA 2AYXA 2JRCA 3AB7A 1DOAA 3L1IA 1GZSA 3CZPA 5KBYA 3MOSA 4XX0A 2VUUA 2EEZA 1IMOA 5BMVB 2NYAA 2HHHM 2FUG1 2FHPA 3ESCA 5HMLA 3GYBA 4JLSA 1FRZA 3LWNA 1XSEA 5ALWA 5TS3A 5DB4A 4GMHA 4INJA 1Z6YA 2XVMA 5J47A 1ZC4A 1YZKA 4PHCA 1IDN1 1Z88A 2QR3A 1USKA 5FI5A 3STHA 3X1WA 1Q7EA 2AXQA 2VHQA 3M3HA 1Z7BA 2UDPA 1TT7A 3SS8A 1W75A 4WMLA 4AY4A 1QZMA 3D6UA 1Z6ZA 4B6QA 4I5SA 2QW8A 1PR4A 2QG6A 1UCFA 2QI9F 1X37A 2PZGA 5AK4A 3OTHA 5F12A 4XGRA 2JLQA 2RMKA 3ZYCA 3JQRA 1VBNA 3G1UA 1BWSA 3JZDA 3KWJA 3LZDA 1CUEA 3ERCA 1Q16A 1J8DA 4HI0E 1FMCA 1CQJB 4UTXA 4AICA 2M6SA 5DTEA 4M76B 5DYGA 2YXEA 3SJ7A 4ENVA 3IMKA 2DWMA 2O19A 3KALA 3ZTWA 1PS9A 4IZIA 4DV1B 1X7HA 3R75A 3T7EA 5CMLA 4UC0A 2XUKA 3AKYA 4MUKA 4AJKA 1BQEA 4Q9AA 1BVSA 3ORHA 2WQZA 2FN9A 1P33A 4Z2YA 4CQLA 2FFQA 4CODB 4YECA 5F5XA 4LGCA 1IXSB 1CFJA 2IHZA 2BIFA 4PPGA 2I3DA 4FFBB 3UHAA 2IDZA 5T8KC 4A1FA 1U6JA 4CL8A 3GT4A 5JCJA 4CT5A 2UUBB 5CM8B 1DE0A 1ZMXA 4UJ3A 3IA2A 4D0RA 2NTVA 1Q92A 1YRYE 3OP1A 3NT2A 5K0BA 1WX1A 1KVUA 1OQAA 3L04A 2QTBA 3K1AB 4I55A 3T94A 1J49A 4OQXA 4XGKA 3P97A 2X4GA 4QHTA 1VCIA 1UT5A 3E6AA 3N6RA 4MDYA 1E9CA 3CH5A 4CL3A 2CBZA 4P3YA 3TKYA 2VPQA 4JOBA 2J07A 4QJ4A 2YXLA 4NX2A 3DFMA 3WSVA 4EENA 2I3ZA 3ZWAA 2DPXA 2H5LA 4E2YA 4YJFA 3S5UA 3QX9A 2PY6A 2W2QA 3WK5A 4OHPA 2PQ6A 4ITRC 3VVMA 3QE2A 1BA2A 4TYPA 3C97A 4BCBA 2ZSAA 4RADA 3TZQA 2GZRA 5CFPA 5CA1B 3ER6A 3NAMA 4K03A 1T9GR 2D3TA 3N8KA 4BP8A 1RJWA 2NXWA 2R8RA 1BAPA 3R5JA 5ALOA 3DKIA 1SBZA 2Q2QA 1NPYA 4EZEA 1Q50A 3IHPA 3N6VA 2IYEA 3Q8KA 1T3HA 3LVRE 2GF2A 1BGVA 3FB4A 4EFLA 2VWPA 1ENPA 3ZUGA 3DBLA 3MUFA 2G09A 4U7JA 4YRJA 3FLEA 1UJ2A 4ASUD 1VIAA 4K1LA 4R5MA 2ONZA 5K4AA 3D8TA 4XYEA 5E7JA 3NOXA 3U4QA 5LVAA 3WGIA 3KKEA 4C04A 5I3ZA 4FI3C 4MVCA 4J2OA 3DHVA 4PF1A 2AJBA 2WSBA 3H2IA 4AZ3A 3F6CA 2MH8A 2R4EA 3U6DA 3E1GA 1OZHA 2H00A 2V7VA 3LVBA 4C3UA 4NV1A 5I7HA 3HU2A 3CLRD 1RR6A 4GU5A 3LW7A 2Q4BA 2Q9AA 1CUAA 3ZD7A 1QH1B 4KXWA 3EGOA 1D2GA 1QUTA 2C99A 2FWMX 2OXCA 3MEQA 2NV0A 2H29A 3W67A 2ZZNA 3BJRA 1T2CA 1AIPA 1H4QA 3DCYA 3HY6A 3QFFA 1VFNA 4HB3A 1MIOA 3EGCA 3U9TA 1DC6A 4LRWA 1PIWA 4FKBA 1C9EA 1IVSA 2JGKA 2QB5A 3KU1A 3QQ5A 1FDIA 2R1VB 5JDCA 5EXXA 2EX0A 3JATA 2R11A 4LOJA 3NT5A 1W52X 1GLNA 4C4YA 4LE1A 4ER5A 1MC1A 3GLUA 2VYNA 4N7MA 4NP6A 3IOEA 3ZEIA 2BGTA 1Z5UA 1GL7A 3PQ8A 3A1VA 4PAQA 5LBTA 2F48A 1Q7CA 4P08A 4MH0E 2GHIA 1O9GA 1E79D 4TQ9A 4ZOCA 5G1OA 2BFFB 3O9VA 1Z4PX 3RK4A 3ZWCA 1QP7A 3FWPA 1YDHA 1P17A 1PDWA 1N6IA 4JBXA 4D99A 3T06B 3GJSA 3DNMA 4JMPA 5IVDA 4NPHA 3GRAA 1IQPA 2V96A 3P0FA 2Z3ZA 1NW7A 3DFIA 2R8YA 3GJ0A 1YAHA 2EP5A 4FYMA 2QYSA 4EA8A 2F1OA 5AJXA 1C1HA 2PK3A 3M49A 5E95A 4RNAA 2HPHA 2Q07A 2LXEA 4EL0A 3RTGA 3I05A 2DH6A 1QIFA 1OAKA 4GOJA 1GY8A 3DSRA 3P9QA 1KAQA 1YCDA 4KFRA 5D3MB 2G4VA 1KYQA 1GCGA 1HEIA 3DB2A 4DCTA 1ZA2A 1NP7A 5J58A 2A5YB 3IIMA 4TLCA 1TI7A 2GEDA 4GECA 2A1IA 4IXTA 1L4UA 4X65B 3PUVA 3RUCA 4EIWA 5JZOA 1ZH4A 1YVDA 4BRZA 3NBUA 2AG8A 5A71A 4DA4A 1EZZA 2A0XA 4EQ6B 2B2NA 4I8DA 3U3XA 1PS0A 5D3ZA 1P91A 3MRSA 4L2IA 2Z5FA 1SCJA 1ZFNA 2CV1A 4U6NA 2IYWA 1TK9A 3V97A 2Q9UA 3NT4A 1HGXA 3ENVA 4ZCLA 2V7EA 2XECA 1DIRA 1SBQA 6CHYA 5LD2B 2UXBB 1L1QA 2OY0A 1VA4A 2Y4OA 4EZBA 4OAPA 3OA0A 3SZUA 3KB2A 2EA0A 4WKGA 5IDXA 1NUHA 1C1XB 2W93A 4QOEA 5IBQA 4RW0A 4ENQA 4OHWA 2GD1O 4N12A 4UREA 2EKBA 3MXOA 3LCJA 1KAEA 2B9EA 2FE1A 4P33A 2XCLA 1ID8A 3DMYA 3WGNA 2AF4C 1ZM4A 3EPPA 4G65A 2D6FA 4RC9A 4TVBA 4DDTA 1NPDA 2JNWA 2QD1A 4WY8A 4MGEA 4JI6M 2XB6A 1SOMA 2IYTA 2PL9A 5F7ZA 2FSHA 4HH1A 1B14A 5DJ5A 4FN4A 4W9NC 1N5KA 4Q3BA 2VJMB 3L92A 4PLPA 3F5DA 1E8MA 3SQOA 3U6OA 2W6JA 1YUMA 4QARA 4WEOA 2IUSA 4S1TA 3QYEA 3PUYA 5WRFA 1U7HA 4QNMA 1R8XA 2K7FA 3JR3A 5IAKA 3QLUC 3RS4A 1DG1G 3HYCA 1ISRA 3NZEA 5GIPE 3Q7SA 2PGIA 1XZKA 4MCJA 3UKOA 4RV4A 3ZDRA 4KQWA 5JV5A 5TE9A 4DM7A 3IOYA 3QYBA 3BIJA 3WKBA 5DNVA 1BZYA 2PXXA 3I58A 4AQDA 1AK2A 3CG0A 4ZVRA 3CNLA 4NC9A 1RIFA 2CF6A 2VUHB 3EQ7A 1MJHA 4W5OA 4C0SA 3JZAA 2NO4A 3D4LA 2YN2A 1M1YA 4XVQA 3L41A 4DVJA 2PQMA 1DKNA 1RWVA 2YVAA 3SVZA 3L9WA 4RVSA 3RYIA 1E32A 2AOUA 4I5EA 4KP7A 1V1MA 4OXQA 1LSOA 3K8YA 3IT3A 2MCFA 4FZ3A 4GWGA 3IBTA 2YC4C 3OVMA 4EQZA 2BR3A 1L7QA 4P5DA 1YWGO 4H3KB 2Q9BA 3CZ9A 1DAFA 2O8DA 3G79A 2VAPA 3OFJA 1F8YA 2AEJA 4H9GA 3DZGA 4OVKA 5EIEA 5JNRA 4LF8M 2MMCA 1XJWA 1VLJA 1U2EA 3LIPA 5IWAB 4CMKA 1MX1A 3OF2A 1RYZA 1PFGA 5IAEA 1NF8A 2D7GA 4TQGA 2W6ID 3Q4GA 1BU5A 3INNA 5KTPA 3PRKE 1K8YB 2GNOA 5DVZA 3OHMA 3CC8A 5TGTA 4QOSA 1YVEI 2B30A 4N41A 2VP9A 3B82A 3FIJA 3NP7A 4LZOA 4BNHA 1TK3A 5GP1A 3QVKA 1LBQA 4LJSA 5I9LA 3FI9A 3ZGZA 4JP3A 2FKAA 1VXOA 2EUCA 3PXAA 1C81A 2J3DA 4HAUA 2P5YA 2I66A 1YDFA 1BHJA 5EIXA 4J4HA 4BEVA 3U60B 3WNVA 4OJQA 1ZR2A 3VR4A 4GUAA 4AY6A 5CPBA 2I54A 1NW8A 3SYLA 3AR4A 1RQ7A 2WWGA 4IMPA 1SVIA 4V03A 4NULA 3OP4A 3ONFA 3D5TA 2J41A 4JJFA 4EVRA 4HDSA 3IE0A 3BTSA 4HMPA 3D5QA 5AKEA 1XBTA 3LC2O 4RULA 2GBIA 4MQ4A 4PTZA 3E2MA 3U0BA 4DSUA 4UCXA 3GEDA 1XD9A 4TV9F 4S2UA 3B7NA 1CTQA 4JT2A 1CT9A 3AVQA 3FGOA 1RXUA 3Q8MA 1R5OA 1RCUA 4ZA2A 1IUKA 1RLIA 2XCQA 4YREA 4E09A 3G1WA 4WESA 1PZXA 3D43A 2NU9A 1GUZA 2UU9B 5HCIA 4UU0A 3N75A 3FMFA 3LQYA 3PA8A 1T1GA 3QE3A 4IQFA 4ZU1X 3OETA 4I9HA 1FIUA 3H5IA 2F3RA 1KMCA 4B87A 1XPUA 3ZVMA 2PLRA 2ZTMA 2X0NA 1LJLA 3VAYA 3U44A 3WWYA 5C8YF 3R20A 2O8FA 4Z9YA 1GGJA 2B7LA 1VLQA 5G3YA 4TLLB 3TIFA 3KOMA 3TZKA 1P9RA 2A84A 4U2GA 1GCUA 4DV4B 1VHDA 1WU8A 4ZJZA 1Y82A 3PGXA 3MS2A 1O58A 4MV1A 4Q1EA 3N0XA 3C8DA 3KQKA 4LHVA 4EO7A 4QBTA 2GK3A 4I7EA 2CLDX 3ZXYA 1TUBB 4HH0A 3H83A 4RHTA 3KZ1E 5AFSA 3L0PA 3E0QA 4OMFG 3BERA 1ZGAA 4LYGA 3ABIA 4HDKB 1FMJA 1ULUA 2NZUG 1DAMA 5BVHB 1B2LA 1I1NA 1QNLA 1ISJA 2WM3A 1WLYA 2WFLB 1DEKA 2B0JA 2I65A 3U5TA 3D0KA 4GXTA 5CFQA 1D6NA 1VMAA 4J75A 4G0XA 2EJVA 4KIUA 3L8HA 2PSFA 1YAJA 3W3AD 2GEKA 1GQOA 2XZPA 3OPXA 4S1PA 3BMOA 4M88A 2PUHA 4J7UA 1IM5A 1O95A 1LVGA 3N86A 2KSQA 3NFRA 1OZFA 3SJZA 3NYRA 5BR4A 3ID6C 1GRCA 3MIZA 4UCQA 4X3PA 3AERB 1MPXA 2WF6A 3T41A 3R8FA 3TNYA 4I5FA 3ELUA 4IHAA 2JJMA 1W4BA 1CJCA 4F9FA 4OUDB 2VLBA 3SHQA 1QHHB 4OREX 3IEVA 4DMRA 2BBWA 4FPXA 4WZAB 3TNFA 1QRSA 4WLUA 4HGRA 3DPSA 1YI1A 3JQGA 1U7TA 1R2YA 4FU0A 2LBCA 1E4EB 1Z2EA 2XBUA 3UXMA 4UCWA 4L9RA 2YJZA 3AP1A 5JNLA 3QMVA 3R8XA 1WR8A 3IO3A 1YT5A 4KN6A 2QW0X 1SN7A 3IUJA 1RHKA 5H4GA 1N2IA 3GFBA 3P9RA 4B2PA 2ZE8A 4GP9A 1BHQ1 3W8DA 1WSBA 5JLJA 3S81A 1QAQA 5CB4F 4NMHA 2QZ4A 3F73A 2QZZA 4ZDJA 4X91A 4L02A 2XVAA 2PM8A 3T7JA 4ATNA 2GT1A 1EUCB 4LZAA 1TCUA 5D85A 3JQBC 4UAGA 3VFDA 5K3CA 4ARBA 2W2MA 3KYJB 2Z83A 5JZVA 5B64A 1OH7A 2JI9A 2VPTA 1O96A 4LSMA 3CBGA 3TZHA 5HFNA 3T1YB 4X8MA 4P7JA 2VTBA 3K15A 1AA6A 4Q4DA 3NBAA 3RVLA 3EFHA 4QU5A 1U8XX 1V8BA 2IJGX 1CC1S 1AO3A 3DG9A 3ZV5A 2RKOA 2J6CA 4Z9AA 3DLIA 2YV1A 4M0FA 3ETDA 4IJ6A 4D9MA 3RWMB 4U7FA 1A72A 5M2QA 2OB1A 3OZAA 3RSQA 1G8AA 1X7DA 3MSXA 5DGDA 3MELA 4PQGA 4H0CA 2ZRCA 5B1YA 4S24A 3DMPA 1FRQA 4NE7A 8LDHA 4IQ4A 1JDVA 3DQZA 3MFYA 5E7MA 3BCSA 4RO0A 1ZMVA 2X49A 3ZCXA 3EIEA 2D4AA 3F67A 4OH7A 1G55A 2PO7A 2HIAA 3B3GA 4BN5A 3MPUA 1Y81A 1NHWA 4JR1A 4MEAA 1U1DA 3V80A 6AT1A 3QELB 1LLDA 3C3EA 3G7UA 1JIUA 2N42A 4DRXA 2SKDA 4OG2A 2WIDA 2HY7A 4L85A 2JS7A 2A8YA 3MLBA 1OA0A 1EFCA 3ZCQA 1K66A 3C0KA 3B1KA 3WL7A 4MW6A 3I9V6 2O5CA 3SG0A 5IKEA 5G0UA 4ZC1A 3WLFA 4DLBA 4MA5A 1Z0DA 4NZMA 1DIOB 4YJ3A 2V0GA 4IDQA 1ZJWA 2IIQA 4B3HA 1E2PA 4IEEA 1Q83A 2I67A 3LTEA 1K2WA 1COWD 2H63A 4REMA 4TKVB 5FYQA 3FZYA 4HY3A 3G3EA 3IJEB 4M1QA 1T36A 5CPFA 1KFVA 4BLVA 4XDZA 2Q29A 5JNSA 3L1HA 5EJAA 4BO9A 1L3CA 3BGIA 1ZJ4A 4JNCA 2G1KA 2C5GA 3ANSA 3F3KA 2E7ZA 4NZYA 5LA6A 4P3XA 4NOLA 4YK7A 4GO1A 4KNWA 5LOVB 1A9QA 2VYFA 4DIMA 4EW1A 1KMQA 1SVOA 2BLNA 4CMIB 2IXEA 4ZYUA 3DYVA 3CGGA 3P96A 4BRWA 2GRJA 3OTGA 3ZR4B 1PF7E 3CLUD 3OE7A 1QS0A 1XRLA 1AK9A 4EJSB 2ETVA 4XFKA 5K3FB 4UFPA 3OBBA 3DL2A 4UAVA 3FX2A 4KL8S 5JUWA 4FIZA 4YI3A 1L7DA 3GZTB 3B1ZA 4DT1A 1Z7WA 3CR8A 5F7XA 2C2OA 3RS7A 5SY6A 4QDKA 2V0NA 1RLTA 5DEIA 1PSZA 1E6CA 2WICA 2I8LA 2PGAA 2CXHA 3SI7A 3VZBA 1CDEA 3O8RA 2B99A 1L5KA 2G77B 1LTHR 1GN9A 3OC6A 4JL8A 5FDFA 2DBRA 4NAHA 4PSDA 5AKIA 4YCNA 3P0IA 1M83A 3RROA 3C70A 2HWXA 1M74A 5CCBA 2FEMA 2QR5A 3G23A 1ISMA 1G41A 5CT6A 5CLHA 4D8TA 1MH1A 3HL4A 2JDIA 4MGIR 1Q21A 1XLTA 3VI4B 2E21A 4Z99A 3KO8A 3MTQA 121PA 2CNNA 7CATA 1XZIA 4HRAA 1NUQA 6Q21A 4OBXA 2BY4A 2FU5C 2QRZA 4A5OA 3O90A 1EDOA 2P2SA 5IF9A 2FW0A 2ZXEA 3ZWKA 1SOUA 3UO8B 1QHNA 3O47A 2ADMA 1DBVO 1PTJA 3KJFA 3PYLA 1U8AA 4WECA 2CMKA 2QAGB 1VCHA 1RXIA 3DTYA 1CULC 1YB2A 3CLSC 1V9LA 3GAZA 3IHTA 1DEHA 4DV7M 3LT4A 4X3CA 1MO6A 2OHHA 1L4EA 5JBNA 4UZFA 1ZNXA 1PVOA 3W4IA 2B25A 1Q77A 3IA7A 3VVBA 2ZCVA 2DJ5A 1GL9B 5K0NA 5JALA 2NU6A 1KJNA 1M1NB 3ZIUA 3SYMA 1T6OA 1J42A 1P80A 3THXA 3H11A 4FZVA 1W93A 2WDPA 3TR6A 2WKWA 2XLJA 2KE5A 2RJOA 2RGWA 1GEEA 1Q12A 1CJTC 2HDWA 1TVKB 2ZG6A 2RC6A 4KH0A 1PV1A 4KI7A 1N5MA 2EJCA 1YMUA 1WB4A 2ZI9A 5JROA 1MJGA 1UBNA 2QJFA 1SULA 1TZ2A 4NK4A 4K0KB 2B98A 3UUWA 1KI3A 3TRIA 4REQA 4HGZA 3L8EA 3Q6IA 3NI2A 1W5TA 1K3WA 1V4BA 4HPJB 1P5FA 1XCMA 1FDRA 2XTNA 4K0RA 1X1SA 5LYJA 3HY5A 2I2CA 5KNBA 4WOBA 1M6NA 5H80A 4WRRA 4O59O 2F4VB 3TD6A 2ECPA 4O2AF 4Y9UA 1VDDA 4JBWA 1YKGA 1YS6A 2R6R1 3HJ8A 2QE7D 1LK5A 1ONBA 4D74A 2PVCA 4MKGA 2O7RA 5IBCA 4QXOA 2IHNA 3DTVB 1EXNA 1INLA 1R37A 2X23A 1UBMS 3P2IA 1OXSC 3KEOA 4RIFA 3QBJA 1A97A 2HK8A 2DKNA 4ABTA 5TGZA 2G0TA 5LUBA 4ZO7A 2PUDA 3WR5A 2EX4A 5AHXA 4KXUA 2FZ5A 4KN5A 4NK5A 1SCAA 3VOBA 4OLAA 3CB2A 2PCLA 4G1CA 4AM8A 2OV8A 4P84A 2REQB 5DH9A 5JQGA 4RVNA 1GGNA 1GSAA 2ZRFA 3TBKA 4LXUA 3DKRA 4MQFB 1V26A 4PZZA 2PJDA 2M6LA 2XT0A 2X5OA 5DWVA 2UUCM 1X9GA 2FWRA 3IE2A 4DIKA 4MB7A 2O7VA 1NXSA 5IBPA 2XFSA 3JQAD 4IGIA 3EXEA 2I71A 4FOOA 4V38A 2R8BA 4PG5A 2ODNA 4BMCA 2CXUA 4XVHA 2WSMA 3I4CA 5FIUA 4EGAA 1DKMA 1N3YA 2JK1A 3N59A 1HT0A 4I50F 2GXSA 2Z8XA 3QXCA 1G8YA 3DEJA 3KE9A 3HJGA 2IHVA 2IGBA 1YS2X 3EUEA 3WGKA 3E4CA 1JHAA 3DE5X 3BB1A 4M8NE 2B1IA 4LFAM 3RS2A 2PWZA 1U63A 1ZWKA 5J4YA 4X85A 3DBHA 1Q0LA 3D7MA 2QUHA 4AFNA 3DLPX 1U6IA 3OJ0A 2NMVA 1ZD8A 4QKQA 4L50A 4V24A 4DLVA 1FUYB 1T43A 4UU1A 5J3JA 3ZWMA 4PXAA 3A27A 4IQGA 4XX1A 3IUMA 3KSMA 4JROA 4AG6A 3KAPA 4HLCA 3DVAB 1Q17A 4LY3A 5K0LA 1UK8A 5CXSA 3PJGA 1WRBA 4H59A 1J1IA 2AWOA 4DVGA 4EY8A 1ZRSA 1JJIA 3S55A 3EPJA 3OZDA 2Z3VA 4C4SA 2XPCA 3IVMA 2R6CA 2D59A 10MHA 1KOLA 1LPMA 3D4NA 3MD9A 1SM4A 2PH3A 4NMMA 1E1YA 3N8HA 1U0OC 4R2XA 4WNYA 2QVYX 5IPFA 4Z54A 1S2NA 4HDAA 1H0SA 3WGUA 1RDFA 1PR5A 5ALMA 2QLFA 4P4SA 3A1UA 2A9RA 13PKA 1MT0A 2I0FA 3FUCA 1OXXK 2Q0QA 3J81S 4FCCA 2O52A 1JSLA 1BEZA 1E7SA 5F3WA 3A37A 4NV0A 5LP6F 3ZJVA 4MWSA 2REXB 3PNPA 3EARA 4C7OA 1X1CA 2X0JA 2J85A 5CX4A 1M1XB 1EWKA 2R87A 3TZCA 1MO5A 4OI2A 4V0SA 2F3PA 1G18A 5JTUA 3F3MA 2RH5A 3AF5A 2HIHA 1RP1A 5JCOC 4G37A 4RQTA 4DCPA 5DGTA 1MBZA 4KPEC 4NH4A 5G1NA 3VH4A 4QU8A 2AHRA 4BQFA 1S7GA 1ZHFA 1ODLA 1KIFA 4INAA 4GOKA 1P3JA 4CMEC 2GQ0A 1NN0A 2VHJA 3K6SA 5FWAA 2C3UA 3FTPA 4XK8F 4JSYA 2QX4A 1NBMD 3ETEA 3WKDA 2G1PA 2ZB7A 1HMPA 2EIXA 1J07A 1U2DA 4B6JA 1EDEA 3N2EA 1H6DA 5KTSA 3MT9A 4GF5A 5LZ2A 4LG2A 1R6UA 1OT5A 1MRZA 4ARCA 2Q4OA 2AI2A 1D04A 1KXZA 3E9MA 3M33A 2O14A 3I52A 5F35A 1Z08A 3BK7A 4BFWA 1ODTC 3IP5A 4Y6GB 5ITYA 1M34E 2ZS7A 4CNQA 1FP6A 3EAFA 3ORRA 4ESOA 1FK8A 1WNFA 4DUGA 1U7PA 3WYCA 1ZVQA 1O8CA 1XIVA 4BQEA 4BNZA 4Z4HA 3EK2A 3IQEA 3SX2A 3FG9A 3KJGA 1SXJC 4XQGA 2DU8A 3PTAA 1F4VA 3GGGA 3JD1A 4PCVA 4OX9M 2WJZB 1POWA 1X9IA 2B35A 2QMYA 1FSGA 4DA7A 3UICA 3E9QA 1J2YA 1ZUIA 1G20E 4K9PA 2O6LA 2C2XA 4E5UA 2QXTA 4CTJA 3TQIA 3WI7A 4PHGA 3R7LA 2UKDA 1FP4A 3SYKA 3GEPA 5HWSA 5BR7A 4N9WA 1HBJA 3LECA 5K3EA 4K6HA 5CW2A 2QPOA 1E4YA 3RWOA 2YXDA 1GNRA 1YCHA 1NVGA 3RK1A 4MIYA 2ZTVA 3UBMA 4OQFA 2BF4A 2NIPA 2J7PD 3N7AA 4HWOA 3Q3EA 5DNWA 2OUIA 3BRWD 3GELA 3H6GA 4BVFA 3T6PA 3TFQA 1QGYA 5SV2A 3TTWA 1QRAA 4X95A 3PD7A 1SQ5A 1XNQM 1QX4A 2NXEA 1O5IA 1QHGA 2YCBA 3N0WA 4MYCA 4TWBA 4I3GA 3IJPA 4RKYA 3WLTA 1JG3A 3Q0EA 5FJIA 3HNPA 4G4SO 3WBFA 2BGUA 1UBKS 2F90A 4ARSA 3PLAE 3NASA 4QGSA 1WXFA 2J9FB 2P3QA 5JMTA 3N3BC 1H2FA 4DIEA 4E4TA 4DV6M 1IEVA 1E6UA 2RGBA 1NU6A 5SYAA 1I3OA 1Y1RA 2L2QA 3V00A 1SOWA 1NNJA 3E82A 4YP6A 5DRYA 4XXHA 4DLTA 4KX5A 2BFEB 5DN6D 4TWZA 1UXHA 5E6SB 3D9QX 2GWHA 2OWEA 2KPOA 3LUGA 2VDKB 1K86A 1RLUA 4BVKA 1E1CB 4GL4A 2PWBA 1KJIA 1NV8A 4GE0A 1PL7A 4RY0A 1DRJA 3K9OA 1OU0A 2OV3A 3AEUA 2F9FA 2PMEA 4Y9SA 2EGGA 1ODKA 2V1XA 1LU9A 1VJ5A 5IARA 1GPYA 5LM3A 2UUAB 5CEEA 1AUQA 4HEHA 4AK9A 5L53A 4MRAA 2HJWA 1I01A 5DFLA 1VB3A 5DXAA 5EJEA 1GT91 4EB3A 1MVOA 3DUFB 3BM5A 2V7QD 1Z5CA 4NTZA 5DW3A 4UVHA 3GQBB 4KK4A 4PZ0A 4A4DA 5K8VA 1H0RA 4OJYA 2TS1A 2YVKA 1P61B 1CRLA 3Q6NA 2ZVQX 3ADKA 3PGKA 1R66A 4Z5XA 2Y1CA 1ZY2A 5AIBA 1WXDA 1ZU5A 2QY9A 5LMNB 4PYRA 2DWOA 1NURA 1JIQA 1EX1A 3F3YA 3MJSA 5JZSA 2GD6A 4OD0A 5HCUA 3WXBA 3EDMA 3CX6A 3VMMA 3ROZA 4UVDA 1HZZA 4PWZA 3R5FA 1SG6A 3ZZ0A 3O94A 2OK7A 3X1MA 3RC3A 3CZRA 1WD5A 1JEQA 3FCXA 3EEFA 2YHIB 3AXTA 1WOYA 5T57A 1E4OA 1DWPA 4FIDA 3G02A 1BMFA 2QT9A 4P0TA 2YZNA 3RYFA 3ZD8A 3HBNA 5A06A 1MB2A 1E2MA 4TSKA 4O3FA 4RY9A 2MROB 3C3DA 3C98A 3RVNA 3EA5A 3F74A 2D1TA 1YTUA 3B38A 1VJGA 4EG0A 5BYJA 2DFTA 1LBTA 3KSAC 3T3HA 2DWPA 1DS6A 1ST2A 1QIMA 1RQPA 5BSKA 3E18A 1DCMA 1EB9A 1N32B 4DDVA 4ISCA 2PKRA 3WYGA 2V4UA 1P45A 3X1JA 4N5LA 4O33A 2FRDC 4G2NA 1NIPA 1KGDA 4TWJA 4G6ZA 2PRSA 3ANLA 3UT6A 4AS2A 4LEIA 3IQDB 4I9GA 1CERA 4PV7A 1N9ZA 3F4KA 4S1VA 1KC1A 3PUKA 4Q3DA 3BCHA 4NEHB 5A4FS 3KV1A 4O2BA 1WZCA 5GZ3A 4Q34A 2BFCA 3LHIA 1KH2A 1YU6A 1EUDB 1Y6FA 1OX5A 4O4JF 4CM6A 2PBRA 4IIFA 3CSUA 4E33A 1UWCA 2VP4A 5BYBA 4GI1A 3L29A 1R27A 5D6OA 5BURA 5G3ZA 1U90A 4ENRA 5FYDA 3THGA 2PEYA 4Q3OA 4OBEA 4M38A 1R4NB 4EX7A 4OPMA 4DWOA 4OXYA 1SXPA 1ZSNA 5KYGA 4ZT5A 2J0QA 1AB6A 2FN8A 2MSLA 5D51S 1X39A 2X1HA 3WMFA 1I0IA 3EA0A 3HN2A 4Q4HB 2Z2KA 4KQXA 3BUSA 1ESZA 1AQNA 3ZVNA 4TT3D 4BLUA 2OQIA 3OZCA 4GEWA 5TF0A 2WF9A 4PRKA 4KGXA 3BKXA 1G2QA 3TE7A 3D3QA 3PQ4A 3R0VA 3ITEA 5KNDD 5HUQA 1JG1A 2J7OA 1S2IA 5A4KA 5ANRB 2VF5X 3TLJA 1RXVA 2AJLI 5CTAA 1G38A 3L8CA 3ZDBA 4UZEA 3E7XA 1BHO1 1EHIA 4GYWA 4UBIA 3RIXA 4A6XA 3QLVA 4Z9XA 4AJ1A 4GMQA 4CZ2A 2QMZA 1I30A 2FW9A 2DPMA 2XRFA 2WJIA 3LQ1A 3CNEA 4X5OA 3ZBTA 4Z0PA 4A6EA 5ALRA 4XRGA 4ALKA 2GVDC 2OE2A 1VKOA 4Q4AA 2YXNA 1JF8A 5BV1A 5KWEA 3NOQA 1AHHA 3U9SA 2PH5A 4URFA 1JKJB 2OXRA 5GV8A 4LECA 2PG3A 2D0DA 3SBDA 3A6ZA 5CDHA 4R0MA 1CY8A 1G1AA 4NRVA 1UDRA 1Z0KA 3K7EA 1MABA 3E9NA 1ORVA 3IIJA 3L8YA 1Q0TA 1R88A 1JQDA 4NABA 1BCSA 3WV4A 3N0RA 3MJTA 5KVSA 4PFJA 1KMHB 3TW6A 5DM0A 1KAHA 2FMXA 1WF3A 4Z4EA 3BRSA 4JI8M 2D7CA 3AVVA 2DBYA 3QENA 2M1ZA 1Z73A 1IHUA 2XDYA 1VPEA 1IZ9A 3JSXA 5CFNA 3EEYA 1CY6A 4Q9DA 5PGMA 4R4JA 1AGXA 2UVPA 2WU8A 3E3NA 5FR2A 4RXTA 4WLNA 3CCBA 5REQB 4PZYA 2QRNA 5KOHB 5B2EA 4HXGA 1J2JA 2XQVA 1SHKA 4HFJA 3VU0A 4Y1RB 4OFZA 2BDEA 3TWOA 4O3MA 3LC7O 2UZ0A 4RAOA 4W1QA 4B3RB 5DBFA 1N2CA 3A6LA 3DGFC 4UM9D 5IJ0A 1HTWA 1NQTA 4EATA 4EAQA 1GARA 2G1UA 1V5IA 5F1OA 3NPMA 4CLRB 1EB8A 4F4JA 3HJSA 4PHHA 4JYAM 2NU8A 3HQ4O 1WIVA 3L05A 3ADCA 2DI0A 5I6DA 4BKPA 5ALDA 1LY1A 4M0CA 4FS8A 4P16A 1PJQA 4Q9NA 5CEFA 4YRCA 4BV9A 3EOZA 3SVLA 3K2BA 4BDTA 3K94A 1KWKA 4FILA 3SC2A 2P2LA 3B8EA 3IUYA 4HQLA 5BR8M 3ESXA 1E2DA 2ZPTX 4OBBA 2QTHA 1IY8A 2P9EA 1SKQA 3H8WA 1E1QA 3Q11A 3HKBA 3SQXA 4RK1A 2ZR8A 4EWLA 2IOFK 5C8VA 5EVCA 4P93A 4AC9A 2JJYA 3QI7A 2EW1A 5ILOA 1WUJS 1E8NA 3E22B 1TJ5A 1YR7A 5LXTA 2AFHA 5HVNA 4L8RC 2NVOA 1B00A 3T9AA 1V11A 4P6VF 1BG6A 3EF3A 4MYHA 3SBXA 2BWJA 1T1RA 1QFSA 2DR3A 4ZTUB 1BEUB 3DWEX 4Y2UA 2ZP1A 1DKQA 1UZAA 3B5JA 3N0VA 4MLDA 4LQ4A 2VNHA 4FHEA 2ORYA 5KAMA 4I4IA 3JQ9C 1X19A 1XZQA 3IVXA 3KR2A 3AY0A 4Z6KA 4TUWA 1QK4A 4XYLA 4HGOA 1HFJA 3RHTA 4UBJA 1YDGA 3UXYA 4PT5A 3VNSA 4AB1A 4QICA 2VNJA 4ENSA 3TDKA 3P1JA 3ITDA 4QU9A 5ICCA 1VKHA 2X7JA 4PHFA 3D6VA 1LX7A 2XOKA 4RU1A 4P7BA 2HQRA 3KETA 2Y9PB 2J32A 2R60A 4X90A 4ZHQB 1ZOIA 1T2FA 4V1CA 3QOFA 4BAGA 3A31A 3A11A 1GPJA 4RFSB 3BKWA 3D3JA 2Y67A 4RA6A 1X77A 1GTRA 4YAOA 5BO5A 3F6RA 3RS5A 2W2KB 1U5CA 3BPSA 3B8HA 4XRRA 3AM4A 4EGQA 2WHPA 4ZWNA 5FD8A 3E5HA 4IV5A 4MS3A 1XMSA 2X22A 4MARA 4GUDA 5GIOE 1L8XA 4Y6SA 4DCGA 3FIUA 3BJMA 2LXNA 3OQ1A 4DBGB 3AETA 4NIMA 1C14A 2MIIA 3KL2A 2OZLA 5CNKA 1UPFA 4MS4A 1YR9A 1V7QA 4Q3AA 3HFSA 4FR2A 2EC5A 1ISFA 3PEFA 3BMCB 2EFCB 4FNGA 5TT0A 2YYSA 1M2VB 4N8EA 5U4XA 2FQ1A 1YB5A 2X19A 4Q3CA 2XZOA 1X7XB 3GBVA 4HATA 2ZTLA 3GVXA 1RJDA 3K4PA 2QLNA 1TA4A 2GILA 1T5HX 4R1MA 3HCCA 5IKPA 3ZU6A 1UZNA 4IBOA 1P6XA 3D2BA 4NEGA 4LTDA 3ROKA 1LDBA 4G8BA 1JHVA 1YNOA 1WSWA 3EPRA 4O4HF 1S3IA 4JJ6A 1M7BA 2Q0HA 1JA1A 3B53X 4F2WA 1MRNA 3IPXA 4JS0A 2X4IA 4AKHA 4Q7KA 3BSYA 2AZXA 4LFBB 2A7QA 4RZHA 1RAHA 1NVFA 1N33B 1HE8B 1NWHA 1KDVA 3RTCA 4K6FA 3N9IA 3H3XA 4RS3A 1D2AA 2NZXA 3DTTA 4QEDA 1Z7GA 1C1YA 3TVTA 3LCMA 1AJEA 4WZBA 2X9LA 4X54A 4ETIA 2OK8A 2FSFA 1LZLA 3IS3A 3WJ2A 1YA8A 3WJ1A 1Y8CA 1AGPA 2OFOA 3OQ6A 2C4VA 1RC1A 4IRMA 1QVZA 2IU4A 3CLTD 3EYAA 3PWZA 3ND5A 1K82A 4MV9A 4DCNA 3RFTA 2PAAA 3T1TA 3NNNA 4PLVA 5C8YA 3WLHA 3OTOM 1M1ZA 3SYNA 2JHGA 2B8EA 3H1EA 1HE2A 3ASUA 1RXEA 4CMJA 1C50A 4X71A 4CF3A 4MV6A 1FVOA 3G13A 3OPNA 2QJOA 2WZBA 4DUYM 3K5HA 1RWXA 3N2LA 4MIOA 1JLLB 1KQNA 1V8FA 3MMZA 3OEHD 1RS0A 4MUGA 1BYUA 2GBLA 1YFZA 3U3RA 5AUOB 1LX6A 3QXJA 1ZN7A 4LYJA 2X4DA 1EVJA 3AZPA 1DPGA 3BXFA 3LFUA 4FMBB 1ZQ9A 4BBPA 2HA3A 4IJWA 1EM8B 2IYPA 3HRIA 1I7QB 4LZNA 4RVHA 5DM70 2VQEB 2PMKA 3DL4A 1JFSA 4R71A 3WWCA 3DB1A 3DOOA 5EKTA 2ZS9A 2AN1A 2IYLD 1N7GA 5MFPA 5CX1B 3STVA 3MT0A 4PAOA 2VQFB 4CIBA 3FLAA 4RVCA 5HQJA 1ZS9A 4YJ2A 3HCPA 5AOBA 2R0IA 1ZXBA 1SH7A 3SLGA 1A95A 2VJYA 3VGPA 4NWIA 2NUAA 3B1FA 2ZT6A 4OAQA 2OPFA 3RJ5A 3L49A 2WWHA 1DTEA 2W43A 4LOAA 1TTPB 2OWDA 4CKCA 3EODA 1B3RA 5I7UA 1UJMA 4JVLA 4K9KA 1HM5A 3BQNB 4M0WA 1PE0A 1CUUA 4XIGS 2UXCM 1EFVB 2NO6A 5G41A 4C06A 1C3JA 1QONA 3NXKA 4HPXB 1XXHB 2AMVA 2PT5A 5IDVA 2LNDA 4H08A 2IEIA 3KJEA 1CRWG 1EHYA 1CUHA 4E32A 4S1NA 2D1FA 4TTPA 1ZIPA 1PVVA 1KO8A 1XG5A 3V1YA 1HLPA 1PYGA 4BTVA 4BDSA 2H52A 4HEOA 3IBYA 2XSZD 221PA 1HKUA 1BE1A 1X6VA 1ZGHA 4JWTA 4HNSA 3GIDA 1KJZA 3RCBA 2FPUA 5I48A 4PM4A 4P3PA 1KDZA 2VQSA 1H4VB 1WPRA 2WTAA 3AF6A 2XAAA 4NOOB 5D6NA 5LJLA 3TXYA 4YJKA 4A27A 3PEWA 2JI6A 2B4RO 4F60A 2OOAA 4D3YA 4WLOA 2JASA 1AVTA 5HS4A 3AM3A 5DU2A 2XTAA 3V7UA 5GM2A 1L7RA 3WLQA 3FCOA 4F6RA 3N2GB 3CLTC 2O7SA 3ITKA 3NTQA 1MAHA 1S4QA 3AUXA 3GFOA 1P3DA 2XMQA 3JCZA 4PYIA 1IAQA 1RVDA 3FNHA 3R6WA 4OB7A 3MJCA 3DLAA 4OQEA 1QH9A 5AXCA 5C7IO 1KJQA 3ESDA 5B36A 3U4AA 4ZGGA 4OH1A 4YJDA 2VCHA 1NNI1 5TB5A 4Q1VA 4LKRA 3K0CC 3B7ZA 4ZZ2A 1Z4MA 2NQ8A 5B1DA 3JAMS 2KHZA 5J9FA 3AUTA 2XFTA 4MVXA 4B3MB 4I5DA 1IPEA 1DJPA 3D4BA 5CUQA 1KMIY 1XTUA 1ZD3A 4IDAA 4H6XA 4YX9A 4QJIA 5DXFA 5K0FA 1JEYA 4TQUS 3I9MA 1K7FB 1JP7A 3Q9LA 3FTNA 5BOVA 2ECFA 3RJZA 2P6MA 3TLYA 4YJHB 3GA5A 3KQWA 3N5CA 1ZMOA 1LI5A 2WW8A 4BTLA 1JEDA 1UZUA 5HFAA 3M5DA 1LTQA 2ZZKA 4GQAA 1GITA 1C4WA 4ZQIA 1P4JA 1QIDA 1MTZA 4TMKA 4QVGA 2JBHA 4FTWA 2O07A 4L9WA 3DW1X 2XF2A 4O4IA 2OCDA 1X94A 1Q3BA 5ITUA 3U3MA 3RU3A 1HDZA 2LDBA 1B15A 4E31A 3W90A 2G40A 1OPRA 2ZRMA 2I76A 2YFHA 3HI4A 1II8B 3W0LB 5J4KA 1QWSA 4MB2A 3L0DA 4M0DA 3EZYA 3ILSA 3T95A 4QUGA 3AF1A 1SG9A 2XYPA 2WD9A 3MYYA 2W6CX 2OECA 3HPRA 1CR1A 2DNAA 4NCXA 4OYHA 7GPBA 4JP5A 3ZK7A 1IXRC 3QEJA 1P4AA 1SBCA 5GQSA 4AVYA 2FZGA 1F8FA 2V5UA 3I8OA 4F4HA 2PYDA 4PZEA 2YUIA 4WZAE 2BHRA 1B6GA 3WDKA 2FUG6 1FMTA 1EFRA 5AHOA 4XTRA 2XCTB 4QL3A 2PWPA 1XVAA 2H4ZA 3GBSA 4Q02A 3VYUB 1IOWA 4RH1A 1GUBA 4O63O 5AVYA 2NAPA 4P7FA 5CG2A 5KNCA 1FFHA 2VT3A 5L4NA 1IRXA 4L6IA 1YACA 1A9OA 3W5SA 2AZDA 3C1UA 5JSKA 3F6PA 3RYTC 1J9EA 2FJUA 2B1GA 3QUQA 2XNHA 4BJ3A 1JLSA 1JNYA 1S96A 1AUPA 1TYDE 1IBLB 3FN4A 2ZYIA 2A0WA 3N8DA 1KFBB 1JAYA 5IG2A 3S4YA 1MPTA 1K9VF 3Q8GA 5TPWB 1VHLA 1FCJA 3X3HA 3QXXA 1PGOA 4BGIA 1MH9A 3LP8A 4QASA 3G5MA 5EMLA 3GQ3A 4DDWA 1IZ0A 2C97A 2ZXFA 2I7NA 4K6GA 2NXJA 1BMTA 1YQ9A 4LVOA 4ZCQA 3PC8A 4MYSA 1NW9B 2YIDA 2PBFA 3DZ8A 1E3SA 4ITQA 2PRYA 4E6PA 4YCDA 4CN8A 3DMHA 4DJAA 3RD5A 2Y0CA 5HDQA 1TQDA 1T34A 4H18A 2WG1A 2BBSA 1FUUA 2JXNA 1U2ZA 5KJ6A 2EYUA 5I9TA 2XEPA 4WASA 3M1AA 4G4SP 1CHNA 4D25A 3BZBA 2HQSA 3TO5A 4GXRA 1SOVA 1UDWA 3HYLA 1V71A 3CNHA 2IZ5A 4U7TB 5J2UF 4TMYA 4H7HA 1U8FO 1TUGA 5A5GA 4J4TA 3R7WB 3EDRA 1NW3A 1N9GA 1HQDA 2ZTUA 1QHFA 2JFQA 4WZZA 1G59A 1J21A 4U7PB 4CLHA 1E58A 1A2KC 3F6SA 3PR3A 2EBUA 1KK2A 3WXMA 4MGHA 5CLQA 4YFYA 1R2ZA 3DKVA 2KWIA 1X8XA 1A9TA 4ZZIA 4HRYA 4KR3A 2GN0A 1QLHA 3QBVA 2AG0A 3RVSA 2X9VA 5AICA 2PA0A 2A5FA 3ZWQA 1V16A 3MGCA 3ZXXA 3HXQA 3ZHUA 5HQTA 3WRYA 3SPXA 1IIRA 3UT5A 4D41A 4W99A 2Y92A 2EIHA 1G4AE 5FUXA 2LCIA 2OORA 3CLSD 4QYSA 4F1JA 1PR0A 3UMFA 3LCVB 4KVZA 3KQUA 3STXA 1N34M 4O2AA 2HQBA 5A1JA 2QIPA 4IIYA 4KVGA 2IDJA 3O4GA 4AW9A 3A2KA 3SOPA 1X7YA 1G0NA 3EG5A 3QVUA 1FMLA 4WGGA 1TZCA 4K6CA 1C7RA 3VR5A 3DHNA 3LAWA 4GKAA 3IBFA 4MVJE 2R66A 1AHIA 3ZNPA 1NONA 4KXMA 5CR9A 4GXQA 2SCUB 4XQ9A 1US8A 2GM5A 4RMGA 2BC9A 1GG8A 4RWEA 1TD9A 2NV2B 4E15A 2OGSA 3CU5A 5LMCA 5AKHA 2OBLA 3GZNB 3C6XA 4LRUA 3MINB 1DO8A 1OLSA 2BISA 5LC1A 3CF6E 1M2GA 4TMTA 2EW2A 5E9WA 5CM2Z 2N9UA 3T9FA 4NCBA 3HB9A 4FCTA 3RSHA 1DPFA 2ZAGA 1XTKA 2VRCA 4HN9A 5DX8A 2YMMA 2W6QA 1XKQA 5BPFA 2Y76A 3VZDA 1ZRNA 1WMBA 1SU7A 3WTCA 3VAAA 4I50A 4LDPA 3WICA 4CMHA 4UQPA 3K9HA 5AJHA 1X1QA 2RH9B 4LE0A 3HA3A 4KGVA 1N0IA 2E6UX 2JIOA 3RU7A 3F5QA 2AXPA 2VAMA 2JLBA 4QYIB 4RD2A 2XQKA 2W58A 1E6KA 1KBOA 2VJQA 5T67A 1ZNWA 5FWDA 4KPUB 2IUTA 4QAJA 1WB5A 1P4RA 2H17A 4MSUA 1HDCA 1IL0A 2YTZA 3IXMA 4GQIA 4NU8X 1GPBA 1JWAB 2JGDA 1GG2A 4M46A 3QPUA 3WE7A 1FFDA 4DFDA 1SQ6A 3UJHA 5K2OA 4AZ0B 4J0JA 1C7ZA 3WK4A 2AUMA 3QW4B 1TJNA 3LPNA 5IFLA 1F1JA 3PX2A 1FSPA 2E49A 3S2IA 2J9RA 4NBTA 1FJ2A 4F04A 5E6JA 5F1KA 2JLXA 3ASVA 2Q6IA 3WIOA 3DOIA 4N0PA 1J70A 1IJKA 1REQA 2FB9A 3ECCA 4W1SA 1E9FA 4QT4A 1MZVA 2A5JA 3K71B 3YASA 4UEQA 1PEYA 2KJQA 4L8YA 2HO5A 1NDQA 4ETMA 1E20A 3OFVA 2ZIGA 5AW4A 3EXG2 1EWQA 3BWXA 2G08A 3TWMA 4F3RA 4ON9A 4R31A 2BGNA 3LOUA 4IMIB 3W05A 5UKDA 3E7WA 4HO1X 4YI5A 4RTKA 1M54A 3H65A 2ODBA 4R7ZA 1SFRA 4LWZA 4ZGBA 5F4BA 5BOSA 1RKVA 1YIOA 1GPWB 1PLKA 2IKQA 3X1KA 4IW3B 3L7YA 3UHFA 1J23A 1M9NA 4EVQA 5JXHA 2QLMA 4CISA 3OZEA 3T4EA 3D6AA 1KPIA 2D5LA 4FEAA 3S27A 2WIKA 2XRMA 4N5HX 3DWGA 4TMXA 4PPYA 2ZITA 1HDIA 1MR3F 4WOJA 3MYRA 1NNSA 4R0VA 1AKRA 1ZUNB 4UTPA 1BROA 2WWXA 5B7QA 4QFDA 2ECQA 2C3MA 2IUFA 1XNRB 5BNWA 2DCUA 1Q5PA 2CLFB 3L6DA 4K9OA 2C20A 1JFRA 2PHZA 5C37A 2N47A 1H1TA 1YJXA 4M7OA 1B43A 4G25A 3QY9A 1LF0A 1H5QA 1YR8A 4TZTA 4Y7DA 5FNVB 4OV6B 1HKHA 2ZTHA 3NM6B 2W2XA 5EWJA 3ELBA 4M6WB 3OPVA 1UBEA 2Z6VA 1AQ6A 3KOXE 3BXOA 4EY7A 4CEJA 2REBA 3HZJA 3AJAA 5BNZA 5JC8A 3IVGA 1C1DA 1BH6A 1E0SA 3W5DA 5FO1A 1D9XA 3ILHA 3IC5A 4EGCB 4LN1A 2J5YA 1Z5AA 5LZ9A 4RBNA 3HYRA 3F2IA 4HSGA 5EY5B 5J63A 3LGAA 3UG7A 5B3KA 1I33A 3ILKA 5JJKA 3WZMA 3KQLA 1JG4A 3AINA 3ONDA 2VEDA 2HQOA 5SYMA 3WJ7A 2L42A 3VI3B 3OIVA 2IYXA 2Y68A 1QIEA 3HDYA 4JEMA 1DV1A 2PUAA 3CUVA 1UAYA 4XCXA 1ZJYA 2DAIA 1EJ2A 1UL1X 3L6OO 1TQ8A 2TMKA 1L2BA 3ZV4A 3D0QA 1CEYA 4DMCA 1WQ4A 5AM0A 4TLDA 3BHNA 2XE8A 2Q27A 2DWUA 5F9FA 3PA6A 4BMXA 4G4NA 4Q12A 1FU7A 3IXLA 5A0TA 4JB3A 2JY6B 8OHMA 1GA1A 1L0BA 3JPWA 4LWOA 2JFBA 3AG5A 1PGPA 4B3FX 3PCRB 3VPXA 4OLBA 2WFMA 4FXOA 3TMAA 1V1RA 2HQ1A 1BHSA 4WFIA 3VO1A 1R16A 4FR0A 1CUZA 2MINA 4URUR 4J91A 2VP0A 3WHKA 2ENWA 1KKMA 3CVXA 3JRWA 3MWEA 4U9HS 3WGLA 3SWWA 3IIIA 1IVYA 4UQLA 1VHQA 3CM0A 4ND1A 1Z8FA 4XPIA 2J9YB 2DKFA 3NC0C 1SXJD 3OI7A 4P4NA 3AJ8A 1N2GA 3G2QA 2C2WA 3MGKA 1YR6A 1MU0A 3GU3A 1JZTA 4WE3A 4NENB 1FUKA 1KY4A 3EPKA 3U1VA 1GZ7A 3KG2A 4FWIB 1VLVA 3TTYA 4L9AA 4DJTA 4UXHA 1VRCA 4N6GA 2D2FA 2CXPA 3V2UA 1M8PA 3K70D 1ZM2A 3HA5A 2XMCA 4GKVA 4MRMA 3RLFA 3R7BA 8AT1A 3PT5A 2V03A 4G5YA 1F2TB 3QSGA 2HRCA 4RETA 1TRHA 5YASA 2RAVA 1VJ1A 3QF4B 5G0SA 1EIZA 4CIVA 4F11A 5FL7A 2QQ0A 4XWKA 3ZHZA 1E7QA 2LHCA 3A3PA 4B6OA 4WAUA 2HBYA 4RTRA 1CQXA 1RJGA 3UZUA 2YC2C 3BJEA 3VJMA 3GEGA 3U6CA 1HRDA 3HTXA 3JYOA 3TSCA 3KJZA 3A45A 5LZ4A 2VHXA 5H82A 1YHNA 5DM60 3EZ2A 2WJJA 4IHJB 5ULLA 3LT1A 2AEFA 4HF7A 4P3KA 4DDHA 1VSUA 1PGQA 1V45E 3K72B 3CUKA 5KWIA 4NMLA 4QGBA 1WJ7A 4HGNA 1GXSB 1E3JA 4LW8A 3M6XA