2G5RA

Crystal structure of siglec-7 in complex with methyl-9-(aminooxalyl-amino)-9-deoxyneu5ac (oxamido-neu5ac)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
114
Chain Sequence
KDYSLTMQSSVTVQEGMCVHVRCSFSYPSQTDSDPVHGYWFRAGKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sialic acid-binding Ig-like lectin 7
publication title The structure of siglec-7 in complex with sialosides: leads for rational structure-based inhibitor design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 29
structure length 114
sequence length 121
ec nomenclature
pdb deposition date 2006-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2g5rA00
2DD8L 2O5XH 4JO1L 4P99A 5DJZA 4X5XB 1IL1A 3CMGA 3N06B 5MEOA 3IKKA 4K2UH 2GK2A 3S4SB 1GOHA 1O7VA 1UENA 1J86A 1TCRA 3OXSA 4RMUA 5D9SA 4HC1H 1P9MA 4HZAA 5E2WH 5EU4B 4MZ3A 2Z31D 3BUYA 2VLKE 4PRBA 4GW1A 4ZAKA 3T2OA 1HDMA 4WWKC 3V6ZB 4NPYB 3KS0H 1QVOA 3HPJB 1QSFD 2DQHH 2ESVB 3C2AL 4MA1B 4WFFD 4O02L 3SDDD 2J2ZA 3QUMH 4Q9QL 4PJXF 5I71B 4CADA 4KY1H 1TZGL 4PJDA 4Z7UA 5EZIH 1FYTD 3TBTA 3RFZC 1PQZA 4P2CG 1IZKA 4U05A 2GJZA 3MNVB 4G43B 1T1WB 3CZFB 5EU6E 3DIFB 4WEBL 5F7MC 1EBAA 5ESQA 3ZT5A 1EFXB 3AMKA 1IAOA 2EDWA 4UIMA 5B4MC 3MRLA 4FFWC 1FFQA 1E4JA 2UZXB 3CCHA 4MXQC 3VI3F 4IRSD 1WIPA 1ZEAL 1DTUA 15C8L 5TQ0H 4QO1A 3DBXA 3SDCD 2C9AA 1T1XB 2AXJA 4QRRB 2BY0A 4YWGH 4PG2A 4DW2H 3CFCH 5GGTH 4F9PA 1KB9K 3PP4L 4JB9H 4PJXE 4L8DB 1KFAH 1A7NL 2DMCA 3C5ZB 5KN5B 4MSWB 3W0WB 5DMYA 5I74B 3STBA 1A9BA 3LHPH 4OZGB 1GOFA 1EJOL 1JPST 1S9YA 2QQKL 2VLLA 5F7WC 3L3GB 3ZKXC 3C6SB 5AD0B 1MQKL 2WQ8A 4K94H 2QL1A 3C5JB 5TE6H 4LKCB 5IT2L 2X4QA 1MNUH 2AJYL 4NN6B 1RZFH 3QIUA 3C6LD 1MWAA 5IHUL 1FL5B 3T4AB 3VI3E 3D18B 5KSAC 2UWEF 3MRKB 3X12A 4OV5A 1SEQL 2HMID 2I5YL 1PSKL 3IXAB 1UZ6F 5KSBA 3VFTB 3MRPB 5I16A 3RWCA 1A3RL 2APWA 1JMZA 4XAKD 5T3ZL 3IB4A 3R0MA 1FGNL 1JPFB 4LLQA 4NRZB 1W72A 3O8XC 2V9QA 2VQ1A 3ARRA 3KYMB 5ADOH 1TZIB 2D03L 3EO1A 3NIDF 2F9BT 3D6GA 5EDXA 4QHUB 1OGTA 5EIIB 2F58H 4O51B 4JN2B 3DROA 1FL3A 1RZ8A 5D6DA 2UWEE 5DLMH 1LEGB 3QDMD 1RIVL 1UZ6E 3D39D 5FB8B 4PJEB 2P43B 1U8QA 1ZVSB 5DUMH 2EXYD 5IF0A 3UXFA 3LV3A 4G6FB 3BHBA 5ISZD 3P2TA 2DM7A 4C83B 3W5NA 3PIQA 2JKXA 1MLBA 5F88A 5GZNC 1RJLB 2EH7L 4ONHA 2PYEA 1OP9A 3RUGA 4IOSD 4GRLC 3NIDE 4J2XA 4HKXB 2A0LC 1Q8MA 4ZO8A 2AEWA 3VWKA 3Q6FA 2A9MH 2H2SD 1E4WH 2RGSA 2IBGA 5C71A 1IC7H 3OJDB 3KPLA 3EKCA 4DTGH 1LO4H 5GISL 2FRGP 4UIKH 3VDCA 2CLVB 1P4IL 4P2RD 1BBDL 2Q76A 3MRIA 5D7IA 2YD1A 5AUMB 1K4DA 4Y4FA 4HS8L 3JWOH 1MFCH 5LQBH 1REIA 4OZ4B 3VG0H 1F4YL 1QFWL 5T1MA 3CXDH 4NHUB 4YAQA 3O3EB 2NXYB 1W72L 1X9QA 1B6DA 5IW3A 1A2YB 3UAJC 4X8JB 1CG9A 3VWJC 3ET9F 4NFDA 4U3XA 3V4VL 2CLRB 1WGOA 3JV4A 2R0WL 3MBXL 3MRJA 3W11D 3VD3A 1OQXA 1GJIA 4ODVL 1U8NA 5I0DA 3GRWA 2MKLC 3RDTB 1RUKL 4PGBA 2DQJH 3TCLB 4PJAA 1W2KT 2M1KA 5EBGA 4FRWA 3MJ8A 1H9VA 3MLUH 5MEQB 1AO7E 4HFUH 1L0XA 3R4DA 4JN1L 1JGLL 2OYPA 4Y4KC 4OZGF 3S34H 1IAKB 5CJQH 1EHXA 3RRQA 1VFOA 3ETBF 4QRQB 2NY5C 1HNFA 5BV7L 4KZEH 1OSZA 2B1HL 4HS6A 1HIMH 4AZ8A 4FQIL 3CLFL 1U58B 3NCYS 3MFFA 1RK0A 2R0ZH 3SDAA 3E6FB 4M4RA 4RRPA 3LKOB 4KI5D 1HNGA 1S7SA 3NA9L 4JFYB 3V6OA 2ED8A 3KLHD 2PTTA 3BDXA 3U36A 3VXUE 1MFAL 2OX5A 3MUHL 3HUJB 5C09A 1X5XA 4NP4H 5DK2A 1F11A 3W0WE 2AV1A 4WFED 8FABB 4DGYL 4OZGE 3QIBB 3UYRH 5C0FA 3VGHA 1QUNA 5IFHL 4RAHA 1ZVHA 5BS0B 4PGJA 4RGND 4S10A 3V5DA 2B5IC 3IAGC 4HT1H 1NLBH 2JJVA 4AENB 4MXWH 1T0NA 1X7QA 3Q1SL 4OIBA 3VCLB 1A6TB 4LLYA 3MA7B 5DJ6B 1RFDL 2NY6D 2E27H 4LQFL 4NOBA 3TWCH 5L6YH 4PJEF 3WXVH 4TPRH 4EEEA 4Y4HA 3MUJA 2X1OA 3TO4A 3RZCA 4HIEA 3HZYB 2ZSVB 4P9HH 3R06B 3NCJH 4NC0B 1J0HA 4Z95L 5T3XH 3MODL 5KVEH 3GRWL 1RUAL 2Z9TA 4YEFA 4P0DA 3VXRA 1JZ8A 1IBGH 1CICB 3RL2A 3KXFE 5JOPE 5JQ6L 5B21A 3BPNB 4DUXA 2OQJB 3PV6A 3DMMB 4D0BA 3MBED 2VDNH 4O00A 4OZFG 5A2JH 1YJDH 4Q97A 4YPGB 1XMWA 1NGPL 2XN9E 5ICZA 4NBZB 2VXSH 4PJEE 2GSIA 5K9OA 1NCNA 4WFHE 5GRVK 3VDBA 3ZE0F 3RU8L 2F5AH 3GSVB 1U3YA 3F58L 1T6WA 4PJIF 3KPSB 5FO8B 1A3LL 4NNXB 4F2MB 2VZ1A 5JMOC 1KT2A 5JQHC 4IS6B 5T1DL 2VKWA 1EV2E 3GSWA 1MCPL 1KTRL 3H9HA 2X7LA 4JM2C 1G9EA 1TTFA 1VFMA 3QI9C 2X05A 3QQ3A 4PRID 3RTQC 1OARH 1A1MB 3T0XA 5IESL 4JQIH 1ZT7A 3EO0B 3T4YA 1YUHA 1K8DA 2A1WL 4MNGE 2X41A 3G04B 4NQUA 5TFSL 3VGAC 1TJIL 2PO6A 1W0WA 3ZE0E 4X4YB 2V2XB 5HVFB 2AJZB 4XX1E 5DRWA 3DETC 1SYSB 4PJIE 1G7QA 2Q8AL 4HZLB 1Y18B 3WL9A 2E7LC 2CLZB 1CFNA 3CDGA 4MB5A 2DM3A 5FKPB 2XZQH 1MHEB 1UM6H 5HYJE 5TDOB 1ITCA 3ROLB 1XGRA 3TJEH 4I4WB 1BBJB 3SDYH 1I1FB 2XY2A 4JQVA 5D1QA 2DQEH 4WHTB 5EOQH 3HR6A 1MELA 1G7PA 1B9ZA 2XA8L 1S5HB 3MRBA 5C92A 4AEFA 2XZCH 4OZIB 2X9YA 1A7PL 4GXVL 2HLFD 1U95A 5DQJA 4I5BB 1OWRM 3GSOA 4LU5H 3HRZA 4JY5H 2A83A 5ENWA 4NGHH 3BZFB 4LLVB 1YMHA 2E8YA 2ZSWA 2V5YA 5L8JB 1QG3A 2PW2A 4QXWA 4XP6H 4JFFA 4NZTH 4J3WA 3OKMB 4APQA 4GQ9L 3BDYH 4OCXL 3VXSB 4X5WB 3FO1B 4EI5D 3SE8H 2ADGB 1LEIB 2CDGB 4YHPB 2P5WA 3Q5OA 4OTXL 4HAGA 3BH9A 4YHOL 2H9GB 2X9XA 3IGAB 4BH7B 1A02N 1IEHA 1D3CA 3DARA 4JFEE 4M03A 4GMSH 1A6PA 4F7MB 4JJ5B 5CINH 3OQ3B 1D7FA 1SVCP 4D94A 4O58H 2OP4L 4MLSA 1RZJL 1EGJH 5EBWB 2WINB 4ZFGH 1HQRA 4AK1A 1H15B 3G6AB 3ZYZA 1PFCA 4JO3L 4XB8A 3V5HA 4J4PA 5GJSH 2VYRE 1MIEH 3ULVL 2YA2A 4ISVA 5K93A 5BS0E 4P9ML 4P5TB 3A6CH 3IDIA 4HWBA 1A1NA 4HXAL 1IKFL 4N8CL 4CVXB 3GMPB 2BSTA 3QJFA 1XCQB 5DJ2A 3RNQB 3HLAB 3TVMA 5J13B 3BPCA 3FQNA 1U0QA 2OR9H 3E2HC 4FHBD 4ZXBD 5C9KA 4WW2A 1ED3B 2DYPD 1SJXA 4WTWA 5DJDB 5IVXF 2NX5E 4FQ1H 3ULUL 1V3LA 1YY8A 3CH1A 4R3SB 4K7PH 3P9LB 1L7IL 4LLMA 4ZPVB 2VC2H 3MXVL 5CEYA 5C7XH 4JZJA 3UX9B 4YDIH 4D0CB 5JA8B 1QRKA 3V5KB 3ARDC 2HVKA 3QPXH 4PIRF 4G80B 4E5XB 4M43L 3O45B 1TVBB 3P4OB 3QFJD 2JCCA 1RVFH 5HGBA 4H1LB 3QUYB 3KPPA 4CNIA 2YBRB 5IVXE 5ICXA 3RWGA 3OKNA 2AK1L 1G0DA 4X9BA 4Y19B 3WN5C 4ZUUB 5L9DH 1N5AB 3QA3B 5CKAA 4C55A 3KPSE 4JFHE 4G6MH 1UEMA 4F7TA 2ITDA 1E27B 4ZFZA 3LS4L 1FFRA 1NAKL 4NQEB 3HA0A 1I1AD 2X4RB 2PETA 4CN6A 2APFA 5I1LB 1ZXQA 1TIUA 2V17H 4QYOA 5INDB 3IRPX 5DFTA 3LH2H 3H9SB 3C87A 2NY2C 4D0DA 4HDIA 3WHE0 5I8CB 4J6RL 2KKQA 1MREL 4JDVA 2CGRH 4DKDC 1DQLH 4OZIF 2MCG1 3O0RL 2NTSP 4M61A 5HHOA 5K9QG 1OAKL 2OTWA 3RX5A 4LSPL 2JB5H 2Y1VA 1QRNE 4U1LB 1HZHL 1Q72H 3ZKND 5E94A 4L8SB 4UOW1 4R8WL 2HT3C 2HA1A 5EO9B 3ZDXF 3MGOA 3TA3B 1U3ZA 1A64A 3IFLH 3PWUA 3NIFF 4YDLB 3SBWA 1MFDH 4PP2A 4OZIE 4IOIA 3S6CA 2A9NL 1DQDL 1LP9B 1VEOA 2PTVA 5HY9A 3RVUC 4HMCA 4EI6A 3RI5K 2X40A 1U8LA 2KQNA 1CIDA 3F62A 3GIVB 4Z77A 1MRDH 5SWZB 3B9KD 4IRSC 4YGAB 3A6BH 4L9DA 1EO7A 4FOMA 1UJ3A 1BD2E 3SDCC 4ODUB 2WAHA 3ZDXE 4XPFH 5IMMB 3NACH 5FO7B 1BVLA 2PNDA 2QQLL 4UI2A 3GNML 3MV8B 2HVJA 1J0IA 4I2XB 3NIFE 1CL7I 2Y4SA 5F3HA 3RWEA 4AM0B 5CGYC 1IT9L 1NBZB 4GLRI 1FN4A 5E9DD 4NCC1 1AGBB 1W8NA 4OD2A 1MAKA 1G9NC 4P49A 5E5MB 4F7CA 2H1PH 2BOBA 4ODSH 1S7WB 5F9AC 3EOAB 2AQ2A 2R1XA 1EO8H 4PY7B 1J1OH 2VERN 2HMIC 3BISA 4J3UA 4HG4J 4RFEA 2BNQE 5EZJB 4GMTL 4QRPE 2WLZA 3M8OL 2HWZL 1PKQA 3UTSA 4Q9RL 1N64L 1TNMA 2H2PD 4PLNC 1NCBL 4M1CC 3FTGA 3EJZD 1UA6L 5EUKA 3DJ9A 4Y0GA 5IQ9B 2KQMA 2ZUTA 3G6JF 1IGCL 3ISWA 4OCWH 5HHVH 4KZDL 2ILLA 4G42B 4I9WE 2HAZA 2EZ0D 5D5MB 5JHDB 4N0UA 2JJWA 4BH8B 3NFPB 4OSUL 4QHNB 4Y2DA 2VLME 2F53A 5KG9B 3GSUB 4M6NH 1LDPH 2EXYC 3DVFA 5C0BA 4DJMA 5C0RL 2PF6A 4GS7C 3BT2H 3BIBX 4X6EA 2E8ZA 3OAUH 2E7BA 4TN9A 5GS1C 5T3ZD 5IG7A 4JPKL 1YEIL 1WZ1L 2DQGH 3G6JE 3VFWA 1HQ4B 4ZAKD 2Z91A 1F3JA 4PJ5E 4OUUA 4R0LB 3PWNA 4Y19E 4MD5A 2H2SC 5D1XB 1KJ2A 3OKLB 3NA4A 1NEZB 2ZOLB 3IRZA 5D70H 3T77A 3E8UH 1CDGA 1JPGB 4PY8J 1YQVL 1Q1JL 5C0EA 4PRPA 1HXYB 5JORB 1ES0B 5E0QA 4PGEA 3LS5H 2JK5B 3MOBH 3B5HA 3ZSTA 3H9SE 2VE6A 3O2WH 1RK1A 3MCKB 5CSZA 1NFIA 3EYOB 3MCLL 2PYFA 4BQ6A 3OB8A 1U92B 5D93B 3GMMB 5FO9B 4OLYL 1S8DB 1MEXH 4OCLC 4P57A 4N1HB 3MZGB 2Z8WC 1LP9F 1FAIL 3MRRA 1AJ7H 5K59F 4DZ8B 1D5IL 4PGDB 1UCBH 3HI5H 3L7EB 4EQ3A 1FVCB 4L8CA 3N1PC 4BKLB 1CE1H 4YH6A 5SX5K 3W11C 3KGRA 4FFYH 4GBXC 3MLZL 4A6YB 5J1AB 3HB3C 3OHXA 4GAFB 3RAJH 3C60B 5I1GH 1OW0A 5HTSA 4MJIB 1U8KA 3QIUD 3RY6C 4JFOA 1T89A 5EULV 2VLKA 4ZTPL 1AHWA 1KN2H 1GIGL 5F1IB 3DVNA 1WBYB 2X1QA 4DKEH 4R4FL 5J0BA 2WBKA 2FATH 3ARTA 3LD8B 2BOCB 3ARGC 1DQJA 1LP9E 1J1PH 1TMCB 5GGQH 5K59E 3G5YB 3GB7B 4HC1A 4I0PB 4PFEA 4N9GA 1ZT4B 2YD4A 4YBLB 2FB4H 5EU6A 4KKLC 3VXQA 1R5WB 5DJ0B 3FB8B 2AXFA 3L3OB 2CRYA 4LIQH 3CU7A 2FEEI 4XNQA 4KI5C 2VRAA 4TSBL 3RI5F 4Q58C 5FDWB 1AY1L 1KJ2L 3OR7B 3DYPA 4PTUA 2OK0H 2FJFA 3WIFA 4GUPB 2ZUWA 3X11A 4UTBH 2QSQA 3CVHA 3HFML 4NO3A 3GZKA 5JW4M 2IH3B 5DD6B 4XPTL 2BVOB 5DK3A 4X7EC 2E6QA 4BSVB 1NUGA 2XFXA 2JB6B 1HSBB 1XGQA 1XIWB 4PJXA 4WJ5A 4ZUTB 3TIEA 4PJCB 1I8KB 3IDYB 4L1HA 2E6JA 2BMKA 5L8KB 3NCBB 2X4UB 3EO9L 4G9DA 5IB5B 1CQKA 4G8IA 1DBAL 1GGTA 4P59H 3O4OC 4PJFF 2PYED 2IBBA 3IF1A 1HILB 5I18H 4C4KT 3VWKD 4AG4L 1HSAA 1MLCB 4JY4A 3DTXB 3LEVL 1JV5B 5DD3H 3VW3L 3MJ9A 4KK5D 1AFVH 3BWAB 4G5ZL 4W68A 5GIRB 4KKAD 3TO2A 3T8XB 5JR1H 1K2DB 3BEVB 1EHLL 1NGYB 1YECL 1GZPB 3T0EB 1AQDA 1QA9A 3UTOA 1PG7L 3LVEA 4PREB 4XX1G 3LPWA 3MBEC 4ZUSB 2PKDA 2A77H 2IC2A 2O5XL 1AIFB 3IDNB 2ZCHL 4PJFE 5E8EB 3VRIB 1FCGA 4HC1L 5E2WL 2UWEA 2XWBB 5LKNA 1YEEL 1OSPH 2PXYA 1F3RB 3ARBA 4P4KA 3CSBA 3VA6A 5TF1H 2CDFB 2QKIA 4IJ3C 4U31A 4RWYL 5IBLD 2F54B 5B22A 4P3DA 1GAFH 3WS3B 1P7QA 1H5BA 4OFPA 2BERA 4NKMB 1S5IH 5D7JC 2HJFA 4ODWA 1JZ4A 3CVHL 4QTHB 5FUZH 1L6XA 2Q6WA 4JFDE 3NPSB 4LVOC 5ADPH 5LWYH 1J5OL 4U6VH 1A7OH 3TYGH 1DLFL 4BQ9A 3T2PA 3KPOA 3DO7A 3BAEH 3RWIB 1XR9A 2N4IA 1Q0XH 2J88H 4Q2ZA 1OP3H 3ZMRA 3MRCB 5GGUA 2H41A 1RUQH 3LEXA 4JKWA 4ODXB 5DJAA 4F57H 4B5EA 4DW2L 1CLCA 3QWRA 5TH2B 3R1GL 4JGMA 4QGYA 3SDAD 4NKDB 3N9GH 2L0DA 2XYCA 3INUL 5EO1B 1OL0A 3LHPL 3MJ9L 1T5XA 2NLJB 2RFXB 2OJZH 2AXHA 4LSTH 4GOSA 1JRHI 4NM8L 5C09D 3U4BL 3RVXC 3U0PB 1MNUL 1HHIB 3FQTB 5EZOL 4XVSH 3U7WH 2NZIA 4ZD3H 2HLFC 3HCVA 3F6LA 3QUMB 4PV8A 1U42A 4FQCH 3AVEA 1HINH 1YEHL 3WIIH 1NL0H 3GBNH 2BVEA 3N1GC 2E9WA 3HPJA 5HDQL 2ESVA 4M62H 1KCRL 2F19H 4S1QL 3MYZA 5ILTL 2P8PA 4PJCF 3QULB 2GI7A 5ADOL 1C08B 3S3JA 5HHXH 4Y4HD 1MCSA 1OLZA 3PV7A 3TO4D 4PP1D 3RZCD 2VQUA 3DIFA 1CD1A 1EFXA 2VKXA 4TSAH 3X3FH 3V0WH 3U2SA 4K8RH 3VXRD 6FABH 3IDJA 4GKSB 3RIFK 1Z3GH 5DUML 3CX5J 3GK8H 1T1XA 1EHNA 4M7JL 5FYKH 3VFPB 4V1DB 5BVPL 3QDJB 3RWDA 5DVNA 2YD8A 4IBLT 1BQUA 3ZTNL 2B4CC 4L8DA 4PJCE 2CJUL 4IMLB 3JUYA 1MHHA 3MQIA 5I1EH 3C5ZA 5KN5A 4MSWA 3W0WA 4PB0H 2R8SL 4OZGA 3H2WA 3L3GA 3D9AH 1TETH 1P6FA 2BSRA 2HH0L 4HMEA 1D9KB 2A9ML 3ECBB 2XG4A 5FYKE 4ZXBC 1UB6B 3V52H 3DSNA 4HK0A 1OAQH 2MCPL 1DSFH 1NAMH 4J23A 3UZQA 1NGZB 4TUJA 2YHGA 1QLFA 4RX4A 3D18A 3NCYP 1A0QH 1DR9A 3A67L 3IXAA 3MRPA 5B8CB 1BMGA 3BOVA 3VXTB 3TBWB 4KJPD 3FL7A 3QUZB 5DF0A 3QFDB 2HFGH 2X1PA 3KPRB 1D5BB 4NRZA 4YQXL 1ZLVH 3T0EE 4XP5H 2PO6D 3TH4T 4K7FA 4UUJB 1MFCL 3ULVD 3MV11 1CFVL 4QHUA 4XP4H 4Z8FH 1MCJA 3UP1A 3EYQD 5EIIA 4AQ1B 1YZZA 3KXFA 4O51A 4JN2A 4OI9A 1T7YA 4TSCH 1PY9A 2W0FB 3LQMA 5LJYH 2DLHA 5E08L 4Z18A 1HN1A 2VZ3A 1ZHBB 1JGVH 1Q9LB 3SGJC 1Q9OB 2XN9A 5C9JB 2F54E 4BFIB 3ULUD 5FB8A 4PJEA 2FGWL 3JTTB 5CIPH 3SE4C 1I1AC 3RBSA 4XC3L 2X4SB 3OAYH 4MWFB 5FV1L 1IC5L 3S34L 3RP1A 3BRFA 3KPMA 3SPVB 3DNKA 4HKXA 3KAAA 1KJMB 4JFFD 1YYML 4FNLL 4APQD 4KZEL 2VIRB 5SX4I 5EWIL 3I9GL 4HJ0C 3CVIL 4KJYA 3VMPA 3CPLA 1B0GB 4HHAB 4MNGA 3OJDA 2P5WD 3DVGA 4JQXC 5L2KE 5FOJA 2CLVA 2PCPB 4HPOL 3FO9B 5F7KC 4HPYL 4PJIA 2OS7A 3JTSB 3H7BB 1IM3A 1LEKB 4NO0A 1FZKA 3EYVB 5IKCB 2EH8L 2YKLL 4WUKL 1XGPA 3MRGA 4HWZB 3MREA 4N0YL 4TOYH 3Q3GA 4OB5L 3RGVA 4LCCC 4J4PD 3P4LA 3LQAC 1A7RH 1N6QH 3QEUA 1SM3H 4U4BA 4JKMA 2CQVA 5ID0B 4JHAL 3B9KC 1BEYH 2W38A 4OJFH 5L6YL 3OAZK 4MQTB 3SGDI 2G5RA 4ZQKB 1DDHB 4K3DL 4WCYH 3TVMD 4HKBB 1DANU 4XMPH 4QTIH 5E8OA 5JO5B 1E28A 3DX9B 5IB1B 4NN6C 4FN0A 4ALAL 4GJTB 2UUDK 1FNSH 2BVQB 1JZ3A 1BQHG 2H8PA 4QRQA 5BRZB 1UWEL 4HKJA 4Q6IA 4EN3B 5KTEH 4GAYA 4KROD 4XPBH 4EOWL 1TZHB 2EE3A 5HGHB 2NY3B 3LKOA 4H8WL 1JNLL 3P30L 1EEYB 1J0YA 1J8HB 3HNSL 5CSGA 5CD3B 1HXMB 3RIFF 2UV3A 3GSNH 3O41B 4S1RL 1IAIL 4LNRA 4KHTH 4QRUB 2IANE 3EJZC 3BPOB 5GJTH 5DD5H 3MXWL 1UKQA 5BS0A 3IDMB 3QXTA 3T1FB 1BGXL 4AENA 2PW1A 2D4FA 3VCLA 3P0YH 1SEBA 1GHFH 3BXNB 4MVBD 4HUUB 1WLHA 3NABL 4MA8L 3UPRA 3JV0A 3ILPB 2OL3H 2NX5A 4GRMB 2X4OA 4IRJC 2XTJB 3BSZL 4UQ2B 4OGXH 5C0GB 5DMIL 2VZTA 2XZQL 3R06A 5HHOD 3UDWA 4GW5B 4N68A 3WIHH 1P9MC 3LEYH 1N6VA 4JFQA 1MVFA 3VFMB 5D96B 1FZJA 4LAJH 4OGZA 1F90H 4U2YA 3DX8A 4M93C 2XZCL 2EDEA 3B2VL 5HI3D 1S3KL 3T3MF 4LU5L 5IVXA 3QXUA 3GSVA 1YY9C 2HN7A 1KEGH 4XP6L 4LKXB 3KPSA 5FO8A 1IGIL 1X4YA 2AQ3A 2OMNA 1YMME 1AGCB 3D69B 1NCAH 3MLRH 5A16A 4XGZB 4NNXA 1MFEH 4U0RB 1RZKH 5DJYA 2VXVL 3SE8L 3MLVH 4IS6A 4GAGL 4U6YB 1WWWX 1CD0A 1JI2A 5DMKB 5ETUB 5F1SA 4JANB 3SCMC 1RIUL 2W0KA 1YEJH 4H88L 1A1MA 3EO0A 1NMAH 3BQUC 3CXHK 5F3BB 4XNXH 3MRDA 3P9MB 3T3ME 3G04A 3NN8B 1X4XA 4RQQB 3W2DH 1CIUA 1JPSL 4J1UA 4UU9B 4X4YA 4MX7B 2V2XA 5CINL 5ICYA 1JZ2A 3GGWA 2AXGA 4KC3B 4O58L 2BX5A 4WV1B 2AGJH 4RGOL 1RULL 3MRFB 1QRNA 3QIUC 3TNMB 4KVCL 3H0TB 4MCYB 3ROLA 2YZ8A 4Y5XB 4XVTH 1BBJA 5GGSY 2IAMB 3QWQB 3RNKA 1YA5A 1I1FA 4XCFL 1WZLA 3MLYL 4WHTA 3BN3B 4H5SB 5I1DB 3FAXA 1S5HA 4XZUB 1X5FA 3KYAA 4OGAD 3UTSD 4NQCB 3R8BB 4OZIA 2E9JA 4N1CA 7FABL 5JXAL 1JHLH 3TYFB 3T0DA 1XAUA 1KIUA 1F4WH 2F8VA 4HUMB 4DVRL 2AEPH 3HNTL 5HDOA 1XGTB 5GS2D 2EYRA 1L0YA 4NQVB 4Z0XA 3TIDB 2JF1A 4OT1H 4XVJH 1BD2A 1XCTA 4YDIL 4NQDE 1CXLA 4NKIL 4HBQA 3VXSA 4X5WA 2FBJH 2H32A 2IALB 5I8OH 4ERSH 1KGCE 4Y2DD 1PKOA 2CDGA 4YHPA 2F53D 3LKNA 3VA2C 1KULA 1RVFL 4LCWB 5C0BD 1DQQA 3ORJA 4Y5VA 3IGAA 4EQ2A 5KW9H 1AD9B 2CKBA 5FUOL 4YNYB 1S9KC 4F7EA 3NH7H 4M3JA 1NPUA 5DEGB 3UTQB 5L9DL 4F7MA 2VXQH 4KK6D 1R3JB 4U7MA 2X42A 2J4WH 4K71C 3KLAB 3G6AA 1FRGH 2LABA 4JM4H 1G9NH 1CGSL 3FO2B 4CGTA 2BNQA 5LBSL 3DMMC 4NCC2 4QRPA 2R69L 4P5TA 4KKAC 1BZ9A 3LH2L 4NN5C 3VXOB 4PRPD 3TN0C 4CVXA 3GMPA 3WKNA 5KVDH 3ABZA 4NWUH 5GRVL 3HLAA 1S9XB 2A74B 3SQOH 1H3TA 4QRTB 1R3KB 5EBMB 1ED3A 2Z92B 4S1DD 3AREC 4LVHB 5I73B 1QKZH 1RZGB 4R3SA 5GRJH 5AYUH 2G75B 3C8KB 2Q1EA 1BQHA 3IFOB 2BFVH 3MNZB 5IBLC 4LOUC 2GY7B 4L3EE 3S36L 5AYQA 4WHYG 1VGKA 2C1PB 1ETZB 4LRIA 3CDYA 5D6CB 5EC1B 4G6KL 4G80A 4E5XA 1ZHNA 1FFPA 4HKZB 1FBIH 3LMJL 3M45A 3HNVL 3P0VL 3G6JA 4JFXB 4MD0A 5IHZB 1KTLA 4PJ8B 1JWUA 2VLKD 4KAQH 1F58H 2YBRA 3FQXB 3OKDB 4F8QA 4PJ5A 3SKJL 5BOZG 3UYPA 5CEXB 1BIHA 5EORL 4Y19A 3KPNB 5ACZB 4YHYB 1UC6A 1WFUA 5IUSA 2WUCH 1WITA 4KV5F 1EXUB 1ULVA 5D7SH 2CKBL 4KUZH 5H37H 5HHQB 5EU6D 5C07B 3VFRB 4NJ9H 1HH6B 2FX7L 3H9SA 5AZ2L 3V6OC 1NSNH 3CFDB 1MJJB 1WFOA 1I4FB 4QF1A 1EBPA 4HW6A 5EU7C 1KG0A 1NCTA 3HAEH 2EC9U 3EHBC 5I8CA 1I7TB 4P48A 1QPXA 2GUOB 3RWHB 3BH8A 3P77A 2J8HA 2D9QB 3X13B 3P3YA 4KV5E 2FJHB 1QSVA 3CGTA 2E6PA 4U1LA 5KOMC 4NNPH 1Z9LA 1DANT 5E2UL 3RZWA 4U2ZA 1BWWA 3BGFC 5JZ7D 4NJAH 3QG6A 4KJQD 1UM5H 1JVKA 5GHWH 1J1XL 4P2OB 4WI2A 4Y4HC 5BJTB 2R1YA 5HHVL 2Y5EA 3WE6B 1HYRC 5IFJB 2L7UA 4OKVB 4D8PB 1LP9A 1BM3H 4KGLA 1GYAA 4N5UA 2MTPA 3C8DA 1CTOA 4ZODA 5TE7L 3LIZH 4PJGB 5CSBA 1AXTL 1QSEB 3TFKC 3NAAL 4ODUA 2UZIL 2OJEB 2D2OA 1CLYH 1RAMA 2DMBA 1MI5B 4GG8A 5FO7A 1D5ZB 4OD1H 4QXTB 3OAUL 5FKAB 5FOBA 2QADD 3WJLA 4HUNB 4AM0A 2OZ4A 1T1YA 1JHTB 3BPLC 3ARBD 4P4KD 2IWGA 5F9OH 4U1HB 2QQNL 3I6KA 1PX3A 3UTZA 1P4BH 5E5MA 4OI8A 1P7QD 3FOLB 3HC0B 1S7WA 2YD6A 2YA1A 3EOAA 4XHQA 1NGWB 1OAUL 4HF5H 1QBLH 1CLOH 4PY7A 1N7MH 2MMXA 4HLJA 4V2BA 43C9B 5IB3B 1NBYB 5E56A 2JLLA 5DC4B 1YNLH 1RI8A 5L8LB 3SGEI 4DCQB 4WHDA 3BKJH 4WFEE 1S9VB 3ARFC 3GMQA 2NNAB 1BFTA 4HQQL 3ULVC 2V7HB 4GFTB 5BVJB 2J12B 1G7JA 5IQ9A 5J9PA 3HG1E 4L9LB 4GW4B 1KCUH 3EYQC 1F4AA 5D7LB 5HYIA 2DQCH 3QWRD 2ARWA 3FOMA 1NCCL 1UCBL 4HLZH 2FJGB 2ZPKL 4DOHE 2BSSA 2P5EE 4MNQE 4ETQB 1FO0B 4BH8A 4X7TB 3KG5A 5F6HJ 4PJFA 4M8QB 4CW1B 3ULUC 3V7AG 3RAJL 4XHJC 3SJVE 1XT5A 2VDKH 1A5FL 1WWAX 2FGZA 3MO1B 1UWGH 3JWDC 1H3VA 4HJJH 4M48H 3ULSB 4UDTB 4P46B 4X4XA 1LMKA 1D6EB 3HR5A 3SE3C 5JW3H 2Q86A 4Y16A 5C6PB 1U3HB 1UADC 1R3HA 2XG5A 1P6AB 2VZVA 2IEPA 5GGSB 3VXMB 4ELKB 5IB2B 3DRTB 3MMEB 5FGCE 2OZ4L 3F6IA 3LDBC 1R24A 1AD0A 4JFDA 5J1SC 2VDPH 1AO7D 2WBJC 3OF6A 1JPGA 3T0AA 4GAJH 4RFOH 1ZE3C 5C0ND 2NPLX 3K1KC 5GGRB 1YC8A 3L7FB 1EFXD 4XWGH 3IXTB 1YNTB 1RZIB 4IIQB 1HH9A 3LZFH 2D7TL 2EIZB 1T21B 3MCKA 3P9WB 1TCMA 2FIKB 1X5GA 4QCIA 4MXVF 3CMOH 4YHKH 4YX2L 2AKRB 5FO9A 4NZUL 1S8DA 4MAUL 4QY8B 1HHGB 4G7YL 3IU3B 1KJ3H 4YFDB 3X14A 3CNKA 4GH7B 1FPTH 3LKRB 3MGTA 2LAAA 1IGFL 4DZ8A 2NXZC 4PGDA 1RMFH 4P59L 1U8MB 2XNAB 2ZUXA 4MA7H 2DQIH 3W0WD 3BKYL 5IIEB 3O6FA 4A6YA 2CR3A 3MJ7B 5GGVH 2OSLA 4PB9L 1CGXA 2XKSA 5DJ8B 3D3VE 3TVMC 3PNWB 2VZSA 5KJRL 4WW2C 4FQJL 5D2LF 4WWKB 5E1HB 4QLRA 1H8NA 5FM4A 4U1NA 1C12B 5CAYB 3EZ8A 4MXVE 4RX4D 5DYOB 5EN2A 4OAWA 3RX7A 1MCKA 1WBYA 5JR1L 1GL4B 1K9TA 3LPGA 5FHAL 1AKJA 2QSTA 3CK0H 3I6LE 3H9ZA 4L4VB 5DJ0A 4ZG1A 3FB8A 1SMAA 4KFZC 5I15H 2BC4B 1N2RA 3LKSB 5FDWA 1LO3H 5D2LE 4AIZB 4GUPA 2Y07H 1CU4H 4JO2H 3KXFD 5JOPD 3HC4H 1MSPA 2HRPL 1GAFL 2I25N 4QHMB 2K9UA 2IH3A 2R9HD 5I1KL 2IGFH 3ARPA 2WIIA 2XN9D 4J3TA 2AEQH 1R5IB 4BSVA 1S5IL 2QSCL 1T22B 5DD1H 1HSBA 4ZUTA 2QLVB 3FCTA 3WUWG 4PJCA 2P7TB 4M6OH 3ZKXB 4WFHD 1I8KA 4NYLB 1D6VH 3QO1B 5I76B 2X4UA 5IB5A 1MCEA 5AZEL 2B4CH 4UNTA 3EOBB 4YJZL 1M7XA 1P7KB 1HILA 3GI8H 5LGJB 3DXAB 5C0IB 2O93L 3V7MA 1JV5A 4S2SB 4N90E 4G8GB 4YUEL 5I1HH 1E6JL 4A6YL 1QYGH 3QEQB 3DX6B 3QEGL 3PDDA 4BZYA 5GIRA 3HI1B 2VMFA 4JKKA 3O8XB 3RVVC 3T8XA 1K2DA 3BEVA 1NGYA 3T0EA 1GZPA 1NAMA 1WBZB 2OJZL 3CC5A 1AR2A 1XR8A 4PREA 3KR3L 4R4NC 1FC2D 4XVSL 1AIFA 4NO0D 5TJWK 2Y7QA 5F7YC 3OGCB 4FTVE 3IDNA 5J4MA 2X89A 4FQCL 5HYJD 3VRIA 4HH8A 3QHFH 5ITFB 2VDRH 4NCDA 1NL0L 3RGVD 5CWSB 2NXYD 4YHZH 1TDQA 1RJYB 4TVSa 2CIIA 2F54A 7CGTA 4OI7A 1MAMH 1R3LA 5TGBA 3RPIB 4DQOL 4FQ2L 5BW7C 2VL5A 1XF1A 2ZCLL 3EYUH 4LSUH 1UJ3C 1WC7A 2HT2C 3OV6A 4QTHA 1F6FB 4GRLB 2QHRL 4HIXL 5EPMA 5LCVH 3B8YA 2DWDA 1E4XL 4LSRL 5DQ9A 2EC9T 5IVZB 2FWOA 3C60C 2GQHA 3TNNB 2HJLB 2XPGB 3GMOA 5L0QC 1T2QL 4ELMF 3WLWD 3IJYA 3RWIA 4JHWH 5FM8A 1TVHA 4LK4A 1RHHB 1UACH 1Z3GL 43CAB 4LDLB 5FYKL 3WKML 5L2KA 3UPAA 4DFIA 4I0PC 5D8JL 2QR0A 4NKDA 4JFED 3IYLW 5I1EL 4XAWH 5EO1A 3RWFB 1JYWA 3UJTH 2NLJA 4X8XA 1TETL 1OTUC 2B8OT 1D5MB 4NO5A 3V52L 3U0PA 3MLXH 1HHIA 1FORL 3HC3H 4OGAC 4U3HA 4ELME 1K4CA 3VWJB 1OAQL 3QIWC 2AJSH 2Z4QB 5F72S 1NAML 3IDXH 3UTPE 3UC0L 1N5YL 2W9DL 1INEL 4I3GA 5BS0D 1QQDB 4I3RH 3QCTH 4RMTA 3WFEL 1ZT1B 1AE6L 2CH8A 1KBGH 4S0TD 3PQYB 1G6RA 3B5TA 4G9FB 1M7IB 4XP5L 2DD8H 2DJ4A 4JO1H 4Y4KB 3I6GA 1HYSD 2NX5D 4Y2DC 5GS0C 1ROWA 1C08A 1A1OA 5I19L 4EUPH 4DK3A 3ZYIA 2X2YA 4LPUA 3CUPB 3ILQD 4UT6L 2EDLA 3SE9L 3F7YB 5HI4C 4PYHA 4XI5D 3VFSB 2DL2A 4KUCF 5HI5D 3HZMA 3C2AH 1JTTA 3QH3B 4O02H 4KK6C 4GKSA 1E6OL 1U91B 1WEJH 4IMKC 4Q9QH 1TZGH 2VISB 2VAAB 3VFPA 2DRUA 4RBPH 1OGAE 4WEBH 1H8OA 4LGPB 2XWTB 1BOGB 4TULL 5F7DB 1T1ZB 4YO0B 2IANA 3KPSD 4JFHD 3VGDA 2B5IB 1V7NL 15C8H 3ECBA 3QO0B 2W65A 5EOTB 2Y5TA 3CFBA 2FHCA 2UY7A 1J05B 4JPWL 3O2DH 4HS3B 1A4KB 5IOPA 3IS1X 2BDNL 2C3VA 3MV9E 3DUUB 3VXTA 5F70A 1QHOA 1JNNL 4Z7WF 3QUZA 1EJOH 2QQKH 3QUXC 3I85A 1MQKH 1D5BA 5IT2H 4KKCD 4NFCA 4YBQD 2NZ9C 2AJYH 4OCMC 3U46A 1GOGA 3B6SA 3GI9L 4EDWL 5HHME 5IHUH 1G6RL 4OM1H 3AM8C 1YQ2A 1QRND 2I5YH 4XBPA 5J57B 1T5WA 4JZOA 3S3SA 1AHWC 1ZHLB 3RVWC 2ICEB 1A3RH 3HAEG 3L5WA 3TV3L 3S5LB 3C5SA 1FGNH 3PWLA 3P4MA 1Q9LA 3WUWA 4ZO6A 4NZRL 4Z7WE 1AP2A 3LRGA 2X4SA 2D03H 4H20H 4MWFA 3NPZB 1NCDL 3WV0A 4AL8L 4EXPX 5E99L 1ZHKA 1DE4A 1SMOA 1YMMA 4TUKL 1YEDA 2C4FT 4P23A 1ZGLM 3O3BB 5JNYA 3GJFK 2YC1A 3J7HA 3SPVA 2VB5A 4JM2B 4ZDHB 3D2UB 3EYFA 1PAMA 1KJMA 1RIVH 2BVUA 4FQXC 3QI9B 2EYSB 4HH9B 3RTQB 1BD2D 1JWSB 1DFBL 2MWCA 2YXFA 4OZHB 4XNMB 1RIHL 4YLQT 5LAXB 4HD9A 3OPZL 3DX7B 3VGAB 1B0GA 4HHAA 1VKXA 1LNUB 2EH7H 2ZG3A 3FO9A 5CILL 3JTSA 3H7BA 4K3EL 1ZWIB 4RSVA 1XF2B 1LEKA 4JGJA 3EYVA 5IKCA 2ADIA 4X99B 1VHPA 3CFKA 9CGTA 1PZ5B 5I6XC 4WO4C 5FCSH 5AWNH 1JBJA 2BNQD 5HPOA 4E0RB 5GISH 4K94C 1MWAH 1I9IL 4LNVA 4G3YL 4QRPD 2K1MA 4P5TD 1FDLH 1BBDH 3N85H 5ID0A 5TDNA 2V6HA 3PQYE 4HS8H 3BJ91 5FHBL 4YXHL 1P4LB 1DDHA 5B38B 1WIOA 4Y89A 1JZ7A 3O9WA 1F4YH 4RMVA 4POZD 5HD8C 4OGXL 3KYNB 3L95A 1W72H 5JO5A 5IB1A 4I9WD 3QQ4A 1YN7A 1Z9MA 2QADC 3F7VB 4KQ4H 4DKAA 1T04B 3L3DA 1A14L 1KB5B 2ED9A 4NQDA 1K6QH 3MV7E 3V4VH 4P4KC 5H8DA 3MBXH 3BX7C 3OMZA 4U6HB 3CX5K 3QRFM 1WFNA 3U9PL 2VLMD 1F90L 1FE8L 3R0NA 5B8CC 1A6ZA 1DUYB 1MPAL 5DMGD 4JKLA 4X6CF 1RUKH 4EN3A 3WFBL 4HGKC 1DN0A 1TZHA 1KIPB 3LRSA 2DBJA 4LL9A 3KJ6L 5HGHA 5FEBA 4HLZG 3H7LA 4JN1H 1JGLH 4NQXB 1KUMA 2R4RL 2E9BA 4PRHB 1EEYA 3P4NB 2X1XR 4LEOB 5I8EB 3VDAA 2K7QA 1S7VB 4JO4L 1HXMA 3ZKMD 5SWSE 4PJ5D 1NC4B 1P5UA 5FF6A 3SHSA 1MFEL 2XZAL 5BV7H 4Y19D 1EUUA 1N4XL 5JXEA 2B1HH 2XWJA 4FQIH 3CLFH 3MYJB 1PEZA 1GGIL 2OL3B 1TQCC 5E8PB 5A2LH 2GHWB 3EAKA 2JJTC 3PABB 3U4AA 1CXFA 4X6CE 2DI7A 1NMAL 2R2EB 1CDHA 3E2HB 3O6LL 1MFAH 1VACB 5HHNA 3W2DL 3ARWA 3RJQB 3H9SD 5IR1A 2BY3A 4HUUA 1QSZA 4M6ML 3WD5H 4O2CB 1EA9C 2FZ3A 4UQ2A 3FT4A 1BX2B 5C0GA 5CMAB 4KTDL 4V2CB 2HTKD 1NC2B 1KYOJ 2J8UB 2DN7A 4JRWA 2IQ9L 3ARDB 3Q1SH 4L3EA 4X6DF 1V05A 3JWOC 1FL6A 1RFDH 4LQFH 4LSQL 2FLRT 3HS0A 4X0KB 3RHWK 3STZA 1KELL 4H25B 4L29B 3RL1B 3RBGA 2V2WA 1ZGLB 4NKOB 1VSCA 4JLRB 3CZJA 3KWWA 4PRDB 1CS6A 4R96A 1F4WL 5AG9A 1SHMA 3WN5B 3HI6L 1T0PB 3GHEH 3U9UB 3NTCL 1VENA 3MODH 4Z95H 5HGAB 4NUGL 3VJ6A 3GRWH 1RUAH 4LKXA 1A22B 2H3NB 3D69A 5TDPA 3CJJA 3MOQA 3BWUC 4F58L 1RY7B 4X7SL 2EDBA 4X6DE 4BFEA 1EVUA 4U6YA 1NGPH 1ND0A 5CP7B 2COQA 2DJSA 2NY2B 4GO6B 1BZ7B 1HHHB 5DEFB 1CFQB 1U8PB 2FH8A 2DQFA 1H3UA 3F58H 5IK3A 4F3FB 5A40E 1A3LH 3SDXB 3QNXB 4UU9A 3UBXB 4MX7A 4LRNL 4LGRB 2ADJA 5T1DH 1U8HB 3GJFH 3CSYB 4JM4L 4MAYA 3QNZA 1BHGA 4Q9CA 3M17B 4YE4L 3HAEA 1FG2A 3F7RA 3H0TA 5IESH 1MCNA 4MCYA 4OBRA 4Y5XA 2A1WH 5TFSH 3SO5A 1FYTB 4QXUL 1TJIH 5KVDL 1CF8L 4JHBA 1BAFL 5I1DA 4XZUA 2Q8AH 3DUSB 2GK0B 2QBWA 4U6XB 3TYFA 1GC1L 4ZS6C 3EJYD 2IJ0C 4LAQL 5GRJL 4IRSB 2I9LA 1UXSB 5D1ZC 1JP5A 3RKPA 2Z8VC 4NQVA 3SDCB 2IADA 3D0VB 4LCIL 2BHZA 5T33L 2BFVL 3I75B 3OX8B 2OXGA 1XGUB 2NTFB 4HWEL 3WLBB 3LN5B 2IF7A 3C9NB 3TPKA 5E4EC 1A7PH 1NDGB 1FBIL 1BF8A 4PJ7B 2DJUA 4JJHA 1TJHL 1I7ZB 2VWEE 5T1LB 1S9WB 5HPMB 3SKNB 3UROR 1P1ZB 4YNYA 4GQ9H 3ZZ1A 3IT8D 4Y16D 2FX8L 1PY4A 4OCXH 4PRHE 2DM2A 5MERB 2XT1B 1LILA 3LB6C 3FB6B 3WO4C 1WV7T 4YGVB 2VDQH 5I1AB 4UQ3B 3PGCA 4OTXH 2F8OA 2J8UF 3F8UB 1FFNB 4JFDD 4MHHG 2AK4B 4PS4L 1MCOL 3GJEB 4NJ9L 1F97A 1N0LA 5CGMA 1ZANL 1S9XA 5HGDB 2A74A 3QISA 1B4JL 2QTEA 2OP4H 4QRTA 1JNJA 3WSQL 1RZJH 1TPXB 5EBMA 3IFNL 1Q94B 3I02B 3FB5B 5DTFA 3ULVH 3DRQB 4X80L 1RZGA 1XZ0B 4P9MH 2P5EA 4MNQA 2G75A 2W9LA 3C8KA 5E2TL 2DLIA 3IFOA 2ZUYA 2W91A 1SVZA 4HXAH 1IKFH 5JHLL 1X6LA 2P44B 2J8UE 4DGIL 4QNPF 3SJVA 4GS7B 4KVNL 4CMHC 2C1PA 1ETZA 3DHMA 1NGQL 5GS1B 3O6FD 5D6CA 1ZLWK 5EC1A 5KANI 3TH2T 2R56L 1I8MB 2JIXA 3VD5A 4HJGA 3CFJB 2KZ1B 4JFXA 2IPTL 3WS6A 4WV1C 1L7IH 3OKDA 5E2VL 5DVOA 3MXVH 3RHWF 4XCYB 4XNUH 2CMRL 4NC1C 3WLWC 5CEXA 5DO2C 4XCNA 5JDJA 1AKJD 1HK6A 2LVCA 1EXUA 2P24B 3OJVC 1NJ9A 4M43H 4QNPE 4P2RB 4OF7A 3VFUB 4NZDA 2AP2A 2G2RB 1TQBC 4OD1L 5IW6A 3VFRA 3BVNA 1HH6A 2NCMA 2EKSA 4Z78A 2ICWI 1MJJA 2AK1H 1FVEA 5HYFA 1I4FA 2R4SL 2ICCA 3MPCA 3B9AA 4KK9D 3VFGL 4JFFE 1I7TA 3VE0A 1VFAB 3LS4H 2ZUQC 1WIUA 3GMRA 2UYLB 4ZFFB 3PGDB 2GUOA 1T6VN 3RWHA 5IJKA 3EFDL 4UBDD 4NQTA 1N7ML 1AQKL 2A2QT 4W6WB 4GBXB 5HDLA 2FJHA 1UQSB 2CDEB 2VH5L 1D5XA 3H9YA 2P42B 3ZLQC 2YD5A 3GM8A 3RWJA 4M7KH 1U36A 3D3VA 1BFSA 1BJ8A 2NW2B 4J6RH 1MREH 5FYKD 5T5NG 2HRLA 4HWBH 3DSFL 1LHZA 1HYSC 1LE5B 1OAKH 4LSPH 4YR6B 1KACB 5BJTA 1FNEA 1Y6MR 3ARGB 2EDKA 3DURB 8CGTA 3GMNA 4OKVA 4D8PA 4R8WH 4XI5C 3VGBA 1OB1A 5HI5C 5CEZH 2NY0D 3QP3A 4Y5YA 4JCLA 5DRZB 3T0ED 1Q9KA 1PLGL 2JCCF 2VUOA 1LK3L 1VPOH 4KRNA 4W6YB 1MI5A 1FLTX 1G0YR 3P0GB 5D2LA 4QXTA 1QR1A 2X89D 2AI0L 2FL5B 3REWA 2A9NH 5CEZE 1DQDH 2GITA 3C08L 2X4NB 4TNVK 1JHTA 1MRCL 3T0BA 4AMKL 1CXHA 4RGNB 1CE6A 2Q87A 1JPTL 4U1HA 4WEMB 2F54D 2GYSA 2A6DB 2R1WB 3BESR 1U8OA 3FOLA 3HC0A 4KK8C 5KVGL 3D25A 2H6PB 1IRAY 1LE9A 1U8JA 4PGZA 4O2EB 2QQLH 3O4OB 2CUMA 3GNMH 1G7IB 4LCYA 1PG7X 2JCCE 3AUVA 2X9WA 43C9A 5IB3A 1A4JB 1IT9H 5JDSA 1NBYA 4XWGL 2AK4E 3BJLA 1P5VA 5DQDL 25C8H 4DCQA 4LPCA 2EDXA 3LZFL 4KKCC 5F6IC 1X44A 1K5NA 4YBQC 3AXLB 2NNAA 3NBNA 4BQCA 3QR2A 4UMGA 3KS0J 4B7IA 1KJ3L 5DFVD 4HIJB 5L2KD 3L3IB 4XH2B 3MBEB 3TZVC 2FYYA 5IP4A 2FJGA 4YIQA 4GMTH 3VH8B 3DGGB 3M8OH 2HWZH 1FO0A 5EUOB 1CDCA 5BO1L 5DRNB 4HSQA 1N64H 5J6GA 4FTVA 4M8QA 4CW1A 2R0LL 4RAVB 1FVDB 5DRXA 1UA6H 3EIFA 3I3DA 5FAAA 1O0VA 4IJ3B 4NRYB 3AROA 1IGCH 1UXWB 1NFDF 4UDTA 4FQQA 4WI5A 4KZDH 4P46A 1D6EA 3S37L 4LQ1A 2J5LC 3TT1L 3UMTA 1BP3B 1YYLL 5D7JB 1CDJA 5D2NE 5I8KL 4IOFC 3TF7C 4OSUH 5DXWA 1T83A 2X70A 2WWKO 4PRIB 5GGSA 3CK0L 1KOAA 3BP5A 3SN6N 4ELKA 3DRTA 4LVOB 1YPZB 1JWMA 3RKDC 4NBXB 4OQTA 2H26B 3GUTB 4JPKH 1Z9SA 1WZ1H 1ZLWH 1IEBB 5JPMA 1S7RB 5DR5L 4F9LA 2I60L 3U4EA 1YNTA 3RJDA 4LGSB 2V5TA 1NFDE 2OR8A 4LBEB 2FEDD 2FIKA 4LP5A 2AEQL 2AKRA 1KC5L 4QY8A 2KBGA 4JCMA 1HHGA 4XNYH 3BO8B 1JN6B 1YQVH 3QEHB 4Y1AE 1I8IB 3LKRA 1F4HA 3W82A 4KKBC 3X17A 3RGHA 4JKPL 1U8MA 5ERWA 5JLZB 3WFHB 4O2FB 5ANMB 4ELMA 4XVUD 2EDQA 3MJ7A 2IAND 3SOBL 5DJ8A 3PNWA 2KUTA 4LHJB 5KSUB 1DBMH 4OLYH 2DKMA 5A3ID 4POZC 1FO0L 1MJ8L 4WWKA 3KLSA 4PLJD 4MA3B 3G9VA 1FAIH 2EXWD 4D9RE 2E9IA 3F5WB 3B4NA 2DQDL 5EIQA 5GXBB 3VFNB 1INDL 4I18C 1EMTL 2YUXA 1BPVA 1MOEA 2XTLA 1IAMA 3MLZH 3KJ4C 3V9FA 2XI9A 2YUWA 4HUWB 1MHCA 1PKQE 1F6LL 4PR5B 3IETA 1HHJB 1LD9B 4LASL 4JR9H 4G6AC 3UJJL 1GIGH 2F74A 3LKSA 3PJSB 2VDRL 3IAQA 4R4FH 4AIZA 2FECL 4OQTL 3ZKMC 4P2YA 2ORBL 2ZP0T 4QHMA 1CFTA 4WUUE 5INCB 4ODHL 1PG7W 1OGAA 4Z7VB 2A6JB 1T22A 2GCYB 2P7TA 5LCVL 4NYLA 1WISA 3QO1A 4X7DC 5I76A 2GKIA 4TSBH 4C56E 2DBLL 1DVFA 4TNVF 1AY1H 1KJ2H 4AEHH 4ZXBB 4YFEA 4RAUB 3X3GL 1YMMD 2HG5B 4IRZH 3GO1L 4P23D 4KMLB 3HFMH 5C8JA 1UJTA 3EOBA 1UVQA 1BVKB 5KSAA 3ZO0A 4XPTH 1P7KA 3QRGL 1F4XL 2BNUB 1MCWW 3O11A 5K9JH 4S2SA 2ZCKH 5AG8A 1JGDB 3LQZA 2GT9A 2HTKC 3QEQA 4ZO7A 3EO9H 3BIKA 3HI1A 4NT6A 3VRJB 2I9TB 3CDFA 2YEZA 2Y25A 4JVPA 2BJML 4ONFL 1J88A 5F9JA 4DVBB 3QFJB 1WCBB 1ZLUH 3DOSA 2NYYD 3BKCH 5C0CB 4AG4H 1YPZF 3O3UN 3FN0L 3MLXL 2ITCB 3IVKB 1G9MH 3OGCA 3MX0A 3IDXL 4W70A 4WY7L 4G5ZH 4KKNA 4I3RL 3QCTL 5KS9F 2HFFB 2QQQA 3FB7B 5ITFA 4JPVH 2EKJA 2D31A 5KVMC 2R2BB 5M94B 3BRDA 1FLRL 4JRXE 1EHLH 1YECH 1I1AB 4D2NA 1FHGA 4ZS7L 1PG7H 3RPIA 3TBYB 1OTSC 4BZ1L 1G7MA 3QPQD 5JW4R 5FGSA 4XRCB 4RZCB 3L6FB 3H3KA 2ZCHH 1I7UB 1PDKA 5IMKB 3FT2A 3WMSA 3O9WD 2AABL 1YPZE 1JMXA 5IVZA 3S97C 1YEEH 2X4TB 5ESVB 3TNNA 1A9EA 4RWYH 3WJLC 4NQDD 4GKNB 3TP4A 5A43C 4PLKD 5KS9E 1AGEA 1FP5A 3G08A 1WEJL 1RHHA 2X4PB 1KGCD 5HXMA 3CVHH 1DUZB 1O5DT 1I3RB 3OB0K 4EN3D 4JRYE 1K85A 5DDHB 2X10A 1J5OH 4OKDA 1YEFL 2NY3D 5H2BB 3RWFA 1DLFH 1KXQE 3U0TA 4M1GH 5IBTH 4OBSA 1ORSB 3CFEA 3ZHDA 4LCCB 1D5MA 4Y2OA 4MJ5A 3QDAA 3MJ6A 3ESVF 5JXED 3AC0A 4U3CA 3O2DL 1UB5B 1BOYA 1BLNB 3B9KB 1QQDA 3R1GH 3HE7A 3INUH 3L3KB 1ZA3B 3MSPA 4IDLA 2WLYA 3MJ9H 3P73A 3L3JB 3PQYA 4CJ1A 5ECJE 4G9FA 4GSDL 5BOPA 4YK4C 4BFBD 5SWQB 4NUJB 4R4BA 4NM8H 3U4BH 1ZGLP 1M7IA 2BVYA 1QFWM 2WMPA 4Z7VF 4ZSOB 5EZOH 4PY8I 1MUJB 2UY6A 3AMLA 5E6IA 4H26B 1EAJA 2XTJD 4OM1L 2NR6D 3O4LB 1NCWL 35C8H 1L4IA 1GGCL 3MV7A 1YEHH 4LPTA 3CUPA 1Z5LB 2O5ZL 3F7YA 4DZBB 4U1IB 5T1KB 3VFSA 4L3ED 5HDQH 4Y16C 3GSQB 1PGRB 4S1QH 1KCRH 5ILTH 4OFYA 4NBYB 4K23L 5ALCH 1JF1B 2VISA 3GMLB 4OCRL 1NEUA 4H20L 2VABB 4Z7VE 5JOFB 3JV6A 5SWSA 2EC8A 1ONQB 1ZAGA 3VXNB 3GSXB 3PGFL 4WI3A 4BZ2H 1MHPL 1T1ZA 4YO0A 1OF2B 2YPKB 4I48A 1QBAA 1OT1A 1XF4A 4X83A 4J3OC 4ZFOB 4OCYL 2A73B 4L4TE 4M7JH 4NQSB 4X6CA 5BVPH 5CZXC 3CLEL 2QSVA 1KIQA 4WNQA 3LOWA 3ZTNH 1JRHH 4HS3A 1A4KA 3SO3C 4WWID 2CJUH 3DGCR 3E6HB 4IRJB 2RQ8A 1MCBA 2K3TA 4UAOC 2R8SH 5KSVB 3Q48A 2GJ6B 2HH0H 5DJZB 1IL1B 1NFKA 4DAGL 3O6FC 5IWLA 1TCRB 3MUGB 2BY2A 3PHOA 2MCPH 5C0CE 5AWNL 4N5EC 5D71L 4ZAKB 4XBEL 1E4KA 1HDMB 4MAYD 3A67H 32C2A 1QVOB 4WI7A 1F02I 1ZHLA 1MWAL 3QB7C 4M93B 4UB0L 1VERA 1FDLL 3N85L 4CADB 5TPWL 4Z7UB 3VG9C 4UV7H 3PF2A 2NY5L 4YQXH 1PQZB 4WI9A 3BGMB 2GJZB 5F9DC 3FO0L 1IGJB 5ESQB 2AV7B 5LXGH 4UIMB 4MQXD 1CFVH 1T0MB 1MH5A 3MRLB 4J3XA 3CCHB 4OIAA 4KQ4L 1QFPA 3CSPA 2DLFL 1K6QL 5E08H 4X6DA 2EIDA 4ZDHA 3D2UA 1X5LA 3DBXB 4XNZC 5F1OB 2XIDA 3C8HA 5J6HB 1IQWL 3QI9A 1A6VL 3SCMB 3RTQA 1JWSA 4XNMA 2ESVE 2FGWH 4MD4A 5IJVA 3BQUB 4XC3H 5LAXA 1S78D 3OR6A 5E24E 3MJGX 4MJ6B 4LDOB 2Q7YA 2XRAL 1IC5H 4K8RC 1QEWA 1LNUA 1UYWL 4OM0L 4L3CA 2RHEA 3TBSA 1G84A 4P2QB 1TFHA 2X4QB 2I07B 1UEYA 2LAGB 4HFWA 3QIUB 1ZWIA 1YYMH 1KENL 4FNLH 1XF2A 1KCVL 1T7WA 5CHNB 4OCNC 5A2IH 4K7PX 5EWIH 1JZ5A 4X99A 3I9GH 3CVIH 1PZ5A 2EDDA 1TJGL 4Q0XL 5I16B 1VADA 3RWCB 3J8F7 3BUTA 4QRRE 3QUKB 2YMXL 4HUVB 3L1OL 3K0WA 3BZDA 4PUBL 4LLQB 4HPOH 4LCUA 3GJFA 5ITBL 1CFSA 1W72B 4HPYH 3OB0H 2HLAA 2NY0C 3E3QE 2VQ1B 5D72H 5ALBH 2WWMD 4IDJL 2HKFL 1LK2A 4HEPG 4HMDA 3EO1B 2EH8H 2YKLH 4WUKH 3WD5L 2IPKA 4BFGA 1OGTB 4EVNB 4N0YH 3DROB 3HG1D 3W39A 5FK9A 4OB5H 5IQ7L 3NFNA 1AGFA 3HHRB 4F15C 3O4LE 4M1DH 4OFIA 1KB5A 2P5ED 3FQWA 4MNQD 3EZJB 4PYGA 1B2WL 4HGMA 3OKOA 4JHAH 4P5MA 4FQLH 4U6HA 4JPIA 2IH1A 5TE4L 3LV3B 1NDMA 3BHBB 4HK3J 1FNHA 2ICWJ 3SJVD 2ZOKB 4K3DH 1DUYA 2O61A 2VUYA 4WDIB 3AAZA 4PJ9C 3KYKL 5F88B 4X6FB 1KIPA 1TITA 4R7NB 4ONHB 2JIXD 2PYEB 4NHCH 3GHEL 4Q9BA 4ALAH 3Q6FB 1NGXB 4PRHA 3P4NA 4OFDA 4LEOA 5I30L 4K71B 4OFVA 4H0GA 1NC4A 4J8RB 2M2DA 1UWEH 1L7TL 1EK3A 1F6AA 1ACYL 4NN5B 2RIKA 5TF0A 4EOWH 4X9GA 3TN0B 5I1CH 1KCLA 2X6MA 1I9RH 2DTSA 1NKOA 2ARJA 3V4PL 4H8WH 4NRXA 5D7IB 1JNLH 2L7JA 3P30H 1BF2A 1K4DB 1RPQA 3PXHA 5AEAA 2Z35A 3HNSH 1WTGT 5E5RB 2WV3A 4S1RH 1IAIH 1HKLH 3QQ9C 3T04D 3AREB 2YK1H 5T1MB 4HUKB 5F7NC 2GJ6E 4YAQB 4YHMH 4O2CA 2YD3A 3MXWH 4KJWC 5FYJH 1QLEL 1BX2A 3MRHA 4AEIH 5I66B 3EFFB 1BGXH 1NC2A 3O3DA 4NZJA 1NLDL 2J8UA 3SGDH 3MRJB 2WQRA 3ARDA 2BNRB 3BW9B 1KJVA 1DN2A 5J56B 4ORGA 1U8NB 1EERB 3NABH 4MA8H 4FXGB 3HTLX 4HAFA 2CSPA 2GW5A 3K2UL 4H25A 2VDML 4L29A 5FYJE 3D3VD 3BSZH 1KB5L 3MJ8B 1TENA 4S11A 4JLRA 2VDOL 1BFVL 2BY1A 4N0FB 3EDDA 5DMIH 1NBVL 5LVEA 3WN5A 3U9UA 3B2UD 5IV2B 2CO7B 3KPQB 4OLZL 1NANH 2H3NA 4HS6B 4WU5B 4KRMB 2CK0L 2FEDC 3I6LD 3MFFB 3SDAB 3B2VH 5E00A 1S3KH 1S7SB 4IM8A 2YRLA 3OKKB 1CFQA 1IFHL 1Z2KA 1HI6B 4ZNEE 5C09B 3ELAT 3HE6C 1SJVA 5DK2B 2PR4L 1XF5A 3HUJF 1C5CH 3QCVL 2ADFL 1IGIH 5FA4A 5C0FB 3QNXA 4P2QE 1GVIA 1MCFA 2VXVH 3V5DB 3QXAA 1U8HA 1IGML 3WEXB 1KPRA 1WCQA 3CSYA 3DYMA 4GAGH 2VDQL 3I50L 1T0NB 1X7QB 4PLJC 4LMQI 4ZUVA 3F12B 3M17A 1RIUH 3BGFB 4LLYB 2EXWC 4H88H 2RCSL 1M7DB 3BP6A 1GZQA 1F8TL 3MA9L 2SEBA 4NDMB 4X9IA 1JPSH 4E41B 4UOW0 4Y4HB 3UBXI 3TO4B 3RZCB 4HIEB 4B0MM 5FM5O 3HUJE 2L4OA 4RGOH 3DUSA 1RULH 4N90D 3H8NA 5BZWB 2QV2A 4CMMB 4KVCH 4Z0BL 3VXRB 3RL2B 5J3HD 5EO0A 3PV6B 3SDCA 3DLQR 4XCFH 3OX8A 2EECA 5EU3B 3MLYH 1CVRA 1XGUA 3WLBA 1N0XL 1URLA 3BN9D 3ZDZF 4MNHB 5ICZB 3VH8G 1FSKC 2GSIB 4QOKB 1Z0NA 4FTVD 5JXAH 7FABH 3V6FA 3BPLB 3U6RB 4JFPA 4DVRH 3HNTH 1VFUA 5KBNC 5T1LA 5K9KA 5DHYB 4P46D 3SKNA 2WK2A 4RA0C 5CZVL 4P23C 4MQ7B 1P1ZA 4XNUL 5I2IA 1M05B 3OJ2C 3H9HB 4NKIH 2X7LB 3LN4A 1DLHA 12E8H 4YGVA 4UQ3A 1ZT7B 1UH2A 1BZQK 3ZDZE 4JFZL 4W81A 2AK4A 4Z5RB 3PWVA 1S7TB 4D9LL 3ARFB 4YFLI 1RZKC 1C5DA 5FUOH 4N0RA 1G7QB 3WL9B 1CFNB 3ZKQD 3AS3A 2NYYC 2XXMB 3CDGB 4L8BA 1JCKA 4U1GB 1Q94A 1KYOK 1XGRB 3I02A 1CGSH 3BZ4A 5FGBA 1YC7A 3FB5A 4S0SD 3PL6C 4GQPH 5LBSH 4JHZA 1XZ0A 2R69H 3MACL 2A6IA 3MRBB 4OLWL 1W0VA 4M7KL 4TVPE 1XEDA 4NO2B 1YNKL 1U95B 4HIIA 5CBEA 3GSOB 5GS1A 3QPQC 3HRZB 2A83B 4HWBL 2W60A 4M7LL 1CDUA 5ENWB 3UTPD 1I8MA 2ZSWB 1IKNA 2PW2B 4I0KA 3O9WC 2ZNXA 2GTZA 2ZJSL 4WWKD 3CFJA 4LLUA 3MOAH 2MHAB 2Z31C 5D2NA 1KV3A 3PHQA 1HHKA 3WHXA 3LDBB 4ONGL 4XCYA 5CEZL 5ESAB 3S36H 3MC0A 2JJUA 3SDDC 4UV4L 2WBJB 5DS8B 4FA8A 1S7UB 4G6KH 3BH9B 1VPOL 2B7DT 2OTUB 3VFUA 3LMJH 4ONOA 2C26A 5B4MD 3HNVH 3P0VH 3LRHA 2CXGA 4FXKA 4D9QE 3S96B 2CO6B 4KDTA 4MXQD 3MRMB 2H32H 3EJJX 5EOCH 5C86A 1NFDA 4NKQB 3SKJH 1UKSA 3T1WA 3BGAA 5EORH 4Y8DC 2IQAA 1VFAA 5JA9A 5DGQA 5JW4N 2UYLA 4ZFFA 2NXZB 3VXSE 4Y1AA 2CKBH 2BRQA 1RUPL 5L2JA 1OGAD 2BVTA 5JIPA 1AXIB 4GBXA 4UT9H 2CDEA 2BSTB 3PXJA 2FX7H 3QCUL 5AZ2H 5AAWA 2EYTB 4R90H 3TVMB 1VEPA 1DVFD 3BPCB 4B41A 3FQNB 2CR6A 1CXEA 4ZUWB 4WW2B 25C8L 2FHBA 2NW2A 3PE9A 4YEEA 4E41E 1LGVA 1ZLSL 5KSAD 4KUCD 3C6LC 1N59B 5L7XL 2XOTA 1LE5A 1CVSC 1H0DA 3MLWL 5IHBA 4YR6A 1CGVA 3ARGA 4LLMB 2N56A 3ZT7A 4UNUA 3MV9D 5CEYB 1JNHA 1KEML 1IGYB 2HVKB 5E2UH 5DSCB 1KIRA 4JREC 1JIBA 1S7QB 4HGWA 1QLRB 2VR5A 5HHMD 1J1XH 1N3NA 2ZWLT 3S8WA 1F42A 5FCUL 1YDPA 4CNIB 3GFUA 4HUXA 4QOKE 3OKNB 1T20A 1M4KA 2IFGA 1TPXC 2FL5A 2WANA 4NNYA 1I1YA 2D7QA 2EE9A 4WUUA 5C08B 3S35H 4F7TB 3CSGA 5D7KE 4WTZG 1QFUL 2ITDB 2DM4A 4ZFZB 2IBZY 5TE7H 2PN5A 2A6DA 2R1WA 3ZT6A 3BKML 1AXTH 1CL7L 3NAAH 2UZIH 4JG0L 3U7YL 4QYOB 4PD4J 3IU4L 4C56A 5GZND 4O2EA 3BEWB 5GS3A 4KXZH 1G7IA 1C5BH 4AIOA 3HZKA 2VNCA 3S4SG 1A4JA 4ZO9A 1KLFA 5HHOB 2QQNH 1QPPA 3PHSA 3BYYA 2DI9A 3JVGC 4PRAA 2D7MA 1OAUH 4TQEL 5E8NA 1SJHA 1T3FB 1OVZA 4X7FC 4XNYL 4NQEE 4MAYC 2VN7A 3L3IA 4XH2A 2VLRB 5FA3A 5CJ5A 4OZFB 1R3IH 3IDGB 5I1IL 3MGOB 3VH8A 3GBLA 4KDVA 1ZA6B 3PWUB 3ZTJG 5MEPA 5E7BA 1U9KA 4RAVA 3RA7L 4HQQH 4PP2B 1XFPA 4IOIB 2X09A 1DBML 3V0VA 4ZPTB 3UAJD 5HY9B 4MQXC 1WF5A 4LLWA 1UXWA 4O5LH 4JRXA 1U8LB 4DKFL 2DQUL 4Z77B 1NCCH 1QD0A 4W4OC 4R2GD 3JBG7 2ZPKH 1UJ3B 3HE7D 1QOKA 5D7JA 2FH6A 2E5EA 1UWXK 3PQYD 2BVPA 1FJ1A 2FD6L 5EH1A 4G9FD 5BCAA 1BVLB 1V3JA 5L88L 2VR9A 1A5FH 2YD9A 1YPZA 2HVJB 5L0QB 4NFBA 5E6ID 4JR9L 5F96H 2H26A 2NQCA 2Q20A 1NMBL 4X6BB 3GUTA 1IEBA 3U7AA 1S7RA 3MV7D 5KS9A 1IJ9A 4PLOB 4UINL 3SY0A 4F7CB 1MCWM 2BOBB 1DQML 3SKMA 3BFOA 3OKYA 4WENB 4LBEA 2OZ4H 5SWZE 1DEEA 4JRYA 4RFEB 4A2MA 3SGEH 5IEKB 1JN6A 3BP7B 1I8IA 1FNAA 1CK0L 1KLUB 3KLHC 3ES6A 3O6ML 3D87B 4AEHL 3W5MA 5B3JF 3MV8E 5SWSD 4IRZL 3BDBA 3QIWB 4I2XE 5JLZA 3WFHA 3FTGB 4O2FA 2D7TH 4I1NB 4F37K 1R6VA 5DZOA 3BMVA 3SKOA 4YX2H 1PD6A 3EYSL 1YN6B 5K9JL 4NZUH 4RGNC 1AC6A 1A6WL 2ZCKL 4MAUH 4RGMC 5KSUA 4G7YH 2NY4D 4MA3A 4LLDB 4GRWB 3F5WA 1IGFH 2ZUSA 3G5XA 3QXVA 3FFDA 5D5MF 3VFNA 5DHVB 1FG9C 2NY6C 4Y2DB 4G6JL 2F53B 1ZSDA 3BKYH 3NCCB 1N6UA 2RBLA 1HEZB 3PP3K 3BKCL 4PB9H 1F13A 5B3JE 4X6EB 5F7LB 3DUHA 4BQ8A 4M4PA 5IG7B 1LD9A 5KJRH 4FQJH 1G9ML 4BM7A 1U41A 4XCCL 3VFWB 1WBXB 1I1CA 2Z91B 1VFBB 3PJSA 3UCRA 4HX1B 4JPVL 1CGWA 4DWHA 2YZ1A 5A2FA 3PWNB 4WU7B 5FHAH 5DK0A 2FEEL 3T77B 5D5ME 5JHDE 5C08E 3EGSB 4Y4FD 4Z7VA 4PRPB 3WDIA 2DTML 4TYUA 4PGEB 3STLB 1H8SA 2VE6B 4ZXBA 4XP9L 4RAUA 1NFIB 2HG5A 2YUZA 3JZ7A 2HRPH 4LVEA 5I1KH 4L4TA 4XWOD 3D2UD 3NCEB 1SY6A 4P57B 1CR9H 3QI9D 2QSCH 3RTQD 2EDOA 2D3VA 3QUXB 4PBXA 4KTEL 5FYLE 4EDXA 4G8EB 3VRJA 5AZEH 1LO2L 2VLRE 2AJUL 3WDHA 4NIKB 4M1GL 1WCBA 5IBTL 3FKUS 2F8XC 4LVNC 3NFSL 5C0CA 3TPUA 4WHYH 4HULB 2ITCA 1AHWB 3IJHB 2Y6SD 4LSDA 5H94A 3IVKA 4OD3L 4YUEH 1E6JH 1I85C 3BZEB 4A6YH 1V7ML 3B2UC 3QEGH 3SGJA 4WTZA 2HFFA 1DQJB 3B9EA 2R2BA 1LQSR 2Y36L 3SE4A 3GHBH 5IROA 1YEKL 3OTTA 3FQUA 3IKCA 4DGVL 1IC4L 5EU6B 3VXQB 3KR3H 3FHQA 4Y5YC 1OD9A 2MQ3A 4CBPA 4XRCA 1I9JL 5M95B 4X5XA 4LF3B 4K3JL 35C8L 4PTUB 3S4SA 3WIFB 2LVEA 4MJIE 5EU4A 4FQXB 3EOYG 2X4TA 5ESVA 4WGWB 3V6ZA 4NPYA 1WJ3A 4HXBL 2GJJA 4GKNA 2P8MB 2Z8RA 4DQOH 4FQ2H 1CLZH 5DT1L 4EI5C 2ZCLH 2X4PA 5ALCL 4YC2C 2BMKB 4YHIB 5SX5H 4HIXH 1DUZA 2QHRH 3SEPA 1I3RA 1UWXH 4G8IB 2CPCA 3U1SL 1I7RB 3MNVA 1E4XH 4G43A 1T1WA 3CZFA 2MPAL 4LSRH 4OLUL 5HDBF 4YXLL 1SY6L 2EO1A 3NVQA 4UT7L 1TLKA 5F6HI 4EBQL 3IF1B 1J8KA 3SGKC 1T2QH 4FP8L 4BZ2L 5I6XB 1HSAB 4WO4B 4PRHD 3VU2A 4FG6D 2YPVH 4L5FL 5B39B 4U1KB 1NC4D 4LCCA 3DHJA 4X4ME 2CUIA 4QRRA 4RMWA 5JW5B 3WKMH 2JJSA 2NW3B 2FO4B 1UB5A 5EA0L 1BLNA 1OTTD 2YWZA 5IGXL 1JRHL 2G5BB 5D8JH 2XACC 5J3HC 1MIML 2DDQL 4PGCB 1AQDB 5DZLA 3L3KA 4PG9B 2C3HA 4XCEB 3MLSL 5HDBE 3C6SA 5AD0A 1IM9B 4F37F 3BN9C 4PJBB 3C5JA 4LKCA 3T2QA 5LG1A 1QBBA 1FORH 2QADB 4H26A 1FL5A 2UWEB 3UC0H 3T4AA 1N5YH 2W9DH 2ZUUA 1INEH 3ARBB 4P4KB 3O4LA 3MRKA 3WFEH 1NMCC 5DFWH 3VFTA 1AE6H 1J12A 2D0FA 1Z5LA 1P7QB 2DKUA 2DIJA 4OGYL 1NC2D 4YHLL 5T1KA 1MVUB 3ARDD 4Z76B 3OG6B 5IM7B 1JHKL 1JPFA 3GSQA 2HJFB 4UV7L 1SBSL 1T83C 3JUZA 3KYMA 4RFNB 1JF1A 1TZIA 3FJTA 5I19H 5LXGL 2VABA 3KPTA 2D7NA 4UT6H 3P11L 3ARXA 3SE9H 1ONQA 5BZDB 5GGUB 1EO5A 3LEXB 4F9LC 1TQCB 1LEGA 3BMWA 2F15A 1E6OH 2YPKA 4XTRD 5D1QD 3L9RB 1DJSA 4ZFOA 1NKRA 1ZVSA 5CP3A 3DYOA 5I9QC 3VFVB 4NQSA 4C83A 4HK3N 1T5XB 3K81A 1P2CB 1RJLA 3E6HA 3NZ8B 3LQAL 4IRJA 4TULH 3BP4B 4LARL 5HBBA 4NOFA 2ENYA 5KSVA 2GJ6A 3HCVB 5KZCD 1V7NH 4MLIA 4PV8B 2P48B 5E6YA 3MUGA 2Q3AA 4JPWH 3G6DL 2B1AL 2W9EL 1NUDA 1C7SA 2EDHA 1QFHA 3V4UL 3PWPB 2O26U 2BDNH 2HT3D 3PDOB 4JGUA 3ZKNC 4BSWB 1JNNH 2P8PB 5D72L 5ALBL 2B39A 3PDGA 5AUMA 1AR1D 1SJEB 1AO7B 3UZVB 4JG1L 2CUHA 3V7AE 3BGMA 4XMKL 3O81A 3NZHL 3GI9H 1B88A 4EDWH 1IGJA 1G6RH 4OZ4A 1CD1B 2AV7A 3RVUD 1T0MA 4NHUA 3O3EA 3U2SB 1JYVA 2WUBL 4GKOA 3ZHLA 1A2YA 4X8JA 4M1DL 3IDJB 2Z8SA 3TV3H 2CLRA 5F71A 5D4QA 4R7DB 4P3WA 1BQLH 4FQLL 4TTGA 3VMNA 5J6HA 1X3DA 3SCMA 5BMFL 4NZRH 1M6OB 3RWDB 3RDTA 3VXUB 3BQUA 3B3IB 2FO1A 4ZNEA 3TCLA 2B2XL 1MHHB 1NCDH 3QXDB 5CGYD 4AL8H 5MEQA 4MJ6A 4NHCL 5E99H 1Q9WB 2FR4B 5CEZD 4TUKH 4ZFOL 2BSRB 3THMH 1IAKA 4P2QA 1DVFC 5T1LD 1J0ZA 2I07A 4I77L 4PJBF 3H3PL 1WVZA 4HK0B 1A47A 4AQOA 4TUJB 1JTPA 5CHNA 1DFBH 1QLFB 1RIHH 4LHUB 1U58A 3OPZH 3E6FA 5I1CL 4PJHB 1I9RL 3QUKA 1I9EA 4JFYA 4V1DE 4HUVA 3QDJE 2AK4D 1FV1B 2IPUK 1MFNA 2VSDA 2WBWB 4H1LG 3HUJA 5CILH 4K7FB 4K3EH 2FCBA 4M1CD 8FABA 1HKLL 1YEGL 2H2PC 2YK1L 3QIBA 4D3CL 5D1ZB 4YHML 2OCFD 2C1OB 4PJBE 5FYJL 4EVNA 3KXFB 4AEIL 1U8IB 1QFWI 2VXUL 4A2LA 3Q6GL 1I9IH 4G3YH 1A6TA 2EZ0C 2WW8A 2XN9B 2YWYA 3MA7A 5DJ6A 1CXIA 5E4EB 1MCQA 1P7HL 3OJMB 1R5VB 4YXKL 3TC9A 5FHBH 4YXHH 2ZOKA 3KPRE 1EZVX 4WDIA 5JUEH 2VXTL 2KH2B 3T65B 3HZYA 2ZSVA 4X6FA 4R7NA 3KPMB 1TTGA 1A14H 5E6ZA 3WO4B 2R2HB 1NGXA 2CRZA 3B9DA 1CICA 4ZAKC 4J8RA 1F3DH 4RA3A 2OQJA 4KJYB 3U9PH 1FE8H 3DMMA 3CPLB 1MPAH 1HCVA 2I26N 4MNGB 3WFBH 4YPGA 3DVGB 4WW1B 5J11B 2R0KL 3CX2A 4Q74A 3KJ6H 4U33A 3TN0A 1ZS8B 5CD5D 5IEHB 5DVMA 3QJHB 2Q8BL 2OLDA 4PJIB 5GSRB 2R4RH 1IM3B 3CXHJ 1C5CL 4JVWA 1FZKB 4JO4H 4NO0B 4OIIL 1XGPB 3MRGB 2ZNWA 5HYJB 2XZAH 1DBBH 1MFBH 3MREB 4U1SB 4F2MA 3AREA 1N4XH 5C0DB 4JY6B 1KCSL 3Q3GB 5MI0C 3RGVB 1GGIH 2YSSB 1RURL 3WBDA 3QEUB 4Y1AD 1AXSB 4B50A 5I66A 4PG2C 3P40A 3D85B 3EFFA 4CMHB 1CZ8L 4DUWA 2ZKHL 4LP4A 4F9PC 3QHZH 3BW9A 2BNRA 4GBXD 4R2GC 3ZE2F 3O6LH 3PWPE 1UT9A 3HE7C 2D0HA 2ATPB 3HB3D 3QYCA 4FQPA 4FXGA 1OAYL 2AJZA 2ARJQ 4M6MH 1SYSA 5E8OB 1WWCA 4HZLA 1E28B 1Y18A 2DQTH 2FSEB 2CLZA 2H45A 5F7EL 4XC1L 4N0FA 5FKPA 5LGHL 5E6IC 4KTDH 4M5YL 1MHEA 1AI1H 4D9RD 5TDOA 3TCXA 5IV2A 2IQ9H 2JELL 3ARGD 2H8PB 4I4WA 3KYOB 3AY4A 3KPQA 1OPGL 2IFFL 1OWWA 1O7SA 4HKJB 4LSQH 4WU5A 3GSRB 4Q6IB 4GAYB 4NN7C 3SKUD 1KELH 4KKLD 1TQBB 3ZE2E 4JFEB 2I27N 1NBQA 1C1EH 1MY5A 3OZ9L 3QQNA 5GGRY 4I5BA 4PJHF 3OKKA 4BK5A 3HI6H 3NTCH 1HI6A 4NUGH 3BZFA 4LLVA 4OF0A 4XB7A 1PVHA 2ZUQB 4LNRB 1B3JA 1IVLA 3OKMA 5D6DC 4WUUD 4F58H 4X7SH 3FO1A 3F7PC 5H35B 12E8L 2ADGA 3WEXA 2X44D 5BRZE 1LEIA 1RUML 3OXRB 2PW1B 2NY4C 1K3IA 5FYKU 1ZK9A 2AS5M 3F12A 5F97E 4C56D 1SEBB 3OAZH 2H9GA 1NQBA 1BIIB 1M7DA 4YDVB 3FFCB 3L3HB 4BH7A 3UPRB 5HSFA 5BV7C 4PJHE 2NX5B 4NDMA 2X4OB 5CBAB 4K9EL 1INQB 1SYVB 4E41A 5TQ2L 5JIIA 3QWOB 4JJ5A 1J8HE 4LRNH 3VWKC 5MHSE 4TVPL 2UUDH 4P3CL 5EBWA 2WINA 1M1SA 1H15A 5IWLC 3Q2CA 4KK5C 5BZWA 3FRPG 1X5IA 4G7VH 4CMMA 1JF5A 4JFQB 4YE4H 1NEZG 2J6EA 5C2BL 1DBKL 1E4KC 1FZJB 1WUNT 2N7BA 3V8CA 4QXUH 5EU3A 3DX8B 1CF8H 5DVLA 4NWTL 1U3JA 1WSST 1XCQA 3RNQA 1BAFH 4MNHA 4NM4H 2R15A 5T3XE 3PUCA 3W9DB 5IVXB 4QOKA 4Y4FC 5DJDA 3FMGL 3DV6B 1GC1H 2XTJE 2HN7B 2YOCA 3U6RA 1UG9A 1FH5L 4LAQH 3K4DA 3N0PB 3MOAL 3P9LA 5A16B 5HHPB 5DHYA 4JRXD 4LCIH 5T33H 5DJYB 4ZPVA 4MQ7A 1M05A 4HWEH 4D0CA 3V5KA 5D7JD 3WUZA 4X98B 4Q7DA 4XWOC 4DN3L 4CU6A 4MB3A 2BP3A 4OQ1A 2XV6B 4AH2B 4BSJA 1Z6JT 3O45A 1TVBA 3P4OA 2LTQB 3MRDB 2NY1D 1BQSA 1TJHH 2GFBB 4Z5RA 3EOTL 5ACLA 4H1LA 5F6IB 3QUYA 4J1UB 2CIKB 5EOCL 1S7TA 3ARFA 3FN3A 5ICYB 3GGWB 2AXGB 3CAFA 2ICWB 4HBCL 4ZUUA 2FX8H 5J8OA 1N5AA 3ARQA 3QA3A 3OWEA 1QRNB 1E27A 2DAVA 3S37X 4NQEA 2Y6SC 2EDNA 3TZVB 2X4RA 4FZ8L 2FLBT 4JRYD 5FDYA 3RNKB 5I1LA 4PS4H 4UT9L 1MCOH 5INDA 3SDAC 4HEME 1L6ZA 4R90L 4OCSL 3OKEB 4M02A 3RVXD 3WO3B 1ZANH 2J6EL 4NO2A 1RZ7L 3B5GA 1B4JH 4RCAA 4WTXA 1FZOB 3WSQH 1MRFL 4UILL 3IFNH 5GRUL 3SE3A 1WZMA 3DI2B 2J5LB 1EVTC 2EYRB 4Z0XB 4X80H 2VN4A 3WDJA 5E2TH 2MHAA 5JIKA 1BD2B 1XCTB 4NC1E 1IE5A 4L8SA 5JHLH 5SV3A 1R0AL 4HIHB 4DGIH 5ESAA 2H32B 5EO9A 2BCKB 4KVNH 4CU7A 1G6VK 2WBJA 1NGQH 3LKNB 5DS8A 4KGJA 1FIGL 3TA3A 1S7UA 3C2SA 2WWKT 1DQQB 1G7LB 2R56H 4Y5VB 1H3PL 4JDTL 2OTUA 4WI4A 3TO4C 4PP1C 4WI8A 2CXKA 3RZCC 4NQCE 2VWEC 1DEDA 1OY3B 2CKBB 2IPTH 1Z0MA 3S96A 4G8FB 4F7EB 3MRMA 1P69B 3WFCH 5E2VH 1I3GL 3K2MC 3S35L 1IEAB 2CMRH 3GIVA 4KMTL 3I2CL 4FG6C 5SWZA 4GT7A 1KCKA 4HCRH 3BD5A 2BNQB 1U2HA 5F93C 4XXCA 4QRPB 1BZ9B 5DURD 5IMMA 1OTTC 1F2XK 3C09C 3MV8A 1C5BL 3WNPA 4WHCA 3PWJB 4I2XA 4LCWE 1MCLA 2WP3O 2EYTA 2AVGA 2VQTA 1NBZA 5E70A 2PXYD 2R4SH 3FFCE 1AGBA 4KRPD 4ZUWA 3VFGH 4MB4A 5HVGB 3DO3A 2FNBA 5CUSL 4L4TD 1N59A 3L5XH 3EFDH 1AH1A 4I18B 1BQHB 4Y7MA 5IW1B 1AQKH 3B83A 3JWDL 3WJJA 4KQ3L 3DECA 5E8DL 3KJ4B 2VH5H 5JPNB 3HKFA 5DD0L 5DUPL 5EB9A 1R3IL 1VGKB 4KJPC 5EZJA 1IGYA 2LU4A 1RZJC 5DSCA 3ZDYF 3HMXA 1LO0L 1X5JA 1S7QA 1ZHNB 1FFPB 1QLRA 2PO6C 1MF2H 3DSFH 3G6JB 4MD0B 5C0CD 1KTLB 2LV4A 1JWUB</