2G5RA

Crystal structure of siglec-7 in complex with methyl-9-(aminooxalyl-amino)-9-deoxyneu5ac (oxamido-neu5ac)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
114
Chain Sequence
KDYSLTMQSSVTVQEGMCVHVRCSFSYPSQTDSDPVHGYWFRAGKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of siglec-7 in complex with sialosides: leads for rational structure-based inhibitor design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Sialic acid-binding Ig-like lectin 7
total genus 29
structure length 114
sequence length 121
ec nomenclature
pdb deposition date 2006-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2g5rA00
3GIVB 3QJHB 1JPGB 1U3HA 4U2YA 2P44B 5AD0B 1W8NA 1VGKA 3PABA 5M7QA 1LO3L 2B1AH 4Y4HC 2KH2B 1GC1L 1L9MA 4QRRE 4NKMB 1VFAA 4MD0B 3QQ9C 1BQHG 5CIPH 2EC8A 3KPLA 4M7KL 4PV9A 1P5VA 2QADB 4IOIA 5FKAA 3BXNA 3GMNB 4RFEA 1GGBL 1QBLH 4WGVB 4LLVA 1JZ2A 1CFTA 1QTYT 2GCYB 2XACC 3PHQA 4YIQA 2UUDH 2BVPB 5EWIH 1ZHKB 2QR0A 2KQNA 2X7LA 1T7WA 3EDEA 3MRIA 4HKJA 1QSEE 2AXGB 3T1WA 4RMUA 3HN3A 5JHLH 2ZSVB 5B38A 5F93C 1HI6B 4XP6H 4YBQC 2EKSA 1T0PB 1KCUH 4KUZH 4XP4L 3WJLC 3RDTD 2ICEA 5HI5C 3GBMH 4IRJB 4LLDA 4OFYD 5C0IB 2VDRH 1KN2H 3SDCA 5DWUL 4XP9L 2Y7QB 3VFGL 5D1ZD 3EW3B 5J13B 5GGRB 4KJPC 3U0TB 4XPTH 5DUPH 3K81A 2P24A 4PBVC 1G7QB 2O5ZH 2HKFL 4H8WC 5MENE 4P2QA 4WJ5A 1IEBA 4D8PA 4N90E 1A7RL 3D9AL 4R96A 3SQOH 3DMMA 3SGKC 1T03L 1FBIH 3PGCA 4GKZA 1LEIA 4MB5A 4PY8J 4ZPTA 3BPLC 4NC2B 4HIEB 5BOZG 1GC1C 2JB6B 1I3RA 3C6LB 3TBYA 2EE6A 3MLYH 4U2ZA 2NY0D 3VCLA 4OZIF 1OTTD 3MRDA 3VXUB 4HIIB 5IFJB 3U7WH 2GJZA 2PW2A 2ZUQC 2VLKB 3SO3C 3UDWA 5E9DE 2YPVH 5DMGC 3U46A 4PUBH 4Z5RB 3GJEA 3BO8B 1YEFH 4HFWA 4Y4FB 2E7MA 2KL6A 3DUSB 1U2CA 1JNHB 4NQCB 3LKSB 2VABB 3HZMA 4PJ5E 1K9TA 4TOYL 1RZ8B 1YA5A 1CDIA 1KCRH 4G80A 4PJGB 4CVZB 2CRIA 5E5RB 5JXEA 3VRJA 1DQJA 3MRNB 3OAYK 2EDRA 3UTPD 2WUBL 5C6TH 4G9FA 2OI9B 2K1MA 4I18A 2DQTH 3IGAB 4AIZB 4OZIE 3RP1A 1R24B 3I2CH 2EDEA 1DVFD 3LQMA 2R29H 3ROLA 1XH3A 4JFHD 4JB9L 4L9LC 4OCXH 4K9EL 4X9HA 3ZMRA 2DL9A 2BRRL 5FYJH 4C56A 1GVIA 4HCRL 3ARFB 3IDYB 4F33A 4M5YL 4V1DA 1FH5L 1WT5A 4M7LH 4WFHD 1EIBA 3ISWA 4NZTL 4RAHA 2XTJB 2K3TA 3NIGE 4W6YB 4WTXA 1VKXA 1QSVA 3H0TB 3VFSA 4RNRA 3ME0A 3MROB 1N0LA 4PJGA 3WFHB 3GGWA 1R5IA 3RVWD 4PJFA 4P23D 1D5IH 1RVFH 4XNYH 1JN6A 2EIEA 4HSQA 3U0PB 3IJSB 3G08A 4PGCA 1RZ7L 1JBJA 2HLAB 3Q2CA 4PJ8D 2HJFB 1TQCB 4PY7A 1FGVH 4Y4FD 4XZUA 4WI8A 4DKEL 5KVGL 1KJVA 4GSDH 3KLAA 4I0PA 1KF9B 2PW2B 4XNXH 4MXVF 3WJJC 1CIUA 4HIIA 5AEAA 1IGJB 3CFBB 1S9YB 4ZPVA 4G8IA 1NC2D 1J0HA 2VJXA 3CDGB 4QXGL 1N4XH 2VXUL 4JE4B 1R3LB 3UYRL 5DR5H 3LB6D 4YPJA 4LCUB 3WKMH 5A3ID 3R4DA 2EYTB 32C2A 4NN7C 4QXWA 5DFVD 5CD3B 4K8RD 4ZUWB 2EZ0D 1KEMH 3KYAA 3FOMB 4UIMB 2D9CA 4A6YB 2GTWB 2VN4A 1T5WA 5L2KA 3OG4B 3QFDA 1AP2A 4CW1B 2XKNB 1BD2D 3BKJL 1ITCA 4LCWB 4MSWA 4HWNA 3AS1A 1JGDB 4NHUA 3SDDA 1IGYB 3P30L 3O8XC 2HJLA 3ZE2F 3P40A 1R3KA 1BECA 2G5BA 4HXAH 5FV1L 4EOWH 5KJRL 4KHXL 3IFNL 4KY1L 4OCWH 3UTPE 3D39B 4DOHE 4CU6A 5C0BD 3ZKNC 1NANI 4ZDHB 1A14L 4PJIB 1HH6A 5ETUA 1HE7A 2NY6B 3AREB 4XC3L 1ZVSA 2X05A 3UTSD 1PZUB 2X7LB 4HZAA 2XZCL 4LQ1A 2AERT 1NCAL 3L3OB 3WHXB 3P9MB 5A1AA 4AM0A 3IETA 1CD1B 2RBLA 3LEXB 3FT4A 4PV9B 4X7TB 1R6VA 4NUJB 1PBYA 1SY6L 2DWDA 3WO4B 1UH2A 2FB4L 3ULUH 3GM0A 1DBKL 4WI5A 2GKIA 4I5BA 5FGCE 5I19L 1MCCA 3MXWL 4FFWC 5DD0H 1A7PL 1I7TB 2IH1A 1QBLL 2EH7L 1FNAA 1Q1JL 3RBGA 2PXYA 2IANB 1U9KA 4ETQB 2ZG1A 2HJKB 3IDJA 2AJVH 2W9EL 4UI2A 1NCDL 2FGWH 3TV3L 2AK4A 4P2QD 5I71B 3RL2B 4Y1AE 3O2VL 5EIIB 1NFIA 5CBAA 5IEHB 4JZOB 3H3BC 3BKCL 4OCYL 3TBTB 3LN4A 4HDIA 4ZOBA 4OD2A 3OXSA 1HKLH 4U6XA 3A0OA 2VDRL 1OD9A 3AS2A 1CU4H 4CVXA 3V6FA 2Z8SA 4M3JA 2XICA 1K4CA 4P9ML 1INQA 4HIHB 8FABB 5LWYH 1ZA6B 1H8OA 3OPZL 4WGWB 4NM8L 2O26U 1WISA 2MTPA 5BJTA 4Q9RL 3L3IB 4XPTL 5DUPL 4Y5XA 3ULVH 3PWVA 3GO1H 4PRIA 3WS3A 2D3VA 3OAZH 1A0QH 4Y5VB 4QRSB 3PV7A 4K9EC 3S4SB 4PJEE 5DQ9A 1ORSB 2MQCA 3F7QA 3IDGB 5DHXB 4LLWA 4PREA 2I60L 1O7VA 3WIIH 4NHCH 5TQ2H 3GMMB 1KB5B 1C5BH 1KXVC 4LNRB 2Q8BH 3TCLA 1G84A 1BVKA 3UBXB 3PV6A 4U4BA 4MCZB 1S5IH 5FK9B 5J7CC 4UU9B 1GPOL 1BMGA 3TA3C 3LV3A 4KVCL 3L7FB 1BOGA 4Y16B 4KDWA 1TCRB 1YEFL 4EXKA 4GRMA 2NY6D 2D7PA 3GMRA 1HQ4A 4AT6A 1NANH 2P5WD 3FONB 4TVPD 5IHBA 1A6WH 5C70A 4P49A 4LLMA 5F1KC 5DA4A 4AMKH 3EZJB 3C2SA 1OTUD 1I7UA 3TH3T 4KAQL 5DJ0B 3BIAX 2WUBH 5F7WC 5C6TL 3BGFB 4X98A 3SDAA 2FYYB 1OB1B 3ARBD 5BV7L 3JTTB 3I2CL 1U8LA 3U36B 3DRQA 5GS1C 5D8JH 3BP5B 4MWFB 4NSKB 5DFTA 4L3CA 5DJAB 5B8CB 3VW3L 5C0AD 4MJIB 4M7LL 4QHMB 1KCVH 1TDQA 1LE5B 4UT7H 3ZZ1A 1VDGA 3N06B 4LAQL 4ONHA 1U8MA 4RAVB 3SGJA 2MOVA 3FAWA 2I26N 1U8NA 1RZJL 4O9HL 5CSZB 1MFBH 4RGMB 4YHPB 4LMQE 4M93B 2EDNA 5L6YL 1DLHB 5K9JL 4DKFH 4JY4A 1JPTH 1K4DA 2EICA 2VXSH 3VG0L 1FGVL 3GUTA 3G04B 2NR6D 4NZJA 3HHRB 1WAAA 5GRXG 1N5YL 5T1MB 3W0WB 3ECBB 1CFBA 1AGDA 4YXLH 5ICYA 3VD5A 1F02I 1FNSH 3STLA 4UT6H 4XXDB 4HWBL 4L9LA 4PTUB 3WEXA 1NBZB 4HGKC 2IAMC 2ZG3A 3VXUE 2BNRA 2V7HA 4Y2OA 5A2LH 5MHSD 4KZDL 1I1YB 1T1ZB 3PWUB 1YDPB 4LHJB 4YBHA 2FCBA 5I1DA 4YDLB 2FWOA 5F9OH 1X5HA 3VFUB 4G42B 5GSRB 4YE4L 3GJFA 3O81A 2FBJL 3ULUD 4MZ3A 5E2UH 4NFDA 1BD2B 4MJ4A 4KJWD 4B53A 5JNYB 2HKHL 3HG1A 1NH6A 4KXZH 4XBGB 3P73B 4KTDL 5ERWA 5IB4A 5HGGS 4FMFA 3MBEA 2D31A 5B3NA 1IAIM 3R0MA 3V6OE 4PRDA 4HX1B 2B1HL 1UWXH 3VE0B 2DYPA 3TFKD 4WNQA 2ATPA 3STZB 4ALAL 3V95A 4NKIH 1XIWD 1OW0C 1LO0L 3O9WD 1JNJA 5I6XC 2R23B 4NGHH 2EEAA 2W59A 1KNOB 1HXMB 1RSFA 1J1OH 2BX5A 3W2DH 4LK4A 3PWPD 43CAB 4L3AA 4BSWA 2VLJB 4QEGA 1ZEAL 4G7VL 3DUUB 4M1CC 2P1YA 3EYVA 3MRLA 4PJDB 3AMKA 5JLZB 2PN5A 1IRAY 3BQUB 4EN3D 4X8JA 4P2RA 5A2FA 2XQBL 1QFPA 3D0LB 2BDNL 3ARBB 3TN0A 3Q6GH 4FQ1L 3B9KA 1DQQB 5JOFA 3FJTA 2DBLL 3JUYA 1DJSA 1DBJH 1WBXA 3LY6A 5E2JA 2VL5B 3M17A 1KLFA 2B4CC 4MD4A 3WIHH 3BVNA 3C8KA 4L4TB 1BVLB 1F2QA 4YDVA 5I8EB 4CMHC 2QL1A 3HUJE 1T2XA 1T66C 5IW1A 5DVNA 1HHKB 1Q9LB 2XWBA 2FATL 1NDGA 5GS0H 2V2WA 2E9IA 2HT4C 5HHNB 1Z9OA 1L7IH 2VLJA 3BEVA 5AG8A 2NXYB 2W0FA 4Q9CA 4N0CD 2ITCB 4J3VA 3VFMA 1D5XB 4L4TA 1AJ7L 1H0DA 5KOMC 4YHZL 2CKBL 2VDPH 3ZYOA 4S2SA 3QXAB 3DO7A 1Y18A 1NCWH 2DM4A 5KS9E 4XNMB 1BQHB 1NMAL 2APXA 5D7IA 4M9PA 1UB5A 3GI9L 2V17L 5JXEC 1JWMB 1UADC 1IAKB 4IIQA 1H3PH 4X4ZA 4HF5L 4UINL 4N68A 3RWHB 1JRHH 1OGAE 3MRCA 4YXHH 4P2RB 4JM2D 1FYHB 1T1XB 3BQUA 1M71A 1PW3A 5TPWL 3O8XB 4PJ5B 5E08L 4Z76A 3EYVB 3MRLB 3O9WA 4NOFA 2F8XC 2VLLB 4BSWB 4AG4L 4CNIB 1WJ3A 5ERWB 3P73A 3B5HA 1KIPB 2BMKB 1HK6A 3MA7A 1CGSH 2EH8H 4HMCA 5FM8A 2MQ3A 1FFNA 1A0QL 2EEDA 3S3JA 3HI5L 4OM1L 3VH8A 4J4PD 3TBSB 4X6FB 1CL7H 2OL3H 5GSRA 1RJYB 1IAOA 3SKJL 1A2YA 1QACA 2DMBA 3VGFA 4M7JH 1SHMA 2A38A 5B39G 3RVTD 1UWGL 4D94A 4XMLL 3QIBD 2CQVA 3EZ8A 5IVXF 3WEXB 5I1IH 1I8LA 4MDIA 3OGOE 4M43L 5F96L 3OJDB 4L3EE 1PYWB 3D85D 5ICYB 3VWKB 4E9LA 3W0WA 3VI4E 4XAKE 2YA0A 4RGMC 1TTFA 2CRYA 4LBEA 3GJFB 4EN3C 2B39A 2YRPA 5EUOB 4G42A 1S7VB 1CFVL 3LKPB 3WL9A 5I73B 1QLFB 4L3EB 1WCBA 1P1ZA 5J6HA 2UZIL 1MRDL 1T1ZA 3IFPA 3QI9A 1LE9A 4X4XA 4YHPA 5DUMH 1D5MB 3UPRB 3W39B 2HH0H 2AQ3A 4X7FC 3R0NA 4YGAB 5T1LD 1CK0H 5CP3A 4HUXB 3BPLB 3WNNA 1XF4B 5DJAA 1S7QB 4OKVA 3CZJA 4NNYA 1AXIB 2HT4D 1CG9A 1FE8L 2XPGB 3T2NL 3WN5B 1MRFL 3N1QC 4ZFOL 4E5XB 1DLHA 1RZJH 4O9HH 3MR9B 4P3WA 3RIAF 1MCDA 1I8KB 2FD6L 1UB6B 1BJ8A 1INDH 4LRIC 3LZFL 4DKFL 4UTAL 1DANT 2C7UA 2OJZL 2VXSL 3BI9X 1BM3H 3AB0B 1I75A 2VZTA 4F7TA 5KW9L 1B4RA 2YRLA 4ZXBB 1HHIA 1OLZA 1RMFH 5FDWB 5T33H 5K93A 1FLRH 3OMZA 5HYFA 1TLKA 3P4NA 3W5MA 2ARJB 3MOBH 1C1EL 1SJHA 1S9VA 4RGND 3G6JB 3EJZC 2VQ1A 2APTA 2YKLL 5FK9A 2B4CH 4OBSA 1UWEH 5AYQA 4NM4H 4RMTA 4BQ6A 4JRWA 1LP9A 1UXSB 2GFBB 4N9OB 5EO1B 1H5BA 5DQ9B 1JJUA 4X4YA 4PJEF 1IGML 5KSAB 2IMMA 2KQMA 1QUNA 3AB0C 4XNZB 2GHWB 4JO4L 5I2IA 4OM0L 3VWKC 4ODWB 3NA9H 2FSEB 2MFNA 3QRFM 5FYLE 4FXGA 3SKMA 4PRAB 1X6LA 4NIKB 5CBEA 3MFGB 1ZMYA 4HJ0C 4JN1L 5CKAA 4YZFF 3UROR 1KTLB 2B1HH 4PLJD 3DI3B 3BHBB 3I6GB 3ULSA 3MV7A 4HIHA 3MNVA 3VFNA 5D1XA 2NNAA 2F53D 1AGEB 1X5JA 2APFA 1FJ1B 3TBTA 2VLRB 2E27H 3LQZA 2NY5C 4R2GD 2XFXB 2DQFA 1AR1D 1Q9OB 4WUKL 2WNGA 3L1OL 1A9BB 1NC4D 1MVFA 4BQ8A 4S1QH 1IL1A 2A1WL 1MCWM 3MRGB 4X7SH 5BO1L 3FO9B 1XIWC 1C8PA 1F2XK 3L3IA 4YWGL 3GSNB 3GI8H 4AL8L 1X5GA 4L29A 1J5OL 2HP4A 2J8UE 4XH2A 4PS4H 2QSTA 2JKXA 1CYGA 3QH3B 4C83A 4OB5L 3ARYA 4PJBA 1HWHB 3M1BA 5KN5A 3S3PA 3WO3B 4WW2A 4LSSL 1QLRB 5SWQA 4TVPH 4Z7VB 3ILPB 1JUFB 3GZKA 1FV1B 3GB7B 1Q8MA 5D2NA 2Z31C 1A5FH 1Q94A 4AM0B 2R2EB 2J88H 4UV7H 3P9MA 4IRSA 3D9AH 1ED3A 4UV4L 2FATH 3QDHA 5GS0L 3WHXA 3MJ9A 4LCCA 2BSRA 1L7IL 3VFOB 5EUOF 3TT1H 4GG6B 4GLRI 2PO6B 2WWMD 4DW2L 5KSVB 2H26B 4H0IA 4ODUB 2J6EL 4C57C 3OKEB 1CXLA 3FRPG 2DQUH 4IRZL 4WWID 5DVMA 3ES6A 4PJIA 5GIRB 3QUMH 3DRTB 3GI9H 3QUXB 3QNYB 1E4WH 4WW1B 4FQIL 4GG6E 5C0JB 4AQ1B 4Z0BH 3FO1A 4QHLA 1MCWW 2BVEA 1WWBX 2IBZX 4MSWB 2CH8A 4LNVA 3QDJA 5D2LB 1MFDL 4GAJH 2A77L 3VFPB 1A4KB 4LSVH 4TOYH 1DUYB 4NN5B 1A4JB 3RUGF 1HH6B 3FOMA 5I6XB 1ACYL 3AC0A 1LO2L 5DQJA 1FG2A 1ZKAA 32C2B 3B2VH 5C2UB 5SX5K 2EDKA 5DT1H 1UENA 3OGCA 5C09A 3LH2H 2ESVD 3HNVH 3SY0A 3BPNB 1BBJB 4X7EC 1SYVA 4XWGL 3SKJH 1R3KB 2GITA 1P6AB 4HUMB 1R3LA 3DBXA 3KPOA 1FL3B 1X5ZA 2P7TA 1I8LC 2XKNA 1AGBA 2IF7A 3MUGA 5E94B 3V6BR 1OSZA 3ZTJG 4LSQL 5FGRA 1A3QA 1ODAA 1XGRA 3RKPA 1JGUH 2QQNL 3JVGA 4NDMB 3F65A 3GMLA 3CMOH 3SCMC 1J8HB 1JK8A 5F9WC 3BIKB 4Y4HD 4Y7MA 4YBLB 1TJHH 2OM5A 3PWJB 2GK2A 4L4JA 5HY9A 3A6CH 3B9AA 5C08D 3PHOA 3WFCH 4H8WL 1FVCB 1JF1A 1MRDH 3T4AB 5BRZD 1LO3H 5KVGH 3MOAH 1QVOA 4X6EA 4NFCA 3FQRB 4G8IB 2A2QT 4WV1A 1QFWH 2H1PL 1FC2D 3IFLL 4WFED 4WI9A 1P2CA 4UDUA 4XVJL 3I6KA 2YSSA 2AEQH 2Y6SC 2J5LB 2HVJB 2WBKA 3VRIB 1KJVB 2NX5D 4V1DB 3TJEH 2RGSA 5F7LB 2GAZA 4K3GA 2HFEA 4G5ZL 4OI8A 3U0WH 3O11B 1CLZL 4HKBB 1KJ2A 2BVYA 4NCC2 4WDIB 1VACA 2F15A 1N5AA 4DN4L 3PDOA 1GL4B 1RULH 1LEGA 2EDJA 4J1UA 1A02N 2A9NL 4CVZA 4X0KB 4TULH 4Q9QL 1ZHBB 4J1UB 4NKDA 3TJHD 4JN2B 4JFXB 1E6OL 4PR5B 3RWJA 1KJ2B 4HKBA 4PGZA 4U0RC 1BGXL 3MLPA 2PYFB 1JPSH 3D85A 3VRIA 3VU2A 4P9HL 2GJZB 4FQ2L 2A73B 5E5MB 1YC7A 1ZWIB 5ALBH 2MMXA 1D5ZA 2DQGL 2AEPL 3GJFH 4EI5A 2YEZB 4G7YL 1MHEB 3GMOB 3S9DB 3H42L 2H2PD 1ZT4B 1I3UA 4ZG1A 1EPFA 1EEYB 2JELL 1RZ8A 2DI7A 2IMNA 2V5RA 5F1OB 1RIVH 1D6EB 3R1GH 4MXWL 4E0RB 5C0GB 2V2TA 4R90L 1I8MA 5KAQF 3RKDD 2L4OA 2Y07L 5K9OA 1EUUA 3EYOA 3RZCB 4GOSA 3LKNB 3MLUH 1FP5A 4MHHI 3ZSSA 4YHNB 4AENB 3V7AE 2EXYC 3ULUL 3FCTA 3KDMA 4OF0A 5FA3B 5TE4L 3VWKD 1WLHA 4RAUA 2Y1VA 5BVJB 3C6LA 3TBYB 2A6DB 3HS0A 3RWEA 2JJVA 3UPAA 4MJ5A 5FIEA 1DANU 1Q1JH 3MRHA 1UXWA 3LS4L 4GKZB 3EOBA 2D4FA 2WP3T 1JE6A 4JRYB 5LGHL 1RAMA 4BFIA 5T1KB 1D9KA 1HHGA 2N7BA 3KYMA 3S37L 3PIQB 4GLRH 5IJKA 3ZL4L 1YMHB 5I8CB 4RSVA 3MNWB 3U0TA 3ARVA 3Q6FB 5JIKA 4ZFGL 4UQ3A 4XX1G 2R15A 1I3GL 1HKLL 2DTMH 2V2XA 2MCPL 4OCXL 3BN3B 3SKNA 3KAAA 4G6JL 3ZDZE 3TZVD 1OQXA 1X3DA 5BMFL 3FFCD 1OP3K 4H88H 3U2SB 2WMPA 3IB4A 4LSSH 4B50A 2X6MA 1M7DA 3B8YA 5J1TC 4TVPL 3IDIA 3DUHA 5L88H 5D1XC 3HPJB 4QXTB 4RQQA 1TXKA 3KDMB 4R26H 2Z0BA 4PBXA 3WFDL 2X1WL 2PO6A 2Z4QA 3FB8B 2DQEL 4DQOL 1W72A 3PWLB 5SWSD 3QDMD 4P3DB 3OKKA 3K8MA 4IRSB 4RFEB 2JCCF 3QUMA 5GS2D 3ARXA 3BKYH 5TQ0H 4Y5VC 2V2TB 3FQUA 4P4KD 2F9BT 1JUFA 4N8PA 3QIWD 5L8KB 3RUGE 1FAIL 1CTOA 1UKQA 4FZ8L 1O7SA 1GPOH 5TH2A 4NKMA 4HUWB 2W91A 1LO5A 4KMTH 3LOWA 3MLWL 2WBJA 3O6FC 2GJJA 3NCYP 1XCTA 3O4LB 2E8ZA 4QTHB 4WU5B 4KV5E 4NO2A 4OZGF 3VXTA 2NY3D 3SDAC 5ACZB 3NFSH 3WLBB 3KYNB 3OHXB 4Z7WE 2BHZA 3OR7B 1ZTXH 4ZQKB 1QFHA 5EU6B 1IVLA 4KI5D 2O61A 4TVPE 1ACYH 3DURA 4NUGH 5IOPB 4D0BB 2OP4L 5GGSA 1TVHB 4OLZH 5IB2A 5IW3A 5JQHC 1KTKE 5JHDA 4CU8A 1VACB 1EMTH 2X5PA 1R3IH 1P9MA 1KTLA 3MV01 4HIJA 4QCIA 1YEHL 2GJ6A 1RU9L 3QNZB 4UOW0 1YEGL 5FUOH 5J8OA 3GEWB 1FZOB 2QQNH 3L3GB 2A9ML 2M8XA 1CFSB 4Y2DD 4KC3B 2YN3A 4ODWA 1EJOL 2EDDA 3QIUB 5CJXA 4Z7VE 3C5JA 3GKWH 1JHLH 2R0LH 4WV1B 4Q97A 1XGUB 3C08L 5CD5C 1GC1H 2V7NB 1YPZA 1BLNB 1BZQK 3GSVB 5F7DB 4FFWD 5GS0C 4S1RH 4YZFE 2ZUUA 1XCQA 3SGEI 5E00B 3VXNA 2CLRB 3F7VA 2V9RA 3C87A 1NUGA 5FKPA 3QWOB 4ZSOB 3JZ7A 4JFED 4QT5B 2WLYA 3DX9A 1S7RA 3QDAA 1IBGH 1T0MA 3MXWH 3ZTNL 1OSZB 4IRSD 1B0RA 4ZXBA 3MUGB 1QLEL 2CPCA 2R4RL 3EOAA 4NQDA 3LKQB 5IVXE 1QP1A 1RURL 5J4MA 1KLGA 3MRRB 3EGSA 4U1LB 1BFVL 3PDDA 5F9JB 1U36A 2DQIH 4JFFE 4YR6A 4E42B 3QIWC 5HGHA 2B8OT 4LQFH 2E3VA 5TE7H 1BBJA 4AYFA 5D7KE 2VMFA 2FO4A 1A1OA 4KTYA 3LIZH 4XP9H 3V4PL 2YA1A 4WU7B 3RZWA 1QRNA 3GMQA 4FG6C 1U95B 1MF2H 5CZXD 5MEQA 4X5WA 2G2RB 5FHBH 4EDXB 2WZPD 4G8GD 5DI8B 2LVEA 4MQ7B 1LO0H 4Q9RH 1WBYA 5EO0A 1GRWA 1NCNA 15C8H 1IGTB 4FZEH 3W39A 3H42H 3UPRA 4OD3H 3LQAC 1FBIL 2JB5L 4NQVB 3IF1A 1XMWA 5KOVC 1HYSD 1TPXB 2B7DT 5T1KD 2G60L 2UWEF 4ZAKA 2NTFB 3O3UN 1F00I 5CP3H 1INEH 2Z31A 2E9JA 4I0KA 3D48R 4X6CE 3RNQA 2EDOA 2H32B 4JHZA 5EULV 1SEQL 3K2MC 4FQ1H 5ITFA 4B41A 5F7FA 1NGPL 4KJQC 2VN7A 5FGCB 5J12B 5TE6H 4X9IA 4Z77A 5E2TL 5EIQA 4XVTL 1ZGLB 3A6BL 2APWA 5IB5A 4O2CB 1KPUB 4YX2L 2VDOL 5DEGA 5K9KA 3BAEH 1MSPA 1RJYA 2EO9A 2HFGL 3TBSA 1CQKA 1RHFA 4HWBA 5KAQG 3MRQA 1GJIA 4DK3A 3MLTB 4QRTA 4XI5D 2L7UA 1HINH 5AUMA 5A40E 2VDKL 2HWZL 1E4XL 3N1MC 2CLZB 3BWAA 3FO9A 3W9EB 3QA3B 1I3GH 1ZLUH 4RFOL 1T3FB 3FB6B 4G6JH 1M71B 1BIIB 4ZAKB 4HUUB 3SE9H 3TC9A 3WHE0 4JQVA 3X13B 3V7AG 1D5IL 3MV9D 5E08H 1UB5B 3PGFL 5D7LB 3NZ8A 2XWJA 2C5DC 3IRZA 4QRQB 4HWEL 4XNMA 3KPQA 1T6VN 4U7SA 1TETL 4PJGF 3ZHKA 1L0XA 4UIKH 4Y16D 1U95A 2IADB 3EDKA 4YNYA 1A6AA 3BEVB 4APQD 5GS1B 2R56H 4TPRL 5HHNA 5DTFA 2AJXL 1NDGB 3OKMA 2VYRE 3NBNA 3O8XD 4NBXB 2C3VA 4XNZC 4ELKB 3LHPL 3BPOB 4U6HA 4K7FB 3UXFA 4LKCB 4QXGH 4XNUH 5J89A 1QSFB 3UYRH 4FFYH 1RUML 5JW3L 2FJGA 4U1GB 4Y88A 1CD8A 3WKML 4NQDB 3QI9C 1QO3A 4KMTL 2IPTH 1DQQA 4OLUL 4XRCB 4ZNEA 2X40A 3V5HA 3G5ZA 3KNBB 4H1LB 5DMIL 2UWEA 2QEJA 2EDHA 4D9LL 3KYKH 5JLZA 1F97A 3F5WA 1G7MB 3ARDC 4ZO9A 5E56A 4EDWL 4X99A 1EUTA 5ID0A 2UY6A 3MUZ1 1BZ7B 3ZKQD 3VD4A 2X4OA 5ESAB 2HH0L 3VRLE 3S34H 3UZQA 4F7MB 1OARL 5SWSE 5HHVH 1FO0A 5C0DB 1QHPA 4ELMA 1URLA 3HI1A 4RRPA 1IM3B 3VFTA 4MJID 1HSBB 1I4FA 1K3ZA 2AV7A 3R8QA 1GGBH 1OWRM 3BPCA 1X6NA 3LN9A 4JFZL 2UUDK 3QG6A 2B2XL 4DKAA 2XZCH 3GSOA 3M07A 1Z6JT 3EYSL 1KLUA 3ARPA 5D7KD 4N0FB 5BZDB 3CVHL 5DLMH 5BV7C 1OCWH 3TWCH 4DAGH 1D5MA 4H5SA 5C07E 4QGTA 4J6RL 3MFFB 1KIUA 1TZGL 1CE1H 2ZOLB 5CIPA 1HZHL 2HLFD 5GGSB 5E6IB 3CFIC 4JGMA 1I1YA 3C6SB 3HC3H 3OKLB 1PD6A 2Y9RT 4A2LA 1JHKL 5DD3H 4JZJA 4N9GB 1SYSB 2DM7A 2NY2D 2EH7H 3PWPB 5CGYD 4KU1A 3HZYA 1OP5H 1IBGL 1KTDB 2W9EH 3HRZB 5IV2A 2MQ0A 1FNGB 3MRBA 3F7PC 1MCSA 1QLEH 1NAMA 2J4WH 3KHQA 3GUTB 4JVPA 2DB8A 4HBCL 1R5VB 1MUJA 2COQA 1H8SA 4QF1B 3WO4C 3T3ME 1OAYL 4P5TC 1EHLH 5I8OL 4JJ5B 1EFQA 1IQWH 4WENB 4LHUA 2FEDC 2XQYK 5E7FA 3B5TA 4Q6YA 1U8NB 3I02A 1CU4L 1Z2KA 4W81A 2R1YB 4KRNA 5JHDD 4TSAH 4P3DA 3T1FA 1JI2A 1KIPA 3AM8A 4IS6B 2ZUWA 5CEZD 3QIUD 1BPVA 3WE6B 3IFOA 5HI4D 4QXTA 4RQQB 1U8LB 2BCKA 2F54E 2Q76B 4G8GE 3IDIB 4AG4H 1AHWA 3W5NA 1M7DB 5CZXC 3CSYB 4M9OA 1X9QA 5F6HJ 1LK2B 2MJWA 2XXMB 5FB8B 3VMPA 4JKKA 2XA3A 1D9KD 4LLMB 2EECA 4AL8H 2V2XB 3HCVA 3VXPB 2F53B 2BNQD 1D5XA 3Q5YA 4OFDA 1KTRL 3H7BA 1CIDA 3GBNH 2LV4A 5FUCC 1DQLH 2V2WB 3RZCD 3CXHK 1N64H 4HK0B 3P77B 3KHOA 1KPRB 4Y4KB 1FNEB 5IIEA 1J88A 1FNFA 2I27N 3QIWA 4RX4D 4R0LB 3KNBA 4H1LA 4M43H 5GJTL 5T1KA 5IW1B 5GRJH 1PAMA 5FYLH 3OTTA 3BP4A 3DETD 3VXMA 4XVTH 4GQ9H 3H9SE 3VXQA 3HNTH 1GGIH 1GH7A 2FGZA 4QOKD 2FJGB 1VERA 1A5FL 3RTQC 5C0EB 4JREB 4AMKL 5JW4M 2Y5TB 5IW6A 1XF5B 5FUZH 2GY5A 3UTSB 3LRSA 2VLME 5KS9B 2IG2L 2VH5H 4IHOB 5D8JL 4PJXE 4XNXL 3ZKMC 1JFQH 1ZLVH 3BIBX 4LLYB 2Z8WC 4HPYH 1RHHA 3D3VE 4YGVB 2VRAA 5DHYA 3N50A 2PW1B 4M48L 4YQXL 3BDYL 4HDIB 4MQXD 5E0QA 4F15B 4CBPA 5E5MA 4HUUA 4WHYH 5IEHA 3ORJA 5HDQH 1JF6A 5I76A 2VZVA 3BT2H 3AMLA 3MBEB 3IAQA 1FL5B 3QDJD 4R3SA 3T2OA 1RZJC 1SBBA 3L3JB 2Z9TA 3OR6B 3LH2L 2HFFA 3BKJH 3QPQD 1IGIL 3REVB 3VDCA 2L7JA 4RMWA 1AO7A 5IJVA 2NY4C 4G8FA 2A83A 5KJRH 4KHXH 2MWCA 3VFUA 3S88L 4KZDH 3CXHJ 5F97E 1LEGB 5D70H 2YZ8A 1G7HA 1N5AB 2RQ8A 1A14H 3N9GH 1NEZB 1CLYH 2XTJE 3BOVA 1G7LA 1A6ZA 1X5LA 4Z77B 1CD1A 2GAZB 3FMGL 4GG8B 5TGBA 3E6HA 2XZQH 4MA8L 1DSFL 2OR9H 3ECBA 3L3OA 1DQDL 4PP1C 2B1AL 1B9ZA 5D7JA 3QFJB 3WFCL 1BOYA 2PTTA 1EO8L 4Z7QF 4HKZB 1HNGA 1JTOA 2Z31B 3ZSTA 5KVEL 1F6FB 1AQDB 3S97C 3C60B 3OJVC 2YZ1A 3X11B 1IC5H 2CIKB 4BH7A 5CUSL 5D96B 1RJZB 1NEUA 3IF1B 4AEHL 2OS7A 4IMLA 3C5SA 4L1HA 1UCTA 2G5BB 5EWIL 3U1SH 1KCSH 1ZS8B 1WQVT 3HE7A 3LEYH 3AGVA 4TTGA 1JGDA 2CKBA 4NHUB 2GI7A 4LSUH 5FYKE 3W2DL 1ZT1A 1ROWA 3BDXA 5D9SB 3DGGA 4WUKH 5FYJD 1AGBB 3S98A 2YD4A 4LPWA 4N1CA 25C8L 3DRQB 3CH8A 4A6YH 2AABH 4UIMA 3CMGA 5HVHB 3SE8H 1RI8A 4ZUWA 3VGGA 5DLML 1OCWL 3RGVC 4KV5F 4AJ0A 1CQYA 4WHYG 4PJ5D 3SPVB 3FT3B 1FSKB 1SMAA 5C6PB 1VFBB 3EO1A 1T20B 5DQJB 5DQDH 3ZKXC 1JHKH 5DD3L 3I50H 1HQ4B 1KJ2L 1Z9LA 2VC2H 4AT6B 5ALCL 1S78D 4ZPVB 2XV6B 3LCYA 5HHOD 1A22B 2PO6D 3BDBA 1B0RB 2VDNH 4MJ6B 4GAGL 4LSPL 1ZLWK 2K9UA 1T83A 3HE6D 4GRWB 2X4RA 5GS2H 3NFNB 3X3FL 5F1SA 1DVFB 5DFVC 4ZUTA 4PRHE 2A6JA 4K8RL 3DXAB 2FL5A 3MV8A 4XXCC 4FABH 4TYUA 5SWZD 3HUJB 1NJ9B 3L95B 4NQUA 2OMNA 5EU5B 3QUXA 3PDGA 3ET9F 3X11A 2J6EH 4LLWB 3ZT5A 5JW4R 3HE7D 3F12B 4OZGA 4UT9L 4DEPB 5E8NA 2JK5A 1G6RL 4JDZA 5CP7B 1U0QA 1QRKA 4H25A 1E4WL 5DJ8A 4FQIH 2Z8VC 4FQLL 3ALWA 1FCCA 4KKAC 5ENWB 4NYLA 4GKNA 1I1AA 5IHZA 2CGRH 3ARGA 4OQ1A 1G6VK 4EN3B 5F7HA 4FNLH 4LVNC 4OJFL 5ANMA 1XH3B 4IRJD 4QOKE 3AVEA 5I1EH 2VXQH 3IGAA 4AIZA 1TPXC 1OWWA 2EDFA 3OAYH 4CVXB 2R8SL 1F11A 1A3RH 2VIRB 3M1BB 2W0LA 5KN5B 5C71A 3JWOC 4MD5A 4U49A 4NWTH 4JZOA 4S0TD 3QH3A 5J06A 5HXMA 1BBDH 2CRZA 3WUWG 3CFCH 4LGPB 4HGWB 3MBEC 4PJCA 1JMZA 1EV2E 4JGJA 1LWRA 4HC1L 4Y4HA 1V05A 3H9HA 4ZQKA 3FFCA 1XR8A 4R97B 2HJKA 4N5UA 5CSGA 3BH8A 5DD6B 3QBTB 4EI5C 5GJTH 5EU7C 4J3XA 2AJUH 3O4LA 1CICD 1VENA 2VLRA 3GSQA 2FJHA 5J12C 1TVBA 2NX5E 4HG4K 1AGEA 3W11C 5F9WB 4B0MM 5D72L 3DI2B 3DVNB 1MVUA 2YD1A 1DN2A 3ETBF 3BHBA 3NZHL 4HIEA 4ZPTB 1B0GB 1CICB 3PGCB 2Y6SD 4L8CB 4WTZA 5IF0A 3LEXA 2Q86B 1FYTE 5EO9B 3L5WB 4OLXL 1ORQB 4TTDC 3B9DA 1D6VH 1MI5E 3KPSD 3QCTL 4G43A 3MJ9L 1WSST 2ZOKA 4H25B 2CSPA 4KJYA 4NC1E 1XF5A 2AEQL 4FZ8H 3MOQA 2MHAA 2JK5B 3O4LD 1ZVSB 5CHNA 1CFNB 4QHNB 1QKZL 1NKRA 1EFXD 4G5ZH 1CGUA 2FECL 1CLZH 1GZPA 2X9YA 1M7IB 5TDOB 3WSQL 3U2SA 3NFSL 4JG0H 1B4JL 4UTAH 4LCWE 3V0AC 5ISZB 5FO9B 5CZKA 1CXKA 2X4RB 3T3PE 1OT1A 3TT3H 3MRIB 3SJVD 3LQAH 5HPOA 3VXMD 5BXFA 4MCYA 2A6KA 1ZHKA 1HHJA 2QR0B 2F53A 5FGBA 1PLGL 4QNPE 4OLVL 1MELA 2I07B 5ISZE 4O4YL 1IGIH 3BQUC 2VSCA 1JPSL 1U58A 4ALAH 4W6XB 4TQEH 1LD9A 1XAUA 4JRYA 3ARGD 4YFDB 5BW7C 4JKWA 3EYFA 4W4NA 3SBWA 5D70L 4KK9D 5DGQA 1AR1C 3OKDB 5E1HB 3HS0B 3PXJA 4PJBF 3JTSB 2DQDH 2YK1L 4QXUH 1FYTD 5FGSA 2JELH 1A1NA 1MJJA 5TF1H 1XGQA 4Q2ZA 3GKWL 5FM5M 1DSFH 1ZT1B 3FAXA 5IR1B 5K9QG 1IC4H 2DKUA 4LP4A 4YO0B 1I1FA 4O51B 4JN1H 4K3DL 3Q6GL 3S37X 2MCG1 1I8MB 2HLAA 1DBKH 4X6CF 4JRYD 3H6JA 2ESVA 4HT1H 3T2PA 2CIKA 4FHBD 2YWZA 3FQTA 1P1ZB 4O02L 2HTKD 1WC7A 3LKPA 3WL9B 4JY5H 2W9DH 3N85L 1A7BA 2A0LD 2LE9A 3ABZA 3U1SL 4OQTA 4K94C 1KUMA 1WFNA 5DDHB 3SJVA 1OGTB 1N59B 2R1WA 1ZGLP 1QPXA 3GSNH 3E6HB 4OF3A 4HC1A 4GG8A 5TGBB 1BFVH 1T5XA 3JV6B 2AABL 2OZ4L 2R0KL 3I6LE 5I1CL 5JO5A 1HCVA 5E6IC 5JDSA 1YNKH 1OQOA 2LTQC 4FQJL 4I18B 2WSKA 3B5GA 1XF2A 4KZEL 1NCWL 4ZFFB 2RFXB 1HNFA 4WEBL 5J6GA 4NZUL 1MAMH 1F58L 4QRPA 4IMKC 2DIJA 4Z78A 1IKFH 1XFPA 4N0FA 2J8UB 3HZMB 1V7MH 4MDJA 4TNWF 5T1LA 1MJ8H 4NQCE 3PP3K 4LHQB 5C86A 1OP9A 4WDIA 3QEUA 1T04B 4JFYA 3BO8A 3VA2C 5IHLB 4CNIA 5FO7A 3PP3H 1EZVX 4Y19E 2XTLA 5I1GL 3LRHA 2QQLL 1ZA3B 4MB3A 5HDOA 4DW2H 1I1CA 4PPTA 2E7CA 2DI8A 1EFXB 3EYQC 3AAZA 1IM3A 2ADGB 4OM1H 3VFTB 2DQUL 2PW1A 4NKOA 3HE6C 5F88B 2W65A 1RZGB 3VWJA 4NRXA 2JB6A 3QUML 2VQUA 2XKUA 4YGVA 2X4OB 2CK0L 1CDYA 4S2SB 4Z0BL 4R8WL 1MFEH 2WANA 4XVUC 1S8DA 4FQXC 5LBSH 4ZUSA 4BQ9A 4BSJA 4IHOA 2AK4D 1N0XH 4AEFA 2P24B 1XGRB 5IWLA 2AJYL 1SVCP 3V4UH 1VESA 5E94A 2P7TB 4QO1A 3BYTA 3CPLA 2IQ9L 1LO2H 4AH2A 1J12A 1G1CA 4KAQH 5C0EA 4KXZI 4JPWH 1OAKL 5D2LE 1JP5A 4HK3N 3HC0A 1V7NH 2VOTA 4KQ3H 5DMJB 5FF6A 2BOBA 3B2UC 4ELKA 5FHAL 3VXSD 3WXVH 4KPHL 4MMZC 1E4XH 1FG2B 4OLZL 4JM2A 2QLVB 4KQ4L 1PDKA 3NMEA 4CADB 3F58L 1H5BC 4GBXD 4GW4A 3X12A 4UT7L 4L9DA 1FZJB 4Y2DC 2LAAA 3SE9L 2EC9T 3MO1A 3E8UL 5ELIA 4R4FH 1EMTL 1R3IL 2ED7A 3HCVB 1H9VA 1FE8H 2HT2C 3BGAA 3MBED 3PGFH 4ZFOB 5I73C 4KK5C 3IS1X 4P59L 1J0ZA 1JPTL 3KVQA 3C5ZD 2VDMH 4WHTB 3RHWF 2OTWA 1T21B 4APQC 2H32H 4CVUA 1JHLL 2DYPB 5CJOH 1T3FA 4Z7QE 4M1DL 3D0VB 4XT1C 1JTTA 2F5AH 1J9CT 1KG0A 2D31B 1BJ1J 2YWYA 4GUPB 4S1RL 2E8YA 5IQ7L 3WHE1 5M95B 5AUMB 1TVDA 1BD2A 4PLKC 4P4RA 3TGXA 3ZE2E 3MRMA 3CDYA 5SWZE 1U8IA 3OB0H 4HCRA 3MRQB 1C1EH 5B4MD 3NVQA 4X6CB 4WO4C 1HQRB 1UWEL 3QUYB 3QCUH 1CVRA 3ILPA 5K9KB 2ZJSH 2EEBA 1VA9A 1BD2E 1U8PA 4ESKA 3EDJA 2ATKA 2FZ3B 5E9DB 3WSQH 3OKOB 5C3TA 4NQSB 3UTQB 2PTVA 2CDEB 1X5AA 1YQVH 1S5HA 3ZT6A 4C83B 4OCLC 5HHMB 4FG6D 4PGDA 5TE7L 3UCRA 4BYHA 4F8TA 1A6UL 1IM9A 3EAKA 2OMBA 4NQXA 4WIQA 1B88A 4ODXA 5JXAL 3QEQD 5KZCD 2VWEE 5DXWA 3SQBA 1OARH 3MNZB 3W9DA 4FFZH 1UKSA 2DLTA 5DVOA 5H2BB 5FHBL 5CEYA 2GUOB 2X4PA 3NCMA 4M4RA 4PRHD 4NJ9H 2B2XH 2YN5A 3D69A 5E8DH 3VFNB 3U7AA 4MQ7A 1MJ7L 3W0WD 3U4AA 1W72L 4EDXA 4XWOC 3HE6A 4FQXA 3DVIA 3QG6B 5GRUL 3TWCL 3V52L 4X9BA 1KEGL 1CE1L 5IM7B 4PJ9C 5IJKC 1Q0XL 1DBJL 2AV7B 1U8QB 4F58L 3O6LH 2CKNA 2DKSA 3ARBC 4ZSOE 3TH2T 2YXFA 4PJ9B 4YR6B 1MI5B 4O02H 1J05A 3OQ3B 2JCCA 4JR9L 5K59F 2W9DL 3P3YA 4R4BB 1OP5K 1RIUH 3ZDYE 3EOAB 4LOUC 4L4VA 1U8QA 3OF6D 4CU7A 4PP2A 3PGDA 3P4NB 3ARZA 3L7FA 2X10A 1T0MB 5LAXA 3SDYL 2YOCA 4JHWH 5CAYB 5EA0L 1IKNA 3QIBB 3PGDB 1MCIA 3MUJA 1HHIB 4XCFL 1NMAH 2FEDD 3S36L 1IQWL 3V4VH 2MCPH 1KB5A 1P7QB 4B7LA 1J05B 3C9NB 4PREB 1S7WA 1QSFA 4WEBH 3S4SA 2BRQA 4K7FA 4YHIA 2BP3A 2X1PA 2UVFA 4XHJD 1PKQA 3DECA 4Q74A 4Q6IB 5MEPA 2NY3C 3SDAD 3TNNB 1ETZB 4EKXA 3I75B 1YEKL 3HA0A 4QRPE 1QRND 5FYJU 3VGDA 3MJ8A 2VZ3A 1P4BL 3W81A 2ADJA 2QQLH 4OLEA 3HAEG 4LEOA 2HAZA 4L8SA 4POZC 2XWJB 3B2VL 4TPRH 3HMWL 1PJ9A 1HSAA 2IPKA 3HNVL 2GUOA 2X4PB 5IKCA 1YNTB 5D93B 3T65A 4JG1H 3QZWG 5J6HB 1R5WB 5JORA 1NFIB 5F96H 5CBAB 4HS3A 3SJVE 4P57B 1S7XB 2WWKO 2CUHA 3JWOL 4CMMA 2X9WA 5EU6A 2BY1A 1UM6L 5FECA 4FFYL 1GOGA 2YMXL 4UOW1 1U41A 1WZ1L 1DQMH 4M1GH 2IPTL 4Z7UF 4QRTB 3WDJA 5ADOL 1UZ8B 1OAZL 4GMSL 4QTHA 4WU5A 5BZWB 5EOCJ 3TPKA 3FO2B 1RJCA 3RPIB 2VNCA 5FCSH 3NIDE 35C8H 4P23C 4CJ1A 4JFOA 5EG6C 4O2CA 1E4KA 4H8WH 5C09D 3QULB 2BFVH 3SGDH 1BWMA 4XCEA 4KQ3L 4X7TA 2QV2A 3NCFB 1QFWL 2H1PH 1JYNA 3QUMB 4Y1AB 1NBQA 4KQ4H 4PJHE 3OKKB 2FH8A 4GW1B 4MHHG 4UOJA 1YEDB 3MA7B 3B2UD 3QXWA 3RVXC 3QUYC 5I18L 3E8UH 4JRYE 2CDGA 1KJ3L 3IDYC 2DJSA 4J12A 4TNVF 3O9WB 5D7LE 3KG5A 3LS5H 1WIUA 4YQXH 3QDGE 4TTDD 4J4PA 1FIGH 2G5RA 3MBXL 4IIQC 2OI9C 3C08H 4PRPE 2AQ1A 2BNRD 5DJCB 2OJZH 1IAKA 4IIQB 2WWMC 4TULL 3WUZA 2X4SA 2NY5H 2NY2C 1IGYA 2Y06H 1AXTH 3WKNA 1DBMH 4LCWA 1CD0A 4RDQF 4X5WB 4K7PY 1OAQL 3DMMC 3MOBL 1EO5A 2NZ9C 3GSWA 3PQYE 1BQSA 2KZWA 2J7LA 4GW4B 5MEND 1I8IB 5HYJA 3EO0A 3SCMA 5FO8A 4LEXH 7FABH 2JIXA 3IDMA 4CN4A 4Z7OE 1HHKA 4OUOA 5IQ9B 4N1HB 3WMSA 5ALBL 4B7IA 1AH1A 1MFCH 3CLEL 2GK0B 5FF6B 2HTLC 1HXYB 2W9LA 1RURH 4JPKL 3MRHB 4IEFB 5F9JA 4QY8A 3QHZH 4YDIL 1U93A 3EGSB 5IMLB 3AXLA 5JR1L 4JO4H 4MA8H 1HILB 3R1GL 3UTZA 2DQJH 2IQAA 4EQ2A 5A3IC 1FYTA 4KK8D 2R1XA 2QADC 4R90H 1EHLL 4AENA 3LIZL 3V4PH 3QDMA 4X8JB 1WCQA 2X4QA 3NGBB 1ZGLM 4HBQA 3UJIH 2VR4A 4PJDA 3CH1B 2NX5A 5FO7B 3V8OA 4QHKJ 5CUSH 3VXNB 3BKMH 1S3KH 3O4LE 1NMCB 4FFZL 4MA7H 4I3RL 4O00A 4I9WD 4LLUB 5EN2B 4FZEL 15C8L 4OI9A 1YPZB 3VWJB 5CJBA 3LS4H 5J6GB 3TZVA 2DLGA 1UZ6F 1QBAA 3ZKND 1MJ7H 3KXFA 5T3ZH 2BNQA 5JO5B 4L1DA 1YUHA 3ZL4H 1WVZA 5D7SL 2XT1B 4QHUB 5DO2C 4HS8H 4C56B 4DGIH 3EOTH 4JKPH 3H9SD 4WWKD 2LU3A 4D3CL 1EEZB 1NCBL 5HGAA 3ROLB 3RWJB 2EYSA 1J1XL 2F74A 4F58H 3O6LL 5TE6L 2Z91A 4H88L 4QRPB 2LU4A 3D2UB 4G80B 1AGCA 3K8LA 5HPMA 3NIFF 1TVHA 4LIQE 4NO0A 3RA7H 2HMID 3KPPB 1KOAA 3QPXH 5C0CB 4UNVA 5GRJL 2VDOH 2ZCKH 5HI5D 4PJ7E 5F1IA 4U3CA 5TF0A 4OGYL 1T7YA 2NXYC 4HFWB 4Y4FA 3DXAD 5JW4Q 4D0CB 1PY9A 2BSTB 4OGXL 4TSBH 3OR7A 4YO0A 3OHXA 3KYNA 2JE8A 1KIQB 1RZIB 2FLRT 3DMMD 3WS6A 4CDGC 4X6BA 4DGVL 1YMMD 1NFDA 1MH5B 1X44A 5DDHA 5HHOB 5FYKH 5C9JB 3O3DB 5F72S 3ROOA 3O3AB 2VH5L 4I2XB 4ZS6C 1LMKA 4HG4J 1FL6B 4PRHA 3C09C 4S0SD 3HTLX 1IC1A 1JFQL 1H15A 5F6HI 1BFOB 3PHOB 1JGVL 1BQUA 3T3PF 5D1QA 3HR6A 4RZCB 5HY9B 5HD8D 5INDB 2VISB 1IEBB 4D8PB 2A77H 5D5MF 5CKGA 2NY3B 1CF8H 2C1PB 3HZVB 3NTCL 3KJ6L 3ALPA 5I17A 4JRXE 4H20L 1F3JA 1A3RL 1K3IA 2EDWA 3JTTA 3FHAA 5DZLA 2FYYA 3L9RA 2N7AA 1MCOL 2HG5B 1BAFH 1C5CH 1T2QH 5DJ0A 3H3PL 1NBVL 2ICWB 1UA6L 5LXGL 1FZMB 2X89A 1HI6A 1EXUB 5JOEA 4QHNA 3BZ4B 3FT2B 5IMMB 2E7HA 3GMRB 2Y23A 5EC2B 5C3LD 4H0GA 2YMXH 4OZHE 1TCRA 4KJYB 1QEWA 1CICC 4W4OC 5F3BA 1DQML 4M1GL 5CJ5A 4N0RA 4M62H 1WFTA 4P2YA 3BXNB 3GMNA 5EO9A 2AJZB 4MCZA 35C8L 4ONGL 4XVSL 2AJ3B 3D25A 4R6UA 1B0GA 5C0JA 4F37K 4KRLB 3U7YH 3KPLB 1NBYA 1I9RL 2BFVL 3WFZA 3C5ZB 3DV6A 5J1AA 4Z7WB 1YECH 1Q9WA 1LP9F 1C16B 4YHYB 2R0WH 2ZP0T 4ZOEA 3GIVA 3QJHA 5DD6A 2AKRB 2ZOKB 2X1OA 3CK0H 3MLRH 3NCJL 1I1AC 3B8SA 1ED3B 5K9OB 5IVOA 2BVOA 2NW2A 4OCRH 1AY1H 1WWAX 1AO7E 4WW2C 1UJ3C 5C0GA 4L8CA 3MLVH 2FH6A 1IILE 1QG3A 2ZNXA 1MVUB 1TJIH 1ZAGA 3UTSE 3KLHC 3DVNA 3BP6A 2NYYD 4FTVE 4GKSA 3CFKB 1OSPH 5HYIA 3WUWA 1E28A 2Q7NA 4DGYL 3GSQB 4PRBA 4PJBB 1JGEA 3DHJA 1Z0NA 1CR9L 3IRPX 5FFLA 3O2WH 5I75C 2VTFA 5EZIH 2GSIB 3FFCB 2EDXA 1DE4A 3V5KB 5FV2A 2NW2B 2C3WA 5IHZB 3CU7A 3I50L 1KJ2H 3T0AA 4LPYA 3E3QC 2AKRA 4O58H 3RWGB 2DQFB 1QA9A 2ED8A 4DZBA 4DUWA 2BNUB 3RY5A 1AXSA 1RUPL 1I7TA 3ARFC 1RIVL 4OD3L 2N4IA 4NO5B 5DHVB 4I5BB 1JNNH 1X4YA 2Q87A 3QZWA 5JIIA 1FG9C 1MCHA 1YNLL 2DLIA 3P11L 5KSUB 3ARGB 3DXAA 2PCPA 1WV7T 3RNKA 4UT9H 4OZFH 5CINH 3JV0A 1IGFL 2FR4B 2DI9A 4LCIL 4Z6AT 4X4ME 4TUKL 4IRJC 3QISA 5AYUL 3U6RB 4JDZB 5T3ZD 4ACPA 4KGJA 4ZUUB 5L9DH 2P43B 4ODSL 5GRVK 1O5DT 2WINA 3TFKC 4QRUA 1OL0A 5DRXA 1JF1B 1FVCA 3MYJA 3D39A 2ICWA 5J3HD 2MKWA 4PJ9D 1NJ9A 4FQHA 5I1EL 3VFVA 4OTXL 1PG7L 4M5ZL 4PJ8A 3PUCA 4WHDA 4NQEA 2R8SH 2A6JB 3L9RB 2HJLB 4ZOCA 3VXRA 3HR5B 2OZ4H 5I1CH 2D03H 4N0UE 3EOTL 2HWZH 5D2LF 3RL1B 4N0CC 4ZNCD 5L0QC 5E2WL 3I6LD 5EOQL 1OP3H 4BKLA 4F7TB 1ERNA 4XBPA 1MREL 1MAML 3GKZA 5E8EA 1OPGL 2F54A 3GSXA 2ZUTA 1T6WA 5FYLL 1BZ9B 2Q20A 2VISA 3OKNB 4BUHA 5JQ6H 2FX9H 5J13C 3I9GL 3C2AL 2FX8L 4PIRF 4DZ8A 4U1JA 5AWNH 3FQWB 1N6UA 5IB1A 1AFVL 1TETH 5D72H 3O3DA 3SDXE 1X5YA 2BY0A 5D9SA 3MPCA 1U8JA 2YUXA 3BZEB 5CJQL 1RZIA 3QEQA 4AEEA 5EZJA 2AAVA 2ICES 5SX4I 5E9DD 1Y0LA 4OLXH 3RNKB 3QDGD 5IBTL 3MZTA 4Z8FH 4GMTH 2HJFA 4NNPH 4ZTOL 3V9FA 4W4OA 3U0PA 4XNUL 2DIBA 3IFPB 3QI9B 4GRWE 5FXCH 1RUMH 5EZOH 1AGCB 5HPMB 1DFBH 5C7XL 2ENSA 2VB5A 2DS4A 4OCNC 3SGDI 2ORBL 4G8FB 3MROA 1QKZH 4XCCH 1NC2B 3U83A 4DCQB 5GHWH 2PTTB 1Z9SA 4GS7B 3MUHL 3QFJA 2XG5A 4ZO7A 4N90D 4JFDA 1P69B 3KYKL 1JF5A 5IFHH 1G7PA 1F6AA 4R3SB 2UYLB 2P5WE 3RHWK 3KLDA 4PD4J 3RI5F 4Y4KD 43C9B 5I76B 1G7LB 4AK1A 3DWTA 5I75B 1YQ2A 4CAGA 5FHAH 3WXVL 3H2WA 2QSVA 1QLRA 3CX2A 5HYQA 5C0BA 1NBVH 2Q6WA 3S34L 3GMPA 4JFEE 3TESA 1FHGA 4LCYA 3HI6L 4EXPX 4OFVA 4DJMA 4Z7OF 5J11C 1EBAA 4XGZB 4QYOA 4TQEL 2ZUSA 5F7KC 4LLUA 5EN2A 1RZKC 1L9NA 4QGYA 2BMKA 4X6DE 2OSLB 4BFEA 4MNQE 5ITBL 4JFZH 2WV3A 1KACB 5SWSA 4YFLI 2DQDL 5CSBA 2R0LL 4P5KA 1DQDH 4IOFC 2X4QB 2VDML 5KSBA 2D7TL 5F71A 1TENA 3IAGC 1EO8H 1SY6A 1ZHNA 1Q9WB 3TBWB 2VSDA 3C5ZA 5J1AB 2NNAB 4K3DH 1MQKL 3T8XB 3MNVB 5GXBB 4NOBA 3RWIA 5HHOE 5JMRA 4HH9A 4R96B 1KCSL 3Q48A 4NC0B 4QRRD 5E6YA 4R0LA 3TIDB 4I4WA 4K07A 4TN9A 1FGNL 3CCHB 2JIXB 1DBAH 3OV6A 1KPRA 4BZYA 3WNKA 3LRSB 1P4IL 5FO8B 5CILH 3PHSA 1OAXL 4OCRL 1QEWB 5C1MB 5KSAA 4Q9BA 1YEEL 3SE8L 1E6JL 1U3HD 5J9PA 4MD4B 1CL7I 4W6WB 4XP4H 3RGVD 5IVZB 3VXQB 1WEJH 2EO1A 2R0KH 4F7CA 2VAJA 2LVCA 1AKJD 3HRPA 1KB9K 2CLVA 3B9KB 4KZEH 5TDNA 3EJYD 4LPTA 4C55A 2HTLD 1NC4A 5IIEB 4BSVA 1F3JB 2EE9A 5C0RH 3PG2A 4OZFA 2I9TB 4HJ0D 43CAA 2X9XA 1J10A 3RJQB 4JANA 2BVPA 3SDCC 1CT8A 1E4XI 4P5TB 5DSCA 2NY0C 5BRZA 4H1LG 1A7RH 4PB9L 2IBBA 1JZ5A 3PWPE 1T83C 3NAAL 1CLCA 4MD0A 1KJMA 1FL6A 5HBBA 4XXCA 4NNYB 1VGEL 5GZOC 1WAAF 4KVNL 4RFNC 5F7NC 1XF4A 1MCEA 4X9GA 3BGMB 3SN6N 1B0WA 5EBMA 4HUXA 2VZ1A 5C0AA 1KIQA 3DNKA 1N64L 3TIEB 2PXYC 2R1YA 3RY4A 2ADIB 3BRGC 4BH8B 4FNLL 2ZZUT 3EDDA 1SYSA 2VE6B 3VJ6B 3UTTE 1RIUL 5T3XD 2FWOB 4GQ9L 3G6AB 5KS9F 2YD2A 4PJHB 5IT2L 3BD5A 3U30C 5I1DB 4XP5H 1MUJB 1KCRL 3G6AA 4GS7C 3R06A 2BNRB 1F8TH 2F58H 3E2HB 5EUOA 1YN6A 2Z91B 4L9LB 4PTUA 4JPWL 1EA9C 3QHFH 5ICXA 4L8SB 1V7NL 4G8GB 4XCFH 2P5ED 2EYSB 2OL3A 2H6PB 1PYWA 2BHYA 1ES0B 3PWPA 2Z35A 5D71H 1MREH 4KK5D 1SBSL 4P2OD 1YUHB 4F9PA 1J1PH 2KDGA 5FYJE 1QD0A 5BRZE 3C6SA 2Z93A 3KR3L 1CFQB 5DEZA 2NY7H 4F57L 2AJSL 2PYEE 2V6HA 3FQNB 3BDYH 4RISL 4DWHA 1MEXH 2VLMD 3LDBB 1IM9D 5ESAA 2LFGA 5TFSL 1RZ7H 1LE5A 5DC9B 2AJXH 4MJIA 2JJWA 4PLKD 4P0DA 4L3CB 1ZANH 4DKEH 2YD3A 2I9TA 3MLSH 5CZVL 4MYWB 4U6YB 4JFPA 1CDCA 5LAXB 1AQKL 1GCFA 4Z8FL 5TDNB 4JPIB 1C7SA 5JW3H 4HQQH 1NCTA 1A21A 4ONFH 3WBDA 3FFDA 2AQ2A 5IVZA 3QO0A 1AIFB 3ZE0F 1OAUL 1U93B 5IMLA 3TPUB 5EZOL 1Y18B 1CTNA 1BZ7A 4LKCA 1WZ1H 3QCUL 1HXYA 5H35B 4JG0L 5HI3D 3RVTC 4RMQA 3IJHA 1OAZH 1Z9MA 3F5WB 3FMGH 5GRYA 2YR3A 5F3HA 4EDWH 3DGCR 3KWWA 1L4IA 1YPZE 5C0FB 4EIZC 4FQXB 3GSWB 1EHAA 1FFRA 4DUXA 1RIHL 4HH9B 3UBXA 1WITA 3SDDD 1S7UB 3TCLB 4GXUN 3RBSA 4HV8A 3KPQB 5IBLD 3QXDB 5ILTH 4QTIL 3NZ8B 2YPLE 3MCLH 3ARGC 5JOFB 2HRLA 2XY1A 1BEYH 5H2BA 3NFPB 4JFQA 1BX2B 3MGTB 4KRPD 4A2MA 5JHDE 4P5KB 5DTFB 2H9GA 3SKOB 5T3ZE 4S10A 3KPRA 2CDGB 4I9WE 2G75A 4GRWH 1NLBL 5C0BE 1DUZB 1Y6MR 4LL9A 1EAPA 4YK4C 1IC4L 4HJGA 1DN0A 1FQ9C 2D7TH 1OM3H 4A6YL 1XF1A 2DM3A 3BYYA 4M02A 3QNXB 3NIFE 3JVGC 5GGUB 2CDEA 3SGJC 5T3XH 2Y06L 1KB9J 4MNHA 3GMPB 5KG9B 1K5NB 2ZPKL 5ID1A 1U8PB 4MQSB 1OAQH 4JFDE 1U8KA 4ORZC 4TSCH 5BOPA 1XR9A 3QFJE 5D1QD 5DRWB 4LEXL 7FABL 1A7PH 2VC2L 3ULUE 4HHAB 4F80A 4U1HB 4X7CC 4YDJA 4JR9H 2J4WL 1K2DA 1BF2A 4P4RB 1P4IH 2ITDB 1QBBA 1UM4H 4OD1L 5DA0B 3QHZL 4RWYL 4G6FD 3I3EA 1E6JH 4KWUA 3TVMD 4OSUH 3T0ED 1KPUA 4OKDA 1YDPA 1CLOH 4NRYB 4PLNC 1KPVA 3DPBA 2IBZY 4TSAL 2JTDA 4UNTA 4DTGL 1DQTA 3FL7A 5C0NC 4OLYL 1ONQA 3STLB 5GGUA 3ULUF 4FQLH 3QEQB 5KZCB 5JXED 4LDEB 4NQTA 3MJ8B 1U91B 5GGTL 3ULVL 4RBPK 1EGJH 3MUY1 2E5EA 4PYHA 1A6VH 4I8DA 1FRGH 5ETUB 1G7IA 3NPZB 2VXQL 1RZKL 1KENL 4LHUD 4PB9H 1P4BH 3OX8B 3AM8C 4KFZC 4PJCF 5GSVA 3S4SG 4PJHF 5J0BA 2I60H 3TA3D 1WBYB 1S7WB 1MHPH 4NWTL 3MRRA 4U1LA 2X4TA 1OT2A 1C5BL 4LSDA 4R8WH 2Q8AL 3SDDB 3VXRE 4KKBC 1MRCL 3GNMH 3MRFA 5LBSL 5B8CA 4FQXD 5KVDL 4JDVB 1I9IL 3RAJL 4MA3B 4MWFA 4GAFB 3DVGB 5GS3A 1JL8A 4QT5A 5F8RC 1CE6A 2WM0A 3VXRB 2BVUA 1LDSA 1NUNB 3G5XB 1GGCL 2CLRA 1KULA 3QQ9D 2WIIA 4ZXBD 5IHUH 3RX7A 4LU5H 5ADOH 4CMHB 2YUVA 5DRNA 1OAKH 5FUZL 1RZGA 3NZHH 4G6AC 4EUPH 1GIGL 1A7OH 5JW5A 5DUBA 5F89A 1P6FA 3QHFL 1WBZB 3D3VB 3QUYD 5I16A 4U6YA 2X1XR 3MJ9H 4BZ2H 1L0YA 2DTSA 5FKPB 2PCPB 1E4JA 5D7JD 1IARB 4R4FL 3VMOA 3PWNA 2FX7H 1ZLUK 4J7RA 2UZYB 1T04A 3AFLA 3IJSA 3KR3H 3GSVA 5T1LB 1ZLSH 4OLWH 5L2JB 2NMSA 3TVMC 2V7NA 3FB7A 1NGWA 4MJIE 1FORL 2AV1B 4DZBB 5D7IF 4LIQH 4PRIB 5IOPA 3VG0H 1KBGL 4HD9A 4H26A 4ELMF 4Y5XB 4GRWF 4LP5A 4G6ML 1T5XB 3STBA 3LQAL 4WV1C 1MCOH 1DE4B 5D4QA 1C5CL 2OL3B 1R24A 3QFJD 2GW5A 4LRNH 1FNSL 1CXFA 1DL7H 5AZ2L 1W0WA 12E8H 3CVHB 3B4NA 4X6DB 4K3EH 2D0FA 3KPNA 3N9GL 3P0GB 1XIWB 3BWUC 1MIML 1HOCB 2FIKA 5J11B 1F13A 3TP4A 4QXUL 2X1QA 4Z5RA 5BVPL 1MWAA 1PQZA 4XWOD 5GQBA 4YDIH 2BVOB 1D5BB 4X5LA 3VWJC 3B9VA 1TTUA 3IDJB 1NGQL 1A6UH 2HKHH 3PWLA 1W72B 4BQBA 3U7YL 1E0OB 4OQTL 5DVKA 5DJ6A 2R39A 3B3IA 4UQ2A 3TYGL 4RGOH 4FMKA 3HUJF 1D9KC 4HJJH 1SM3H 4AEHH 1IAIL 4X6DF 1I3RB 4X7DC 5TH2B 4PRID 4WI7A 5C0AE 2DWDB 3MV9B 4GRLA 3BJ91 3IKCB 2OTWB 4G9DA 5D6DC 1HH9A 3ZKSD 1KB5H 4OZHA 4MVBD 1DVFC 4WJ5B 2D4DA 4D9QE 2RCSH 4ZYKB 5DSCB 2D9QB 3D3VD 4F8QA 3UP1A 5CEXA 1U8HB 5JPMA 3FB8A 5LJYH 2DL2A 1YY9D 4PLOB 2YC1A 5C09E 4ZOAA 5B8CC 4ERSH 2P4AB 4KUZL 5ESVB 2B5IB 3HPJA 4DGYH 5ISZD 5A2IH 1EXUA 3DX7A 1R3HA 3AU1B 2BERA 1YNKL 3FZUD 4IRJA 4LLDB 4BFIB 1ZE3C 1IQDB 4GKOA 1U8OB 5IROC 5EZIL 3RGVB 3QDJE 3SDXF 4TSCL 5HVWA 1IKFL 5HGDA 2ZSVA 3ZKMD 3FCTB 2DF3A 1WF5A 2IH3B 3X3FH 2XRAH 1NMCC 4YHNA 5I8KH 1KELL 5CEXB 4U1GC 2JIXD 4A6YA 5A16A 1RFDL 4G43B 5HYJD 2GCYA 3PIQA 4I4WB 1JYWA 4J2XA 1ZK9A 4R4NC 2J12B 3L5WA 4ZD3H 3S36H 3WDIA 2HKFH 4LCUA 3C60C 1BFOA 4UUJA 5HVGB 3T8XA 1VFAB 2XYCA 4PRHB 5F88A 2P5WB 4MLIA 1JRHL 5C9JA 5DJ6B 5HHOA 4IDJL 1QYGH 1MH5A 1U42A 1XF3A 2H3NB 3MJ7B 4KDTC 4J3SA 3P4OB 1MLBB 4NP4L 5DK0B 1N2RB 4NQCD 5E5UB 1G0DA 4ODSH 1GZQB 4P9HC 3CAFA 4NO3A 3AROA 4PJBE 1OTUC 3G08B 3U82B 4JO3H 4MZ2A 5DRZA 3NTCH 2CXKA 4UAOC 4PR5A 5HHME 5KSBE 2VLKD 1MQ8A 4XGZA 2J8UA 3H8NA 3ZE1E 1CGXA 4OBRA 4NO0B 2PR4H 4MD5B 1A3LH 1VEMA 4QWWC 1QSFD 2VIRA 5F1NB 4MNQA 3IS0X 4OV6F 5C0BB 2Q6WB 4X6DA 1MCJA 4M7JL 1VKXB 4K9EH 5JZ7C 1HYSC 4XP1H 2F74B 5T5NG 4JFHE 1DBBH 2BNQE 5JDSB 1XF2B 2A73A 4HCRH 1MRCH 4XI5C 1DTUA 2CD0A 2H8PA 4HIXL 1UM6H 3WNOA 3RAJH 4JFEA 2DQTL 2A0LC 4NYLB 2H8PB 3GHBL 1RPQA 3ARRA 3MV7E 3KXFB 3KJ4C 2J8OA 3SJVB 2FO1A 1WFUA 3MLXH 1NC2A 3NABH 3CX5K 3JWNC 4LU5L 5F1NA 4YBQD 3ZE1F 2MNUA 4XPHH 4PJDE 3FQTB 5ESQA 3PDOB 4EIGB 5E99L 1E4KC 1F3DH 3QDME 4XVSH 1E27A 1GIGH 3O6ML 2P47B 4LASH 1SEBB 4ISVB 2CK2A 3H9ZA 3VD9A 3B83A 5DJXB 3MV8B 4RX4A 4U05A 4RIRA 1JK8B 4GMTL 4NDMA 4HUKB 5I15H 1MLBA 1U8JB 2H3NA 1CDHA 3P4MB 2R0WL 5DUBB 2FX7L 1I1RA 1G6RA 2BZDA 5D1ZB 3VMNA 2AXFB 1A1NB 1MJJB 3OSKA 3V5DA 3RTQB 2ORBH 1ZLSL 4DKDC 1FIGL 3QEQE 4U1JB 4UUJB 5HYJE 5GHWL 3MLVL 5EZLA 3SDXA 3MTRA 1N4XL 2VXUH 1TJIL 5LG1A 1JYXA 2DJUA 2ERJB 4Y4KC 1J8HA 4YH6A 4LFHD 5A16B 1KBGH 1F4AA 2R69L 3P4LA 5HYJB 3DVGA 4BKLB 2A6KB 2X4UB 2OXHA 2KPNA 4JDVA 3QUXC 2MPAH 2YPKB 4JJHA 4JKMA 5CGMA 2E6QA 1FLRL 1FL3A 3CC5B 3QDGA 3BESR 2BVQB 5DJ2A 3QUZD 1BIHA 2YKLH 1YEIL 3ESVF 3VFVB 1YYLL 1M7IA 1OTSD 3HC4L 5IBUG 2SEBB 5ITBH 2EKSB 2QBWA 2J8UF 1CVSC 1R3HB 5E8OA 1YYMH 2BY2A 5EBLB 3NH7L 3ES6B 4WFFD 5ESVA 4HKZA 3K74B 1T22A 1U91A 5KSVA 2HN7A 3UTTB 2XWTB 1FFOB 4ODBD 1RD6A 3BW9B 5FDYA 1MLCB 1TZIA 3IU3B 1ADQA 4YUEL 3N0PB 3RVVC 5DC4B 3TVMA 1Q0XH 4YPGA 5FM5O 4IOIB 2P8MB 1IGFH 1G9NC 5KSUA 4LVOC 1A6ZB 4KKCD 4K23L 4I3RH 4MA7L 1HH9B 4G8EB 4NKQB 1IAIH 3QZWB 4X4MA 3W0WE 3MV9A 4GRLB 4P48A 1FDLH 1N7MH 5CD5D 3MRKA 2EE2A 3QG7H 2VQTA 3DXAE 5L9DL 1WGOA 3OKEA 4J3OC 3GSNL 2BNUA 4OIIH 1QA9B 3L1OH 5DYOB 3WLWD 4Y5YB 4LCCB 4OTXH 3OR6A 3U9UA 4HS8L 5H94A 1NCBH 2Y72A 1NL0H 2P42B 3RPKA 2ZKHL 1XGPA 3FRPA 4P57A 1UC6A 4JHAH 4PB0H 4WVRA 1HOCA 3FQXA 1NMBH 1V7ML 3VGAB 3GRWA 1Z5LB 2KBGA 5HHPB 4N0YH 4U0QB 1Y6KR 4H0HB 3GK8H 4LCWD 4LPUA 1X7QA 4M7ZC 3NN8B 3IJYB 3TZVC 4EVNB 4FRWA 1OGAA 1DUZA 5JDJA 2XRAL 3O6FB 3C2AH 5JPNA 1AE6L 4UV7L 4GKNB 5D7IE 1QSED 3MRGA 4ZO6A 9CGTA 4NM8H 5A2JH 4Y89A 5KS9A 3UTSA 3SO3B 3V6ZB 5F9AC 1SQ2N 4NPYB 1C16A 3LSOA 4XPBH 4ZD3L 2CJUL 5I1JH 1FJ1A 4YEFA 4FQCH 3FB7B 2VLJE 3MXVL 1W8OA 1H5BB 3UZVB 1EAJA 4P5TD 2CIIB 1P7QA 4U1KA 1G9EA 3JWDH 4U1IB 3L95A 1OF2B 4L4VE 2AJ3A 3D25B 4P4KC 2PXYD 3HUJA 3VFWB 3VXMB 3PWNB 2WP3O 5HD8C 4YHKH 2FL5B 4N8VB 3V4UL 3K46A 4PRAA 3SKMB 3TYFB 3NFNA 1FNEA 5I16B 1S9WA 3P77A 4HK0A 1K8DA 2IQ9H 1YMME 4I0CC 3ILQC 4Q7DA 5IT2H 1YY8A 3CZFA 4H20H 3RVVD 1XGYL 4LHUG 2C7UB 4P2RE 1TFHA 2VZUA 5DRNB 2QSCH 1AIFA 1C7TA 4V2BA 3L3HA 5C6WH 5F7EL 3QO1A 3PF2A 4D2NA 2WIIB 2CO7B 3F58H 3G5XA 4MNGB 5EOTB 5C8JB 5I1AB 4JPIA 5ACLA 4XP1L 1L7TL 2LABA 5KANI 2ARJA 5D71L 3VW3H 5CMAA 2XPGA 4JFPB 4UTBL 3SO5A 2B5IC 3HE6B 4XPFH 4Y2DA 1JGUL 4F57H 4F9LC 4P59H 4MQTB 1MFBL 3FTGB 3T04D 4RISH 1BP3B 2UVEA 2DRUA 4JRXA 4PGBA 5GSVB 4RZCA 5INDA 4IMLB 5CJOL 3MREB 1I8KA 4U3XA 1LE9B 4XCYB 1UEYA 2DQHH 1H3TA 1CFQA 3S5LG 1YECL 3O6MH 2NY5L 3SE3A 1N5YH 2G9HA 2I25N 2PNDA 4P3CH 3RVWC 5JUEH 5SV3A 1S7QA 4FQQA 2VZOA 2APBA 1ES0A 1QZ1A 2QKIB 2FHCA 3VXOB 2VITB 4PRNA 2QQQA 4X6BB 1KTDA 1TNMA 3I85A 2ZUYA 2ZJSL 1Q72L 4PG9B 1UH3A 1SMOA 4MDIB 4J3WA 3UTQA 2W1NA 1J87A 4PJAB 1DBAL 3V0WL 4M61B 4NO0D 2ATKB 2FZ3A 1NFDE 3R06B 3KYOA 5SWZA 4P4KB 4DN4H 1H3WM 2IGFL 3MV8D 1RK1A 2AXJA 3OF6A 1WAAE 3DTXA 1HYRC 1LEKB 2ZOLA 1S7VA 4LVHB 4I0PD 3D87B 2EIDA 3HAEB 5I1HH 1TJGH 3HPLB 1V5JA 2C4FU 2J8HA 1KLUB 2F19H 3TIEA 1TQBC 4PJIF 4U1NA 2BXZA 5DURB 2XN9A 4YDJB 5DK2A 3G6JF 3KXFD 3GSRA 1KG0B 1JRHI 3WIFB 3PQYD 4NKIL 4FQ2H 2WW8A 2A74B 1K8IB 1BEYL 1RUPH 4RMSA 4XVUD 1F4WL 1T21A 3TZVB 2GYSA 3OXRB 3RWHA 2ZG2A 5LCVH 4OF7A 4AIXA 3JV4A 2O5XH 4P2OB 4F7MA 5D7IB 4K55A 3QIBC 1FZKB 2RHEA 3JXAA 4MS8C 5FYLD 2X4NB 4JHBA 1M05A 1T0NA 3NPSB 4KKLD 4I18C 5GRUH 1EAPB 2YUWA 3IU4L 4B5EA 3ZHLA 1KEGH 4G9FD 2Y07H 1AKJA 5E1AA 1FZJA 3QYCA 4DGIL 2H9GB 4JKPL 1J1OL 1P5UA 5T5FL 4OF6A 4J8RA 4EUPA 1T1XA 4BELD 2JJSA 5JHLL 2NTSP 3QDMB 2ZPKH 3PNWB 4M7LT 3V5HB 5D1QC 2FEEI 4XRCA 4CN1A 3I3DA 3GSUA 3CFDB 1HILA 1A1MA 2AEIT 2XQBH 3GBML 3DARA 1N7ML 1BQHA 1S7SA 2WUCL 5AG9A 3G5YA 5DMKA 2FNBA 2V5MA 1PVHA 2PO6C 3VD3A 2Q3ZA 4MAYA 2JF1A 3PL6A 4OIIL 3PNWA 3D0LA 1OY3B 4JKLA 1ACZA 2D0GA 2XWBB 1NCUA 1Q9LA 2NXZC 5IESL 2CKBH 1IJ9A 4P2OC 4ZFGH 2B20A 3CDFA 2V9QA 1QPPA 1JZ3A 1HXMA 3BVNB 3C8KB 1M05B 1H3PL 1T0NB 1ZHLB 1CGVA 4PRIE 1S7SB 3GFUA 2N1KA 4Y19A 5E4EC 4PV8B 1IKNC 3QXUA 5I66A 3PQYA 1QFUL 4N0YL 2VDPL 5DJCA 2FX9L 1TQCC 3BISA 2ADFH 3WDHA 5CEZE 5LGJA 3VGEA 1EFXA 1PZ5A 3ARBA 3E1F1 3IVKA 1FNHA 4ODVH 4FTVB 4HF5H 4UINH 4ZTPH 3QA3A 2X70B 2CLZA 3BWAB 3CVIL 1A64A 2CXGA 4YXHL 3QSKB 5IB4B 5DK2B 3HI5H 4MNGE 4MA1C 5CJQH 4U33A 2CDFB 3VXSE 5GPRA 3HZKA 3UJTH 4W70A 5IVNA 4GO6B 3C09B 4Y1AA 2Z8RA 3L7EB 3MRJA 4NQDD 2C3XA 2EH8L 1SJXA 3H3PH 3MXVH 3JWOH 4S11A 3GNML 3STZA 3JV5A 3LKOB 4C4KT 3ZLQC 3PJSB 2DDQH 1DFBL 5SWZB 3P9LB 5C2BL 4K2UH 4WY7H 4XCCL 43C9A 2IWGA 4PJAE 4QWWD 4XNQB 3O2DL 3MRBB 4Z7UA 5BZWA 2C4FT 3QHTC 4LSRL 1G1YA 2IFFL 5IHUL 1OGTA 2ESVE 5EU3A 3FN0L 4FQQB 5KTEH 3HPLA 3S5LB 1XGYH 4JZJB 2X42A 4K71B 2DLEA 2QHRL 1RVFL 4XNYL 5HHXL 3K1DA 2XIDA 1V3JA 1T1WA 4R7NA 2NY1C 4Z7UE 5F7EH 5IKCB 1CFVH 2H45A 3HI6H 3CSGA 2VE6A 3NCBB 4PJAA 3RTQD 5EU6E 1MFAL 2XA8L 1P84K 1NKOA 1YEJL 3VGHA 3Q5TA 1U8MB 5IK3A 4UTBH 3WJJA 2A6IB 1RU9H 5T1MA 2FHFA 1YEGH 3O4OC 5DD1L 3Q0HA 1XGQB 1JGLL 5D2NC 1AY1L 2NXYD 4PJ7F 1K4DB 2DBJA 4JY4B 4OIBA 4G6KL 4D9RD 1INDL 1P9MC 3VXSA 3WNLA 1FORH 4WFEE 3ARSA 4MNGA 5C8JA 1CXIA 3MREA 1AXTL 2JJTA 5HGHB 3FN3A 4JRXB 4PGBB 4WFHE 5GGTA 2IFGA 1JZ8A 4KI5E 4G6MH 5BRZB 4R7DA 2I07A 3FONA 4DFIA 2LQRA 5ID0B 5FCUL 5BXFB 12E8L 4NSKA 1BOGB 1SJVA 3QWQB 2B4CL 1S7RB 5KANG 5FO9A 4LGSB 5HVHC 4X98B 4XAKD 1NC4B 1F42A 2VDLL 3NOIA 4NQEB 5JR1H 5EB9A 4LNRA 4KY1H 3MYJB 1KFAL 4OD1H 3VWJD 1JTPA 1MI5A 4MXVE 1BWWA 4P23B 1ORSA 5C0ND 4DVRL 2NZIA 1XGUA 3RWFB 3RWCA 3NIDF 3LSOB 2C3VB 1CLOL 4MLSA 1CWVA 2JCCE 3LV3B 5CINL 4RGOL 4JFFB 4CJ0A 4DTGH 2YA2A 2IADA 4YNYB 1ORQA 5GS1A 2HT3D 5AYUH 5BJTB 5IF0B 4LKXB 4KMLB 1OF2A 1OGAB 3RWIB 4U1IA 2OQJA 1K4CB 3TA3B 5JHDB 5D93C 2VXVH 5EUKB 5HYSB 2FB4H 3QQ3B 3FFCE 1EGJL 1X7QB 2RCSL 3RX8A 4C56E 1Z5LA 5HHPA 4OV5B 3OXSB 2O5XL 3U48A 3X13A 2B0SH 4KKBD 4LF3A 1YY9C 1RZKH 4HUVB 3UDWC 3V6ZA 4D0BA 3W9DB 4D3CH 3RL2A 2O61B 2AJVL 4ODXB 4ONOA 2DKMA 2FBOJ 3SCMD 5E7BA 3V5KA 2WQRA 4M8QB 1NGPH 4S1QL 5ACZA 5IP4A 1DEDA 2EDQA 3O3EA 2UV3A 4PJ7B 5DYOA 2RAMA 1OPGH 2PF6A 1XCTB 4U6XB 4LCYB 4OD2B 2APVA 1A7NH 5E9DA 5FM4A 2CR6A 2I5YH 2XN9E 2WUCH 3I9GH 5IB5B 4OGXH 2Q3AA 4GH7B 4G8EA 2ID5A 3FQUB 2HFGH 2P8MA 1CS6A 4ODHL 2AEWA 1G7PB 3S96A 4LSTL 1I1AB 3TVMB 5DF0A 3U9UB 5D7JC 1W2KT 3BW9A 4XCNA 4Z0XA 2PXYB 3KPRD 3PP4L 5DJZA 2DLFL 5DJ8B 4YDKL 4JLRB 2HN7B 1T66D 1JV5B 3OL2A 5CP7A 1XT5A 4F7PB 3D0VA 3MYZA 3EJZD 3MRKB 1T89A 4BM7A 3DV6B 1ZLVK 3RJDA 3ZDYF 5E6ID 1QYGL 3QWRA 1NBYB 5L7XL 2AJSH 3UBXG 4K94L 3FT4B 1X5FA 4FFVD 3SHSA 1B3JA 3KJ6H 4KUCF 2BVQA 5DJ2B 2DJ4A 4Q6IC 3EYUL 2OLDA 3BZEA 3WXWL 2PYED 2G2RA 3MO1B 5DK3A 2XWTA 2P8PB 4MJ6A 1HDMA 2XNAA 1MHHB 5IFHL 4DUVA 1BAFL 5IMMA 4R0LC 3L3KB 1UA6H 2HFTA 4KHTL 1I85A 2BOBB 4U3HA 4ONFL 4F15C 3L5HA 3OKNA 4WEUD 4MAUH 2NY6C 3GSXB 5DT1L 5E8EB 2OTUA 2A6DA 4LSQH 4J4PC 4AH2B 4GXVH 3RTQA 4D0DA 3L6FA 5I9QC 1UCBL 2WAHA 3CMOL 5I17B 1MIMH 3DGGB 3FRUB 1T5WB 5FGBC 2VAAA 3J8F7 5FOBA 1TJHL 1WIOA 4M6NH 3ALXA 3HR5A 2BY3A 2CKBB 3RZCA 3EYOB 2F8OA 4K3JH 3FN0H 5KTEL 4XPHL 1DZBA 2ZSWA 5DC0A 1NGQH 2YD8A 4PY7B 1S8DB 5E99H 5D1QB 3ARDA 1XCQB 3IDXH 5CWSB 2EYRB 3AS0A 2QHRH 1YMMA 4HPOL 2EDBA 5DRXB 1BJ1H 1F5WA 4POUB 5K9JH 4GG6F 2IAMB 1IE5A 3WD5H 1EEYA 3CDGA 5HHVL 3TNMB 3V5DB 1CBVL 3A6CL 4PJFB 4WUUA 5INCA 4NKOB 2NW3A 2AXFA 1MFAH 5D1ZA 5JW4N 2E7LC 1D5ZB 1ULVA 4O5LH 4URTB 4I3SH 5D7JB 4Z95H 4N5ED 1A8JH 1CFSA 2YPLD 1T1YA 1CXEA 3RVUC 2BSTA 2N56A 4JFEB 4NNXB 1S9XA 4G3YH 4HWBH 3EYSH 4PGCB 1IEAA 1UJ3A 1WWWX 1ZSDA 4G6KH 3CFEA 4M93C 4NRZB 3EHBC 4DAGL 1IAII 5DEFB 1E6OH 2R2HA 1WEJL 1TZGH 3GGWB 4NO5A 3NACL 1VFMA 1AO7B 2R69H 5IJVB 1BGXH 1TQBB 2D7NA 1JNHA 4KJPD 4NQCA 4OFPA 4MX7B 2HFFB 1A9EB 4Q9QH 1IZJA 1J0YA 3FKUS 1S9XB 4JQIH 1F90H 1DEEA 4U1MA 3ULVC 1YEIH 4JAMA 4HLJA 5DK0A 3TBVB 3P4OA 4XBEL 1N59A 2AXHA 1P2CB 4UDUB 2M26A 4RWYH 1JWSA 1YNLH 1WC7B 3TNMA 2ZCHH 2VABA 4MAYD 4RGNC 1QBMH 1YMMB 4F2MB 3DUSA 1RHHB 1LNUB 1VGEH 1EX0A 3U46B 2V5YA 3B9EA 4PJEB 1Z0MA 4EBQL 4MXWH 4GBXA 4UILH 3CH1A 3GMLB 3ZYIA 3MV9E 4W68A 3MC0A 4JY6B 6FABH 4PJAF 3H9SA 4WWKA 1V3MA 5KSAC 3MRDB 1X4ZA 2CR3A 2RB8A 3RWDB 2VKWA 1JMXA 1CGTA 3UTZB 1FRGL 1TTGA 2Y7QA 2AGJH 5GRVL 2DBLH 3AXLB 2EKJA 4KH2A 4E41D 3M8OL 3OKDA 4LVEA 4XP5L 1UVQA 3U4BH 1EK3A 3WIHL 3RGVA