2G5GX

Cofacial heme binding to chan of campylobacter jejuni
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
255
structure length
255
Chain Sequence
PLQENKDFYILDTHTQKKISFEDMILELLKADVILLGEKHDEVKHKISQVMIFNALEGNLSSQNINFDVALEMLASTEQNHLDKAFKNKKTIKANELTNALNWDKVWKWKDYEQFVNVVFYSKSKILGANLSRSEITSIYNGAQPLKGYVSTTNEVKKQLFDIISLSHKLNPEENKELLDKLVEIQQFKDRRMADVLVHHVNKVLLLAGSYHTSKKIGIPLHIQDFKSSKKIVVVNLSYGEIDLKDSDYVLIYKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative lipoprotein
publication title Cofacial Heme Binding is Linked to Dimerization by a Bacterial Heme Transport Protein.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Transport protein
total genus 96
structure length 255
sequence length 255
ec nomenclature
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF04187 Cofac_haem_bdg Haem-binding uptake, Tiki superfamily, ChaN
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.760 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2g5gX02
3.40.50.11550 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2g5gX01
2EBFX 2EC5A 2EBHX 2G5GX
chains in the Genus database with same CATH superfamily
3UJBA 4RFSB 1YI0A 4JR1A 1ZM3A 2BKVA 2C54A 4U7GA 2VHXA 2PVSA 1Q0TA 4E2WA 1JEDA 1A1SA 4LMRA 4X65B 1R4ZA 3P0IA 4EVQA 3MGBA 2D0OB 2YYSA 1U2RA 3H75A 1D4AA 1XG5A 1A9QA 1E7YA 4JODA 2FQXA 3PC8C 4Y1RB 2JCXA 1KDTA 2HWXA 2I7TA 1UFKA 5FOSA 5KI6A 4NBLA 3F73A 1PQPA 4LWOA 5KHLB 3IUPA 2ZRFA 2CNDA 4TMWA 2NSLA 1ZD5A 2NSDA 3LA8A 4NQRA 4ZCQA 1R4AA 2QVGA 2QK4A 1SBIA 1HZZC 5LQJA 3FOZA 1R2ZA 3P94A 2PUEA 2AH5A 4BLOA 2I6GA 1YVDA 4AMGA 5TB5A 3PXUA 1KZ9A 3K6SA 4N49A 4Y6QA 2PGIA 1O0BA 3MJSA 1NURA 1AUAA 3R44A 5GQSA 1M7GA 5CXXA 3PYXA 1W581 3CX7A 4IQ8A 3HFJA 3IDFA 1S2OA 2O8NA 2VXOA 1QHIA 4DMMA 1LZLA 4RHTA 5ILQA 2AK2A 2O0HA 1JG7A 2Z2YA 4B3SB 2W8BA 1U2DA 1E4YA 3HRKA 4GYWA 3PLAE 2X14A 2VTBA 2QD1A 2AFHB 3HPQA 4IS2A 1SEPA 4LE2A 2J46A 4RHXA 4NU0A 3H7IA 4I1PA 2WZBA 2OHJA 4WINA 5D00A 4QARA 1FU8A 1GCOA 1ICEA 2YZGA 3AJEA 1R6XA 4LYFA 1G8MA 2K87A 5LQCA 3RROA 2ZI4A 3S29A 5G0VA 2R6GA 3OLYA 2ZUWA 1G1AA 3OPQA 4YRQA 1NXVA 4JLWA 1GP2A 1XTJA 1NV8A 2MOKA 5BNTA 4LXGA 3MRXA 3S6JA 3OX2A 4JA2A 3U4QA 5J59A 1V1MB 1NI5A 4B4VA 5TQ2A 3ZK9A 1PFGA 6AT1A 4HLUC 3BHMA 1HE2A 5F3DA 1L5GB 2GDJA 4CQLA 3H1FA 5JC1A 2WWXA 4D8YA 4QREA 3CRNA 4N3BA 3PQ7A 1VG9B 4DAEA 3IDSA 2OHOA 3IECA 4J29A 3AJAA 2LBCA 4JBWA 1ZRSA 2WIGA 3OKFA 4YMHA 5CB4A 3K9QO 4RS4A 5LUBA 2YXLA 2DAEA 2X3UA 1QJCA 2VF2A 1SXJA 4B3FX 4V3CA 4BAZA 2VWQA 1DQSA 3MS7A 3OI7A 1C7YA 3EODA 4G9GA 1T0BA 3CLHA 5E8RA 5DSZA 3HABA 2HSWA 1GT6A 4YJ2F 5C4MA 2ZKIA 1BXZA 1HV8A 4TLMB 2OHGA 2WZQA 4NCIA 1RTKA 3ETEA 2HA3A 4ON9A 3DM9B 3CXUA 4P5EA 1HLPA 5AXCA 3THYA 4HR7A 2JLWA 4Y9TA 2VPZA 2LR0A 4FGSA 1O6ZA 3LDGA 3EF3A 1NBMA 4M1SA 4KO2S 1DBVO 2XQVA 4AUNA 2F3QA 2JD2A 4QFCA 4NU5A 1S2LA 1W5AA 3H17A 3SHFA 4ZI3A 5JJIA 1NW6A 5JDIC 1R0LA 2D54A 3DBHB 2RGAA 4EF5A 2I54A 2UZ1A 4AJ1A 3A6KA 1T1GA 3CLUD 1WQ4A 1HH4A 4MRSA 5JQWA 4J0GA 4W5QA 2DTDA 4N9WA 4UD6A 4PIMA 1LPOA 3VKFA 2FEOA 2XUKA 1G59A 3QUBA 2CVZA 2J87A 4X65M 2O6HA 4RTQA 1AIPC 3VR0A 1G5QA 1NF2A 3PF8A 2NIPA 3N39C 3WRXA 3MMZA 2JGLA 2JASA 4ZV4A 2DZOB 3A27A 1TF0B 1BDMA 3AMVA 5J4VA 2R44A 3LPDA 4YFVA 2QN8A 2NZUG 3IBYA 4P86A 3LYLA 5TJHA 2LXEA 1ZUIA 3MQ4A 5JVDF 2HPZA 4BQFA 3DAYA 4J9VA 1SCAA 1UMKA 3L28A 2AYXA 1ZIOA 1RBMA 3I9LA 3DVAB 4KQHA 2P3OA 1PJBA 3T7RA 3S2EA 1Z5AA 5KTSA 2IIQA 1CIVA 4HUJA 4M8NE 8ADHA 2Q9AA 2AXPA 4ZN6A 3FVQA 3D6MA 1G1MA 3HHYA 4QPCA 2NUTB 3VPAA 5A9SA 4V0ME 3WAGA 2OBNA 4C7BA 2CK3D 3OC0A 4Z7QB 2PUAA 2DWOA 4P3KA 1K9SA 4ZYZA 3HKEA 4LF7B 3ZWAA 1YFZA 3NGXA 3VPBA 4FWIB 5JVDB 1LDYA 1EIJA 2PUWA 3O4HA 1YQGA 1DUSA 5T41A 3TINA 1CQXA 1XA0A 2J4DA 1M1YB 3F6YA 2M6LA 3SKYA 3N0WA 3KOYA 2B82A 2P79A 3OZRA 1GTL1 1N8SA 4I55F 4B3SM 1KL7A 2O8DA 3BM5A 1NF9A 3HR7A 4FGZA 4G0YA 1O57A 4AWAA 3O0DA 4DLAA 1K6EA 3L3BA 3KFXA 2CE7A 4KFSA 1E5TA 1YQEA 3HZHA 1FVOA 4B17A 3D8SA 1R6UA 4EJMA 4DIEA 3TD6A 4EW6A 3PR2B 4UN2B 2IHNA 4JBLA 4MNTA 3WYNA 1V7QA 3B36A 5EP4A 3MAGA 1FJGB 4I55B 1TQHA 3E2PA 4NE9A 5TVGA 1S89A 1MT3A 3A70A 3OLXA 2ZI5A 4K9MA 2HA2A 2C0QA 5JHHB 4MI1A 5JAHA 1H93A 3QYJA 2L6OA 1U2EA 1BSVA 3WIUA 4I9HA 2GNOA 1MRNA 4R6WA 4NMXB 5IX8A 1NYLA 2GXAA 5I8ZA 3H7AA 2Q7OE 1D6MA 2O2EA 3S2SA 1P5HA 3X3HA 1YSYA 4XARA 3JCZA 3CVXA 5K4GA 5JDCA 1WUIS 5E26A 3ABIA 2I4IA 4L6IA 1TFUA 1RQ7A 2XTJA 2BHNA 5LA6F 3PCRB 2OCAA 4EJSC 1IDN1 5CFQA 1EP3B 2CXUA 2NTJA 4LC1A 3A2MA 1GQYA 1SZPA 1KZ6A 4DABA 1P33A 1Z28A 2QTNA 4EUNA 1I0ZA 2YX1A 3KDSE 5ALMA 4LYDA 1OKSA 3HSKA 1V26A 2WOOA 5NULA 5BYKA 1E9DA 3N8IA 1F06A 1XTSA 3HDGA 1QSGA 2CRUA 3DQPA 4EECA 2QZJA 4KQ9A 8LDHA 4M8SA 1J97A 2J3LA 2R87A 3OEED 3PTZA 4K2HA 4AXBA 5T4FA 1XJCA 4OX9Y 2FE4A 2NQ2C 2FV8A 1G3QA 1XMIA 1ZUNB 3EVEA 4IIJF 3LJKA 3BZBA 3GLHB 3BJRA 3ESCA 3WR5A 4RIFA 3QG5A 1BE8A 3R23A 4WDQA 4DLLA 1HFKA 4BZXA 4H1WA 4ACAA 3LA6A 2VCYA 2R84A 3HE3A 1O0CA 3PCXA 4KI0A 4RPGA 2WSLA 3D7RA 4A1FA 2VUTA 2XZUA 5T5QA 3HPRA 2X8AA 1TO6A 1OJ7A 1XEAA 1CUDA 2IDJA 2HNKA 4CL8A 1ISMA 3OCYA 3UUEA 1B1CA 4IIJB 4YCDA 4UNNA 4FT4A 3WDKA 4A8HA 3RRYA 3IDAA 1NN0A 3IQHX 1OFUX 4BEBA 5DLDA 3FOWA 4GDFA 4BFXA 3MTQA 3HH8A 3IAHA 3VGJA 5DU2A 1TQ4A 4C0HA 3JQFC 2E7ZA 4B47A 5K3SA 4L4RA 3V4LA 2WYIA 4OFXA 3WFJA 2QRUA 2GQ0A 4H18A 2QMZA 3U7GA 1XTRA 2VXCA 3G68A 3Q7EA 4YT8A 1MAWA 4GAEA 1F8GA 3T3EA 1A97A 3D4OA 1EK0A 3BD9A 3R40A 1NHGC 1XP8A 4IFBA 1I4EB 3C8UA 1XQXA 2JIMA 1GKUB 4ND3A 1VI5A 4F1JA 4DR4B 1ULAA 2F3UA 2QLMA 4B6FA 3KYCB 4Q4DA 3ANSA 1S3IA 2KPOA 1AKRA 3DWFA 4I50A 1NI4B 5CFLA 1RYBA 2AQIA 2ZJYA 2XCOA 3Q6NA 4JWKA 5J23A 3AJDA 4U7HA 2NUAA 5HIJA 4LF7M 3NIGB 3ZV6A 2B8NA 2Y0DA 5HWSA 2IHBA 4HG2A 3PRYA 2X0NA 2P75A 2L2DA 3VKWA 1TF5A 2W71A 4G3XA 1CJSA 4NAUA 1O7JA 1ABFA 4YH1A 3ZHQA 1JMVA 4I4LA 4RVNA 3RJMA 2WF9A 4W8GA 1CSEE 1WUHS 4A2WA 3BVPA 4QJ4A 4EG0A 4EG7A 2JGJA 2HU2A 3BGIA 4PPNA 2JFYA 1VP3A 4XD2A 1EMDA 4B7XA 3T3NA 4QE3A 3Q87B 4YRBA 1CUFA 3AXTA 3EF0A 2P2DA 3ND8A 3F4BA 1AQNA 1P91A 4P93A 2BFDB 1EE2A 2CMKA 4HVLA 3TIVA 1JZSA 4ZAVA 4CM6A 2DZNB 1KBQA 2QYHA 3DKPA 3TJRA 4G2TA 1P8AA 4YRGA 4MJ3A 1FJGM 2P41A 1CEXA 3L92A 1Z5GA 4KQXA 2IPAB 1IEVA 3LGSA 4X66B 1SHTX 4UTVA 2R7NA 4NVRA 2HK9A 4OHOA 2EW2A 4I66A 4KQMA 3RO7A 3A4LA 1DB3A 3RHZA 2A1TS 4TXMA 3I5YA 3HEBA 3IP6A 2W2LA 2IPOA 2DAKA 2ZAYA 3RCBA 1M2NA 1F0YA 2BMAA 1LQUA 2A8YA 4KU4A 3W5CA 1XCMA 1JU9A 4A8JA 1Z26A 3CR3C 5A2QS 4P0QB 1TZBA 4RJ2A 4WXMA 1DX4A 2HSJA 3ZC3A 4RTSA 5EMNA 3NTXA 1QNLA 4U6SA 2Z09A 1UKYA 4CLOA 2G9RA 2IITA 1SVNA 3DDSA 3O8BA 2DQYA 1ZOPA 4XW2A 5D2CA 1WW8A 1J49A 5LIPA 5SY9A 4ND8B 4CM9A 3WL7A 3ZCRA 3T5PA 5EESA 3HQ4O 1QX4A 1IYZA 1FLVA 2QQFA 2I2WA 1T5HX 1N7HA 2M60A 4FLEA 4WTOA 5KQLA 4FMBB 4KR9A 1FA9A 1JKJA 4ZYUA 2V7EA 4CCAA 1HQYE 2VQ3A 4RVSA 3SBEA 1ODSA 2WF8A 2BE7A 4L9AA 4MJ7A 4N9QA 1O95D 1DGHA 1Q0RA 1DDIA 5I7AA 1E61A 3PDIB 5EHNA 1N1EA 1W9HA 4RD2A 2PBZA 3W8NA 4CGYA 3GH3A 1OZGA 1R0WA 4PVDA 5ILGA 2AMVA 4PZZA 1GXSB 2IRWA 1JT9A 4BWYA 1TJ5A 2XITA 3H2GA 2D62A 2OAEA 2VP0A 1H2EA 1C8LA 1A82A 4J03A 2PUJA 1CUKA 4PGMA 3PIDA 3SC3A 3SDSA 5A5FA 4O1HA 5FR1A 4XVQA 1LPMA 1YO6A 3L9XA 1ABEA 5JYDA 1L3IA 2O4CA 3H5WA 4KFRA 4BXOA 1Y6ZA 1D07A 1QYWA 5JY1A 5H1YA 1CZHA 4E21A 1MO4A 3KQKA 1DSSG 3OEHD 3MTJA 1CF2O 1PDVA 2CXPA 1VL6A 4IIUA 1N8NA 3WK9A 1BA2A 3D7KA 1PLLA 3TEMA 4J0EA 5IZCC 1I1NA 3KLOA 5EZSA 1PO7A 4CEIB 4E03A 5DM2A 5A9RA 1MJ5A 1Z0KA 1IL0A 1NBWB 3K09A 1Y9EA 4BGUA 1LRLA 4FCWA 1T26A 4URWR 4XIJA 3ROQA 3AFHA 3U40A 1XZEA 2QD2A 1FX1A 4Q7EA 4Y6RA 4AW4A 1R74A 1S6YA 1DFHA 1H0KA 5TT1A 4JMLA 3W9YA 1JH8A 1E7SA 2ZBEA 3FHTA 1R7RA 4UTOA 2MMCA 1XCBA 4JYPA 3OFND 4RDHA 1U8CB 1NY6A 4IDAA 2OLEA 1E98A 1H8HD 1TTQB 3K31A 2ZPAA 5JOQA 3CGGA 4WZAE 5F23A 4G5RA 3R9IA 5FCDA 4M9UA 4N5IX 4EKNB 1N92A 4A6EA 3PGKA 4C6HA 1IXYA 5DM4A 3IQIX 3NIDB 5DF1A 3TX6A 3BWMA 3ZUPA 4RANA 1DQPA 4X63A 2NG1A 1THGA 2GOYA 2IXBA 1ZI8A 1REQA 3SARA 1WY7A 4W7HA 1ADBA 1XBTA 1ZGGA 3JZDA 4DHWA 1GPBA 2JZCA 3CBGA 3RFUA 3AO0B 4C87A 4OQQA 3GJSA 4N8SA 3TYXA 2VDWA 3GBSA 2E87A 1D1PA 3SJZA 1XZFA 1YUMA 5BOSB 3U6SA 3W5SA 5DE3A 2A9PA 3ZXSA 3OM1A 3KUXA 4EUFA 4CM5A 3WJ2A 1X7YB 4Q93A 4X66M 4Z6YA 2ZE6A 4C7VA 2FW7A 1QV9A 2G76A 5FPQA 3ZHSA 1NOIA 1MO5A 2OHFA 2FETA 5LZ9A 3MK31 3HR8A 3PPYA 3UGQA 2W0SA 1U7UA 2PRYA 2CXXA 4LA4A 3A26A 2NN3C 4F4CA 2XMDA 3C3JA 2VR1A 3SSOA 2UUOA 1SG0A 2FKAA 4DLUA 1MC8A 5F7OA 5I5EA 1YA8A 3V4ZA 1EXMA 2RH8A 3C70A 2QBYA 4ZVVA 2IJGX 5ULLA 3C2QA 4BQEA 3R6WA 1PUJA 2AMYA 1V3QE 5AKXA 1B4DA 4EZBA 3AKCA 1J1ZA 3RSCA 5F2KA 1TYEB 3H87A 2H1RA 5F9HA 3IDZA 2V74B 3E9YA 4DM3A 3KXIA 2Y20A 3ZE2B 3CN9A 2QRQA 4KVZA 4MLZA 4RTNA 2X86A 4UBNA 1B43A 2QTCA 2ETVA 4OQPA 2NU6B 4YWHA 1P1RA 5FOQA 1OAKA 4YJGB 4BQQA 5B55A 5A0FA 2XCQA 4WA7A 3Q0EA 2W93A 5PNTA 3R3YA 4MINA 1DL5A 3MLBA 3AM5A 2QN1A 3L6OO 3G85A 1XR3A 1LSOA 4MA0A 2HLDA 1TJYA 2WBLC 5MF6A 4E6EA 4MMZB 1D9XA 3I2FA 1Q50A 1DX9A 4MO9A 2M32A 4GX5A 2IW1A 4ARCA 1RKBA 3U37A 1SOUA 2IYWA 5KO2A 4RDIA 5ECDA 3PEWA 4QDXA 2VK8A 1WL8A 2XAUA 4Q15A 4MW2A 1NZFA 4Q48A 1DIHA 4IOLA 3CRMA 5A71A 4IMPA 5K9ZA 4YCCA 3UOAB 1ND5A 1EFKA 1T29A 3WGTA 4PQGA 1WZCA 3PDUA 3R0ZA 5BUCA 3IA2A 5EYPB 4ARBA 4BIMA 1PDOA 4DN6A 3M82A 2VOJA 2Q5OA 2M6RA 3WMWA 1X3LA 3GAFA 1DE0A 3A0RB 1NXXA 3VR5D 4RJKA 5HYVA 3I2HA 1K7XB 2ZXEA 1CP2A 4QTXA 3TDKA 2CBGA 2IPMA 1MU5A 3TMAA 4ZARA 3W5AA 2HA6A 3HO6A 3RSGA 3W1EA 4PNZA 4BUCA 5EXPA 3B1ZA 5CDUA 5CBKA 1D03A 2CLCX 3IJEB 3NKLA 4BQOA 3H04A 3KE9A 1W88A 4LRSB 3TWLA 3CVOA 2NU8B 3WMXA 1E5XA 2HTEA 1KDZA 4LG2A 2CVFA 4R0VA 3M9WA 5IKXA 1QZ3A 3A42A 4CQNA 3EJWA 2FMFA 1RYMA 2OO7A 5AJVB 1WP9A 4XVHA 4JOBA 4ZOQI 4R9SA 2ZYIA 2YMPA 2QTLA 3QX9A 4L22A 4M37A 4FT2A 3NBQA 1AO3A 4MKRA 4GUDA 4HGOA 5CR9A 3LUHA 4Q7KA 1XZQA 2LKDA 4K6MA 4WZBB 4D6PA 3QVJA 1XEFA 3FYSA 1DTWB 2O06A 1YHYA 4JEHA 4BNIA 1KPHA 1QVVA 2CC2A 4IIGA 3N6XA 4YNBA 5KJ1A 1BX3A 3L0DA 3AR7A 4FK8A 2ECQA 2G63A 3R5XA 3KEQA 4ZDIA 4IXTA 4NBSA 3LW8A 4EJ6A 1ADJA 5C8ZA 2OL4A 2F1JA 2FUG6 1SPBS 1XCJA 1W73A 2F62A 3PR1A 3AG6A 1Z5WA 5IJ9A 4JN6A 1AOXA 3QEMB 1G21B 1ZVVA 1OYOA 1EK1A 3C8MA 3V9PA 5A7HA 1G6OA 1SXHA 1XZBA 1VECA 1F9AA 4FQ8A 3BMQB 1TX4B 3T7TA 4II7A 3QUQA 1IJBA 4LZOA 3BH7A 3STVA 1KEPA 1QFZA 5BVHB 1CR6A 5E1MA 3UK6A 2Y0QA 3PGXA 3PE4A 2Y21A 1C7FA 5KDLA 2Z9CA 4ZANA 4HNUA 1J39A 4AG5A 1T1SA 4CIDA 3PNBA 3U6CA 2YQ5A 3TRHA 1IUNA 3IGFA 4NOJA 1MA0A 5EXXA 4YP1A 2WR8A 1VCNA 4MPRA 1H2BA 1OQYA 4PBTA 2O14A 3A6EA 2FLWA 2PSJA 4BKRA 4KE9A 2BEWA 2QVCA 4RF2A 1E3EA 2PUBA 4AJPA 3F6PA 1P6XA 4PT5A 4JYBA 2BSAA 4ISCA 2MJ5B 2Q9BA 4ZZ1A 4HUQB 2PS1A 2V8BA 4FGJA 2B1QA 2DWUA 2PXCA 2HRBA 1CV2A 3ONEA 1X7ZB 2V7QD 1N6RA 2OO5C 4ZQGA 1UXJA 3U19A 3KE8A 2AX3A 4LISA 1UMCA 2GNPA 2INGX 4AZVA 2CSXA 1KQFA 4AJ2A 3GT3A 4GHWA 3GFSA 4XIGS 1HE5A 3WDMA 2G3YA 3MOGA 1Y8CA 4QHSA 2X8JA 1Y1KE 3SVTA 3UJDA 4JVOA 1UMBA 5FQOA 3B8EA 2G80A 3CUSA 5JS1A 3DBOB 2OXTA 2E2WA 4PLYA 2C2WA 5LR6A 4CGZA 4JXZA 1QGYA 1X74A 4NAHA 4TSRA 4IV5A 1ZK1A 1XTQA 5BR4A 3JQGB 5TT0A 3DSRA 5ERYA 4KRYA 4DUPA 4GMKA 2NVOA 3AVXA 1QKJA 3L8DA 4YAKA 1DRWA 4KAAA 4ZEVA 2Q5HA 2QUBA 5KYYA 2UXDM 3IG5A 4EYEA 4D96A 5ICMA 4H08A 2EYUA 3NZEA 2FJ0A 2P9CA 1IVSA 1P4SA 3ZE1B 1JDZA 4NBKA 3A2LA 4XI9A 1XQWA 1ENYA 1LTHR 3JQBA 5DV9A 3FROA 4D97A 3DDOA 5JSKA 1VSUA 4BJ6A 3EVBA 3TL4X 3GP5A 2GR9A 2OC9A 3NLLA 1YNOA 5ITZB 3Q88A 2D00A 4RH3A 2ZSBA 5L3QB 1L5QA 5HF6A 2I3AA 1O4VA 3OZCA 2XUOA 2XDQA 4BVJA 5LZ4A 5LQAA 2C7GA 1XROA 5ALYA 2QMEA 2C20A 3I8XA 3RYFB 2QN6A 1P44A 3FHCB 3ET4A 2BDUA 1SUBA 1ZP6A 4B74A 1BE0A 1WLSA 1XHFA 1JFRA 2BHRA 2FRVA 1NVFA 3DE7X 4IL5A 3RGSA 4UXJA 4ALLA 5FBZA 1MHTA 1Z88A 2F4VB 3VYUB 3TL6A 1NVBA 3I72A 3GRAA 3TUJC 2MYTA 3E9ZA 3C43A 3DEHA 2IS1A 3V6MA 3C8HA 2HJVA 1P5FA 3HWWA 2WWVD 2ZSKA 3IUJA 1AN0A 2YASA 1U65A 3A37A 3A32A 1TUEA 1X70A 3FKSD 2C3OA 3HVIA 4FYVA 2BRUA 3EN0A 3IXQA 3F2IA 2X40A 4C43A 1Z8NA 1W36D 1UADA 2PL1A 1H5QA 1TTPB 3N2KA 2V6JA 2F5QA 4JAVC 1E3SA 1O58A 2JGAA 3JWJA 4K9LA 4B1FA 2VP6A 4Q9LA 2ARKA 2Q0QA 4OOFA 4BJ5A 3EZLA 4ND5A 4B73A 4JI4B 2X0EA 3KQLA 2Q5IA 3MOIA 3HRHA 4M9XA 5A5GA 1GNQA 2HHHB 4J0DA 3V1KA 1A9OA 4K1XA 5HMMA 1UEXC 3NGLA 1NOKA 1WJGA 2X5KO 3AP2A 1BMFD 2V97A 3KQOA 4HH0A 2IX9A 3QMVA 1B0AA 1IXSA 1ZU5A 1BJKA 5IJZA 3VR2A 4RK1A 4KQGA 1TZKA 1YUNA 4Z49A 2HK8A 1LC0A 3WQQA 2ZK7A 2XKJE 1YMVA 1T2DA 1KAOA 1I2MA 1JFFA 3L0SA 3R8FA 3KL2A 2GEDA 1WY5A 3WBKA 1J0BA 2LPMA 3X1JA 1FFAA 4ZGGA 4YJKA 2CLOB 4ZI2A 2ZZMA 4RVGA 1NXPA 2AOUB 1UF9A 1IOWA 2NT4A 3HXLA 8MHTA 4K6HA 2JS7A 2JLYA 3VVBA 4AJJA 4LGVA 1KJNA 4ML3A 1JKIA 2IYFA 3LZCA 2D59A 3CGWA 4RABA 4TSFD 3WL4A 4XR9A 1O94C 3OX4A 3HSYA 1KI9A 4XJXA 1T9KA 3SM3A 5TPWB 3FDZB 1F6WA 3CE9A 4K9KA 4KQ1A 3IP5A 1VGRA 4TQUS 3IP1A 5ITQA 4JASB 2W48A 5ALIA 5DP1A 3LP8A 2I6UA 3TZLA 3EMKA 3ER6A 3U6DA 5CEJA 2JZ0A 3U26A 2A6PA 1U1EA 2FFQA 1CT9A 4Q24A 1VJRA 4BVGA 1BYIA 4FS8A 4X1OA 1M5TA 9LDBA 1ITZA 1HDEA 3V7WA 5G4LA 4NYJQ 2DH6A 2ZUCA 4EKGA 4B44A 2MSCB 1XTIA 1I6MA 5DNCA 1RC8A 1X8KA 2TMKA 3RS4A 1F0PA 2IEZA 1XZPA 4FN4A 3DB1A 1G60A 2F1RA 1SC6A 3F7TA 2O8EB 4NLLA 5JBQA 4OEHA 4WOBA 5FUBA 1ZC3A 5KWVA 1C0LA 1W30A 1NT2A 3D54D 5FBKA 1I3NA 3BWEA 3UMCA 3JAMA 1VI2A 4H7DA 1S4QA 2VTKA 4TZ0A 5AW7A 2HDWA 2V7WA 4J0CA 2AI3A 4BN0A 1Z6AA 1NIJA 1DC7A 1XOIA 2A3NA 1CJCA 3T1HB 4JBHA 2RKBA 3SASA 2Q45A 1TUIA 3UTCA 7ABPA 4IO1A 2RI0A 2RCNA 3FPEA 4UXHA 3W5VA 1J0EA 2V58A 4UHKA 3UWKA 1G7TA 3K70D 1AO0A 1LPPA 1N9GA 2ID9A 2GM5A 4MVCA 2WUGA 1GA1A 4REQA 4DIKA 2XXBA 2Q9CA 4XLTA 5DTIA 3A6FA 2GESA 4Y2UA 2Y92A 5BP7A 3GT7A 1VB5A 4DARA 5JT1A 4KXXA 1JJ7A 3SEZA 2EKQA 3R9XB 1G3IA 1W76A 1XYYA 3GV0A 4JLUA 3P0RA 3RK0A 4GLOA 1V6AA 2J5XA 5KOIA 3SQWA 2KW0A 5IC5A 4IIVA 1YA6A 2HI0A 4WXRA 2Y68A 5BSUA 2Y1OA 4FC6A 3FLEA 3ASYA 3W9UA 2WQ6A 2YH2A 3FCUB 5LB4A 1V6CA 3LK7A 3IELA 3TFWA 4RU1A 4FGWA 4E30A 1RI4A 3OQMA 1WMSA 3IQXA 1B0PA 5DGCA 2IHUA 2Q0HA 3CR7A 2Q5LA 5B4UA 1E7RA 1GGJA 1E7QA 3C5EA 1NVTA 4FFRA 5FBQB 3ZYZA 1PFQA 1LW6E 1Z6PA 2XT9A 3I6QA 2E4UA 5HF9A 3TG8A 1GKKA 1RSZA 4FDUA 5ALOA 1SUWA 4GC9A 3IP8A 3KT6A 4DR2B 4JI4M 4HDSA 1IDOA 4Q7LA 1F48A 2VEDA 1SKUA 1W4BA 3UBMA 4A92A 2HHHM 2WD7A 3CVJA 3HBJA 3UXYA 1RBZA 5HDBB 3ZW8A 5EJCA 3FYUC 4BEWA 1JZQA 3NM6B 6PFKA 3F5QA 2W2TA 1WUYA 2P0EA 1JG6A 4JUFA 2DNAA 4C0SA 2UYOA 4Q9HA 4O2BF 3GQBA 3MLAA 1AK1A 5CEFA 2PNJA 4WKGA 4H0NA 1RJWA 3TOSA 2QG6A 4NBTA 2GILA 2ZB3A 1XXHE 1DCTA 1E2EA 3OPYA 3P27A 1BHJA 1Q0PA 1RWQA 1FFCA 5BW8A 1XIVA 2J09A 3TZHA 2RMKA 3N8HA 2QPOA 1TEVA 3E3MA 4GNKA 4CVNA 4G5SA 1OV4A 4I9GA 2FSGA 1N3YA 1YLAA 4O2BB 1XNQB 1CUXA 1LJLA 2NYVA 1KI4A 3DHYA 1DZIA 2C5EA 3H5LA 3Q7TA 5HUJA 2HX1A 4MO2A 2JDIA 3FRHA 2OYRA 3M4ZA 5AIAA 1U28C 3C3DA 4FEEA 5E2BA 3E23A 3PHHA 1ULTA 4NBNA 3LXMA 4G89A 1SVUA 2Z4TA 1V6SA 2PQMA 3S2FA 1U1FA 3S1AB 3QU5A 3EQ7A 4QGSA 4F4JA 4HRYA 1YDFA 1NUAA 3TWMA 1UDXA 3VNUA 3FCYA 4ZRMA 4RV9A 3AHCA 4U7FA 2YFYA 4RETA 2YJ4A 1F2VA 7MDHA 2IZ0A 5CAEA 2D6FA 2FWMX 4PCZA 2QG4A 3LOUA 3S8EA 2QW0X 4L2IB 4MB6A 2BSXA 3TOXA 3QNWA 3D0QA 2NQ8C 3K8OE 2OFOA 1V1RA 2BFBB 1YXMA 4M99A 4QOJA 4DTCA 4CLRB 4J2HA 2G77B 3O91A 3P4YA 1CB0A 3HFSA 3R0IA 1D8AA 4NMLA 1QGUB 2LNHC 4DV5B 1XCPA 3NHSA 5CHYA 5DTMA 4QLBA 3SE7A 2FA9A 1Z08A 3JQ7B 2BMWA 1DJLA 5KSPA 1IPHA 1SZDA 3T1HM 3V8NA 4AO8A 5T8KA 2PBLA 5D7NA 3NP9A 4QT4A 3LUJA 5FPHA 1YS2X 3EB9A 1E3JA 4D99A 3IKVA 1BGVA 3HKDB 4IDPA 2P4EA 4TTVA 2MGWA 2J3IA 4MLDA 2XF3A 1G3MA 1O1YA 3OU7A 1T8RA 3I62A 3WLOA 3FVVA 3LVBA 1SCDA 3RKRA 2JLRA 1ZJ6A 3TR0A 1N5RA 1KP3A 3RWOA 2BKEA 2BE9A 1V45E 5K8CA 3E5HA 1UJBA 3W5JA 4G09A 3C6XA 3G0CA 3O1HB 4I08A 5LSAA 1DJQA 1QP7A 4EGFA 5A3QA 2I71A 4AROA 4HDKA 2GT1A 3CISA 1Y82A 2OKGA 2R79A 5HDQA 1XFDA 4FDVA 5EL0A 4C0BA 5CXSA 4FFVA 3A25A 3WGUA 3F6SA 5EWJB 3V4PB 1FUEA 1IN7A 2ADOA 2FPWA 2BR4A 1BXKA 2OQRA 1ZW1A 4EGQA 3PTLA 2Z1NA 2D5LA 3RS0A 2W6PA 3HK2A 1KYQA 4FGUA 4V0QA 2P1DA 1RM4A 1LFAA 2PUGA 4L8FA 2VZLA 3KJXA 1QXSA 3KOYE 1J2RA 2X49A 4BO8A 1QZZA 4DR2M 4DQ0A 3JD0A 3H9BA 3UW3A 1PZFA 3VNQA 4REMA 5EOVA 2PAAA 3DXYA 2JHGA 1UAAA 4LV8B 1T3SA 5A0VA 3L6RA 3HXOA 3HJHA 3SPXA 3PXBA 1DAIA 3JQQA 1H1DA 3K5PA 1GG8A 2NU9B 2DVWB 1AUOA 4NOLA 4UVIA 1OYWA 2CXSA 1Z3IX 4G8JA 4O02B 4GITA 2AMLA 2HJGA 3PRKE 4IBIA 4MOWA 1H9AA 5C37A 3CSUA 1JDTA 2EWWA 4C2TA 2OGWA 5CB8A 1NMXA 3KJEA 3GPLA 4GHAA 4D9MA 2CL0X 3ZKWA 2PT6A 4HWPA 2A1IA 3NBFA 4NEHB 4BO4A 2ONCA 2VAXA 4H7KA 1HQDA 1DCMA 2DBZA 4KE7A 3S70A 1JPVA 4QEDA 1NSYA 2IHZA 5JBIA 4FHZA 3HB4X 3U56A 1R4NA 1QB8A 2YY6A 4IDEA 1OZ0A 1HORA 4ADSG 4BFVA 4KLCA 1XZKA 3QHAA 1AJEA 1J2EA 4YHHB 2PLNA 1XNQM 2JPDA 2FFHA 4GLBA 3MWGA 4CIVA 4TLBA 3QUTA 4E33A 2IEIA 4DMRA 1R5BA 1B0ZA 2D5IA 1KSJA 2GBIA 2EZ8A 5DKFA 1UDWA 1UBFA 2QJRA 3I30X 4RJTA 3K9LA 2ZSDA 1NJ8A 2XYQA 4PLWA 1JEEA 3B9BA 3HDHA 3A4VA 3DG9A 4Q4AB 2R1TA 4N6GA 5ALRA 3V1LA 1A4IA 2HCJB 2JZ1A 4QYSA 4XWAA 5J40A 4L75A 1SUPA 1BDHA 3QU2A 3D3EA 4CN9A 1MB9A 4BNDA 2ZRAA 1DBRA 3Q9NA 2I4TA 3HY6A 3JALB 1UC5B 4LHEA 3CX6A 4YLYA 5JSZA 2BCJQ 4RAQA 5DRYA 4K0KB 1E9SA 2OWEA 3E6AA 4PANA 4CRWB 2VPPA 4N03A 1NQAO 2C58A 4CIWA 4F97A 1L4BA 5K7SA 3AY3A 1USIA 1F0NA 1FFGA 5LQSA 4BDSA 4IY1A 2R8YA 3OE7D 4NJMB 4MHOA 3EGXB 3SIWA 4Q9KA 4DV5M 3RU9A 2FPRA 2IEYA 5F1KA 1XA4A 1KJ8A 1M72A 1NNUA 2QU7A 4FC7A 2ID7A 1V5FA 4Z8XA 4BIIA 1JA9A 2CLSA 4DCNA 4P8RA 3HCWA 4OKSA 2P27A 4UVGA 1N7IA 2YC2C 3KXDA 3HKBA 4A0HA 1V5EA 1X8JA 1CZLA 4BFUA 2ZR0A 1GZ3A 5AJXA 4M98A 2G70A 3UJAA 4MYUA 5KJ6A 4Z3DA 4DIMA 2ZM6B 1QQ5A 1W36B 3I1YA 1JDJA 1QO0D 1NRWA 5IK2D 1N1MA 3WP0A 5D3KA 1ICIA 4QOZC 3BWCA 2B9EA 5ALLA 4P7BA 4QD3A 2VOEA 4CHTB 1F3LA 2GZ3A 5EWLB 3KQSA 1JE1A 2YOFA 3DFZA 1QQ6A 4ZP1A 3OFVA 3SR3A 4QRIA 2I7CA 4DZZA 2DJIA 3O47A 4GKAA 1ISSA 4UW9A 4CN8A 4D4HA 2ZS7A 1GQ2A 3U16A 2OYCA 1RR6A 2IELA 2ZXFA 3WFZA 3ZK7A 2HAKA 2YVLA 5HJ7A 1A04A 1UCFA 4JQOA 5IBPA 1VI6A 3DT6A 3SYTA 4EGSA 3RAFC 2EEZA 1OA0A 4QBIA 4AX8A 1PQUA 4BX0A 4PYRA 2VO1A 3M70A 1QMPA 3CO0S 3PK0A 3ZLVA 4CV0A 2D7JA 1GRCA 3AETB 3QXXA 3P2IA 3AR5A 3KPUA 5EZYF 3TNJA 1EUQA 4F4IA 3DTVA 1KRXA 3P2YA 3RABA 1DDOA 3HHXA 2Z5FA 3I1IA 5ADUS 1ZGZA 5DX0A 2V7VA 4YAGA 3DAFA 2IFTA 3NBAA 2ZOSA 3A04A 1BS1A 4L16A 4PXYA 3V8QA 2E0IA 4G0VA 3GLIE 1N5DA 4B3JA 1YCFA 1OBFO 5EZYB 4MYDA 1B16A 4DV1B 4LDZA 4NNOA 2ZRBA 1DNPA 3JQRA 4TYQA 3VPCA 3V9AA 1DC8A 1TR8A 1XTPA 4R71A 2IH2A 5HF5A 2BWBA 1CVLA 2WIJA 3WKCA 3PJGA 4Q21A 4FYIA 3SIXA 4QUIA 2F59A 3A14A 4DRXB 2G40A 4AY2A 4AYWA 1OGYA 5HRUA 2WU4A 3MJHA 3ZNQA 3H2KA 4LHZA 1S9HA 1SC3A 6Q21A 3AY6A 2QN9A 1GL6A 2V9ZA 4MVWA 2QG9A 1JXAA 4Y6SA 3G9UA 3M9XA 1G6KA 3F78A 4YHHM 5FLEX 1EQUA 2I6QA 4R8SA 2PSFA 1DIRA 2CL7X 2LDBA 4QDKA 4F91B 1G6Q1 3BE4A 2DSNA 1G2QA 3QRWA 2I03A 1PTJA 4KQ2A 2XCSB 1B6TA 4YMLA 1IZ0A 2QVLA 4TV8A 4F0JA 3TLGA 1ZRNA 1XVUA 2IYXA 1E2DA 1QLHA 2VSXA 4FSXA 1T9AA 1KSGA 1RYNA 4I3GA 4R2WA 1LDMA 3Q1KA 3H9UA 1I2BA 2VDUE 1NIPA 3L7KA 2H48A 1NR7A 3EMDA 5GIOE 1W47A 1YKSA 4X7RA 3EXG1 3P8ZA 4OXRA 4LF9B 1QIIA 5AM2A 4QNMA 4K0KM 1JPJA 5IXSA 3KLMX 4CE6A 3M1AA 3HCPA 3HUTA 2C97A 2G36A 4HYTA 4OGLA 5KQRA 2O2XA 4JT2A 3M4XA 1KZGB 2CCJA 1EBBA 4C6TA 3FNIA 2BD0A 4IXWA 3KT3A 3LHSA 5CLJA 3K1YA 4FU0A 1YQXA 1SM4A 2OD7A 1QZMA 1VJDA 2FK7A 1U5CA 4RZHA 2UYQA 4L5IA 4MUBA 1G2IA 2F48A 3I53A 1MC1A 2WU3A 3SHTA 4RDXA 3JU3A 3IR7A 4NSNA 3WYAA 4Z8YA 1YRYE 3DDCA 4DMUB 1WNTA 4R3WA 3G2KA 1M2EA 2OM6A 5M2QA 2JH3A 1F2TB 1C4XA 4BJ1A 3LZ6A 4TM7A 1FYVA 2CF6A 3WWPA 1HNWB 3MB8A 1VLHA 3M3PA 2IT1A 3TGWA 4C7XA 3TAUA 4CKXA 5EIBC 4CPDA 2ZJ2A 2ZM6M 2PUCA 4II2A 4TWIA 2XXAB 2APLA 3HNPA 2FOLA 4DLBA 1LRJA 2QV0A 1UM9A 5KNCH 3ZDDA 5JZSA 1JMYA 5ALEA 1QANA 2W22A 3KPJA 4MQFB 3I12A 4R81A 4WUTA 2I2XB 2WFZA 2R4UA 3ROTA 1NN5A 4M0MA 4DCCA 2ZUDA 1E4EA 4PRKA 4Q7JA 4W7SA 1ZHOA 1SB8A 4B9AA 3NXKA 4WFKA 5B3LA 2HH9A 3WS7A 4INZA 3V55A 2NU7B 1OX4A 1UXHA 3ZEAA 3QVSA 3BH0A 2H1WA 1R50A 1SGWA 3DJYA 1F2DA 5KAPA 1JGTA 4B8ZA 2W83A 4ETNA 4LQLA 3ZLTA 3LBHA 3UKOA 1U7OA 4HB3A 3E5RA 2VYQA 4LDJA 5DI3A 2LVBA 4N41A 1CZNA 3D3WA 4U2EA 2GAFA 3DE2X 1DEXA 2Y66A 3WB1A 1G19A 1TO1E 1JBKA 1QYIA 3QSGA 4IILA 2EC5A 1Y7HA 2R7MA 2RJNA 3IIMA 4PLZA 1Z4KA 2FFRA 1VMDA 1ECCA 3AEKB 5FWDA 3EPRA 1NYRA 2B4TO 1MN6A 3NHLA 2VHTA 4AKSA 1O03A 3V3TA 1ZIDA 2Q0XA 5GJCA 2WJZB 3EZ7A 3T7CA 4NYIR 1PBTA 4DYDA 5GONA 3U39A 3VR4H 3AKZA 1JIKA 4JCOA 3KHTA 1F17A 2PANA 3VO9A 1JR2A 1TEZA 2DPGA 2YVAA 4TZTA 4X20A 1S3SA 1YS9A 4TL6A 5DWVA 2YXEA 2ZIGA 1XZLA 5AVJA 3FFAA 4BX9A 4MRMB 4DNXA 4HQFA 1Z74A 1H2FA 3GF4A 5DHAA 1JB1A 1FF9A 1SVKA 3WHIA 4BO9A 3CRZA 5IT0A 1KFEB 1QDEA 3BG5A 5JRDS 2ECPA 3OIVA 4OL9A 1D6NA 5AVRA 3ZE8A 1X7XA 1ZMRA 1GNSA 3K0CC 2OV2A 1JA1A 4BC0A 1RP7A 1XHLA 4RVFA 4DR4M 2GFQA 3UWDA 1YE9A 2FR8A 4YRRA 2JAOA 2WDZA 2XUFA 4H9GA 2ODEA 3CB4A 3AJ8A 2DWNA 3SC2A 4Z4HA 2C88A 1P4HA 1E59A 1PSDA 1IPEA 4XDZA 3G89A 1MZVA 3L7LA 3OX3A 2C7VA 3KX2A 1CB7A 2EJUA 2PH1A 2C4MA 2G17A 5ES3A 5ISMA 4FXOA 3I32A 1NZJA 1Q1ZA 4LF9M 5L7TA 3ZU3A 1DG3A 1VKRA 1NJ2A 1Z6QA 5BN4A 1L4NA 2VPYA 3BX1A 2IOHA 3UMMA 5HP4A 2JFBA 4WASA 1SHLA 2Q1XA 5F9FA 4ALIA 1J25A 4HC4A 5G1OA 2O3UA 2XE7A 4R31A 3VV3A 5BPFA 1VE5A 3CONA 1KBZA 2X76A 3ASZA 4WNCA 1Y7LA 3SVLA 2ZBPA 3KCQA 3PJDA 3L0YA 2IPXA 4ZQEA 3DZDA 4K9NA 2NXCA 4OSOA 2PFSA 2IU0A 1O6FA 3QYPA 3SNHA 4D42A 4ZOLA 2PSHA 3KYBA 3DBRB 5H9WA 1XNGA 2AX4A 2HA0A 2LHGA 5JROA 1Q57A 4N1AA 3GD5A 3AEXA 1HNWM 3PD7A 3LPNA 3EMBA 3Q40A 3UAYA 5CJJA 1JILA 1T9HA 5EPOA 2O8FA 2KZSA 3M5CA 3JYLA 3MN1A 3U6BA 3FMVA 5JZMA 2WU8A 2PFKA 4M0PA 3FETA 3SHVA 1A8PA 1IJEA 4AK9A 1C30A 4EKDA 2AXEA 4LOJA 2VPQA 2X6TA 6ADHA 1CUWA 4WN9B 3EC1A 3QKIA 1U9IC 3HEAA 2DR2A 2UUAB 3V7YA 1YJCA 1CHDA 4H7JA 4Y2PA 2C7OA 2GRUA 5FI5A 2YIJA 1WNFA 5CK4A 4GZMA 5EJGA 1R0BA 5CM8B 5SZIA 2Q6LA 3WLNA 5L6LB 5CIYA 3JY6A 4O8ZA 4FNAA 1ECJA 3QUCA 1NVVQ 1Q7RA 1J9ZA 5TQ0B 4Q19A 1DGQA 4I9FA 3IEXA 1HR0B 1T4CB 1BCSB 1JHUA 2AXNA 1OZAA 2NZVG 3G0DA 3LBAA 4CEJB 3RYCA 5K0JA 3WYBA 2Z3VA 4CMKA 1FUKA 4UEJA 1DKUA 4JIGA 3FTEA 4G37A 2I33A 1JNYA 5HGJA 4QOHA 1QH8B 4RE5A 4LX0A 1B8OA 1B0UA 5IU6A 1N4AA 1Z47A 4RC9A 3KQVA 2ZKLA 3G3EA 2YNMA 5T4BA 2I3BA 1YR2A 3SD7A 5IFKA 5KMGB 2CJPA 3RIYA 4ZRDA 4ZAXA 5EJ7A 3MBOA 4DUYB 1E64A 2J9ZB 4KIFA 5ECGC 1KYXA 2JGDB 1UKEA 4CU5A 5ALPA 2IPNA 3HO1A 4I2VA 1EVYA 3W90A 3SLRA 2EHJA 4QJBA 1ANKA 2QTWB 4MS4B 5CVTA 1E3IA 3CA8A 3COVA 5J2TF 3HTXA 2CNKA 4CUKA 1NDHA 1Y4AE 1YRLA 2V3CC 1DAPA 3VZCA 2WFLB 3SJBA 2H1CA 4V03A 2QHOB 3JQ9A 4Z7NB 1TAHA 2ZE5A 4G0PA 5BNFA 5LDGA 1SB9A 3ZW9A 4IP0A 1Z2EA 3I8OA 4FE3A 3BD7A 3G2HA 2JK1A 3NRCA 3PPXA 3T15A 2XRMA 2Q7XA 3QELB 5J2TB 1TRHA 4PHHA 4C1NA 4D9IA 2EDCA 4N12A 4DSTA 3ZOZA 5FTLA 2BNKA 5MN6A 1MABA 5L3RA 1B00A 3GRKA 2GSDA 4IFEA 4M3NA 3LRTA 5JNTA 1U7WA 1JZTA 3IHWA 4H4EA 5F5XA 1F4IA 3AL3A 1E79D 4W8OA 1Y4SA 5E95A 5JZVA 2SHKA 1SHJA 3FHLA 1L2DA 3PKJA 1ZOIA 2TECE 3NTQA 3C41J 4AY6A 1BCRA 1ZA1A 1Z38A 2GZ2A 1U63A 5E7JA 2XUZA 4RMHA 4Q16A 5AICA 1FTWA 5EIHA 2L17A 4WCFB 1LDEA 3M81A 4RVUA 5DB4A 4HZGA 1OX5A 3ZV5A 4WT7A 4EX7A 3ZHZA 2XYGA 1BD4A 1K97A 4NARA 2Q8PA 1O9GA 3CVUA 3DFIA 1OQAA 2VL7A 3AYXB 4A1OA 3UV3A 2H2HA 2VSNA 1KEEB 1Z6GA 3PXEA 3PVZA 2HBYA 4LK3A 5A6SA 3OOHA 5DYGA 3EEIA 4QTUB 1F3OA 2SCUA 4JENA 2W6ZA 3JSAA 4URXR 2GCEA 3JRNA 4YIHA 4FFOA 2EATA 1PJQA 1MF7A 4TLAA 4A6DA 3QLEA 1UT8A 1QOZA 2OD2A 3UWOA 4HGPA 3GFTA 4Y2XA 3AOEA 3BICA 4DDHA 3HYRA 4JJEA 3M6XA 1AUPA 4UOZA 2QTBA 4U9UA 1R0ZA 2AHOA 4NENA 4RKUF 5E6RB 4DSZA 4XGKA 1C3OA 2ORED 3E4DA 4AWXA 3MILA 1FFXA 2IYEA 4ESHA 2H65A 2Y3IA 3E3NA 5A3SA 1YQUA 4OJNA 1E6MA 1XMOB 3DM5A 2I8AA 2UUAM 2AV6A 4ND7A 4DUGA 1EUCA 1XD2B 3R3ZA 3V2IA 3BSFA 3KAKA 4CLXA 4ZHQA 1JR3D 3TW4A 3PX3A 1WTCA 1OOEA 2JFVA 5LP6B 4ZALA 3WNCA 3GLGE 3QVLA 5BWCA 4YWJA 1Z62A 2ASEA 4BV8A 4FFPA 4E6PA 4ZT5A 4QJIA 4OQEA 1HR0M 3O1LA 5K3AA 3R09A 4UMEA 4FUTA 2GPAA 1I10A 4MYCA 1EGAA 4JB3A 4CKEB 3GWGA 1PSZA 1NAIA 4DOMA 1PX0A 1CY4A 3RPEA 1LDGA 5C5EA 3G2MA 2PT9A 4Y98A 2HQSA 3E27A 4HWKA 1EH5A 4E5SA 1FZTA 1XVAA 2P6OA 2CLLB 4C22A 3O2NA 3LD9A 4MW9A 1SD2A 4DUYM 4D81A 3A3OA 3U17A 1VJ5A 3CZRA 4LQCA 5TXGA 2C4HA 3M4JA 2KRKA 3QWBA 4L95C 1U0BB 2ZRNA 3RIMA 2GK4A 3NG1A 4F6CA 4N5NA 2V5AA 2JD0A 3BMNA 4N0DA 5TVKA 4NFSA 4ZJZA 3L0OA 2J7NA 1GZVA 3FUVA 4KQEA 3SOZA 1CQIA 4MARA 2W2VA 5TMBA 3CW2A 1OWLA 5KUTA 4JZKA 2R8BA 1BD3A 1MOQA 5KSOA 2AI2A 1BYUA 3W2FA 4P4TA 4M1MA 3JATB 4Q1FA 5FTWA 2PMCA 2NGRA 2OV6A 4RWZA 5DWQA 1KJ9A 4RV5A 4D3YA 3NAGA 3O8DA 3E4RA 4N3AA 1WU8A 4C0XA 3V80A 4NBVA 1I2AA 2ODQA 3G5UA 2O54A 1VYVA 2DC1A 3SXUA 3BSWA 3R4CA 4ZZ3A 4CDRA 4GOJA 5IM4A 3FMIA 3W9BA 4JUDX 1GTJ1 2QRPA 4XPIA 2VT6A 1TJ4A 2GQFA 4B76A 5FKJA 4D6XA 3DDHA 5G0SA 1OKKD 3AXSA 3WRYA 1WUJS 3WK4A 2FI1A 2GKSA 2DR0A 1RHQA 3O7WA 4ZAZA 1OV6A 1NPTO 4IDNA 3BQMB 3CZMA 4IX9A 3H2BA 9MHTA 4BNLA 3LYAA 3IJ5A 2VNAA 3ZBTA 1ONPA 5T6MA 5IMSA 3C6BA 3RTDA 1D0KA 5CYPA 1DG9A 5JCPA 1SXIA 1UBEA 1W25A 3N7UA 2VHVA 1P72A 2H07A 4EY6A 1YAHA 4D9EA 2N47A 1O4WA 1YJ5A 1TI7A 1VRCA 2QT0A 3WLKX 1M0TA 3EXEB 1KI3A 2IIVA 4YB8A 3E5NA 2G4LA 3QKRB 1KFVA 2XKAA 4BO0A 2XQIA 2ZJ7A 2WPDD 2BAGA 4LCJA 2POQX 2XGMA 4YR9A 4GWKA 4ZVPA 1JP7A 1YC2A 1KOLA 4KK4A 1XNJA 3B7GA 1JEYB 3WGQA 3O8OA 2AUMA 3A28A 2BI8A 1Y42X 5FRDA 3DMGA 5AVSA 1NVEA 1S8NA 4JL6A 3GLFE 2VBCA 3VO1A 1E9VA 1XXLA 2D5CA 3O75A 2FPSA 1Z0DA 3PC4A 2Q3HA 1GZSA 3NYRA 1XMOM 3I39X 4B6PA 4G63A 1C9EA 2ZS8A 1E1CB 4FYKA 3UHAA 2W6ID 5EJ6A 4YAJA 5EEGA 2VNJA 1JDSA 4ESVA 2YWXA 4KRFA 3SATA 3IS3A 4BKUA 4BMOB 4I4TF 3K1AB 2N42A 3R0QA 1T8SA 2PD4A 3BGOS 1DJNA 1Q2XA 2ZRJA 3DOJA 1Q22A 3A36A 821PA 4O4IA 4S1TA 3ZCSA 2XX3A 5AUQA 5KOHB 4YAUA 3UWMA 2D8MA 2ZJFA 4L8RC 4PO1A 3H5IA 3U3RA 3NH6A 4KZKA 2W6NA 4HEHA 2BTEA 4JB0A 4GOLD 3TLYA 4XQGA 5D1NA 3KSJA 4I4TB 2GD2A 2O25A 2HHLA 5HNKA 1PT9A 3ZIUA 4WQMA 4XUEA 4YJHB 2XIQA 2ADFA 3TTXA 3W1VA 1I6KA 3VZRA 5EUMA 3S68A 3ITDA 4QG7A 2I4RA 5I9TA 2CP8A 3G9TA 4UAJA 3HFRA 1JQLB 5FO1A 3SQDA 3CUTA 1K6JA 3GEIA 3MD9A 5B3KA 1Q3HA 4CLHA 5CCEA 1GKLA 4OXIA 1LRKA 1PLKA 4S35A 1GAQA 1A69A 4Q3LA 3NWBA 3MCTA 4W5NA 3UJ8A 4D8WA 2XUIA 2M1XA 2VPIA 4NXMB 2AD1A 4QAJA 1RTTA 3DZHA 3PI7A 4V0RA 4PX2A 4BU1A 3JQPA 1CR2A 3RUEA 2I55A 2P68A 2A2ZA 1PAUA 4GYKA 4BNYA 3C1UA 3VR6H 4MPPA 3V33A 1DWPA 2Q2OA 3GDGA 1PJ4A 4J0IA 5DNUA 1M34A 2VPTA 3LMMA 2XNHA 4NHEA 1WEKA 4DNQA 4LJAA 1ECPA 4F8JA 3KUUA 4F06A 1X39A 4FFDA 1Y8RB 5CLFA 3NAQA 2W2OA 4P08A 3CLUC 4YMGA 3O95A 1IBSA 4K7JA 4QYWA 1J23A 3C3KA 2EERA 3JVUA 1UOOA 1ZG3A 3NCHA 3FJ1A 2YY7A 3OZ7A 4TRMA 1H0RA 4EGCB 4PAGA 1DKNA 4LE1A 3GNQA 3S28A 4DLPA 1FSSA 4YAFA 3G9QA 2HRQA 3A6GA 2HWJA 3H9EO 2DHQA 4L8YA 1WSDA 1Y33E 3KKEA 1V33A 2W2KA 3AF2A 1VJCA 3CTWB 1HYHA 1A95A 1I32A 5JFOA 3IQWA 4W99A 2H0RA 4DV7B 4I8IA 1SXQA 5FOTA 4ZMBA 4CEHA 4CTJA 1DXOA 2AVNA 3IMGA 2F4VM 5HIAA 1N2CA 2AYZA 2B78A 1PVOA 3NCTA 5ICCA 1FXWA 4BMCA 3I76A 5AO9A 2EJWA 1I14A 3GC6A 3E48A 5AVWA 4LDPA 4KH0A 1Q2UA 4XX0A 2WTNA 4QVIA 4M89A 5ECYA 1FVXA 4PPYA 5K4AA 2K0BX 3QBEA 2YVKA 4I9NA 1NVMB 4NAVA 2P5YA 1TXGA 5KYUA 5LOVA 3BK2A 2QY6A 3KU4A 2QX8A 2QRJA 1ZMTA 1XAGA 4MS1B 3K30A 1COWA 4NP6A 4J43A 4QVGA 3UENA 1S5PA 1NM5A 4XCXA 5U1PA 3OTQA 3WIDA 1T43A 3DUFB 3HZRA 1L5HB 3PF9A 2J0SA 4ZVKA 1QGZA 2P5UA 3FGPA 5BN3B 4OCZA 2PGAA 2VKQA 4YONB 3PPIA 3WLPA 2OFFA 1RJGA 4HH4A 4C1BA 1ATIA 5EWMB 1BEEA 3RYTC 4ZAYA 1M2JA 3RAEC 1XN1A 1CFJA 2WWHA 2QD4A 4X0EA 4ND1A 2O2HA 2A9FA 3MC1A 4KWEA 5LMNB 3T52A 2XECA 4Z0TA 5LZ8A 3B9PA 3K1ZA 1JAIA 4M49A 4MS3B 3PS9A 4U2FA 4L3OA 4YAIA 2EGHA 1U2PA 2F9LA 4NK5A 3ONDA 4MR9B 2RDMA 2NVBA 1NRJB 1DVRA 2C00A 4K46A 1KZ7B 3FDXA 1X38A 3GCWA 3HGQA 1J5PA 4JI0B 1O9HA 3R3VA 4HXYA 4EHAA 3T4PA 1E2HA 1U0NA 2Q41A 1YVRA 1C29B 2OECA 3UJ9A 4EPVA 4JQZA 2JHAA 4C4SA 3KNZA 5G0UA 5CA1F 1ZD8A 1OWOA 1JHMA 1DAHA 1VE3A 3EQ9A 2NNLD 4JLBA 1TF2A 1Z35A 2OPFA 3A1DA 1NDQA 3VJKA 2BJWA 3WSWA 1HURA 1GPKA 1NC3A 4AYTA 3FLMA 2FEMA 4P53A 4U2GA 1M2WA 3L77A 3O2QB 1SXJE 1BDJA 2GCNA 5F64A 3A6ZA 4PN3A 4PC7A 1KZ4A 2C2XA 1NFFA 1EVEA 1SG9A 3BFXA 4NXMM 1YR1A 2IUEA 3QNUA 1QU2A 2LVQD 1QO7A 1BJTA 5CA1B 3MZ0A 3I3OA 1OLXA 4WOJA 4M1OA 3ORHA 1PK9A 4ISBA 4MPTA 5F21A 2IEGA 4TKLA 2ZBGA 4LVCA 3I01A 1WBJB 3UG7A 4C0AC 5REQA 1JPUA 4EB3A 1PTKA 1MIHA 4OATA 5MN5A 2OBBA 3PC7A 3H86A 4HNRA 4OQDA 5DW0A 1NVAA 5I4BA 5FWYB 4NEGA 5JD6A 1BTOA 1NBME 5AM5A 1QTIA 3H99A 1L4LA 5ALUA 4CKCB 4NBWA 5C5DA 3EIWA 4IHJA 1G20A 3I92A 4ZYYA 1SVOA 4NKRA 2VTEA 2DWCA 3ZD6A 1K3TA 5J4HA 2JHPA 4RZ3A 4U5XA 1XTBA 3ZHXA 3RREA 3MSCA 1O2DA 4BLTA 4YDSA 2YWEA 1VTKA 3H1AA 1QO9A 1TW2A 3LKBA 1YBVA 2OZLA 3UXHA 1QFJA 5AOVA 4F3KA 3AFGA 1EFTA 4XRGA 2QLTA 5JAMA 4C29A 1WOYA 1XMSA 4EABA 4HYYA 4I5IA 4UTXA 4HFRA 1Q7BA 4M53A 3FIUA 5C8YB 2ZJZA 3JSXA 4DV7M 1XNRB 3FZQA 5TIIA 4QXRA 3Q0TA 3IFSA 4JA0A 4X3PA 3NDBB 2FZ5A 3D6UA 4GOMD 2H4XA 2DECA 2JCYA 3TQCA 2C2ZA 1SVMA 2UZ3A 4GG1A 3JVVA 1KI6A 5BORA 1IULA 1HG0A 1PT6A 3TG2A 1WSBA 3I2KA 3QPVA 1YQTA 4BKOA 2JZOA 4OI4A 4EHHA 4EVRA 4MV9A 3IAFA 4C06A 3W9SA 5YASA 4UAVA 3B51X 5DH9A 5BSKA 3KSDO 3RK1A 3WWOA 4BHTA 1JBQA 4LSGA 3ZZMA 3EDQA 5DEIA 4F2HA 4P5DA 2N1BA 5DNWA 4F96A 1IAVA 2VF8A 2JJ2A 1OFGA 2GJKA 4P4SA 4KQFA 4UBKA 1WB5A 2CMGA 2XQGA 2ZT6A 3KLBA 2OBMA 5FBWB 4GXTA 3KB1A 1U7HA 2ZSJA 3LV8A 2SKEA 2GBGA 5CJPA 3BXPA 3Q15C 1D1QA 3R5TA 4X93A 2AEJA 3FNGA 5L4LA 1W2WB 7REQA 2AZ4A 1J7JA 3B1KA 5LMNM 4L9SA 3N2EA 1HOTA 3TTYA 1NOJA 2MYPA 2GJAA 3TZCA 3JQ6A 3GFVA 1U8TA 3IJPA 1C1XA 2X19A 4HAWA 3ANTA 5CK5A 4IKEA 3O4VA 3VR3D 4AT1A 3ANYB 2QQGA 2FOIC 4CM7A 5D3ZA 1MQAA 2RHBA 1VP9A 3QLUC 3RJTA 2W6CX 4YAOA 4X7BA 4FM9A 4ZO7A 3AZOA 2I7DA 1AKEA 2W6OA 3ENQA 1GZUA 1OWNA 4JI0M 3QBDA 1SG6A 2E5WA 2F00A 2DPMA 3CEJA 5C7IO 5ALHA 1FQJA 4D41A 1FYFA 1HMYA 1LX6A 1DKPA 1PT7A 1RJDA 2ZYDA 4J4BA 2JH8A 3RC7A 4J3FA 1TM3E 3CUWA 4IGKA 3S44A 3ZLBA 3HI4A 1NY5A 3AV0B 1P6QA 3AL0C 1F7VA 1OLOA 4BAUA 2BBOA 2MTBA 3HRIA 5KEIA 2H3HA 1LWNA 4LV6A 2OY0A 2KW5A 1TQ6A 4HFNA 3NDIA 2OPHA 3AESA 4DB4A 4YI5A 1FDSA 1YHZA 1C50A 2VF7A 2WQ7A 1Z5VA 2SECE 3IT0A 4HMPA 1Y1RA 2QRLA 4P6VF 4CIBA 3BERA 3KM0A 1E2QA 4WEOA 3MWEB 5LXTB 1TZ2A 2RK6A 1JF8A 3HCDA 4F60A 2NQTA 5E4FA 4Z51A 2I22A 3ZW7A 3PQ3A 2EBHX 4DDWA 4U63A 3EDCA 2QPLA 2VYVA 1CY2A 1CQZA 1NRXA 4CF7A 3ZLUA 3GXOA 5LBIA 2BR3A 3EQ6A 1R4MB 5CBPB 4PBSA 5C46F 5DCYA 2E4YA 3DE6X 2WNSA 2MJLA 2NZJA 2IHYA 5BSGA 1WU7A 5C3UA 1XD8A 2P2NA 4IIEA 1OTYA 3KLNA 4TMFA 2I99A 1PQ4A 4TS1A 2FQ1A 4P7GA 1V8FA 5JAUA 1EGMB 4M38A 1PYDA 4AS2A 3ABOB 1AUVA 3X1MA 4RKQA 2VRNA 1XEXB 4TXNA 2O57A 1L5RA 4ZPXA 4WESB 3T7AA 4DMLA 2IBTA 1JHXA 2NYRA 4FONA 3V4FA 3OQPA 3OPNA 4L8GA 4HAIA 4KH1A 3C39A 4FEGA 5HRAA 1Y9JA 2HPAA 5JAPA 4DBLC 2YJTD 2HIGA 3HGMA 4L5CA 2XDYA 1R16A 1G6HA 4B7FA 4MR7A 1YS7A 1XNRM 1IM8A 3M1YA 1U7PA 4LGYA 1ISJA 1X9HA 1SU8A 1IZ7A 2QAIA 1KS2A 5DK4A 2C59A 4CF6A 5KYNA 1U94A 1JQ3A 3WGMA 4K03A 3NYWA 1W5BA 3RW9A 3R41A 1FSZA 3I5XA 1CY1A 2V5VA 1EHYA 3PNOA 5A4KA 3HU1A 4IQFA 2NV6A 2JGRA 4ZZIA 1U9ZA 3VHLB 1FFEA 1VYTA 5I9LA 2I2AA 4BUZA 1TVKB 4W5OA 2OMKA 2IS4A 3COJA 1MNQA 1ACJA 3VH1A 2I65A 4RHFA 1JDUA 2ZCUA 2XQKA 2YIMA 1T2EA 3K71B 4XLZA 3OQNA 4G41A 1PYOA 3JYPA 2FMIA 2IK8A 3LUBA 1DRJA 1HTBA 2Z56A 4W5HA 3OD5A 3TQQA 2QAGA 2B2NA 4LKRA 5J2UA 5D3MB 1ZNZA 5KYVA 2AR7A 1A2BA 4CQMA 5CFOA 2HWWA 2ONKA 1UOQA 5KNBA 1W75A 2BSQA 4YXWA 1UDCA 2B37A 4AJNA 2R48A 1GY8A 3BKXA 2W37A 3GUHA 3UJHA 4IH4A 4GOXA 2Q62A 5C18A 4LCEA 1NW7A 3BQ9A 4DJ5X 3V7UA 2PLWA 1WPQA 2R47A 1GCGA 2FR1A 2XADA 5JS2A 1DKOA 2Z9BA 3DO8A 3IBGA 1YOVB 1U9JA 3EW7A 5BW4A 2VI5A 2LCFA 2GN1A 3MUNA 4J75A 4OM7A 2J8ZA 1B3RA 3QM1A 3ZY4A 1JL3A 3UM9A 2VUUA 3TJZA 2AGVA 1LF5A 1ZUWA 1HE3A 1HRDA 2FN4A 1KH2A 4YYEA 2VLBA 2HF2A 2LXNA 3MJFA 4K3VA 3W3AD 3H0KA 1ONNA 1G55A 2R97A 4DCUA 5JADA 5KC8A 2XTNA 4HEOA 2XGSA 1XQ9A 1YI1A 3HXQA 1EB9A 2BM8A 3C3EA 1X92A 4GMHA 1UZUA 3W4IA 3S7ZA 2XWPA 5AT1A 1N2HA 2KX7A 2C1ZA 5FR2A 3KR0A 1AB6A 2WYWA 3ZNPA 4YV1A 1VLMA 6CHYA 4BGEA 1L7DA 3RYHB 3K70B 2JCBA 4OY3A 1UIMA 2AF3C 3QYBA 3A1TA 4IGFA 1NU8A 2B4QA 2A30A 4O08A 3TW0A 4M86A 1ORRA 4S24A 1G4HA 4OU7A 2FH5B 2DQZA 4G1VA 1I9CA 3KJNA 1P9LA 1TLTA 4F9EA 1VHDA 3IHKA 2I6SA 3JXEA 1NYTA 5EE3A 4EPWA 1CTQA 1R00A 2BOVA 3U3DA 2IU6A 1TYCA 3EG5A 1W1WA 2B8EA 2ZWOA 2UDPA 3HN6A 3ROEA 4B81A 5EHXA 2IVFA 1BXGB 4JH0A 1RQNA 4HYQA 1NR5A 4M0WA 1MENA 3BBPA 3GCXA 2R6ZA 4KSCA 4BECA 5ARBA 1VQ1A 3KKZA 2TSYB 4W9NC 5E4JA 2RD2A 5JCZA 4XWGA 3IVCA 2XEDA 2AZTA 3AJRA 1LBTA 5KU7A 2HA4A 4QTZA 1F8XA 4C6RA 1XB2B 1D2MA 2J0UA 3GAMA 1AF4A 4E11A 4IW3B 4M60A 2Q2EB 4OB7A 2M1ZA 3BE8A 1HDCA 5JYCA 4P32A 5BUQA 1C4OA 1M6VB 3MWJA 1T3LA 5FBVB 4L4YA 4C3ZA 1II0A 3LKVA 1UZMA 4JP1A 1XA3A 2C42A 3QKWA 4B8YA 3BWYA 4IFTA 5GZ3A 1Q39A 2JC3A 2FUEA 1MIOA 3EZGA 4F3TA 3BJZA 1QS0B 4D7AA 1CY7A 4GPD1 4H1UA 4PQEA 5LLSA 5LYJF 4Y7DA 1OBOA 3CMCO 1BJRE 2B69A 5K6AC 2PRJA 4BATA 1T3TA 3R3JA 4GPAA 3TW6A 1PUXA 1K7EB 5CX4A 4HEA6 2BH9A 3EC2A 4L3WA 4MUMA 1BEZA 4PZPA 2I6XA 1B26A 2D2FA 1PJ8A 3GFQA 4XYBA 5FFMA 2NX2A 1RZVA 3J7AC 3ZWXA 1WUTA 2R7AA 3L4BA 5LYJB 2A7XA 3A3PA 1ODLA 1PJAA 2ZRIA 1ZCFA 4B0OA 4LOKA 2QE6A 2HC9A 4Z2YA 2YWRA 1R2YA 4E1BA 2RGDA 3SMVA 1R9NA 5KSYA 5D5PA 4PO8A 2Q1WA 3WHPA 5JNWA 2EKPA 3RGGA 3GLRA 3PFGA 1E1NA 1SK8A 2VHYA 5CTAA 3HCBA 3KB2A 3I9MA 4RAOA 4DV1M 3DAGA 3UO8B 4IMJB 3FPGA 3WRWA 1KQPA 1ZBDA 4X8HA 3BB4A 5F77A 1Z17A 1L1ZA 1ZD3A 1RQGA 2QENA 3C3PA 3P71T 2W2QA 2FE8A 1FX0A 1ZCJA 3I5MA 2X7JA 4L4UA 3DS8A 3HJAA 2NW6A 4O1IA 1Y1QA 2E4VA 3ONVA 3L02A 3U9SA 5CVJA 5JMTA 3GD7A 3O38A 1ZJ5A 1JU4A 1OT5A 5BV1A 2BUBA 1MQ9A 4MP8A 4DMHA 1KK3A 2EKKA 3K9BA 4P1ZA 1RLUA 4KJXA 2BP7A 4CODB 2QL7A 2CCKA 2YOHA 2AW5A 1GAXA 1BU5A 3ZVKA 1O0SA 4UDOA 1Y8QB 4F8YA 2Z6QA 4OSEA 1UBNA 4KR2A 3WLJA 3OZFA 5K3EA 3L8HA 5C4IA 5HQ3A 2LIPA 1H0SA 4O4LA 4KW7A 1RMTA 5HKBA 3KKKA 4LVNA 1TNDA 3SDBA 2GCIA 3H8VA 1RAEA 2C61A 1NJ1A 1DRVA 1GPWB 1N34B 3AVTA 2OESA 3WLSA 2YXDA 4IOMA 1R64A 1J00A 3NIFB 1C41A 5KBYA 3GDOA 1XZMA 3PGVA 4QXAA 3ICCA 4O4HF 3H3JA 3P9YA 3WTCA 1SKQA 1XRPA 4MV3A 4UHCA 4JMPA 2AJTA 1N57A 2OVBA 3QPBA 4CI0B 5FAKA 3V32A 3AF5A 3P9PA 2BF4A 5I3ZA 3U5TA 5C1IA 4M9QA 3W0FA 3ZX5A 5BQ3A 2Q07A 3WNDA 3RNOA 1TUBB 4YRCA 3NBXX 5B58T 1QG4A 4CUJA 1CUAA 3DE3X 1ZI9A 2FSHA 1VB3A 3B48A 5BR1A 3KAJA 3C1TA 4B3DA 3VNSA 3HKPA 4O4HB 1AV6A 1HO3A 2VDJA 1KEVA 1AGPA 4C3UA 3WLLA 1VL0A 2CHFA 2ZSIA 2BIFA 4JQCA 3G2PA 1LXCA 3KEMA 3WY9A 1NWHA 3VQTA 1N2SA 3CW8X 2HCRA 1MBZA 3LX5A 1KP9A 5FEUA 3C1OA 3CWQA 3GA0A 4S2EA 4PFJA 1WSAA 1V11B 4YLGA 3VZSA 4HVCA 3GZNB 1OAOA 3ZE0B 2Q2VA 4MVJA 3OLQA 3NETA 4PYLA 2PUHA 3LW7A 1NPYA 3QPWA 4QYTA 1YZNA 1C0IA 4LGMA 3R7BA 2O0JA 3RUCA 3A6LA 1LPBB 2QKYA 1MRSA 2L0XA 3OT4A 4NFYA 9ATCA 2JY7A 2FQWA 4S3MA 1E3WB 4AF6A 3TIFA 5TF4A 1BA3A 2JI7A 4MQ4A 1T13A 3NM5A 2ODNA 1QKIA 1C4KA 1AA9A 3C15C 1KWKA 1I01A 1DBWA 4D44A 2R66A 3N58A 1YR6A 1SBHA 1I2ZA 1KYYA 1O5IA 4HQRA 4EKEA 4AUEA 3EK2A 5FNVA 3DTTA 1TW3A 1VCMA 4O4JA 4UNPA 3MWLA 4ZGWA 3UGTA 2NSYA 4JP3A 2IW3A 1WW2A 2BBSA 2Q3BA 1U6IA 1Z3CA 1P9WA 4AICA 2O0MA 1RWNA 1TIKA 3ICVA 5AOCA 3SAUA 1A4UA 4D0GA 1WCWA 5AUPB 4B4KA 421PA 4Z4EA 3NHUA 2XWBF 3EVGA 4R3UC 5CD9A 1YDHA 1G41A 3V1NA 4MUKA 4JU8A 3EEYA 1SELA 1RKXA 4PY2A 4NDZA 4QULA 3QI2A 3I8SA 3A6DA 1NTRA 4PPGA 2EFYA 1F4VA 5IPFA 1HT1E 4LK2A 1KO8A 1W36C 1XEWY 5CTJA 4RDCA 1L5MA 4ZCLA 3FWKA 4F86A 3D6FA 3MWDB 1PEYA 2CV2A 5CIWA 1E1RD 1PWXA 4RXUA 2XB9A 1TGUA 2XHZA 1I24A 3NU1A 4YT5A 5HJEA 3KOWA 3AERB 4PZLA 3EIFA 2OCBA 3PLNA 3T9FA 5BUSA 1JQDA 2V6GA 1FP2A 3OX1A 5BWBA 2BBTA 2V5UA 3BD8A 2JJ8A 1YT5A 4R40A 4MVJG 2BONA 1R0CA 3WLAA 2EW1A 4HTFB 2D2EA 1YDEA 5IDXA 3D6AA 2GMWA 3BGWA 4FQ7A 1RU3A 3ILHA 2Q21A 5FA6A 1NGSA 4KMOA 1SQ5A 4NPAA 5JW6A 2R5WA 1AV7A 5JFGA 3A1SA 2K4MA 1IN5A 2Y1LA 2WSSD 2VF5X 2O3JA 1KXJA 1M6YA 4EI7A 5AJWA 2B2XA 4YCAA 4AXXA 1O5TA 3GEHA 2X3YA 4ZAWA 4BNNA 4DW8A 3MMNA 4ZVMA 1M2OB 2O7NA 1G7RA 2YBEA 5CLHA 4V0OA 2HBQA 4GSLA 2YTZA 1VKNA 4X7PA 5DX1A 4RIGA 2I5PO 4D3ZA 3B3FA 4P83A 3RSZA 2MR6A 4KYTA 3TNLA 1H5NA 1LNQA 1WHSA 3R6TA 2L09A 4RMIA 1XMXA 1N34M 4WXHA 3NDPA 1PNQA 3R5SA 3O90A 5K1ZA 4D2IA 1BOFA 2VP3A 3AV3A 4GGMX 3CZAA 1M0WA 1DCFA 2Z3WA 2WM9B 2ZWVA 3SBDA 1W35A 2NZ8A 4QO7A 4QUGA 2RFLA 4NPHA 1J33A 4KWIA 2RBKA 2B99A 3RFVA 4GMQA 4W5JA 1A5AB 4MQEB 4J0JA 4POAA 2C4NA 4A2QA 3LLUA 3WLRA 4A9AA 3AX6A 5FOUA 4BEJA 3MGCA 3HB1A 4C4RA 3JD4A 3T61A 2H06A 2WSYB 3R3SA 3CX8A 3L40A 4UVEA 1L2BA 3JTEA 3R7NA 4K9QA 1QE5A 2DRIA 1ZH6A 3ZH9B 4XUGB 2DWLA 1LS1A 4BTEA 5CDHA 3JQ8A 5A2QA 5HVNA 4RVOA 4KQIA 3KW6A 2IE8A 1J6UA 2X6QA 3JQCA 3KRTA 3HL0A 1QQBA 1RWVA 1BXRA 3P9CA 4LZLA 4WKBA 3QE0A 3YASA 4RL6A 1NZDA 4RTMA 3INTA 3MNFA 3WBBA 5LP6F 3FCCA 2SBTA 4M9RA 1VA5A 2P8JA 2R18A 5HUQA 5CDYA 1TF7A 2FPOA 4G26A 1KKMA 3ZIDA 3CVYA 4C4TA 1E69A 3N2ZB 1ZBQA 1BEUB 4OGGA 2C5GA 4OYLA 1EU1A 4HQ0A 3QYEA 3EQZA 2R3SA 3PL1A 1BKYA 2J5QA 1W0JA 2B1IA 4R0MA 3HYLA 1D6JA 1K6XA 3E3LA 3CUKA 2PMDA 5L3SB 3VVLA 3ICPA 1EINA 3K70C 2C5RA 1LVUA 2JI9A 4I36A 4PRYA 3FMOB 3F67A 3KOZA 2IGBA 2PHZA 1QC5A 2PR2A 1SOMA 1T4GA 4GICA 4HLDA 2QL5A 2VC2B 2I2FA 3GGJA 4TL9A 2C2MA 3L79A 1GNTA 1U6JA 1NF3A 3DV0A 4JC5A 1ZO8A 3SFZA 3I6BA 4JZYA 2G3QA 5K2MA 3SQLA 2YXPX 2QSUA 5FA5A 1YQDA 3VC7A 3TBHA 1XJWA 2OUKA 4ARIA 4NYJR 4R0NA 3MINB 1J9EA 3WBJA 1IOLA 3IOEA 2HY7A 3HCOA 3KKPA 5ITXA 1EWQA 1HE1C 2BZGA 2J3EA 4DWWA 4ZDKA 1UBLS 5CIQA 1H6CA 2V6MA 3T8YA 1JQKA 4BKMA 3AU9A 5GTDA 3L7AA 2D7DA 4IMIB 1GAEO 1UBMS 3USES 4D9JA 3FNHA 3ZHCA 1NXTA 2VDOB 2C5AA 1Q91A 2IA5A 1ZK4A 3GGGA 5AXDA 5CVEA 3UMFA 1O6CA 1XTUA 3I5AA 2PLRA 4XD7A 4LPSA 2B4YA 2Z2XA 1NLYA 4EM6A 2A5FA 4LC9A 1H3FA 3PQFA 3IR6A 1LZKA 4R69A 2P9TA 3UAGA 1N33B 3BFKA 3FDFA 2A4MA 2ZBKB 4MYTA 4IKOA 1N2IA 3CCCA 5IAGA 3NNNA 1XCLA 3CEPB 3AFNA 2VP2A 2O48X 1I1HA 4MA4A 1ZNWA 4D1YA 4RIEA 4TKVA 3V5NA 2I67A 2CFOA 3D1JA 1JVSA 3L6CA 2W2XA 5DCWA 2XEPA 2PWBA 3HYCA 5CT4A 4WECA 2FWNA 5IJXA 2PG3A 4BNFA 4MKIA 1KFJB 4OOEA 2RAVA 1R15A 1BH2A 4HN2A 3HLYA 3UK2A 2VS1A 3IAXA 2UYYA 5KDOA 2O8BA 5H8WA 5DNYB 3ZV3A 2IODA 4NMWA 1D04A 1WMFA 2O52A 4YRTA 1XZGA 2LV8A 1TYBE 4TKZA 2UXCB 4IFIA 1O96B 4QDUA 3ZVLA 4P81A 2GLXA 4PAWA 5A62A 3HZOA 4Q4JA 2JI4A 1U3DA 2Y4OA 5KAMA 3V8BA 4WNAB 2F5OA 1NQTA 1A1VA 1UMDB 4IJUA 3I2YX 1YR8A 4ND2A 5K0NA 3UKJA 3GDWA 3I9V6 3N07A 4Q3CA 4EY5A 1WMAA 4QXMA 2ZIXB 2GM9A 5AVUA 2CUZA 2Q5JA 4Y2TA 3FSEA 3QAUA 3AWDA 2ROQA 3A05A 1JLKA 1ACLA 5JEEA 4I1IA 1H4VB 4FS3A 4Z86A 4NZZA 5DN6A 1XTVA 1LH0A 1DIOB 2NO6A 3NEYA 1RQXA 1GTG1 2VYND 1PEAA 1EG2A 3N74A 3KALA 4IICA 4DM4A 4EG8A 3Q7QA 4MV6A 4FFMA 2VVTA 2C3MA 1C1DB 1A7JA 5HK8A 2FUNB 5KNDH 4ASUD 1RKQA 1JX6A 3WX0A 3IEMA 5ENDA 4IZIA 4HNAB 4U7DA 4LF8B 3KCNA 4EO7A 2C07A 1RZUA 3DEKA 5PGMA 3L04A 1WWKA 1M34E 3EFHA 4ENWA 1V7CA 3OLCX 2AZXA 4XOIA 2C98A 2QE7A 4IHAA 4G6ZA 4P3OA 1GA6A 5L8RF 4FR2A 3GJYA 3UATA 3CS3A 1IPFA 3MWKA 1JHZA 3J80S 1QHHA 4KLRA 5IDYA 3ZI4A 2R4JA 1XMQB 5IVHA 1WZNA 4NZPA 1S2MA 5J4LA 3FZNA 2ZWPA 1W5SA 4KR6A 4ZTBA 3PD1A 1NG1A 2QX4A 2P2ZA 1QHEA 4WD3A 3HR4A 1G17A 2NV2B 4KNWA 4FJ2A 3JWHA 2CW5A 1G0OA 4E1AA 1B41A 621PA 1YZTA 1Y6JA 3PNSA 3DBLB 3FDJA 2NXWA 2K9DA 1G8YA 3EAQA 3IBFA 4G07A 3SSMA 5P8WA 1SCBA 3UMGA 3ZDCA 4PRLA 5EMLA 4H35A 2XZDA 1FLDA 4MW0A 3TR6A 4O2AA 2Z3ZA 4CL2A 3H2SA 1Z25A 2A14A 1ZH8A 2Y6UA 3F71A 3EBOA 1U0LA 2ZBRA 1LDNA 6ABPA 1CE8B 5FI0B 4ZQCB 1Q14A 2HSEA 4QG3A 2EP8A 1SBYA 1SCQA 4K6KA 4JOSA 4NCJA 3QY0A 4JD5A 3STYA 4X6YA 3ND7A 3ENKA 3K35A 2Q0SA 4CV2A 1NAHA 3OJCA 5C32A 5BT8A 3AU8A 2J9RA 1HLFA 2YWBA 3VDXA 4J16C 4WY2A 2ZVPX 4ZCPA 5H4HA 3V7NA 5ITSA 5I9SA 1FRNA 3THWB 2B3DA 1ODTC 1CF4A 4BP3A 4IDHA 3OH8A 3B82A 2XYPA 3MMXA 1US8B 1DMSA 3UQZA 4D25A 2PX2A 1C3XA 2XBUA 2XOKA 4OGKA 3F8WA 3VTZA 2ERCA 5DBEX 1GGMA 2VWPA 1N33M 1X9GA 2D4AA 2WM2A 3S2ZA 4JGIA 1SO8A 2R1VA 1TA4A 2F4NA 3U4IA 5C51B 4IIXA 3KP1A 2DT5A 5T4EA 5KCMA 4B3BA 1T9DA 3B7ZA 4UUAA 4I3FA 4I7EA 1F4LA 3DOCA 2H52A 4MJLA 1CZRA 3T7DA 3JR3A 5EERA 1JEQB 4G86A 5I7VA 1W19A 5DTEA 1P31A 4LMAA 5L8VA 3AF6A 5BVGA 1H8EA 1LBSA 2BKLA 1VSQA 4QGBA 4LWPA 2YQ4A 1KJIA 3Q8XA 4HDMA 1NUUA 3AR4A 2G5GX 4CMIA 1W4AA 1E5VA 2WLSA 2K6BA 5TRTA 5DXFA 4LSZA 4IDGA 5DSTA 3OO1A 2UXCM 1W7AA 2GJSA 1Y4DE 1PU2A 3SP1A 3GGPA 1WV0A 2KM1A 1QONA 3PE3A 1QH1B 4MQ6A 1FYDA 4NC9A 4BGIA 2X0IA 1UWCA 4FNGA 4ZVUA 3RSFA 2BL4A 5LJIA 4QPPA 5C5IA 4G84A 4EMBA 2PL5A 4TUYA 3QTBA 3GQVA 3L4KA 4HMQA 1WGNA 3O84A 3T7EA 3P9ZA 1W4ZA 3TOVA 4C0JA 4RPCA 4S2UA 1Z39A 1QHSA 2QDKA 3DL2A 5I6DA 4UKDA 3WICA 2XNDD 2ZE8A 1TU4A 3H1EA 3RFFA 4XM0A 4LHWA 2AZMA 4YP0A 4DV2B 3HVKA 5ERGB 4MWDA 1TM2A 4H4CA 4JI5B 2C84A 1DTSA 1OAAA 5K3BA 2JKVA 4RMNA 4KKXB 3EXHB 2RARA 3H84A 5DO9A 1GDTA 2V0NA 4F4FA 1KRWA 1AVTA 4DLKA 1PF7E 2XUDA 3QLVC 3FWYA 1KHTA 221PA 5ESDA 5MN4A 1KPIA 1N3BA 3GVXA 1T2VA 4IHKA 4LF8M 1BWQA 4Q01A 4PCUA 4U9HS 3ZGVA 2DZDA 3D8HA 3D4BA 1UZNA 5K3DA 4KLNA 4CIXA 1L4HA 5IJAA 4TMTA 4KTVE 1F12A 5JJLA 4C6SA 4FHDA 1BDBA 1RRGA 3BMCB 2GJ8A 4KWTA 1SUDA 1Y9AA 2AEMA 1G20E 4GI2A 1QVWA 2HFKA 4C9BA 2RG1A 3AL2A 5I4KA 3DLIA 4R1MA 2J3KA 3VI3B 4WCFC 3LC7O 2Q29A 2JGNA 2NTEA 3FF1A 5K6RA 3DPSA 1ZGHA 3HSSA 3EPKA 2NP7A 2ZI6A 3GPBA 1UJ6A 2GAOA 3I34X 2B1GA 3OVMA 4WKCA 1LTKA 2OBXA 1ZDMA 3DOAA 2J6HA 1QDTA 3G8DA 4DLTA 2CXRA 2ZP1A 4RPJA 2VAPA 1J22A 5HKKA 3AVQA 1ZM7A 5DYYA 4Z7JA 4MK4A 1ZKMA 1UP4A 3BB1A 2WVJA 4QUDA 4PM4A 3FRJA 1YKFA 2JI8A 2CFTA 3NTUA 2C3PA 2GN6A 1M8GA 5LMZA 2X2FA 2WSBA 4Z1MA 4Q4HB 3HJCA 1KARA 1W4RA 4A2CA 2QRHA 1U02A 3QV2A 3L7IA 3QHPA 3TBFA 3LQYA 3K6RA 4PHFA 2EQAA 4JV5B 1PJIA 2YMQA 4IR7A 4UHDA 4H2DA 1WKVA 4IS3A 3HM9A 3PQ5A 3S27A 1IM5A 3W2TA 9GPBA 1T5TA 2WG1A 2JNHA 3PFBA 2GO7A 1PGOA 2CMFA 3DMTA 4PCAA 5LP6C 3N7AA 5A3JA 1E1QA 4CFZA 3FMGA 1KNQA 2GLUA 5EGSA 2XGGA 4YFYA 1ZM9A 4H1TA 1GSHA 1Z4OA 1U4NA 4D8XA 3PNQA 5EZQA 2Q1YA 2Y1GA 4L9WA 1APBA 1Z0ZA 5IYZF 3GFBA 3C5CA 5C8YF 2ZUBA 4RHCA 4N18A 4UJ3A 4Q3DA 2NOAA 1V8DA 4A3SA 1CJUC 3KP0E 3CZCA 2RH4A 2R7KA 4J4TA 1AKYA 3NNSA 1YF3A 5EHQA 3AUTA 4RLSA 1Y1LA 1BIFA 2YIDA 1NXSA 5EQTA 3BCHA 1ZGBA 3VSAA 3DZIA 2A5GA 4PHCA 1L5ZA 1MJGA 1BC5A 1W0CA 1V8ZA 2Q3MA 1G42A 5CURA 3L46A 2P2CA 4H1HA 3Q10A 1QOQB 5IYZB 4JK3A 3TRIA 4R2LA 3NIWA 4RD4A 3FCSB 1PR5A 2AXQA 3M49A 1VPVA 4LS3A 3VJRA 3IQGX 3U6QA 3FCOA 4NG5A 4S04A 2H63A 4RVHA 4OHBA 1JHPA 1M6HA 3IB6A 2BTQA 2BKAA 3FX2A 3A10A 3B6JA 4TLDA 3KFVA 5LJLA 2WP0A 3OM9A 3PV0A 3EXFB 4NCXA