2G5RA

Crystal structure of siglec-7 in complex with methyl-9-(aminooxalyl-amino)-9-deoxyneu5ac (oxamido-neu5ac)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
114
Chain Sequence
b'KDYSLTMQSSVTVQEGMCVHVRCSFSYPSQTDSDPVHGYWFRAGKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sialic acid-binding Ig-like lectin 7
publication title The structure of siglec-7 in complex with sialosides: leads for rational structure-based inhibitor design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 29
structure length 114
sequence length 121
ec nomenclature
pdb deposition date 2006-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2g5rA00
3PGFH 3IDNB 1S9VB 4I0PD 4JRYD 3H9SB 2C7UA 2WUCH 4R7NB 4QRQA 3X12B 3O8XA 3C8KB 4G8GD 1II4E 4C56D 3GBLA 4TPRH 4F37K 3MODL 5DJ6A 1HQRA 1YMHA 3UYRL 4ETQA 1OAXL 1U8JB 5D7IB 4M7LT 5F9WB 3JWDH 1A3LL 1ES0B 1JGLH 4MHHG 2CLZB 4Y19D 1CDJA 4Y5YB 3TBYB 4R2GC 2ZZUT 3V5KA 5HI5C 2C4FU 2W9EH 5BXFA 4EXKA 1I8KA 4QRSB 2B0SH 2I9LA 3UJJH 1Q0XH 4OQTH 1CVRA 1DL7H 4TYUA 3R06A 4PJBA 2ED7A 1WSST 4H8WL 2P8LB 4O2CA 5KSVA 5SX5K 1C16B 4HKZA 3HC4H 4JY5L 2FX7H 3IFPA 2A74A 4QTIH 2HRLA 5DJYB 3ZDYF 4NUJA 3LEXB 5FYJU 3O4OC 4YNYA 3OKLB 2HWZH 4TRPL 1D5BB 4UDUA 2EC8A 1QLEH 5IW6A 2MSPA 2YWZA 5E03A 5EUOA 4NQUA 3MLZL 2IPTL 5HYSG 1R24A 3RVTC 1XF3A 1A7QH 1XH3B 4X99A 4I4WA 1XGPA 1UH2A 3ULSA 1B0RB 3EYVA 5HXMA 4WHDA 4UZGA 2Z31C 1BZ9A 2CUIA 5BOPA 1HSAB 1XCQA 5HGAB 4OI8A 3KJ6H 2VUOA 3VXRE 5GJTH 2XTJB 1JMZA 3T0AA 3T65A 2Z93B 4X6FB 1BVZA 43C9A 3EIFA 1PJ9A 1U2CA 5CBEA 4D2NA 1X5AA 4NUGL 5GGUB 3J7HA 3G08B 2IF7A 2BX5A 2NXYD 4I3SL 4X6CE 4PJCB 4UU9B 1U92B 2PW1A 3SDCD 3HG1D 4MJID 3V0VA 2W0LA 3BKJL 2VABB 4ZFOL 3S5LB 4NO0B 2DM2A 3VFWB 1SJEB 5FOJA 5EBMB 5T33L 1UM6L 1ZEAL 5JO5B 2DMKA 4OZIE 4L3ED 3RGVB 4ZPTA 1JYWA 3T4AA 3NCYS 1MCJA 5TQ2H 1NUNB 3NPSC 1NC4D 4CMHC 1JMXA 5CMAA 2EXYC 1BOGB 3WDIA 3VRJA 5L2KB 1Q8MA 1LHZA 5BS0D 1E4JA 4KJWC 4PY8I 3QI9A 1IGMH 5ILTL 3C60C 3BHBA 2XY2A 5T3ZL 1MRFH 4D9QE 2UWEF 3QDME 4HDIB 3B9DA 3RWGB 3S98A 4CVZB 5F9OL 4AG4H 2VDNH 4DAGL 3R8QA 1YEDA 1MELA 4QHNB 5KN5A 5A3ID 2JTDA 3KS0H 4WCYH 1MCFA 5C9JA 3KDMB 3LQAL 2CJUL 3MBEA 5EUKB 4MNQA 3FO1B 4I1NB 3BJLA 3QNZB 4Z95L 3AC0A 2OTWB 1WUNT 3TIEB 5I1DB 3D3VA 5IMLA 3NA9H 1WBXA 4G8FB 4OM0L 4FXLA 4P49A 4G6JL 3OKDB 4OM1L 3IU4L 2F53E 5KSAD 3CSGA 4M8QA 3MV8D 2Q7YA 3RWJA 3OKOB 1BQSA 4P2RA 3UJTL 4ACPA 2DBLH 2VLRD 2NW2A 3LN9A 4J4PC 1NMBH 3IFOB 4Y4KB 2M26A 3EOTL 2G60H 5DRNB 3TWCH 5DJ2B 3NCJH 2ADGB 3B6SA 4HIEB 1J0IA 2Y07L 1DE4A 4WU5A 2KUTA 1ACYH 1IQDA 4ODXB 3TO4A 5IESH 4WTWA 4ZFOB 4G5ZH 4Z7WA 4S1SL 4JY6B 1L0YA 1CVSC 2FBOJ 4NO3B 3RNKA 1H3WM 3T08A 1CBVH 3RVVC 1VFMA 2HP4A 4Q6IC 2GT9B 4APQB 4X0KB 2GUOB 4A6YL 2NX5B 3BDYL 5TDPB 5JORA 1R3LB 5JDJA 2R23B 5L0QC 4MSWB 4XCFH 1BJ1H 1RZGA 1HDMA 5C08A 4EJ1C 3SY0B 4WUKL 1FH5H 1VHPA 1Z9LA 2A83B 4PJBE 1YY8B 3TA3B 2NY2C 4L8BA 2X7LA 2D31A 2N1KA 3MV11 3C5JB 2JELL 2AJYH 1GGCL 3S8WA 4EI6A 1Z3GL 2Y7QB 4OD3L 2IPUK 1SYSA 4NIKB 3B3IB 4OLVH 5GRUL 1G7HA 2VDQH 5EUOE 1A4JA 4OZFB 2VDLH 4XCEA 3DURA 4ZTPH 5CZVL 5TF1L 3SDDD 5JR1H 4F57L 4WI2A 5FEBA 1J1OL 2ZG2A 1L9MA 5HYEA 1CF8H 3S35H 2G5BB 1AR1D 3EOBB 4R0LB 5FUOH 3WS3B 4FTVD 4BFIB 3NOIA 4OBRA 2BOBA 1F58H 4I48B 1MCWW 2Q20A 4HPYH 5H8DA 4D0DA 4G7VH 5TFSH 4R26H 3DMMB 1KENH 3P4NA 3ZDZE 2WIIB 4WFGE 1HQ4B 1QFWI 4YX2H 3F7YA 4PJ8D 3EJYD 5HI3D 1G9NL 1YECH 1U8NB 4GOSA 2GCYA 3O41B 2Z35A 3QIBB 3OR6A 4JB9L 3DYPA 4HKBB 1MJUL 3W0WB 3RVWC 3AREB 4NM4L 4R8WH 4XPTH 3ZYOA 1YYML 3VXQA 4FFVD 4FS0A 4ONHA 1I1AC 1VB9A 1FLRH 3DTXB 2D7NA 1FL3B 1TZIA 5CHNA 1NMCB 4ZDHA 4HV8A 5I73C 1U8QB 4BSVB 2ZOKA 3CFBA 5IR1B 4N90D 4KRLB 5LGJA 1S7WA 2EE6A 1IGFH 3GI8L 4GW5B 4V2CB 2Q6WA 5E8EA 2RAMA 1P4IH 3C6LB 4A6YB 4KI5D 4E42B 5FKPA 3IJSB 4QRPA 2BC4A 4C83B 5EFIB 1VDGA 5I1KL 4GRWH 4YHYC 5KJRH 3S9DB 1D5IH 1H3PH 4ZS6D 3SKOB 3CH1B 4K94H 1SYVB 4FQXD 2XICA 2Y36L 4W70A 4CUCA 2YPVH 2YKLH 3AB0C 4PBXA 5CILH 2V2XB 3TJHC 4OCWH 4PP2B 1QFHA 1JZ2A 4MNQE 2GSIB 3ESUF 4P59L 3PP3K 3DETC 1DLHB 3M45A 3CUPA 5HHME 1OTUC 5EDXA 3KPNB 3D3VE 2A73A 3V7AE 1E27A 1VERA 4EBQL 4Z7UB 5BO1L 1MCOL 3VH8G 5L2JA 1U8OB 3K2UL 1A14H 4QXTB 4DK3A 3V8CA 1WV7T 2FNBA 1FFNA 1I1RA 3IU3A 1BJMA 4OZGA 1Y0LA 5E8NA 1UKQA 4P2RE 2ZCHL 5IF0A 4JQVC 1KJVA 4MZ3A 3U48A 3LQZA 1VADA 4ALAL 4HUWA 5ETUB 4P5TD 4KKBD 4HIJB 2LQRA 1FFPB 3L3DB 5FO7A 3FMGH 4X6DB 4POZD 4UB0H 5BJTB 3LS4L 4UT7H 2PYFB 3D5OF 2O61A 3SGJC 4LSTL 3WIHA 3T3MF 3OJDB 4JM4H 1YNTA 2JJSC 5A2FA 4G6MH 2F54A 2UV3A 3QP3A 6FABH 2BP3A 1G6RH 1MRCH 5HI4D 1YMMB 5DD0H 1GOFA 3MRNB 3ARWA 5TE7L 3EFFB 3SKMA 3G6JB 2EDTA 2OQJB 4M6OL 5HTSA 5I75C 1TPXC 5C08E 2ENSA 4YE4L 5T1DL 4GBXD 3ARDB 4Z76A 2A9NL 4QOKD 1LEIA 3KLHD 1BAFH 5EN2B 1O7SA 4ENED 3MJ8A 1DQQB 4P3DB 3G5VA 4AIZA 3NFSH 5C0AA 3A6OA 5ESVB 5EZOH 3WUZA 1KCRH 1I8IB 2FJGB 4UT6H 2CIIB 1ORSA 4U1JA 1QFWL 4I3RH 4E9LA 5I16B 5IOPB 2EKSB 4NKQB 1ZK9A 4OAWB 1KN4L 3ARGC 2BNRA 3ZTJH 3NIDF 5F7EH 1RURH 1AHWB 1MQ8A 1GHFH 3BAEL 2AV1A 4CU8A 1KTRL 4YHZL 2GFBB 3HMWH 1YNKL 5GJSH 3X14A 2EEBA 2YN5A 3K4AA 2AEPH 4P3CH 2VSDA 3OSKA 5D7JA 2OL3H 5HHPB 3FO0L 1VGEH 1F3DJ 3SE9L 5E2WH 5T3XD 3BSZL 5F1OB 3W39A 3RQ3A 4XH2B 2X4SB 3C8HA 1HE7A 5JA8B 3ARUA 4QXUH 1S7RB 3DUUB 1MHHB 1BFVL 5JNYA 5DMGC 4P23C 2Q86B 2A6IB 3PDDA 1PX4A 3X17A 4N0CC 5AWNH 4UMGA 1MAJA 5IFJB 3U1SL 5DZNA 1MPAH 3Q2CA 4GW4A 1CDBA 4XRCB 4QHKI 3LKQB 4JZJA 1AP2A 1G7IA 4R7DB 3D2UD 3S96A 5F7KC 1H8OA 1U2HA 3CGTA 2KH2B 5DJCB 5CBAB 1UWXK 5DD1H 3O4LB 1I1FA 4QRPE 3KAAA 3W81A 3VRLE 3BYYA 5JOFB 3VWJA 3S34H 4Q97A 2W0FB 4XVJL 3A6BH 2Z4QB 4ODTL 4CMMB 4RFEB 4JREB 2JIXD 4FQQB 1G7PB 4YXHL 3ZL4H 4WW2C 3I6KB 5D1XC 5GIRA 3SKJH 1MVUA 2XWJA 4GKZB 2B1AH 1KIRB 5T5NG 3VI3E 1K2DA 1MHEB 4LAJH 1JP5A 4DGYL 4Y4HC 3PWPD 1RFDL 3LDBB 1KCSH 4L4TA 3EYSH 2PNDA 2AJ3B 2D4FA 1OLZA 2X9XA 4M1DL 2VIRB 1YN7A 4OZGE 3TYGL 2ITDA 4Y89A 4AEFA 1W8OA 2HKHL 4WW1A 2C1OB 3BUYA 3N9GH 5IKCA 4M7LH 2AEWA 3QWRD 1QFWM 1FO0A 3FB7A 4GLRH 4LRIC 1X5XA 5F21B 3ET9F 3MCLL 2GITA 3RTQC 3UDWA 2LTQC 4M5YL 2R29L 4PYGA 4YXKL 5TDNA 3EKCA 3WFCH 1MFCL 4KHTH 4DZ8A 2XQBL 2VL4A 4L9LB 4U1NA 1U8LA 2F54E 3DHMA 4RRPA 5TJWK 4JFQA 3CX5J 1CE6A 1VACA 4DGVL 1ZA6A 3B5HA 2P5ED 2JE8A 3P30H 3KXFD 5D96B 43CAA 1Z9MA 5DD3L 4EDWL 2XQYK 2QJDA 4LSQH 4IDLA 2YPLA 3CSPA 1EBAA 3MV9A 4E0RA 1UZ8B 5FA3A 3WKMH 4HC1H 3HA0A 4GQ9L 3RNQB 4YDJA 4OUOA 4HJGB 5GSRB 2BVQA 5C0CD 5E99H 1A9EB 4X6CB 5C0AE 3MFFA 5JDSA 3BE1H 5DUBB 4MYWB 1ZGLM 3H7LA 4LCIL 5J1SC 2BNRE 3GMOB 4YBLC 4P2QD 1XCTB 4NC2B 1AXTH 4J3SA 4OZIB 1HSBA 4HBCL 4HFWA 4M4RA 5DVKA 3FT4B 4JRXD 5C0NC 4CGTA 1W2KT 5HDQL 25C8L 4X4XA 3L3JB 3SCMC 3ZDXE 4ODUA 2PR4L 3PABA 3SPVB 3RA7L 4L5FH 2ATKA 3MMEB 5MERA 2YA1A 1LO5B 5A16B 4A2MA 4GG6F 3BZDA 3MLVL 1GSMA 3QDMB 3B8SA 1KG0B 4TSAL 1AXSA 5MEOB 3EW3B 3VCLA 4ZNCD 1Q9OA 5MP6H 3TH4T 1JNNH 1FE8H 2IGFL 4PRNA 1WLHA 5D6DA 5J11C 4F9LC 5E8PB 2W92A 1BQLH 1NAKL 3TBWB 4U0QB 1ZHNB 2H2PC 1UB6B 3DX6B 3ILQD 2X1OA 4X7TA 5SX4H 3ULUD 1RUPH 2B8OT 4PY7A 1G84A 2FGWH 2IQAA 4X98B 1FAIH 3BVNA 1INEL 5DC4B 2BMKB 3AM8A 4O02L 1S7QB 2CDGA 4ODVL 4RRPG 4O4YL 2CH8A 5KSBA 4NKIL 4J3VA 3OQ3B 4LQ1A 1ETZB 4YHPB 5EULV 5GRVL 1LP9F 4C59B 4S1DC 1U95B 1H5BA 1FPTH 1IBGL 4U7SA 4NYLA 1IEAB 4LLAA 1MF2H 2J7LA 4MAYA 4NQCE 5AUMB 1CD8A 3LHPL 4XNXL 1XMWA 3KPMA 3MA7B 5TPWL 3GKWL 3PWVA 3V0AC 3C5ZD 4UINH 1JZ5A 1KFAL 1RZFH 3NZ8A 1T89C 3B9KA 1IC1A 3SGDH 2DQCH 4ZFGL 2HTLD 5CKGA 3GMMA 3N50A 4C58B 3DI3B 1BWWA 1A6AA 4F7TA 1ND0A 3CU7A 4L4TE 3PL6D 2G2RA 3O6FD 5BXFB 4RMWA 1I9RL 4U6VH 4MS8D 4GXUM 5FFLA 1HH6A 4JKLA 3MYZA 3I9GL 4HFUH 4O2CB 1SBSH 5DQ9B 4HKZB 1ZSDA 3MOQA 5E6IA 4L9DA 1I8LA 3IJYB 4NUJB 2MCPL 2Q3ZA 1H8SA 4YNYB 5DRZB 3H3PH 5CJ5A 4G7YH 3IXAB 4UDUB 2HT2C 2YSSA 4DJMA 4K8RD 3E8UH 1EO5A 4X99B 1XGPB 1CFVH 1JTPA 4MJ4A 4OI9A 1ROWA 3V4PH 3QUKA 5FXCH 5T3XH 4TSCH 3MROA 2VZSA 4MJ6A 5FB8A 5EU5B 1XCQB 4DCQA 2PO6A 1WZMA 4LVOC 4YFDB 2YPLE 2BHUA 1NCAL 1IZKA 1QBAA 3VXSA 2YA0A 3MV9E 4MXWH 3WE6A 1JL8A 1NBZB 3QIWA 2CK2A 3RWIA 4KZDL 1NUFA 2QR0B 1YEEH 3B2VH 5IHLB 2AEQL 2RBLA 5B21A 4XBPA 3W11C 1QPPA 1NFKA 1SQ2N 2UZIL 5JUEL 5F88A 5F7FA 4HBQA 3BP7B 5ISZA 3OB0H 1ZWIA 1S7VA 2R56L 5HHOD 4LSUH 4AL8H 4N8PA 3MUHL 2V9RA 4POYA 3H42H 4HS8L 1YPZF 1FGNL 4JFHE 4PB9H 4AIOA 2FO1A 5DR5L 1CGUA 4HAFA 3V5HA 4U2YA 1WWWX 1XIWA 4G6FB 1N59A 1QUNA 2QSVA 1KXTB 5BCAA 1B0GB 4OIIL 4TPRL 4KHXH 1ZLVK 5B39A 4WI7A 2F74A 5CEZE 2EC9U 4M61A 3BHBB 5EBWA 3FZUC 3JWDL 3MRJA 2P45B 3DYOA 4RZCA 4UUJB 3AGVA 1JPSL 2W9EL 2VYRE 3NZHL 1FG9C 3KPRD 4HW6A 3GJEA 4ZSOB 3HRPA 5KN5B 2CKBH 5JW4Q 2VN7A 1F97A 4FQHA 1DL7L 1UQSA 4P5MB 3MBEB 3HUJB 3DRTB 5CEYA 4EOWH 2FX9L 2DI8A 5F1NB 5T5FH 3HC4L 4K23H 4KJQD 5I30L 2APWA 3FKUS 3DPBA 4HUKB 3MZTA 1OM3L 4XNQB 3BW9A 4GMSL 2HWZL 1WBXB 3QRGH 1IM9B 1XF5A 1A1OA 3H2WA 3MLUH 2DLTA 1CDIA 4OZHA 1A6ZA 2P24A 3CC5A 5KSBE 2I9TA 5IJVB 1A7QL 1WZ1H 3CK0H 4P4RB 4NWTH 3HE6B 4OLXH 5EO9A 2R2HA 2XTLA 2QHRH 2R1XA 1J8HA 5D93C 1DUYA 2FSEB 3B6SB 4QWWD 3KJ6L 3UTZA 1CYGA 2IWGA 4NQSB 1DE4B 4PGCA 2IG2L 3SQOL 3BISA 4PV9A 1TENA 1MJ7H 4KJYA 4LCYA 2AJZA 4N5ED 4Z7WB 3KHOA 3QQ9D 1QSZA 3NAAL 1UM5L 1TCMA 3ARBA 4JHAL 3RNKB 2WWKO 5FF6B 5J56B 3HNVH 2HTKC 2XZQL 3DV6B 2PYEA 4I18B 2N56A 4I8DA 5D8JH 1RZGB 1A7RH 4LARH 4BSJA 1ZMYA 3MNVB 2ICCA 1OAUH 3ZYIA 2VKWA 3OGCA 3V4UL 3NIGF 4YHNB 1GGBL 4B7IA 4E5XA 5EC1B 2CGRL 4NM8H 3AAZB 4MXVF 5D1ZB 1SYSB 5B39G 1DCLA 5CP3H 2GJ6A 3RKDC 1UXSA 4NFBA 2OJZL 3P2TA 4JKKA 3DX8A 4U1LA 1IGML 1A4JB 4K7PH 3VH8B 3DURB 3RBSA 1LK3H 1OWWA 4KGJA 1YC8A 1P7QA 4KPHH 4M1CD 2VDNL 5EPMB 2X4QA 3RVXC 4X9IA 1UJ3C 2BHZA 2YD9A 4YHIA 1NGYA 4P2OB 4XXDB 2WAHA 4BQCA 5HYFA 1DVFA 1EJOH 3M17B 1KB5H 3VXSE 3WXWL 1SVZA 4NNYA 4MDIA 4NKMB 5KANI 3VWKD 3HB3D 4D0DB 2HAZA 3RIFF 5IQ7H 1NL0H 1ZLUH 3NA9L 4Z18A 1KELH 4JG0H 4IHOA 4Y7MA 2GCYB 4RIRA 1OD7A 1B90A 4TOYL 4EI5C 3Q3GB 5ISZE 3ULUH 5E8DH 4U1KA 3LKOA 5DJZA 4HPOH 2PXYC 1HK6A 2DBLL 2ENYA 2DM3A 5B38A 5FV1L 2G60L 3TWCL 4M00A 4P3WA 2VAJA 3M1BA 2VDOL 3CFBB 4NCC2 4JQIH 5J0BA 1WBYB 4X8XA 5LGJB 5L88H 2Q6WB 5E8EB 2OR8A 2QQQA 3HZKA 1ACYL 2NXZD 5IESL 2HJLB 5D7KE 4QRPB 3ZLQC 3KYNA 3MNZA 4YDVB 1LDSA 4IRJD 4LCCA 5IUSA 3DX9A 1JHTA 3BJ91 4LF3B 1A7PL 4NHCH 2VH5L 1IEBB 4MQXD 5JZ7D 2X5PA 4X9HA 4Z5RA 4JO2L 1DEEA 2AJUH 4CNIB 3QEQD 3CUPB 5FUZH 1O7VA 1FFOB 3MRCA 2AJYL 4PG9A 1P53A 2IPUG 1CQYA 1D9KA 4G6KH 1E27B 3O2WH 5TE6H 5E2UH 4PGEA 2VXQH 5LQBH 2DMBA 2DQHH 1H3TA 4LSVL 4OLVL 1ZXQA 4LHUA 4O51A 3VXUE 3ZKSD 4LPYA 5L2JB 3U4AA 4OZHE 2VDLL 4KK9D 1H9VA 1FFNB 4WFFE 3G5YA 3IU3B 3BH9A 4OZGB 5JR1L 5E8NB 3GUTB 5LXGL 1EFQA 2AGJL 5IF0B 2HLFD 4K8RH 1CL7H 1J8HE 1MNUL 5FGBC 3ULVD 3LV3B 5FO7B 1XF1A 2ICWI 3E3QC 5F8QC 2J12B 4NN5B 2NR6C 4QTHA 4P46D 3P4LA 1H8NA 1RHHB 2W1NA 5CKAA 4NNXA 1KENL 4PRAB 2DJ4A 2CRIA 1YNTB 2F54B 5HGDA 1YECL 3MRIA 2CUHA 2PYEE 5DO2D 1KTDB 3SKMB 1FZOA 1QR1A 1AGCA 3UTSA 2J8HA 3MO1B 2ZNXA 5B38G 3ARSA 4NQEA 1BZ7A 3MLSH 2ZG3A 2W07A 5D2LF 4JGUA 5BZWB 2P46B 2ARJB 3IGAA 1ONQA 2X40A 4XMLH 2R2BB 5F7WC 3BPNC 2W59A 1T1WA 1J8KA 3N0PB 3CNKA 4KC3B 3MJ8B 3DUSA 3G5VB 1G7JA 4EIGB 1I3RB 5D7LD 5C0AB 2GJ6E 3U0PB 5I1CL 2IMNA 1U3HA 1EEUA 1BVLA 4U1JB 2DOCA 1F4WH 5KJRL 3MUY1 4HXBL 2C3VA 1TFHA 5I19H 3VGAC 3RI5F 1EEYA 2YPVL 5TH2A 2YKLL 5CILL 1CFQA 1JWMB 1A6WL 4ZPVB 4WO4A 4WUUA 2AV1B 3MV7A 4V1DA 3QNYB 4ZO6A 1J1PL 5GRZA 2VLLB 2AQ3A 5F6HI 4NCC1 3WFDL 3X14B 1RJZA 3O8XC 3NIFF 4UTBL 2E7LC 4FQJL 1KBGL 3PJSB 5JLZA 1FNHA 2IAND 1BJ8A 3EO0B 4XPHH 2VDML 1F11A 1MIEH 2MQ0A 5MEQA 4Y5VA 2D2OA 4LHUG 4P9ML 3DX7A 4FABH 4HHAB 2BDNH 3PP4L 4HKJB 1AGFB 1A14L 4ZFZA 5I1EL 1EXUB 2BOCA 1M7IB 4F7CB 1CTOA 4UAOC 5CZKA 5DDHB 1YDPB 4JDVA 1T5XB 1X3DA 2OXGA 1RSFA 1J1XH 1ZLSH 4GW4B 1V8HA 1K8DB 4RQQB 1QKZL 4R2GD 4PJIA 1I1FB 4UT7L 3SE3C 5IB3A 4IM8A 1W8NA 4JM4L 3VWJB 2FR4A 5DFTA 1MRCL 4JO3H 1JWUA 4DGIH 2BNUA 2HJFB 5MI0B 1PLGH 2VLME 5ABDE 5GPRA 4GLRI 4PFEA 3T4YA 3AS0A 1T20A 5INCA 5B3JF 1HHIA 3F5WA 3INUH 3RIFK 4I0PB 2XWJB 1FJ1B 2DQTH 3IDYC 1K2DB 2KBGA 2X2YA 3GHBL 2X4PB 2VDKH 4U6HA 1IKFH 4U0RB 4YC2B 2L4OA 2BNQD 3KLSA 3K2MC 5DK0B 2Z31D 4Y19B 3V79C 4K07A 2OX5A 1BIHA 4RDQF 1BWMA 2MQCA 2EDNA 5F7YC 5BRZD 5F7EL 1RURL 3Q5TA 3GRWA 5IKCB 1J86A 1GHFL 2ZUQB 1YEIH 2AS5M 5EOTA 4HS3A 1DBJH 2FATH 3S36H 2GITB 4WW2F 5E1HB 3VXTA 3L3GB 4PGZA 2FJFA 3HE7A 3L9RA 3CFCH 2E6QA 4LVHB 1RIVH 4LRNL 3U46B 2AJSH 4Y2DA 3QI9C 4OF5A 3U7WH 2VR4A 5E2WL 2VQ1A 2MCG1 4BZ1H 2IBGA 3K74B 4DN4L 2DLHA 5CAYB 4JFQB 2Y72A 5GS1C 1VACB 3Q5YA 2I60H 3MOAH 3LN5A 2EDHA 5DJXA 3TNMB 4QHUA 4DVRH 3UTSE 4XPGL 4JPKH 4NQEE 1RJLA 4NRYA 1LWRA 4UT9H 1RI8A 3GGWA 1A3QA 1MPAL 3GHEH 4QHMA 1N7ML 4OLUH 3QG7L 3S4SA 3C09C 3OF6A 3PNWA 3C2AH 1AGDA 3DVNA 4KJWD 5ESAA 3MPCA 4GRLA 3DO7B 1S78C 4OLWH 4L8SB 1MFBL 1JE6A 1FVDA 4XC1H 3U0WH 2BVQB 3V6BR 1IM3A 3MFFB 1Z5LA 3UO1H 2NXYB 2ERJC 3QEHA 3SDCB 3JUZA 3HG1B 3FB8B 2VTFA 3S34L 3KPSD 5CP7A 1QHPA 4XNUH 2OBGA 3VG9B 1GGUA 3A6BL 3RZWA 3I6GB 1RPQA 2WUBL 1E6JH 4WUUE 1KSRA 1Q9WA 4HFWB 4V1DE 4L3EB 2ICWB 4I0KA 5DVMA 4G8IA 1F6FB 4NOFA 5SX4I 3ZL4L 1JF6A 2IBZY 1Q38A 3SKJL 2M1KA 2B1AL 3KR3H 3HAEH 2XN9A 3ZHKA 4M6ML 5FAAA 2ID5A 4KQ4H 4M43L 3OL2A 2DQFB 1QRNA 1S5IH 1QFPA 1KCSL 1N26A 2AXFB 3MLTB 1A7BA 3PUCA 3QQ3B 4OQTA 2BVOB 4MCYB 2ITCA 1Q9OB 3DWTA 1Z0NA 5FYKU 5CUSH 1F3RB 5C0JA 1T4KB 4HF5H 4LPUA 1EGJA 3N9GL 1AJ7H 4QRRA 1K5NA 2HKFL 5F7LB 3MX0A 3NABH 4Z77A 4YHLL 4DKEL 3K7UA 3ALWA 4HMDA 4N0YH 4XNZC 3SGDI 1Q94A 3RVVD 2Y6SC 3BKMH 4YFEA 4PY7B 2UYLB 3HZMA 1A1NA 2X89A 2AW2A 2IQAB 4PJIE 3ULVH 4RAHA 3U0TA 4K9EC 1FZMA 1C5DA 1RULH 3IDJA 4KHTL 2NY1B 3D0LA 5KSBB 3RI5K 4FQIH 3MV8B 4R90L 1YY9C 1YJDC 2NY2D 4J6RH 2APBA 3F6LA 1H5BB 1WIPA 2VLRB 5IMMB 5DS8A 5JW3H 1N6VA 2XQYG 3P30L 2XZAH 3CCHA 4MAYB 3S4SG 3KPMB 2EZ0C 1GCFA 4DW2H 3LCYA 2CSPA 1IC4L 5FOBA 3SDAC 3WKML 2FGZA 2WV3A 1K4DB 1T2QH 3FQRA 1A3RL 2A9ML 2FJHA 3ELAT 4PRDB 5E99L 4F7TB 2KQMA 3BE1L 5M95B 5EIIA 3WHE1 5CJOH 1VEPA 5I8OL 1JPGA 3VJ6A 3O11A 4I13B 4ODHH 4ERSH 3NH7H 1SY6A 1AXTL 2N7AA 3T2NH 4CADB 1IGCH 1C7SA 4M93B 1JGUH 4UQ3A 1BBDL 4ZAKD 3OAUH 3LS5L 5BV7H 2QEJA 2ZSWA 3GMQA 5EOQH 1YUHA 2P8MA 2RFXB 3VGFA 1FYTA 2A1WL 4WWKD 2OR9H 1KXQE 2YSSB 1R6VA 1ZVYA 3TZVA 3KLAB 1HXMA 4Y4FC 3ZE2F 3HZYA 5KVFL 2YUWA 2IBZX 3QR2A 2R2EB 4I2XA 1I1AD 5IHZA 3SDDB 2Z91B 5HHNA 5LGHH 1MIMH 1T1XA 5GRXG 2AXHA 4PJHF 4B5EA 3N1FC 4DCQB 3EHBC 2AK4A 3VRIA 2CDFA 1FE8L 1QSFA 3PQYA 3MJ9A 4YDLC 3OG4B 4FTVB 5FYLE 3OAYK 5FYKE 2JB5H 3NTCH 3UYPA 2NCMA 4MMXC 1RUPL 2CPCA 3TBSB 2XT1B 5D6CA 3VFUB 3VGBA 1OSZA 2FGWL 2QADC 1AQKH 3D87B 1FAIL 1HWHB 4NQXB 3SQBA 1QSED 1R3IH 2SEBA 4PJ8B 1VPOH 3RPIA 4TVPE 1D3CA 1EVTC 5ISZB 3Q1SH 1ZWIB 4GKNB 5T1MA 2NY0C 1S7VB 4NPYA 5DQDL 1R5VA 5D1QA 1YEKH 2IH3A 4MD5B 5ADPH 4WY7H 2JK5A 5IB2B 1CG9A 2ZG1A 1OTUD 3EO1B 2F58L 3QYCA 1JN6B 4BYHA 5SWZD 1BVKA 1K85A 2HT4D 1IGTA 1OCWL 2NY7L 3HC3H 4WWID 2DYPA 1MF2L 4NHUB 5J12B 1H0DB 4P4KA 1TETH 3HI6L 2CDEA 3WO4B 3F7VA 4UINL 2B39A 3EDEA 2XN9E 5B39B 4JPWH 5F7DA 1VENA 2F74B 4C55A 5EBWB 1QRNE 4YXLH 3FCTB 4FMKA 3BESR 4F58H 1RU9L 4B7LA 3HRZA 1UXWA 4FQXB 5KSUB 1HKLL 4PRPA 4N5UA 4W6WB 5C0GA 3G5XB 1KCLA 4QCIA 4PJEB 5JPNB 4HFUL 4ZUUA 1G7LB 5C8JA 1SBSL 1ADQH 3DGGB 4QRRE 4TTDC 5DMJB 1TQBC 4QY8A 3V6OC 4KJPD 4LLMB 4J8RB 3HMXH 1CD1A 1XF5B 3T2QA 4PLKC 4P2CG 3H3PL 1NBYA 3SJVA 1MFAL 5K9QG 3EJZD 2YUXA 2XXMB 3R1GH 4O2FB 4PTUB 1F3JA 1L0QA 4OZ4B 3TVMA 3MJGX 1NDGB 1MJJA 4NO5B 1CFVL 3L5WB 4U1MA 3BWAA 3HPLB 4AMKH 5T3XL 4PJ9A 2ZP0T 3KPQA 5GGTH 2UUDK 1DUYB 2JLLA 5K9KA 4XX1G 1PSKH 1S3KH 5DT1H 1FVCB 4P5TB 4GAJL 2DIAA 1XT5A 5D7JC 4YO0A 4PGCB 4MXWL 2X4TA 2O26U 1KTKE 4HSQA 4PV9B 4KJYB 2AJZB 1KJ2H 4GG6A 3H9HB 4CJ0A 3V0WH 5GRYA 4JAMA 4S1RH 5ID0A 4D94A 3ORJA 1F8TH 2MWCA 1VGKB 2OMBA 1C5BL 3O6KL 1B4JH 3VMOA 32C2A 3IDUA 4K71C 2A6JB 4HIHA 4NWUH 1BD2D 3RY4A 4AM0B 3VD3A 3PHSA 5KAQG 2NY5H 5J1AB 3ZKXC 1DBAH 1MI5A 4PB9L 4YR6A 3OGCB 1TJHH 4GFTB 5HHVH 4HUMB 5CJ8A 5I74C 3QUXA 1MRDH 4GBXB 3CXDH 3HPJB 4E5XB 1RJCA 2Q8BH 1RHFA 5H94A 5I15H 1Z6JT 5FK9A 3RL1A 4R4FL 2Q76A 3U4EB 1P4LA 4RX4D 2CO6B 4KHXL 1OAYL 4YK4C 5I1HL 2LU7A 4M9PA 4HG4J 3T0EA 3DX8B 4LCWD 4P23D 1BF2A 4N0CD 5CLWA 3S88L 3FOMA 3NN8A 4JDZB 4I2XE 2X4QB 3WS6C 1QR4A 4EZMA 4G80A 4YHIB 4H26B 2CKBL 4OSUH 2AK4E 1XR8A 3QIUC 4M7JH 1S7TA 1QSFE 5I1LA 4XX1E 4UTAH 3LD8C 5T5FL 4JFZH 4MDIB 1UYWH 3QISA 2A0LD 3TP4A 2LU4A 2WK2A 1C5CL 1JGVL 2ZUUA 3NGBB 3QRGL 4AEEA 1A21A 2O5XL 5F7MC 4IHOB 5IVZA 5IEHB 2OCFD 4Q0XH 2DB8A 3W9DA 1FC2D 1NQBA 4WGVB 1EIBA 4G42A 5DJZB 3CK0L 5TE4H 1V5JA 5BQ7B 2XTJD 4D0BB 4ORGA 5B38B 1RZ7H 4QHLA 3BO8A 5D1XD 3PHQA 1Q1JL 3FT3A 4ODWA 4Q58C 3LSOA 35C8H 4OCSH 1U8MA 2C1PA 1MJ7L 2ZNWA 4NO0D 5EC2B 3QULB 3NCFB 2VB5A 5DD6A 5C09A 4EN3A 4LCCB 2XA8L 4YBQC 2OMNA 3HNVL 1G6RA 1BHGA 5TGBB 1JHTB 3FRUA 5DMIL 4LPTA 5D8JL 1EHNA 4B50A 4PRPE 1CL7I 2BY0A 4V2BA 2J6EL 4XMPH 1ODAA 1NCWH 2YPKA 4L4VA 1JTTA 3MNWA 5HBBA 4I5BB 2JIXB 4FG6C 1DSFH 4OUUA 2YMXH 4PG9B 2X1WL 4Q9RH 5ITFB 3SJVE 3WSQH 4NBZB 4HGWB 4IOSD 3PWPB 5D70L 2CKBB 3STZA 4DZBB 1LK3L 2H8PB 4HG4K 2MPAL 2XACC 2ADFH 2R0ZL 3GO1H 4KPHL 5IFAH 1YPZA 2XV6B 4Y8DC 2DWEB 4ZS7H 4LIQL 4P99A 1KIQA 5HYJE 1IAII 3BDXA 3WN5C 4KVCL 4U1SB 3TA3C 1KB5L 3VGGA 2YXMA 2I5YL 2WP3T 2YRPA 4LGSB 2J88H 2WNGA 3QPXH 2OL3A 4PRHD 3MBXH 3O3AB 4OLEA 4JFOA 4GG6E 3X3GL 3LKRA 2UWEB 5CZXC 4LFHG 1CZ8L 3FONB 5DQJA 5I1AA 3IJHA 5HGDB 4Y4KD 2F5BL 4WFED 1R5IA 1Q72H 2B4CC 4FFWC 2Q1EA 4LVEA 1FZOB 1HZHH 4JDTH 4U33A 1AGCB 4LLDA 4XHJD 2VL5A 4BZ2L 4HPOL 3JV6A 5DHYA 2GYSA 5D6DC 1BZ7B 2D3VA 2JCCA 3OKEB 3ZT6A 2P5EB 1V3JA 3EYOA 3SCMD 1XF4A 4I9WD 1MI5E 3KXFB 4PV8A 1ONQB 2VLKE 1DEDA 1I3VA 2GY5A 5SWSD 1FDLL 3T0WA 1ERNA 1G7JB 3C60A 4X7CC 3THML 3NACH 3T0EE 1QNZH 1BFOA 2GSGA 2AI0H 5JHDD 5FO8B 5DJDA 3AS2A 2RCSH 3GMNB 1RUMH 2XKNA 4P2QB 1OB1A 1RIHH 3MRMA 3MV7B 3MJ7B 4PLJC 5FM5M 1RZJC 4LLWB 5TQ0H 2AJUL 3AROA 1RJZB 1IEHA 3OAZH 4RFOL 4MA1B 3ARVA 4BFEA 3B9KC 1SM3H 3WFHB 3GRWL 3WUWA 4FFYH 3TGXA 2DQUH 3UZEA 3PWLB 3GK8L 1EAPA 4JANB 2VXQL 5LQBL 1MJ8L 5AG8A 4U1IA 2FO4A 1MWAH 1NGZA 3WMSA 5JW4R 3BMWA 3KYAA 3OKNA 4J4PA 1VEMA 4U1HB 2BOCB 1KB5B 1LEKB 1A7NL 3BD5A 4LVNC 2FZ3B 3O3UN 3D85A 4JDVB 1CL7L 4YHOL 5E6IC 3DV4B 1I8LC 1UKSA 3VFNB 5T1KA 4Z9KB 5CSZA 1OT1A 4S11A 3BQUC 3QIBD 2X70A 1TNMA 2E9WA 3W0WD 4AENB 3CMOH 4Q6IA 4NBXB 5C0EB 3ARED 4S1QH 4CRPA 2WMPA 1P2CB 2ATPA 1OTTC 2BSRB 3I02A 2ZKHH 4ZTOH 1JNLL 2ZSVA 4KK6D 4ETYA 4DUWA 2EDKA 2WQRA 2PO6C 1M05B 1JF1B 4X80H 1T20B 4H0GA 3QUYC 5INCB 4E41A 3UTTD 2C26A 3N85H 3F5WB 4KKLC 4LSSH 4L4VE 1QFUH 3QIWC 1F2QA 1FYHB 2YD1A 4PJ7F 4XMLL 1P69B 4ONGH 4HC1A 1IAIL 1E0OB 1J5OH 3P9MA 1HYSD 5IV2B 3D25A 5K9JL 1L7TH 1M7XA 3FQXA 5EUOF 1CE1H 5B8CA 3AS3A 3JTSA 2XKSA 1S5HA 5M94B 2ADIB 4HS6B 1F4WL 3PL6B 2FBJL 3O6FB 1BX2A 3QWOA 5DK3A 4G6AC 5DWUH 1YPZE 3CZFB 1EK3A 2WIMA 2IBBA 2HLAA 4GQPH 1XIWC 4XP5H 2J8UF 5F93C 3VXTB 2GTWB 4NJ9H 3ZDZF 3L9RB 2VKXA 3WUWG 1CK0H 3QCVL 2ARWA 1XAUA 5E5MB 4HAGA 5DK2B 4OIBA 2P5WD 2VLJD 1GL4B 4PUBH 5GQBA 2P1YA 2Q3AA 4FABL 5GS0D 4KTEL 1T2XA 4YDKH 3RY6A 1AE6L 1B6UA 5EBLA 1LD9A 3LN5B 4YAQA 2JCCE 3QFDA 4QLRA 2EYTB 3CLEH 4X7SL 4EUPH 3S3SA 4X7FC 3GGWB 4F3FB 1AGDB 1NPUA 5ESAB 3O0RL 2Z8SA 1FIGH 4GRLB 4X4YA 4OFPA 1KACB 1YMMD 1CLZH 2W9LA 1FORH 3V5DB 5CP7B 1U3YA 3H7BA 1G7QA 2FLBT 5J6GA 4JFFD 1AGBB 5HHOB 4Q9QL 1E4KC 1NLDH 1PLGL 1CI5A 3ARRA 3MRDA 3MODH 4KXZI 4UDTB 4G8IB 5GHWL 1OAXH 2VZTA 2DQDL 2JB6A 3TESA 3NCCB 3JWOH 3HNTL 2GKIA 1SY6L 3ABZA 1DBKL 3HLAA 3HZVA 4ZO7A 3ARBC 1CXLA 4JFPB 5JOEA 5C3TA 4WU7A 4OKDA 3L5IA 3VMPA 5KTEL 4JLRB 5DJ0A 1QRNB 5I2IB 5C92A 4FQ2L 1M71B 1IAIM 4H8WH 4GKOA 2YD4A 1KPUB 4JQVA 1FNSL 3KPRB 3E2HB 4WENB 5F9JB 4G43A 4BSWA 3NIGE 1MUJA 2LABA 4JREC 2W60B 1P5VA 3VU2A 1EAJA 4OIAA 3G5ZA 4TRPH 4G9FD 3RWEA 1K5NB 5KW9L 1CFTA 3QFJA 2WBJA 2HTKD 3O9WA 3SGJA 2UZYB 3HZMB 3CDGB 4MD0A 3MJ9L 3L5XL 5IIEB 3EOAA 2PN5A 2ICEB 3U7WL 4G3YL 5ELIA 3BZEA 1CDHA 3D0LB 1S9KC 3CLFL 5ITBH 4X5XB 4Q2ZA 3LKNA 2VAAA 2YBRA 1UGNA 4FXGA 4HWBA 2BVYA 4N9GB 1DVFC 4E41E 4WHYG 1AO7A 1KOAA 5D5MF 4UT9L 4NUGH 3CPLA 4I3SH 1AQDA 3TBVB 3RKDD 5EOCJ 2Z8RA 1CFSB 4NZDA 4FZEL 3UMTA 4RWYL 4ZO9A 4OLWL 2LAAA 3CFEA 1UEMA 2OSLA 2FJHB 5T33H 1UM6H 4DUVA 1ZEAH 3RVXD 2P42B 5CJXC 3ARGA 1ZANL 2YD5A 2NLJA 5J89A 4JGJA 5JIHA 3WFBL 5H35B 3O11B 3VJ6B 3VFPA 3O2VL 3QEUB 4ZYKA 4ZUVA 1XGUA 1OAQH 5F3HA 4UQ3B 2AV7A 3OWEA 2QKIB 3GMQB 4JN2B 3GIVA 5HPMB 5ILTH 4YDIL 3P40A 5T3ZH 5F9DC 4IOFC 3VFOA 1FYTB 3KR3L 5EZLA 3LB6C 4DAGH 2F9BT 1D5XB 1EFXA 3TZVB 4LKXA 1J18A 2GI7A 4KQ4L 1S7XB 4OZFH 4WNQA 1V05A 5AD0A 2PXYD 3BKYL 1ED3A 1S5IL 3LQAH 5IHZB 5C6TH 3JTTA 5I8KL 2PTUA 3C9NB 1QBMH 5HY9A 3MV01 3KLDA 1B3JA 4IJ3C 2BY2A 3VRIB 2CDFB 4KRPC 5CUSL 3MRRA 3ARPA 2ARJQ 4HF5L 3PQYB 4I3GA 1OGTA 1P5UA 3EGSA 4IMKA 4Z7VA 3AXLB 3RDTC 3BXNA 3BDBA 4OM1H 1D9KC 1U58A 4EDXA 3VWKB 3BKML 2P44B 4GS7C 5JPMB 4LEOA 4UOW1 5D6CB 4ZFFA 1OP3K 4IIQB 4JM2F 4XWOD 3KPPB 3DXAA 3RPIB 5J9PB 2Y5EA 3EOTH 2XFXA 3VXRD 4IMLA 3MREB 1G9MC 2YUZA 5I6XB 4DOHB 4PJAA 2Y07H 4WW2A 4XPBH 1BVKB 1K4CA 4S1SH 2DYPB 2XZAL 4U6YB 4P4KB 4HWEL 4UI2A 4Y4HA 3F7VB 5IM7A 1W0VB 1NLBL 4A6YH 3BDYH 2WANA 4TN9A 1IC5H 1FGVH 5DI8B 2NXZB 1GZPA 4N0FA 1F6AA 3PV7A 1T2QL 3BGFC 3V4VH 2EIBA 1FN4A 1RZ8A 4GW1B 4LSPL 4IRJB 4NT6A 4HK0B 1ZS8B 4D9RE 1WEJL 4Z0BL 3HRZB 1MCQA 1QP1A 1UXWB 4PRPB 2OZ4A 5E5UB 1ITCA 2J8OA 4PGBA 2JELH 3STLB 2E8YA 4ODHL 1Z3GH 4OD3H 4QCIB 5BZDB 4XVSL 3T2NL 2NR6D 4ZUUB 3RTQA 4PJ5A 4O00A 3OAUL 3T1FB 3FQUA 2H1PL 5EOQL 3QDMD 3QFJE 2F8XC 1EMTH 3L3HB 3CZJA 5CZVH 1CD1B 4F57H 2HG5A 1U3HC 5CP3A 4LKCA 1J0HA 5ANMB 4OFYA 1SMOA 1J1OH 4FRWA 1WCBA 3U7YL 3VD7A 2ZUSA 5FO9A 1NAMH 1WWCA 4PRBB 5T1LD 5F1KC 3TVMB 2FL5B 4U3CA 1MJJB 4WO4C 3LMJH 4OKVA 1X6LA 1CLOH 3BWAB 5LGHL 3LPGA 5GS0H 4PREA 1KEMH 4ZXBA 5I76A 1AO7E 3NIFE 5D2NA 2MJWA 2Y06L 2D0HA 5F96L 5T5NF 4DEPB 4YO0B 3CDYA 2VQTA 2X4TB 1G9NH 3V9FA 2F53D 4FQCL 2KKQA 5E1AA 4GG6B 4P46B 2JB5L 1CGWA 3I75B 3NTCL 4Y5VC 2A6KA 1MJUH 4JAMB 4JPIA 1PFCA 3IT8D 4NM4H 1YYMH 2BVUA 1F4HA 5D7IF 1K9TA 1WC7A 2AP2A 2R4SL 4XPFH 1T80A 5E08H 4JFDA 3Q1SL 2VXUL 32C2B 5LAXB 4JJ5B 1JPST 1YEKL 1T5WB 5ADPL 3O8XD 2JJVA 1DQLH 1JZ4A 3MTRA 3U36A 1Z2KA 2IH1B 2E9IA 4H0IA 3LEYL 5I1KH 1OGAA 3GSXA 2Q76B 1RUKH 5GRJL 2Y36H 4HMCA 4OCLC 3WL9A 4IOIA 3T0EB 5D7LB 5I18L 5KVMC 2D9CA 5ICXB 3FOMB 3GZKA 3SO3C 3GSRB 2J4WL 1CXKA 1LP9B 4Y0GA 4P59H 3FN3A 3H3BC 5B3JE 1UCTA 4GUPB 4R4NC 3FFDA 3V6ZA 4F9LA 3ES6B 1KNOA 1S7TB 4RNRB 5I1LB 1O5DT 4Z7VE 4EBQH 5C6PB 5BO1H 4N8VB 1MCOH 3PV6A 1LE9A 4IRSA 3K2UH 2EDFA 4QXGL 1B0WA 2IANB 5BW7A 4OB5L 3U6RA 1U8KB 5IVZB 4G9DA 3DXAE 4I0CC 3TV3L 4MMZC 3W9DB 2AAVA 3R1GL 1SJXA 4ALAH 5DEFB 1MHCA 5FM8A 3IETB 3X13A 2H6PA 3RGHA 4PJAE 1A7OL 4QHLB 1KEGL 4MVBC 3RL2A 1FIEA 1MFNA 1W72H 3LS4H 4ODSL 4WFGD 3TH3T 3HE7C 1TVHA 5IGXH 4ODWB 4UIKH 5DT1L 1DUZB 4B41A 1I7UA 1U91B 4Y2DC 4L4JA 5GZOC 3IS0X 4Z8FL 4NKDA 2C1PB 3NBNA 1UT9A 3JV4A 1KJ2L 5E2JA 5IK3A 4R2GB 5C09B 5TE7H 4LPVA 3MRBA 3ZT7A 5ESQA 3V0WL 4NQDA 2VZOA 4S1RL 4M6OH 4L3CB 4OGZA 4XB7A 1CFNA 4YE4H 1F8TL 3FRUB 4PJHA 3O2DL 4YUEL 5C0CE 5ICZB 2Y25A 3TT3L 2A9NH 5F6IC 3TO2A 1DDHA 2YPKB 1DBAL 2NTFB 4PJ5E 1T83C 1WIUA 3O4OB 3IDMA 4HH9A 4RGNE 3QI9D 1ZT1A 4OUUB 2YXFA 2DQIL 5HHVL 1G9EA 1N0XL 1QYGH 3CXDL 5EU7E 3OBAA 3H0TA 4KY1L 5DRWA 3BGMA 3QXDA 2BNQB 2QL1A 4WVRA 5H2BA 5MHSE 3BAEH 1BLNA 3MBED 5C2BL 3LZFH 4MXQC 4MNQD 4YHZH 2Z31B 1JTOA 2AXJA 3QHFL 3HNSH 1DANT 1ZHBA 4LAQL 5HHMD 3NCEB 3WIIH 1S8DB 3BZ4A 1KIQB 1ZTXH 3D3VD 4OSUL 5IB4B 1T1YB 2XPGA 5D2NE 1S78D 4KAQL 4M7JL 5HD8C 4F7MB 1DQDL 3BSZH 4K3JL 2HVKA 3ROOB 1HNFA 4JFZL 3ZTNH 3WDHA 3CDCA 4S2SA 3JWDC 2BVEA 4JZNB 5K9OA 1WWBX 3IB4A 3LKRB 4P2RD 1ZA3A 3VMNA 2AKRA 1AC0A 5DQJB 5I1AB 3IJHB 2F15A 3GSNL 2RR3A 4YFLF 3MRFB 3U1SH 4JFDE 3BWUC 3QH3A 2PTTA 1W0WA 3FO9A 3JV6B 3C5SA 2EDLA 2XRAL 3HI1B 3TN0C 4UBDC 4Z7OE 3TO4D 3NPSB 1XF4B 4IBLT 4CMHB 3WNLA 3OR7B 2APFA 2DS4A 2OP4H 1OGAE 5DHVB 35C8L 1PVHA 3K80A 4HLZG 3C60B 1U8PB 4XP4L 4XVJH 1UCBH 3K0WA 5MENA 4KKCC 4LL9A 4P48A 3U2SB 4ODTH 5C08D 1BFOB 3IDGA 1K8IA 1J88A 4DQOL 3F12B 2VR9A 3VXMA 4YXHH 4ORZC 1YEHH 3RUGE 5INDB 5JIKA 2XKNB 1AKJA 4JFXB 4MJ5B 4MD4A 1QQDB 3MRMB 4MCZA 3C08L 3UTQA 2H3NA 1NCWL 1XGRB 4MA3A 4DGYH 3S6CA 4AT6B 3PF2A 1DSFL 4AK1A 1EHLL 1T1ZB 3MOBL 3BD3A 2YMXL 1X4XA 2R1WA 4HWNA 2CQVA 3TYGH 4U1IB 4JGMA 3FB6B 3OKNB 2RB8A 1X5IA 1CIUA 4JN1L 1QEWA 2H9GA 3PDGA 3MCLH 3WLWC 5E00A 4PRIA 1P7KA 1MCEA 2EZ0D 4RMTA 3BI9X 3G6AB 1FRGH 2R29H 4MA7L 4YXKH 2K7QA 2NY6C 1XF2B 1JPTL 1XGQB 1MFCH 5I0DA 1NFDA 1E4XH 5T1KB 1FQ9C 3KNBA 5CSZB 2EIZA 3GSNB 1BIIA 3RKPA 1KLGA 1AGEB 2J88L 1BFTA 4F33A 5KVGH 4Q6IB 1QSVA 4XI5C 4DGVH 3ZE2E 4NQDE 1JPFA 3REVB 4H5SA 2CD0A 4MQ7A 5L0QB 5DD3H 1AI1L 1JUFA 2ZSVB 4PJHE 1Q72L 4XNMA 2J5LB 3CSYA 1HZHL 4KK8C 3TT1L 4JEGB 2NY2B 3EYFB 1OWRM 4BUGA 4E41B 4ZODA 4GQ9H 5B4MD 1HN1A 2HRPL 4J3XA 4QRPD 3FQNA 1JZ8A 1INQB 2MHAB 1P6AB 4X5WA 1JNHA 3ARFA 3P73A 5FV2A 2IPKA 1T3FA 3P9MB 4S0SD 3DVGB 4LCIH 5JW4M 1MCLA 4PLOB 1HHKB 1JHKH 1YEFH 1S5HB 1QNZL 4HJ0D 3MLXH 5D1QC 5K59F 1TZHB 3QWOB 5MEPA 5EB9A 7CGTA 2ADJB 5HDQH 4CDGC 1RUML 5B22A 1YQVH 2IAMA 2PR4H 5FUCE 3RA7H 1UH4A 4OGAC 1FNEB 3PDOA 5JQHC 4NNPH 3MLVH 3KJ4C 4BK5A 3CFDA 1OF2A 4XCYA 1SM3L 1MCDA 1NBVL 1PEZA 2DQUL 3DARA 1IMHC 4R3SA 2NY0D 4EI5A 3GMLB 3SEPA 1D6EA 2EYRB 1KN2L 1RUAL 1WJ3A 2DL2A 2X4UA 3BEWA 3VDAA 1QACA 2IGFH 3MRLA 1KIPB 5FECA 5EBLB 1PD6A 3MXVL 1I1AB 1NAKH 1IT9L 4PJGA 4U3HA 4YAQB 1X7QB 3MUGA 3QXWA 1Q0YL 5I73B 3QFDB 3KWWB 5ICYB 5CGYD 3P0VH 2YD7A 3QXUA 4NZUH 3UPRA 3WYRA 1INEH 4O02H 2F54D 2FDBP 4HWBL 3BRGC 2PW2A 1OW0C 4ODVH 5ACMA 4O4YH 3ME0A 4YHYB 2QSCL 2XG5A 4NKIH 2WLZA 3L6FB 3BIKB 3RU8L 1GAFH 3CMOL 5A1AA 3W5NA 3KPLB 4MB4A 1ZLWH 2E9JA 3AB0B 4GKSB 4HZLB 3S3JA 5D7SH 3VXME 4BKLB 3H7BB 1G7QB 3PWNA 4PJ9C 4ZTOL 3PHOA 3LHPH 4GRMA 4XNXH 5TPWH 1H3GA 3G6DL 4MB3A 5DTFB 4Z78A 2V5SA 4X80L 4NZRL 4U6TA 5J3HC 5FA4B 2Z92B 5C0AD 4ZFGH 3C87A 1JK8B 2QSTA 1QO3A 4PLKD 4XMKH 2OI9C 1R3JA 4L29A 5IFHH 1CFBA 5F7UA 3BEVB 1L4IA 4JCLA 3WHXA 3LKSB 4WU7B 1L7TL 2BVPA 2BNRD 5AYUH 4XPAL 3CVIH 4KUCF 3QDJA 1DQMH 4OZHF 1CE1L 4JZOA 1IZJA 4Y16C 3I9GH 2BHYA 1VCAA 4JHBA 1WFTA 2GJZB 4PJXF 5D2LB 2HYMA 5IWLA 1OAZL 5DWUL 3GB7A 2MCPH 4HWZA 1FNFA 4PRIE 5FGBA 5D7JD 4MB5A 4BSWB 5ADOH 1MUJB 1RIUL 3QUXC 4XP5L 4BK4A 1NFDE 1NJ9A 4UIMA 3QFJB 3OXRA 3UBXA 1IC7L 2YWYA 4QF1A 1NSNL 3QDHA 4YPGA 4FQPA 4K94C 3BZEB 2YC1B 1UZ6F 1IAMA 3GSUA 3WD5H 2FEEI 5I75B 4NCDA 1TPXB 2K1MA 2Q8AL 1JCKA 1NCAH 4X8JA 5J6HA 1MSPA 4OTXL 2AEQH 2MOVA 3HC0A 5DEGA 3RHWF 5A40E 5GGRB 1U8HA 4PY8J 5AZEL 1N6UA 1AQDB 1EVUA 5DSCB 4PTTA 3K46A 3VWJD 1FIGL 4AY0A 1BBJA 4KWUA 5DC0A 3REWB 1JV5A 5GGVY 1G0YR 1ZT7B 2PUQT 3FFCA 1GIGH 4RWHA 3ARGB 1H3VA 4HS8H 4XCCH 3IAGC 4YGVB 3EDFA 1FORL 5DR5H 5GGSB 3VFPB 2JF1A 2VE6A 5I71B 4N0UA 4ZYKB 4HEPG 1BD2B 1NLDL 1S9XA 3HR5A 3GSVB 1HHHA 1PW3A 4HK3J 2VXTH 2R0WL 2CIKA 4OIIH 2OS7A 2E7LA 1ORQB 4OV5B 4EQ3A 1HIML 3GIVB 3JWOL 4P57A 2GK2A 5I8EA 2NY4C 4EN3C 4L8DB 1JPSH 3NZHH 5EZLB 2B1HL 5JMRA 1J9CT 4LCWB 4P23B 3IKKA 2FX9H 4CN4A 3JTTB 2BRRH 2IALB 4PJGE 3K81A 4NRZB 5I30H 4PLNC 1ZGLP 1OM3H 3MRRB 4RBPK 4PJ7A 3RWCA 1KCKA 3QDGA 4GMSH 1OGTB 1WFNA 3TJEH 4NO2A 1D7FA 1MEXL 3ZKMD 4EDXB 3UBXG 3HMXA 3SE3A 5DUPL 1ZHLA 4ZFFB 2CLVB 4J1UA 4KMTL 5C86A 5CIPB 3QUML 1LO2H 5ID1A 2XFXB 2K9UA 2Y5TB 3B8YA 5E9DA 2HFGL 5ITBL 2YPLD 2EEDA 2W65B 4EUPB 2WINB 3MV9D 2GK0A 1JHLL 3X3FL 4FG6D 2VUYA 5GGTA 3SQOH 2IG2H 4LMQI 5E6YA 2J8UA 3FO2A 4WW2B 2GHWB 4J2XA 5D1XB 1K4CB 5A3IC 3MA9L 3NAAH 1UM5H 4JHAH 5IB1A 2JKXA 1OARL 5HVHC 5IVXA 4Y4HB 2XZQH 1KF9B 4K3GA 4N8CL 3F58L 1HH9A 2KL6A 5GSVA 1S7SA 3RWHA 2VO5A 4K2UH 3QDJE 3AU1A 1FN4B 3DLQR 1QRKA 1WT5C 3QB7C 2J1KA 4JFHD 5F7NC 4NT6B 3WEXA 4RAVA 3U83A 3V4UH 5KSAC 3VFRA 1GGBH 2FEEL 3GDBA 4MNHA 1R3HA 2CGRH 2DF3A 4WEMB 3RTQB 5E8OB 5DLML 3E3QE 1OAQL 1MCHA 2LTQB 4OJFH 5CEZD 1A2YB 1NH6A 2OJZH 5CZXD 2B2XL 1R5WA 2E27H 1N3NA 4MQSB 3ZE0E 2XWTB 2HG5B 1JZ3A 3BMVA 1YNLL 1RUQL 1N5YL 1FAKT 4FFWD 3RWFA 3WLBA 5BVJB 5FO9B 5GS1A 4HCRL 2FHCA 3QXAB 5C07A 1KGCE 2NNAB 5AZ2H 5I1GL 2YUVA 5C6TL 1NC2A 2YEZA 3OG6B 3RRQA 3WXWH 5F89B 1QBML 4ZUWA 1I1YA 5EH1A 3VW3H 2DICA 4HUUB 1TIUA 2AABH 5IP4A 2FIKA 3OZ9H 4OD2A 4EEEA 1C1EH 3QUMB 2NY1D 4TOYH 4PJFF 2WZPD 4HMEA 4Y5XA 5L6YL 4PRHB 5C0BA 5FYJE 2A6KB 4U6XB 3WIHH 2OTUA 1UJTA 3FFCE 4CVXB 2FRGP 3UAJD 4YBLB 5HDBE 4F7EA 4JFDB 5GISH 3DBXA 4MAYD 3OJVC 1G6VK 4PLJD 3MC0A 2VDOH 3M8OH 4N0UE 4BQ6A 3IFNL 1UA6L 3B9KD 2CRMA 4XPBL 3SCMB 3L3KA 1BQHB 1AR1C 3NFPB 4ZUTA 3MFGB 1OGAB 3GSXB 3GJFB 4L1DA 4KKNA 3VGDA 5EU3B 3MCKA 5SWSB 3RJQB 5JIPA 3WL9B 1A7PH 1IC5L 1FGVL 4NJAL 1JIBA 2VH5H 4MJ2A 5EU4B 5HVWA 3K4DA 1NEZA 3V4VL 2XXCB 3JVGA 3QG6B 1KPVA 5FM4A 4QGTA 4IRZH 3GKZA 3HCVB 4JO2H 5TDOA 2X9WA 4XZUA 3DYMA 3NFNB 3LN4A 3UPAA 1U8IA 3S37X 5E6ID 5J7CC 5JHDB 4NRXA 1UACL 3SGKC 5D5MA 3RHWK 5J11B 3FFDB 4GG8A 3EYUL 3QUZA 4PJ7E 3NA4A 3QDGE 4FFVC 2VITA 4LSVH 3E6FB 3VXNA 5E94B 2QQKL 3PV6B 1A64A 2D7QA 4PJIF 4R4BA 4UQ2A 5ALBL 5ACLA 1EMTL 2NTSP 1UFUA 5B8CC 1NUGA 2QTEA 5LXGH 3U6RB 3H9YA 2AGJH 1QBLH 1DQJA 3OJ2C 1NAML 2PO6D 1MNUH 4NFCA 5FDWA 1MHCB 5E9DE 3FQTA 3VXSD 2YS4A 4KKLD 3IFLL 4ZS6C 2H6PB 5D9SA 3QIWD 4RAUB 4CJ1A 3LMJL 5E7BA 1CLOL 3ILPA 2EH7L 1OP5K 1A6TA 3RL2B 2J8UE 5EO0B 5GS0L 5AYQA 3SDXA 4CL7A 1KEML 1LK2A 3V7AG 2BJML 3SDAA 3RZCA 4C4KO 1I7UB 3VE0B 2DKMA 3PIQB 3Q6FA 5IVXE 3VDCA 5L8JB 3VFSA 5ISZD 5C0IA 1T21B 4YIQB 3JV4B 3MRBB 4HLJA 3RY6C 3ROLA 1QHOA 2NZ9D 4XPFL 4OGXL 4HKXB 3TLRA 4PJHB 5E08L 3UZVB 2XOTA 1LMKA 3QO0A 3O3DA 2H41A 1EUTA 1XIWD 3MLWL 3OHXA 3VXOA 2IFFL 3EDKA 1TVBA 2P7TB 1PZ5B 4WJ5A 5D7KD 1AFVL 3UTTB 2NYYC 4HH9B 1DQLL 2B5IC 3T1WA 5I1CH 4QRUB 3HR6A 1MCRA 3IF1B 5DMKB 4JM2A 5SWZA 2CR6A 4XTRD 3T8XA 1AXIB 4HXBH 1CICA 3MGOB 1RUKL 3EZJB 1M6OA 4Y4FA 4POZC 1NEZG 1A6WH 2HVJB 1NBQA 2DQEH 5C07E 1J1PH 1ZHBB 4EIZC 5JW5A 5GGRY 3WFDH 4MNGA 4HWUA 4QHKJ 4UTBH 4LVOB 4FQJH 1KBGH 4XP1L 4GAYA 3T77A 2ZJSH 3T04D 3L95B 12E8L 1KPRA 2BSSA 2VDMH 1PKQB 4P9MH 4KUCD 4NSKA 1NAMB 3PP4H 4WFFD 3UTPE 3TPUA 3KLHC 2HT3C 5C0BE 2XY1A 4MHHI 5I1EH 2UVEA 5GGSY 4CW1A 2P5WB 1MWAA 2VLJB 4X4MA 4LLQA 4MGXA 1J8HD 1DZBA 1JWSB 4KDVA 1I7TA 4ZUSA 2NY3C 4TSBH 1NANH 2RJMA 4YH6A 5HYQA 2EYSA 3FO9B 2X4OA 3QO1A 3C5SB 3WBDA 2HN7B 1QKZH 1HHJA 2M8XA 2W0KA 2DIJA 4LEXH 4M6NH 3ARBD 1W72L 4XGZB 2WBJC 3EDJA 3EUUA 5IGXL 3B9AA 3O9WC 5DJAB 5KZCD 4UIKL 4JFEA 2PYED 3FQWA 4L1HA 1MLBA 3MRHA 1CR9H 4NC1E 2G9HA 1I3GL 2P8PB 5MENB 4EQ2A 4OLZL 2R9HD 2H2SD 3QEGL 1K8IB 1KJMA 3ISWA 4HX1A 3QQNA 4TUKL 1FBIL 1I7ZA 3MRKB 1NGWA 4QYOB 3B9EA 5D5ME 4JFFB 4MCZB 3UTQB 3IDNA 2H3NB 1S9VA 3GHBH 3V6OA 1E4XI 4LHQB 2GJ6D 3H9SA 2IADB 4R7NA 4NN6B 2R0KL 1QYGL 1RVFL 3BN9D 1P7QD 2EO1A 5D7IA 4W6XB 4XVUD 2CXKA 2CLZA 3TBYA 3ZZ1A 1U6AL 2EDYA 4JY4A 3I2CL 3QXVA 1HEZB 1CD0A 1N64H 1GPOL 3LZFL 1DVFD 4QRSA 2H9GB 2IC2A 3HNSL 2B4CH 5D93B 4QEGA 4EVNA 5E00B 2IJ0C 4PRIB 3WIIL 3HS0B 4UOW0 1RK1B 3VXPB 1ZTXL 4LRNH 1C16A 3IKCA 3SDXE 1GC1H 5KS9B 4G9FB 3PWJB 3ZHDA 2EIZB 2EIDA 3LH2L 3OKLA 1KLGB 3ZTNL 1BP3B 1SEQH 4DN4H 1NKRA 1D5BA 1T22A 3MGAA 2XA3A 1PYWB 2CRYA 3WIFA 2E6PA 1WZLA 4UV4L 1QOKA 4H5SB 4XPGH 3O6LH 4MQ7B 4BM7A 1JUFB 3UC0H 5DJ8B 4XNMB 3HI5L 1W72B 4H20H 1N7MH 1X5JA 1TJIH 3QG7H 4O2EA 1H15B 4W4NA 1HSAA 4PGDA 4R97C 3KGRA 4IMKC 1MFBH 4IOFD 3EYQD 3JXAA 2WWMD 1T3FB 2OP4L 5SWZE 5GGUA 4F15C 3G08A 1CU4L 2AXGB 4PJCA 1UCBL 3MACL 2VLMD 5CS7A 1RZKC 2H32A 2WUBH 4J23A 5B3NA 2VABA 3WS6A 3S5LA 1UJ3B 1SJEA 4KRPD 5C0DA 4MNGE 1YEHL 4NQCA 3QIUA 5J06A 5JO5A 1K6QH 3RGVA 5E24E 2MFNA 3F62A 1D9KD 4J3UA 1QPXA 5SX5H 4UILH 3OV6A 3PDOB 5CSGA 4M6MH 2AJXL 1T6WA 2BVTA 5HHQB 4LHUD 4OCYH 3P0YL 4M43H 3CFDB 4JR9L 5L2KA 3P4OB 4XB8A 1N4XL 4EI5B 3UCRA 3KYKL 1H3UA 4X4ME 3RWGA 5I9QC 4CVZA 3SKNA 2PXYB 1V7ML 4ZMAT 1TTFA 4BFGA 5KAQF 4QHNA 2HKFH 3MUGB 4YHLH 1AIFA 4N1EA 4DKEH 4ELMF 4FHBD 2DDQL 4Y1AA 4RGNC 2GEEA 1NDMA 3QNZA 1N8ZA 1FRGL 5LKNA 3QCTL 5EU7C 4FN0A 4FMFA 1E4XL 4JFEE 1X4YA 4P5KB 1I85C 3FAXA 2J2ZA 4HUNB 4G8FA 3WXVL 4LK4A 5KVGL 4R90H 3FOLB 3OKDA 1EEZA 3UTSD 4NQED 3TIDA 2X4RB 5FYJL 3OKOA 1LEGA 2C5DC 3VXRB 1BGXL 2MTPA 3LAFA 4GRMB 3IFOA 7FABL 4ZXBC 4PP1D 5D2NC 4LU5L 3JV0A 1IC4H 3IDIA 1DBMH 3V6OE 3K3QA 5HVGB 3H9SE 1A3RH 1U3HD 2A9MH 3MXWL 2X9YA 2VR5A 2DLFL 4ODXA 4ZFOA 1KT2B 3WHXB 4JY6A 5D7IE 1RZIB 4NO3A 5I8OH 1FVEB 2GTZA 1RK0B 1G7MB 3ULUC 4OCMC 2Q7NA 2GT9A 4APQA 1MY5A 4WO4D 4WUUD 15C8L 1JHKL 1YEFL 3MV7D 2VN4A 1HOCA 1Z9OA 2GUOA 4V1DD 2NX5A 3S5LG 3MLXL 5TDPA 1R3LA 5IBLD 2R23A 2XIDA 1BBDH 3P0GB 4MSWA 3LS5H 3GB7B 4X6BB 3SY0A 2E3VA 1AD0B 1IAOB 3WN5A 3ECBB 3H3KA 3ESVF 1CXIA 1YQVL 3TA3A 5CLTA 2A1WH 1Y18A 3C5JA 5F3BA 2EDRA 1NJ9B 4NNPL 4UIMB 4AZ8A 2Y7QA 1UWEL 1AD9A 1EHXA 5HYSB 1J0KA 5KVFH 3B3IA 3QJHB 5AEAA 3KS0J 3C5ZC 4OZFA 3GM0A 2ORBL 2HTLC 1OSPH 2Y23A 3GSUB 4UV7H 4NN7C 5T1LB 2V7HA 2ZCLL 3TCLB 4XCNB 3QA3B 1CIDA 3QAZC 4BH8A 4X8JB 1J05B 5IMKA 4LBEB 3EOBA 4R0LA 3HC0B 5DEGB 1QA9B 3BPNB 3WS3A 5IB5B 2EO9A 4BFIA 2XTJE 3P0VL 4IRSC 4NZUL 4HGMA 3GNMH 4I48A 2FHBA 4BELD 5GS2D 5BW7C 1A47A 3DMMA 2WIIA 2F53B 4GRWF 1HQ4A 1M1SA 5DQDH 4PJCE 3FFCB 5H37G 1SMAA 1GAFL 1U8NA 3GSQA 3VGAB 3CX5K 5KOMC 2F58H 3S97C 5D7SL 4K8RC 1OCWH 2NY7H 3QSKB 2C7UB 4OD1L 5F44A 3SGEI 3HI6H 4QRQB 3HR5B 3DTXA 3O8XB 1FL3A 1URLA 5DJ6B 1HQRB 1YMHB 1U8QA 4BSVA 4ETQB 2FH8A 5FGRA 4GW5A 1TZGL 2R4RL 2CKNA 4XMKL 5E5RB 3ARTA 5I8EB 5IFHL 5L2KE 3C6LA 3V5KB 4E42A 1BJ1J 1RU9H 5CD5D 5LG1A 5AYUL 5E2VL 1HKLH 1I8KB 3CVIL 5EFIA 4J3TA 3WJJA 4C83A 2I9LB 1DQML 5HSFA 3CH1A 3VI4E 1SYVA 5IQ9A 4LLYA 3R06B 4PJBB 4MVBD 4UAOB 5KSVB 2O5ZH 2V2XA 3HE7D 3IFPB 2A74B 3R0MA 3AUVA 1NCDL 4Y1AE 1XGYL 5GZOD 4PJ7B 1DLFH 1WCQA 3QDGB 5ADOL 2DM4A 3BPOC 1DLHA 5I1IH 1MFAH 2R15A 3BQUA 2G5RA 5IW6B 3KPNA 5EUOB 4D9LL 4TNVK 1R24B 4N9OB 1XF3B 2JJTA 4I4WB 4C57C 5F97E 4Z7UA 3CXHJ 3ULSB 3EYVB 5AAMA 4RA0C 3O45A 2L7JA 2EE3A 4OZFG 1BZ9B 1LO0L 1U8OA 4QT5A 5ID1B 1TTUA 4QXTA 4Z7QF 5I0ZA 3WD5L 1LO3L 2CXGA 2GK0B 3OF6D 4GAJH 3QUYA 5FUCC 5FYLD 4GRLD 3IXTA 3T65B 4MLSA 2J8UB 3FO2B 5ETUA 1T7YA 3CD4A 43C9B 4LASH 1Y6NR 3T2PA 5CBEB 3IDYB 4P9HH 5CGMA 1KLFA 3QWQB 4X6DA 1JRHI 2PW1B 4NQTA 4TVPD 5BMFH 2PF6A 5BJTA 4OFIA 1YYLL 4KJQC 5D71H 3V0VB 2LV4A 1C5BH 5GSVB 3O6KH 8FABA 4WFHE 3AU1B 4Y8AA 1EO8H 4XAKE 1GIGL 2MQ3A 5D72L 2V5TA 1V3MA 5DEZA 5CJBA 2NX5E 3MRNA 4XCCL 4ZPTB 2PETA 1JBJA 4XXCA 3G6JA 3T4AB 2OQJA 3U82B 3WO3B 5CMAB 4MDJA 1X5FA 2XN9D 4R4FH 3VRJB 1FSKC 1MFEL 3PP3H 2VXTL 1MQKH 3ARDA 2DQGH 3K1KC 1OAYH 2R1YA 5I1HH 3QI9B 1QRND 3JV5A 5T3ZE 4QWWC 1N3NB 1DBBL 1DQQA 4P3DA 3S88H 3F6IA 4AEIL 5DURB 5ESVA 1K3ZA 1IKNA 1I8IA 4N5EC 3WLBB 1PGRB 1YEDB 2CMRL 5GS1B 2VZ3A 1NGPL 4PYHA 5I16A 5IOPA 3DROA 5C07B 4K9EL 4UBDD 3ZSTA 1KCUH 4OAWA 5C9JB 3CX2A 4MNQB 2YD3A 4QRRD 1OTSD 2YEZB 2JCCF 1AHWA 2BRRL 5HHMB 1YJDL 2GFBA 3C09B 3CSBA 1C5CH 4PPTA 1JGVH 4OCXH 3D3VB 5IMLB 1TITA 3TJEL 4OD2B 2O5XH 3BZFA 3ZKNC 5E95B 1JZ7A 2QQNL 5HHPA 3VXUA 4M8QB 2R8SL 2Q7YB 3RWJB 2OTUB 2ERJB 5SWQA 4P2RB 2X4SA 2NW2B 1S7RA 3CXHK 1LO2L 3DUUA 4PJXA 1Q1JH 3DBXB 2BY1A 1MHHA 3W0WE 1E4KA 1X5ZA 2A6IA 5FCUH 4DUXA 5IFJA 2NZIA 4WU5B 2VXSL 3TO4B 1IQDB 3L3KB 4XRCA 5HDLA 1TMCB 4A2LA 4R7DA 2XA8H 1P9MC 5DGRA 4ZUTB 5CBAA 4PD4J 3UX9B 3RBGA 4KGLA 3O4LA 5DMIH 1N6QL 3HB3C 5JORB 1TQCC 3AY4A 1UEYA 3JBG7 4JCMA 3FL7A 5F70A 1MOEA 4K2UL 2J6EH 3SDYL 1KPVB 3WLWD 1HDMB 5C08B 1EPFA 2NPLX 3DECA 4XZUB 4LQFL 2W0FA 4F9PC 5I1JL 8CGTA 4L8BB 3OGOE 4CMMA 2X7LB 2D31B 2ICWJ 4RFEA 4KV5E 5D5MB 2E7CA 1BREA 4EI6B 4FFZL 5J13C 2VC2H 1FYTD 1HHGA 2EDJA 4HT1H 4XNZB 3ARFC 1F4AA 3I6KA 3P3YA 5E2TH 1G7HB 4OJFL 4RMUA 3TZVD 4GKZA 2W38A 3S36X 5D70H 1MHEA 1HCVA 4BQ9A 5KVEH 2E27L 4XCEB 4WV1C 2MPAH 1QG3A 1JRHL 2R0ZH 4Z7UE 5K59E 4LIQH 2AK4D 2AJ3A 1HWGB 5HGBA 1QSFD 2PCPA 2VIRA 1C08A 3PQYD 5GZNC 2DI7A 5AZ2L 4KVCH 5E7FA 2IAMC 3NVQA 1IQWH 2I5YH 3ILPB 2BOBB 2C1OA 1A6TB 3IYLW 4OF7A 3VW3L 4MQXC 3P4NB 2AABL 1A8JH 3X3GH 4M3JA 1CZ8H 3F7YB 4LDLB 3OZ9L 2Z8VC 4X6DE 2F5BH 1C1EL 4LDEB 3ZYJA 1J7VR 1LDPL 1UWXH 3PWUA 2Z35B 1GGIH 3OR6B 5D1QD 5CJXA 1X5HA 3T0BA 2FWOA 3WIHL 1LO4H 4M48L 4L9LA 2FEDC 4KI5F 4BZ2H 2UVFA 3VXQB 5GS2H 3V7MA 4ONHB 2V5RA 4M9OA 5GISL 2DYPD 1TZIB 3G6JE 1CGYA 5CHNB 5F6HJ 4Y2OA 4ZDHB 4HV8B 4KK9C 2FH6A 2ZOKB 3M8OL 4OGAD 4P4KD 4FXKA 1ZGLA 4H25A 3V52H 1S7WB 3RPKA 1TVBB 4YPJA 1FDLH 2CK0L 5FKPB 4AQOA 2BC4B 3THMH 1OPGH 4HUXA 5DYOA 3CFJA 3ULVC 3RNQA 3Q0HA 1JYXA 4HJGA 3T8XB 1SEBA 4LOUC 1A9EA 4PRPD 1IGIH 4PD4K 1G1CA 1JGEA 5DUBA 4M6AA 4I77L 1NANI 2LVCA 2B20A 3IVKA 4Z0XA 5M7QA 4IRZL 3O6ML 3GMOA 3VG0L 3BGAA 4H1LA 5F1SA 4RFOH 2AQ1A 5DO2C 1MH5A 3GRWH 4YDLB 2DLGA 3U30C 3T77B 4PBWD 3RDTA 1OOAA 5EU6A 2A73B 1X5LA 3GK8H 3SJVD 1GZQA 4WI6A 5EZIL 1MJ8H 4NSKB 3SPVA 1UVQA 2DWDA 4M1GL 5EO1A 1TVDA 3EO9L 5JOPE 3TVMD 5LBSL 3MMEA 3TPUB 2EKJA 1LO5A 2WSKA 1S9YA 1U41A 3L1OL 4M4PA 1J11A 4DTGL 1Y0LB 3DVIA 2NY0B 4PJ9D 1A7NH 4LLQB 1F3DH 1KG0A 1QBLL 1KJVB 4PJXE 3LQZB 4YHOH 1VADB 5IWLC 4HUWB 5HYQB 5J3HD 1ZVHA 3QO1B 4KU1A 2ESVA 5BV7C 3F7PC 2D0FA 5E8PA 4U31A 3TBWA 2O61B 5FYLH 3TM6A 3AMLA 4JFEB 4WI3A 1UB6A 4WI9A 3TFKC 1I8MA 3FQWB 2DJSA 4ZOBA 2OYPA 2G9HB 3O4LE 1JNLH 4X98A 1UZ6E 2BMKA 5E70A 4MAUH 4NQVA 4HX1B 2RHEA 4TVPH 4RMRA 1I7ZB 1MI5D 4M02A 3DJ9A 4OLYL 4K3EH 4B0MM 1ETZA 4YHPA 5HPOA 3QUXD 4OQ1A 1QVOA 4Z76B 1LEIB 1IAIH 1IEAA 3LKPA 4LP4A 5K9JH 1MLCA 1TQBB 4WEUD 1KV3A 3TEUA 4ONFH 1HKFA 5AUMA 4AIZB 3MA7A 4PJFA 3T0ED 4KVNL 4D8PA 2WWKT 1ORSB 1A6VL 2FBJH 1A5FL 5JXED 1CDUA 2BNRB 4JY4B 2AJVL 1NCBH 1TJGH 1P6FA 2DQEL 4H1LG 4EVNB 1CGSH 2I27N 2IFGA 3R4DA 1EA9C 3QCVH 3QHZL 4N1HB 4U1GC 5DQ9A 1EGJH 3L5HA 1JVKA 5D7JB 3IKCB 4MQTB 1FO0L 2ZJSL 4LFHD 3I6LE 3IJYA 4TQEL 3LPWA 3W39B 3K8KA 5DRZA 3QQ4A 4KTEH 1D5MA 5A2JH 3G9VA 3V95A 1AE6H 5EIVA 1T22B 1XEDA 2DTMH 3IXAA 4FP8L 3WIFB 5JNYB 1I7RA 4LSRL 5A43C 1BEYH 4K71B 1PEWA 4X7SH 1LGVA 4TSBL 5DVOA 1MREL 3CVHA 3ZKXB 4O2EB 3O0RH 4PGDB 5EU5A 4JZJB 1AP2B 1G7IB 3S96B 4WGWB 4AH2A 5I74B 2NY4D 4LEXL 4M6NL 5C09D 5CEXA 5KBNC 1GYAA 5HI5D 4EN3D 4JJHA 1NBZA 4JFYA 3DHJA 4XNYH 2QR0A 4XWGH 1E6OH 4PS4L 4YK4B 2V2WA 5BVPH 5LJYH 1CR9L 1X44A 2DMCA 1XZ0A 2H32B 4Q9QH 3BP7A 3I3BA 1NCCH 4L4VD 5C0DB 5GHWH 4GJTB 2DQDH 4NQCB 3QIUB 3HNTH 1F4YL 3LEVL 1BM3H 3JSSA 1SY6H 1L9NA 5GIRB 1MVUB 1DBKH 3LD8B 3BPLC 4Z7VF 1FCGA 5HGGS 5FKAA 3WV0A 4TUOA 2CO7B 5EU6E 1Q9LA 5F7HA 3RVTD 5KTEH 1B0GA 4L4TB 1WF5A 3CMGA 4FQ2H 4TUJA 2BSTA 3E6HA 1P4BH 2FB4L 1YN7B 1FNSH 4OFDA 2ITDB 1CLYL 5CEZL 1N5AA 5L7XL 4UUJA 4WW1B 4FQLL 5C0RH 3SKNB 3BUYB 3WFEL 3FN0H 4JKPL 3P11L 4PJAF 4O58L 1N64L 2NY5C 1FO0B 4ZSOA 3FB7B 1C8PA 1UM4L 2B4CL 5FM5O 5KW9H 1AIFB 5LVEA 2C9AA 4P5MA 2ESVE 4G8EA 3HUJA 3DRTA 4Y1AB 4XBEH 1CDCA 1NDMB 3C6SA 1N8ZB 2EXWC 3MJ9H 3L5XH 5F1NA 5HGHA 5TDNB 1GC1L 4G3YH 4XNQA 4DZ8B 4U1NB 1U8LB 3CLFH 1T66C 5IBUG 1IM9A 1SEQL 4M03A 1CE6B 4X83A 1EEZB 4LP5A 1M4KA 4ZG1A 5IMOA 3TIDB 1ZA6B 5IJVA 3O6LL 2EH8L 43CAB 4P4RA 1T7VA 1LEGB 3BIAX 3HE6A 2HH0H 2EXYD 3UC0L 2YPLB 4H20L 3MV9B 1TJIL 4JVUA 4E0RB 5FA3B 1T83A 3IDIB 2JJWA 3LY6A 2YHGA 2FSEA 4FZEH 4RWYH 3C60D 4YDJB 4JPVL 4RFNC 4TULL 4PJFE 4NQSA 2WW8A 1RZJL 4Y5XC 5JDSB 5LCVL 4RGMC 1ZANH 2DD8L 4FQ1L 4JHZA 2DLIA 1WGOA 1ZLVH 1I9JL 2GTZB 5FF6A 3WFBH 4HH8A 3BUTA 2GQHA 3O2VH 1FL6A 2D7TL 4M7ZC 3DV6A 3NCMA 1HOCB 1TNNA 4I18A 4O9HL 3W2DL 1HSBB 3SOBL 4GAGL 1T04A 3ARYA 3GSOA 1WFOA 2J5LC 4YDIH 4X4XB 3MNVA 3WN5B 1K6QL 4ODUB 3PABB 1PG7L 3FRPA 1Y18B 4YHNA 4UILL 2ATKB 5MERB 5F3BB 5EC1A 4OCYL 1TXKA 3AAZA 4NC1C 4QXWA 1AD9B 5D1ZA 2WQ8A 3BKYH 4O5LH 4J4PD 1AXSB 1PQZA 3VCLB 3JVGC 5I8KH 4WEBL 1F4XH 4KTDH 3ULUF 3VH8A 3D85D 4B53A 2V7HB 1KUMA 4PRNB 1IFHH 2VWEC 5EPMA 3TN0A 4Z7OF 3W82A 4H88L 4L3AA 4BH8B 5IMKB 5T1KD 4UNVA 3C2SA 3B2UC 4KXZH 3QUZC 1J10A 4P2OA 4XXDA 1INDL 4X7TB 3M17A 5EWIH 1QZ1A 2Y1VA 4NKMA 3BVNB 5LGKA 4YGAB 4ZAKC 2CDGB 4OCRL 1AY1L 4D3CL 3D69A 2X44D 4WWKC 3EOYG 2F8VA 3RVUC 3GSQB 4E41D 3Q3GA 4DFIA 4NYLB 3RUGF 4DKFL 1QD0A 1QTYT 1KXVC 3WDJA 1SJVA 2A77L 4HWEH 4KROC 3PWVB 1NLBH 3NZ8B 1U3ZA 3RZCC 1DBML 3B9KB 3A6CL 4U7MA 5A2LH 1WBYA 3GMMB 2E9BA 1A22B 1A6AB 4LSPH 1ND0B 4DN3H 2HJLA 3OB0K 5ENWA 2G2RB 3UZQA 1WEJH 4Z0BH 1DR9A 4YDVA 3BKCL 1OHQA 1YC7A 3U79A 2P43B 5IQ9B 2XZZA 1HH6B 4LLYB 4XVSH 4LF3A 4LVNB 1ZSDB 2KDGA 1IEBA 4ZSOE 1QLFA 3B9VA 5E6IB 2H1PH 1HYRC 4IS6A 3HUJE 4RGOH 5CFHA 3FRPG 1Q9KA 4CNIA 1WVZA 3DSFL 4IEFB 4YWGL 1FFOA 3BQUB 3U7YH 3DOSA 4JM2C 3H6JA 4KRNA 3PGDA 1A6UH 4MLIA 2HT4C 1CICC 3RVWD 1BFSA 3I3EA 3EFDL 3O45B 3QUKB 3MROB 4QT5B 4MJ6B 5FB8B 1OSPL 1IAKA 1MAMH 2PO6B 4UV7L 2GY7B 3GUTA 2Y06H 4WDIA 3QUYB 5F96H 2NYYD 3VXSB 5FGSA 3IXTB 3WE6B 1A1MA 3QIWB 3RWIB 4FQCH 1A0QL 4NGHH 2V17H 4Q74A 4XBPB 4M5ZH 3LV3A 2GAZA 3D9AH 1UC6A 3GNML 5F88B 2R4SH 1RHHA 5DF0A 4Z7WE 4PRAA 3TJHD 2VXUH 3AFLA 4GH7B 8FABB 4KJPC 1WICA 5E4EC 4WI5A 4F80A 3DETD 1CXHA 1KTDA 1KTLA 3EJZC 3SN6N 2UY6A 3VA6A 5IT2H 4ELMA 2IEPA 3V5HB 5C9KA 3MO1A 5TF0A 3LEYH 1XIWB 4MDJB 1N59B 5BZWA 2ARJA 1T0NA 5F71A 2XYCA 5HJ3A 4M3KB 5GRJH 2R2BA 2HT3D 3LRGA 2R1YB 4JVPA 3SE4C 4YHML 1R0AL 3H9ZA 5I18H 4M61B 3Q6GH 4HIXL 4JO1H 4D9RD 3MRJB 1BF8A 4RZCB 2J4WH 1I3RA 5BOZG 2VDRL 3U0PA 2NY3D 3RAJH 3BP5A 1L6ZA 3GJEB 5HDOA 3FJTA 5DUML 3JUYA 5FHAL 5KVDL 3SE8L 3DROB 5EZJA 1PDKA 4FQHB 1UQSB 5GGVH 5CEYB 1XR9A 3ZHLA 1R3KA 2O5ZL 1JWMA 1DANU 3QFJD 4ZPVA 2WBJD 3O9WD 2YA2A 5I71C 3QNYA 4QXGH 2VLLA 1DLFL 4KTYA 4OB5H 1UWGL 3BW9B 1OW0A 4OT1L 3D39A 5C7XH 5I1IL 3BZFB 1A1OB 3PJSA 4GAFB 5FIEA 3TV3H 3R0NA 5F9WC 3VXUB 3EO0A 4OZHB 3C8DA 1A6ZB 2P24B 3CC5B 4Y5YC 4FNLL 2I9TB 1F90L 4ELKA 5SWQB 4CU7A 4HHAA 4OGYL 1A7OH 5EO9B 4HUVA 4HKJA 2R2HB 1YEGL 2R1XB 4PJ