2G5RA

Crystal structure of siglec-7 in complex with methyl-9-(aminooxalyl-amino)-9-deoxyneu5ac (oxamido-neu5ac)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
114
Chain Sequence
KDYSLTMQSSVTVQEGMCVHVRCSFSYPSQTDSDPVHGYWFRAGKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of siglec-7 in complex with sialosides: leads for rational structure-based inhibitor design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Sialic acid-binding Ig-like lectin 7
total genus 29
structure length 114
sequence length 121
ec nomenclature
pdb deposition date 2006-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2g5rA00
5C9JB 1ZAGA 4N9GA 1W72B 4LCWB 5H8DA 2DLFL 3PQYD 2ATPB 3O8XA 1AKJD 1RUKH 1SEBA 5FV2A 5ILTL 3F5WA 5CP7B 2R8SL 1FNAA 4QHKI 4QHUB 2F5BL 2X10A 4C83A 5I1GH 1BOYA 2VDRH 4JHAH 2X44D 2VDLL 2CLRA 3LDBC 4NN6C 3T1FB 3PGDA 2QL1A 2YA2A 3CFDA 4HSQA 3ESVF 3MV11 2ITDB 4G43A 2UV3A 1ZTXH 2UWEA 5INCB 3QUKB 3PV6B 4LCWE 5DTFA 3VFWA 3OKDA 1NGXB 2XZZA 2EDFA 5FGCB 4KHTH 2OJEA 4YFDB 3MODL 1MCDA 5FF6B 4M48L 2N4IA 1W0VB 2F5AH 4KRPD 4ZTPL 5LBSL 1PLGH 1FNFA 4JHBA 4OJFH 2GSIA 2BRQA 1Q9WB 4HXAH 5GZND 4I8DA 3U36B 4QXUL 4HHAB 5BVPH 1KPVB 3BW9A 3IJYB 1ZEAH 3HNTH 2BSTB 4ONFH 3TBSB 5IIEA 1REIA 5IHBA 5TFSH 2Y07H 4TTGA 1RUQL 3BZDA 4F57L 1ZVSA 1JGEA 3S5LA 3VD4A 1CICB 2E8YA 3HZMA 1II4E 2GJ6D 4MDJB 2XWTA 3GEWB 15C8H 5DMGC 4O5LL 3FHQA 4M02A 3GUTB 2XY2A 3OKYA 2VC2L 3O8XB 3BP7A 4K2UH 2BHUA 2H3NA 4OCYH 4LHUB 4PS4L 5CP7A 3G6JA 4M6NH 2D7PA 3EOTH 3OQ3B 4KI5F 2BNQD 4WV1A 2C3WA 4LP4A 5I8OL 4P48A 3ILQC 5D2NA 5K59E 4U6YB 2XN9A 1OSZB 2Y7QB 5AZ2L 3TNNA 1YMMD 3OAYH 1CXFA 2X1OA 4L4VE 1RV6X 3WKML 4K94L 2NLJA 5J9PB 1KYOK 1V05A 2A83A 4U1GB 1NGXA 4K07A 3SY0A 1Z5LA 4KJPC 4FQ2L 1YDPB 32C2A 1G1CA 2AW2A 4FQQB 1EEYB 3MXVH 3Q48A 1PKQB 2MNUA 1IT9H 4FTVD 2VDRL 4JHAL 4I77L 4OZGF 4CADB 1LGVA 3RU8L 3D3VB 2EXYC 2F15A 3QDJB 4OGZA 1K8DB 3AS0A 3QIUC 3N06B 5C0RH 1TVDA 3HZMB 3V6OE 3LOWA 3OGCB 1KCSL 1Y6KR 2R69L 1TQBB 3RWEB 3MRBA 1HWGB 4OF8A 3T8XB 4ONHA 1A0QH 3B2VH 4Z7VF 1D5MA 1GH7A 4WJ5A 1SBSL 1FG2A 4QTHB 2X9XA 4I18C 1CFVH 3PGFL 4F15C 3V7AE 4Z76A 3OB0K 5FO7B 2NX5D 1S7VB 2Y7QA 1BF8A 1A6UL 1HXYA 1JNNL 2NLJB 2K3TA 2WWKO 3S3PA 2BP3A 2K7PA 4KRNA 4GRLB 4S0SD 3FFCD 3BUTA 4O4YH 1MI5B 4K7PY 1A7NL 1U3JA 3JV6B 4O2FB 5BRZA 5GRVK 3TPKA 4PLNC 1KBGH 5BXFB 5C2UB 5IEKB 3ELAT 5M7QA 2E7LA 5E1AB 1UWXH 1SJHB 3HRZA 3K3QA 4OLYL 1RZ8B 1I8MA 3O3DA 4X5XB 5HDQH 1VGEH 4MNGB 3DV6A 5FA3A 4NQSB 4NNYA 3GNML 2VNCA 3WLWD 3MRRA 1MCSA 3U7WH 5B3JE 1V3LA 4PUBL 4Y4FB 1YEGH 5KVDH 5CIPH 1MHCA 1FC2D 1QD0A 3T8XA 3EDEA 1FYHB 3VH8B 2EDLA 3FT2B 5C0CD 4OV5B 1WWAX 2IQAB 4DGYL 2E9JA 4MQXC 5HHXL 5DI8B 3BT2H 5H2BA 4RA0C 5I75B 5K9QI 2XKUA 3QFJD 1FNSH 4ZFGH 1KTDB 3HE6C 1NFIA 3SCMC 4C57C 3S96B 4RZCB 3V6ZA 3VFPB 5HDBF 2A6JB 2FX9H 3HUJF 5E2TL 3BGAA 1FAIH 3WFDH 5MP6H 1XR8A 1MFBH 3VU2A 2DRUA 2NXZD 3QIBD 1T04B 3QBTB 2FATH 3D3VE 1P7QA 2R1XA 4YH6A 2C3VB 1MRFH 2GHWB 4KKAC 4M1CC 3BGFB 4J1UB 4MQ7A 3FO1B 1G7MA 1B0GA 3LY6A 4QTIL 3G5VB 1LD9B 4X5XA 1WAAE 1NDMA 2YPLD 1BBDH 1XEDA 3STZA 3O11B 5JORA 5F1SA 3BDYH 4ORZC 3MMEB 1ZWIB 2GAZB 3RY6C 4XVTL 4PRIA 1N8ZB 5EFIA 3KPSD 3GRWH 5GGVL 1GGCL 3VH8A 1KV3A 4FXLA 3NABL 3HUJB 2X1QA 4M62L 1N7ML 3THMH 1LP9A 5GS3A 2P8PB 5KSAB 1LNUB 3BAEH 5DJAA 1U92A 5I18H 5MEND 1YEFH 1YC7A 6CGTA 2WIIA 4F7CB 1FFRA 3X17A 4PRID 3WLBB 1NCDL 3Q6GH 2BOCA 5LGJB 3TT3L 5IG7A 3DTXB 3GSUB 4RIRB 1XIWB 3SE4C 1MH5A 1MAKA 3DX6A 4NC1C 3ZYOA 3TC9A 1U8JA 2XTJD 3FQTA 4WVRA 5TDPA 1QPXA 4IDLA 1IC7H 1NFDB 4OD2B 5T1KB 3R0NA 3CD4A 1RUPH 3IJSA 5E08L 4ONOA 5FCUL 2HLFC 2ILLA 3MX0A 1WFUA 4MS8C 1OW0C 4ZUSA 4N8VA 3F7YB 1WBZA 1JPGA 1LO5B 3L3OB 4HKXA 4WEMB 1N64L 1YN6A 3RIAF 1L7IH 4UINL 1WTGT 4DZBB 5IT2L 5J12B 1NC4D 3STZB 1KLGA 3D39E 5F7YC 3REWB 3SGDI 4L8SB 1ZWIA 3VD9A 1S9XB 1V3MA 1VGKA 3C2SA 3KPSE 4P9MH 3BZEA 4Q9RL 1CFBA 3N1PC 5EFIB 3KNBB 1VSCA 3LB6C 2VABA 5T3XD 3TLRA 5D9SA 2OSLB 4WU5A 5IM7B 3FN9A 2R0KL 1GGUA 3RTQD 4GQ9L 2DQGL 2DBJA 4LU5H 5FV1L 4J6RH 2MWCA 1TPXC 1A5FH 1T7XA 3MLZL 1RUQH 4PG2C 1H3XA 3P4MB 1BM3L 1DEEB 4JDZB 1YMHA 2BNRD 4ODXB 4GW1B 4U1LB 4I48B 3U6RB 1JNLH 2BNUB 3UPRB 3L3GA 3RDTB 3CC5B 1JP5A 4WFED 2MCPL 5LBSH 2H26B 1BAFH 1VPOL 3MRQB 1L6XA 4X6BB 1J1OL 2F54D 3MRCA 5F8RC 2XYCA 5CEYA 1NGWB 2I07B 5F1IA 3BEWB 4K7PX 2H6PA 3PGCA 4X5WA 4POYA 1X5GA 1WBZB 5JA9A 2X89A 1E4XL 5IBUB 1EEQA 1ZTXL 3GBNH 2H9GB 4QRUB 2A6DA 3CFJB 1BJ8A 4ZFZB 4H25A 5L88H 1GOHA 1U42A 5HVWA 1D5BA 1KG0B 1CDHA 3OB8A 4HIXH 4QXTA 4YUEL 3VXQA 3NPZB 2D03H 3H7LA 5L9DL 1SEQL 2R0LH 1XF3B 4C59B 4X8JA 4M00A 3L6FB 1YNTB 1KJ2B 3LPWA 4TUKL 4KROD 3S36H 3P4MA 4IS6B 1JGVL 2C1PB 2HT3D 1UT9A 4N0YH 5D1QB 1P7HL 4LAJH 1TZHA 1XGYL 1EVUA 3C6SA 4E9LA 1XCQB 4RAUA 2OTPA 5F9JB 1K4CA 2N7BA 3CC5A 1CVSC 3KR3L 3QG7L 3WUWB 2PCPA 3IDIA 4X7TA 4Z0BH 4KI5D 4ZTOL 1FFPB 4N0CC 4OLVL 3TN0B 2R2CA 3P11L 4ZXBA 3MV7E 4GUPA 3QNYA 4IRZL 1MCFA 3NFSH 3R1GH 4HF5H 3HZKB 3FOLB 3RI5K 1NFKA 2A6DB 5DJYB 1F8TL 5GPRA 1X5XA 3B3IA 1NQBA 2PW1A 5DK0A 4XP4L 5E4IA 1ADQA 3F12B 4L9DA 1MOEA 2FLBT 3QG7H 2G2RA 4DZ8A 2CRMA 2P4AB 2VDOL 4MA8H 4PB0H 5CILH 1KG0A 3IFPA 4WW2A 3M07A 5E2VL 1JWSB 2BSSA 3GMQB 3KLHD 1QBMH 4HGWB 3DUUA 3EFFB 3FT3A 2AGJH 4R97C 4X8JB 4DN4H 1W72L 2I26N 4HK3N 4C55A 4DVRH 2PYFB 1DLFL 3OPZL 1VFOA 5IR1A 3Q5YA 1EFXA 5EWIH 3ZZ1A 4EBQH 3MYZA 3O3BA 5JIHA 1P53A 5I8EB 3D3VD 1MLBB 3BPLC 1S7UB 4L3AA 4V1DE 1PFCA 1XGQA 4FZEL 5J6GA 2JIXA 4GMSL 3C9NB 5C71A 3WFEH 3MOAH 1ED3B 5FYJL 5F9OH 5JXAL 1U91A 3UXFA 1N26A 2PNDA 2XWJB 4KPHL 5BS0D 4LPXA 2E7HA 4YHMH 1QYGL 5KVFL 3LKSB 5HYQB 1IKFL 3P9LB 3QIBC 4TVPH 3HCVB 3QUYD 1AGCB 4ZQKA 1MFDH 1J1OH 4ZDHB 5DJDB 3B9EA 1FVEA 2D0HA 2VERN 2W9DL 4G8IA 5BS0A 1FO0B 4HBCL 4QCIA 5E9DB 2NW3A 4PRBB 4XGZB 3BYYA 1QHPA 4NWUH 4TSBL 3TBVA 4PGCA 4MVBC 1FGVH 1DVFA 3S4SA 3DUUB 3PQYA 1PG7H 3TIDB 2A38A 4O2CA 3HPJA 5E6YA 1UXWB 4DKDC 3BPCA 1XAUA 4NJAH 5E94A 4QRTA 5D7IE 3HTLX 4GOSA 2V7NB 1WIPA 4D3CL 1JGDA 1UYWL 4MJ2A 5F93C 3V52H 1ONQA 1DQJA 3JV4B 5HYJB 5K9OB 5DHVH 1U3ZA 1UZ6E 2ZUVA 2F53A 4TNWF 1NGPL 5AAWA 3VRJB 1C5BL 2AI0H 3JWOH 3HPLB 3O4LE 2X2YA 5ANMA 3KYMA 5GSVB 5GXBB 2JK5B 4QOKA 4H8WC 3WFHB 5IOPA 3TZVB 1T20B 1KN4H 2ADGA 3BKYH 2WZPD 1QA9A 4F7TB 2CIIB 5GRYA 5HI3D 5GS1C 1P2CA 1FVEB 1I7UA 3JTSB 2CK0L 4P5KA 4AIOA 2NW3B 5GGTH 4GSDL 3AXLB 4IMLB 2VLJA 4PGCB 1JRHH 1Z0MA 2DQJL 1NAMA 2LQRA 4LSDA 4R4ND 3O2DA 2HJKA 3PQYB 3RWGA 3SE3C 5H37G 4YNYB 1S7RA 1YPZB 3ZT5A 2AVGA 2D0FA 4PJ7F 3BP4B 3PWNB 5DFVD 5J1TC 1A47A 3IRZA 4GS7B 1H15A 2HTLD 3LN5A 5TE6L 4KUZH 1KGCE 4QF1A 1JF6A 5LGKA 5DRZA 3PIQA 4MAYD 3CMOH 2ATKA 4XZUA 3TM6A 3X3FH 1NCAL 3GSNH 2OL3L 4LFHG 3DXAD 4JO2H 1I7TA 3UJJL 4UUJA 3QPXL 5K9OA 3VGFA 3RPKA 2EECA 3MRGB 4G9FE 3EW3B 3INUH 4UIMB 5SV4A 2BVPA 1G9NL 3GB7B 4H88H 5DJ8A 2KPNA 3IS1X 5D2NC 4PGBA 4LASH 3HMWH 3B2UC 3F7PC 4AENB 4PV9B 4U7KA 5MI0B 5CGYC 1J8HB 1CE6A 3RZCA 2VXUL 3H3PL 1YQVH 3DVIA 3Q0HA 3ULVL 5CJXC 3VI3F 1I7UB 2NW2B 3UYRL 3L9RA 5H35B 3HI1A 2H32B 3OZ9H 5FUOH 4MQSB 4P59L 5CP3H 3TO2B 1YJDL 3X14B 4L3CA 3VW3L 2DKMA 3I2CL 2FIKA 1NUNB 2GK2A 2Z93A 1ERNA 2PN5A 3CZFA 4LCUA 4YGVB 2Z8SA 3O9WC 2FRGP 1NC2D 3LN5B 1BQLH 1HHGA 5GZOD 5I15H 4R26H 3VFGL 4XP1H 1KN2H 4PJHF 3KJ4C 2HT4C 4E41E 1BOGB 1QSEB 1Y0LA 1FFNA 1XF2B 3QUXA 2Z31A 3J7HA 1ND0A 4JHWH 3B4NA 4HAGA 1HE7A 1DBKH 4RMWA 5AUMA 4PJ5D 1RK1A 2WP3O 3EKCA 3PJSA 3BKMH 1YNLH 1NLDL 4IOIA 3VRIB 5IB5B 2AJSL 4Z7UE 1GPOL 4P9HC 4WO4B 4U6VH 1CLOH 3HC0B 4M43L 5C0GB 2VXQL 3CCHB 1BFVL 1NBVH 4K3EL 1FNHA 1NBYA 4KI5C 4TYUA 1FV1A 1NGYB 2HFGL 3VFTA 4NQCE 4L1HA 2IAMD 1S5HB 3ISWA 2NR6D 4KKCD 5DVKA 1NUFA 4H26B 5E8PA 3T0BA 1DUZA 2YKLL 1YEIL 1ES0A 4FHBD 4OQTA 3Q1SL 5DEFA 3RDTD 4HFWA 4OFIA 4MD5B 1UXSA 4Y4HA 5IVXF 5HTSA 2X70A 3BH9A 1J8HE 3PL6D 4DKEH 1CFTA 3CDGB 3OKLA 4TSAH 4FQXB 4YX2H 4XNUH 1CGUA 1MEXH 4CVUA 4NCC2 4HAFA 1YN7B 1A0QL 4F7MB 2KZ1B 4LIQE 4QEGA 1A6TA 4EDXA 4K9EC 4HKJB 2Z31B 4WFHE 5FO9A 3ARVA 5F9WB 4L8SC 3HAEB 4Z78B 5IFHL 3O6FB 3GIZH 5IMOB 3JWOL 5I1IL 3P0YH 5IB5A 1LO4L 1H5BB 3OBAA 4P49A 3VFOB 3TPUA 4JN2B 2DJUA 3UZVB 3O3AA 4HMEA 3MACH 2VTFA 2OJZL 5FHAH 3Q3GA 3RNQA 1E6JL 2X4QA 2FJGA 3I9GH 2VKXA 3OKOA 3FB7A 4FG6C 5C0CE 1ZGLP 1OAUL 2BC4A 4K8RH 5SWSE 2AQ2A 4JPWH 5DD5H 2EDEA 2Q87A 4POZC 2ZSVA 2E8ZA 5CEXA 4ODWB 4RMTA 3IU3A 3MUZ1 3QQ4A 3EO1B 3KHQA 3I75B 3NIGE 3ROLB 2P43B 3O6FC 4OCWL 5I8OH 1CGVA 2BY2A 1FPTL 4FABH 5C09B 3CDGA 3OKLB 1G7QB 4R4BB 4PJ5A 3ARGA 5GS2H 3CVHL 2X4UA 2MOVA 1A1NA 3HE7D 3O3EB 2IALA 3NGBB 3WN5A 3I6KA 2PKDA 1A1OA 1AIFA 3RVTC 4MA1B 4P4KB 4G8GA 1SY6A 1TXKA 2AEQH 4MDJA 4JN2A 1KPUA 4EIZC 1OP5K 3T3PE 4CDHA 5IBTH 3FN0H 4DAGL 2X4QB 4DKFH 2ZSWB 3BQUC 1S7QB 4M48H 4PJHE 3VXTB 1FZJB 2YC1B 4H1LG 1KJVB 4NZTH 5EORL 2VISA 4MA1C 5HYSA 5A2IH 3UTSB 1DUYB 1QUNA 4NUGL 3ZDXE 3SDDA 3HNSH 3ULSA 4ODWA 4Z7QF 3BGMA 4M7KH 4P3DB 2DBLH 2DYPD 2FJFA 1U3YA 3BRDA 3SO3B 4FQ1L 2OBGA 5C08E 2DL2A 3GMPB 2A83B 3TWCL 1I1FA 4Z7UF 1MJ7H 3UYOD 3ARGB 4OAWA 3HR6A 3S88H 4TQEH 4BH7B 1UWEH 3G5XA 2J88L 4WWKC 2NXYB 2DLFH 2VMFA 3VFVA 3RAJH 5JXED 3OGOE 4Q97A 1CN4A 2YRPA 4OFPA 4ZOCA 1F8TH 4WRLA 1HN1A 1AIFB 3WSQH 5IGXH 2IH1B 5DS8A 3GMRB 3H9HA 5EU7E 3H42H 1D6VL 3SDAC 4TRPL 4GAJL 4N0UB 5GJTH 3BPNC 1JTOA 4JZNB 1EHLH 3BD3A 4FP8H 3CFEB 3LV3A 4GLRH 5F1NA 3F5WB 1RZJC 2VXTL 3FFDA 4IRSC 2EE3A 3HE6A 3FMGL 5HHMD 4GKZA 1A3QA 4EQ3A 1DQLH 4G3YL 1QSEE 3P3YA 3SKOB 5TQ0H 1NKOA 2XV6B 3BGMB 5C0AD 1D9KC 5GS0D 1JF1B 2R0LL 3B5HA 4JDTL 4UB0H 5D1XD 4WIQA 1U8HB 1UENA 4YHIA 5E00B 3C5ZD 3WO4C 3WXVH 2KDGA 5J0BA 1KIUA 5DQ9A 2VLRE 4XRCB 1U36A 3V4VL 3JV6A 4I2XB 4O2FA 1G7LB 4N5ED 1JPSL 2YHGA 1ZGLM 2FECI 4HHAA 2VLJE 4MD0B 4HULB 1SVCP 4HJGA 4NQEB 3QXDB 5L8KB 2JKXA 1HYRC 3ULVC 2IQ9L 3ALWA 3NOIA 4NQSA 2Y9RT 4IBLT 1BVLB 1N5AB 1MRCL 1JK8A 4X4XB 4KK9C 3BVNB 1D6EB 5DXWA 4HUWB 3I85A 4LARH 4PRPE 1BAFL 5EO1A 1N5YL 1ZLWH 5KSBF 2MCPH 5J1SC 1NANI 4WO4C 4YBLB 5D1ZD 5HGBB 5JW5B 1CE1H 3B9KC 4NQDA 3GHEL 2GCYB 4IJ3C 4PJEE 4U6YA 5D1ZB 3TNNB 1VA9A 3MLZH 5IMLB 3SDCA 1UVQB 1XCTB 4K8RC 5GGSA 1CIDA 2BXYA 1MY7A 4N8VG 5DRNA 2QSVA 4OGYH 4M4PA 3MCKB 3VFUB 5KVEH 5F7LB 1QSFB 2IGFL 5CINL 5EU5A 3KPLA 2VXVH 1GGBH 4DUXA 5SWSB 1IKNA 4CADA 3FO1A 4XMPH 4PY8I 3D3VA 2QLVB 1KB5L 2X4TA 3HE7C 2K1MA 1MQKH 1A7QH 2BOBB 1K3ZA 4UINH 5I71C 3O8XD 2W65B 4WCYL 1BVLA 1N5AA 4LSPH 4KMTL 4U05A 3RWEA 2MTPA 3BVNA 4JZJC 4BSVA 3OF6D 3VXOB 3HB3D 3DX7B 1BZ9A 1EGJA 2R29L 4AK1A 1IC7L 2P8MA 4ZFFB 3FQRA 4G9FD 4Y5VB 4LQFH 4Z76B 4GBXA 4LQFL 5I1JL 3ILPA 4YFLF 5ISZE 1G6RB 4UT9L 1LP9E 2UVEA 4WNQB 1MJUH 2C7UB 3S36X 3WFBL 4TTDC 1HZHH 3DO7B 3OJ2C 2EDYA 3DSNA 1KC5L 4PRPA 5F6IB 3K81A 4X6EB 4YDJB 5F7NC 5D70H 1CGSH 3ROOA 2NTSP 3W81A 2P5EE 3MLSL 4RRPA 4NSKB 3LH2H 2YMXL 1QSFA 1PGRB 5BRZB 4GAGH 1MUJA 3FL7A 3T0ED 2XXCB 4MAUL 5GGVH 1F02I 1N0XH 4TVSa 3KPLB 1HNFA 2MQCA 4OI9A 1DANT 3WHXB 1OT1A 1GC1H 5I8KL 3QXAA 2FL5B 3DI2B 4WHTB 1U9KA 2EDKA 2CPCA 1QR1A 3QXWA 3O3DB 4GG6E 2OK0H 1JPGB 3AMLA 3P73B 2BOBA 1AC0A 3MUGA 5BOZG 2ICWA 4LSQL 3NZHL 3HI5H 4L8SA 1GIGH 3T77A 4PJXA 3Q6FA 3U4BH 5A2KH 1IM9B 4HK0A 4WFEE 1MRFL 1AC6A 3AMKA 3DX7A 3C6LA 4N68A 4KDVA 4WU5B 3BD5A 2QHRH 2P8MB 1TJGL 3QQ3B 1J5OH 1NFIB 3NMEA 4UU9A 5K9JL 4PV8B 4WWKB 1FQ9C 4WEBL 3O9WA 2C7UA 1VFMA 3WIIH 1D5IL 5FECA 2PXYD 1RD6A 5GS0C 1H5BC 3D25B 3UPRA 3DX8B 5C0AA 4M6AA 2DF3A 4NSKA 4PY8J 3JTTB 3VXMB 4HFUL 2VR5A 4IM8A 5J12C 1TVHA 5DEZA 3CMGA 5JUEL 1AXSA 4Q0XL 3QXAB 1B0GB 2RR3A 2GTZB 4BH8A 3QZWB 1SYSA 3G6JE 1LD9A 4TPRL 3GSQA 4LSVL 4Q2ZB 4F58L 1CZ8H 5C0BA 5IB4B 4GJTB 4FQIH 1DSFL 4L4JA 3MOBH 1ZLUH 3NH7L 3AREC 1T3FB 3F6IA 1J8HD 1IM9A 3LKRB 4HK0B 8FABB 1A7NH 4KK9D 1HSBB 5CZVH 3IAGC 1K3IA 1MFCL 3PDGA 3RVVC 2EDDA 3WXWH 1ZLSH 3VXQB 1ZA3A 3LQZA 5D1ZC 5IFJB 3DMMD 1J18A 1NFDF 4OTXH 5INDB 1RIUH 4MXQD 2EO1A 4KJWC 1QSZA 3MLRL 3LIZH 1GGIH 4FFZL 4JFDD 3BIKA 2YPLB 4IRSD 3S34H 4NT6B 3ARFD 1K9TA 2OTWB 4QRPD 3O4OC 3ARUA 4HC1L 1IAOB 3SGDH 5I6XC 3O3UN 3MOQA 3GSNL 3NIFF 1OSPL 1OTUC 3WBDA 3IDJB 3G5ZB 3LRSB 5ADOH 3O2WH 2NXZB 1YEDA 1UACL 2DTMH 2Q20A 4MJ5B 4G7VL 4BM7A 3GSQB 4KKLC 4OBRA 1Q9KB 3KJ4B 4KV5F 1BD2A 4YEEA 3TYFA 1F97A 1IGFL 5TE7L 2NY2B 1KLGB 4O9HL 1WWWX 5FYLH 4RMUA 2G9HB 5LG1A 1EX0A 2ADIB 1BBJB 4KVNH 2NY1B 1JZ2A 2AXGB 4PJCE 1LE9B 2VABB 2DM3A 1M4KA 4MDIA 3KDMB 4NYLA 1OPGL 3TH2T 2W07A 3KWWB 3UTZB 1F45A 5JIKA 1L0YA 2RCSL 2VH5H 1TNNA 2Z8WC 3WKMH 3RWCA 2YD7A 5TPWL 3O4OB 4U33A 4AEEA 1HH6A 2F54B 2MKWA 1EFXB 2NY1C 4BSWB 5C0IB 2YPLA 3FN0L 4ODXA 1UM4H 3K80A 2R0WH 3L3GB 2AEQL 3RDTA 1M05A 2UWEF 3F7RA 5CKGA 4C54A 5DJ0A 5DF0A 4WUUA 5D6DC 5EBGA 3P0GB 1JYXA 1LDPL 1BIIB 5EOTA 1FL3B 4PJ9B 2B1HL 3EYSL 4HXBL 1UH3A 3H3KA 2Y07L 4LIQL 5TFSL 4Y5VC 1IC1A 4S1SL 5DHYA 1D9KB 3TYGH 1MCOH 4R26L 3OX8A 4Z7NF 5I1AA 2AXGA 1DSFH 4H25B 4P5TC 3JWOC 4P2RE 5CLWA 5L2JB 4JE4B 4OSUH 1NJ9B 1FZOB 4JZJB 4UTBH 1PKOA 2XFXB 1LK3H 3I50L 4M6ML 5FDYA 4TN9A 5JOPE 5DVLA 1DDHA 1HZHL 4X98A 4X9BA 3LHPH 1UB5B 2X1XR 5IHZB 3ARQA 1CQKA 4MJIA 1QEWB 2E6QA 1QYGH 3DRQB 3DXAB 3CU7A 2Z8RA 5D1QC 1F6LL 4D94A 2YD6A 3MGAA 1E6JH 1CFSB 4IS6A 3DJ9A 5GRWA 5KS9B 4X4YA 1PY9A 5BZDB 5E94B 3P2TA 1FH5H 4G9DB 3G9VA 3MJ7B 2FB4H 5I1DA 5L8LB 4KZEH 2BDNL 1S8DB 5EBLA 4RISL 4K23H 2B4CL 2C1OB 2YA1A 2GEEA 4JANB 2F53B 1BZ7A 3MBXH 5FOBA 3OJMB 4TTDD 4FQLH 4PJFA 4ZXBB 2GIYA 3MR9A 4CUCA 2V2TA 4GUPB 3OPZH 5EC2B 3EDFA 5IVZB 4HEPG 3PP4L 3B3IB 4PRNA 3T3MF 5E95B 3F12A 5I1AB 4LSQH 4IRSA 1CLYH 1NAKL 2IGFH 5I66A 2FDBP 2E6JA 2DM2A 4HQQL 3JTSA 5EOQL 4OFYA 5ALBH 3QI9B 1XGUA 2K9UA 3DMMA 1GC1L 5I8KH 5E6IA 2Q6WA 3TN0D 5J11B 1EGJL 3CDYA 3RIAK 3VXPB 1I3VA 3KLDA 3DRQA 2GY7B 3DXAA 4MHHI 1N6QH 1MI5E 1G9EA 1EAPB 1FDLH 1OSPH 5JR1L 4N8CL 4ODVH 5FK9B 3ZE2F 3MRPB 3AB0B 2YXFA 3T0EB 1U41A 1UKTA 4NGHL 5CJ8A 1NBVL 4BZYA 3TBWB 3GGWB 1T89A 4LKCB 2EKSA 3V5DB 1A02N 3KR3H 4KMQA 1N4XH 2C3XA 3MLUL 1WWBX 4P4RB 5C0BD 3QIWB 1XIWC 4UUJB 4LSUH 4XB7A 1KNOA 1UM6L 4M7ZC 1ED3A 2X4PB 3QI9D 3WKNA 1ACYL 1RIHH 4PLOB 4HUUB 3BXNA 4NQTA 4J3UA 1MFCH 3CX5J 1O7VA 2V2TB 3FKUS 4BZ1H 4NQCA 3LKPB 2EDRA 3DURA 3QO0A 2SEBB 5IVZA 3OKMA 5J89A 3IDGB 5L9DH 1KJ3H 4X6FA 4ZAKC 3MA9H 2PXYA 4QHNA 2ZJSH 4I18B 5D7JD 2NY2D 3DPBA 1C1EH 3AGVA 4GXUN 2EDNA 2Z9TA 3C60D 2H32A 4U6XB 1AI1H 4FXKB 4XBEL 1T89C 1H9VA 2ITCB 2CUIA 4M7LT 5EZOH 4PR5B 4F9LC 4MJ6B 3DOSA 3GJFB 4GXVL 3MJ6A 5FK9A 3FRUA 3QWRA 3UJIH 2XIDA 1J7VR 3ET9F 4QRPE 4XP9L 4D9QE 4TVPL 4XVSH 1QKZL 4J3SA 4KVCH 2BNRB 3CIQA 1KTRL 3RVVD 1Q94A 5D4QA 4A2LA 1CLZL 2ZZUT 4PJDF 5EU4B 1YEHH 1CGXA 2XQBL 3ZL4L 2H32H 2RHEA 4LHQB 1CDUA 4S1DC 1TZGL 3O0RL 1WV7T 2EDJA 3G5YB 3SO3C 1BM3H 3VMPA 2KH2B 4MCZA 4MLIA 5JR1H 1LO2H 3A6CH 4EUPA 1U8MB 4OM0H 2JK5A 4QOKB 3WFHA 4DEPB 4Y5YA 2DM4A 1T20A 3BH8A 5D7IB 4ZNEE 2HFEB 5TE6H 5DRWB 1Q9OA 2YBRA 1ZVYA 3FAXA 2GUOA 1I9EA 3EZ8A 4Z0XA 3JVGA 4P5KB 3I6LE 5DD6A 1QBML 2N56A 2VLJB 4X83A 1B3JA 5CS7A 4NUJB 5CJXA 5FYKL 1HHHA 2LAGB 4M7KL 1ZLVH 3UTTE 4I5BA 3SDYL 2FJHB 1JGUL 3HNSL 5TE7H 3V5HA 3I02A 3MBXL 3MRIB 2KZWA 5EBMA 4NIKB 3ARBC 4LF3B 4OCRH 3RVXD 4QF1B 5DRXA 4JZOA 2AJYH 4XPBL 5GGTA 4DQOH 4JO1L 5F7HA 1MIML 4PGDB 1NAMH 2HFFB 4M1GL 5KZCD 1L9MA 2D7NA 3MJGX 3QEHB 4HC1A 1P7KA 1QRNA 1HDMB 2QKIA 5GRZA 3MUHL 3WIHH 4R0LC 2CRYA 4EDWH 4FQXD 1J0IA 4HWBL 4Z8FL 1T22B 3W39B 1WBYB 4OFVA 3WUZA 4HCRH 5J6HB 3QUYA 4KUCF 3MJ9L 1MLCB 3BH8B 3IDNB 3HAEG 3QEQD 4RFNB 4NJAL 2YUZA 4E0RB 2OLDA 3E2HC 2W1NA 3S36L 4M62H 3H7BB 1DBJL 4PJBA 2FJGB 5E1HB 1ROWA 4ZFOL 3D2UD 3FO0H 5T5NF 2VLLA 4H0HB 3N50A 1D7FA 4JCMA 3EYVB 2NYYD 1Q9LA 1J12A 2XRAL 2P24B 1KULA 4LCUB 1NMBL 5DDHB 5TQ2H 1A3LH 5EBMB 4TPRH 5CSBA 3ULUE 5IB2B 4I9WD 2JE8A 4NKOA 4Z18A 2EDQA 3H3BC 4PJ5B 3QDGD 1RUAH 3WHE0 4U1JB 3QJFB 4U6HB 1EPFA 4PJIA 5FHAL 1BOGA 1Y0LB 1CFQB 5FYJU 1LO4H 2EEAA 4EXPX 5DD3H 3U83A 3MLWH 2FX8L 4PRAB 1IGML 3TVMB 1UQSB 3LRHA 5C6PB 2Q76B 3KS0J 3WJJC 1BPVA 4UT7H 1NCBH 2HMIC 1WFNA 2YEZB 3MROB 2YPLE 3M17A 2VO5A 1QR4A 5DFTA 1AKJB 4NPYB 2ORBL 4NO2B 1W72A 3ARBB 4OB5H 4F8TA 5EWIL 4JVWA 5F71A 4ZXBD 1JWUA 3SKNA 1PEWA 4CVZA 3MV9E 3UTTB 4JFXA 4EVNB 4DVRL 4Y7MA 1T03H 1DUZB 5E6ZA 4GQ9H 3PGDB 5LAXB 4OD1L 1HI6A 1IGFH 4JQXA 3EDKA 4P2RB 1DN0B 2FJFB 3VXRB 5BCAA 2JJWA 4YO0B 1A2YB 2C4FU 4JFHD 1XZ0B 4EOWL 3ZE0E 2B2XH 1CFTB 1KENL 3IDMB 2OJEB 1S9WB 4GH7B 3O45B 1KB9K 3ARDC 4AQ1B 3LH2L 3AU1A 3IJHA 5K9QG 1HK6A 5BOPA 3ZL4H 3IJYA 1T1WA 1ZT1A 5FCUH 2R4RH 3FCTA 4Y4KC 1ZVSB 4I3RH 3MROA 4PJDA 1AH1A 3H9HB 2PYED 2ADJB 1B0RB 2BFVH 4ZUTA 3CSGA 4JFEA 4U3HA 4XP9H 1XGYH 3D39D 5FCSH 3Q3GB 1R3KA 1RZGA 4M1GH 1F5WA 4U2ZA 2R29H 3SKNB 4CVZB 2HRPH 4HIJA 4EVNA 3CK0L 5ICZA 2AQ1A 4XH2B 2GTWB 5DD1H 5F88B 3MOBL 3TESA 4OSUL 2ZSVB 3SDXA 1IAII 5ITFB 2DQFA 1VENA 3H9SB 3EO1A 4PJ5E 2ADFH 3O6LH 3KPSB 1JGUH 4WTZA 1MCKA 3MA7A 1C12B 4KK8C 5MEQA 1IJ9A 5T3ZH 2MSPA 1DBMH 2NY2C 3JZ7A 4DTGL 2AERT 1OTTD 1YY9D 2YWZA 2YPKB 2XQYK 3IGAA 4KRMB 2GJ6B 4CKVX 3L7FB 2W0FA 2LAAA 4XXDB 1MAJA 3EJZD 1F4HA 4TUOA 5F3HA 2YKLH 5KW9L 1UM6H 1SMAA 3WN5B 1I3UA 4NQEA 3FOMA 3QDJA 4UBDC 4APQB 1X5FA 3HE7A 4OIAA 1RU9L 1A7PH 2WBJB 2L4OA 4XP5L 2HT2D 4F9PC 4JFHE 5IVNA 4JG0H 5CBAA 2FO4B 1U8NB 1FBIH 3FZUC 1R3KB 5BV7L 4PRHA 4UDUA 5F89A 2EC8A 1RIVL 3U0WL 2HN7A 2VH5L 3DGCR 4KUZL 4QTHA 3EYOA 5KW9H 3JWNC 3VE0A 4GW5A 1IEHA 2MPAH 3DRTB 4AG4L 2Z35A 5KVGL 3UTSA 3BT2L 3GI9L 5FO7A 4QY8A 1T0MA 2JCCA 3ULSB 4X9HA 4XMKH 4HWEH 2NXYD 2P48B 1M7DA 1FL6A 4XP1L 1UVQA 1XCTA 3VFWB 5TH2A 3RNKA 5FM8A 4YFLI 2F8XC 4FFYH 4P5MA 3F7VA 1URLA 4OAWB 3VFUA 2R2BA 3T0DA 5MHSD 3L7FA 3G5XB 2ARJB 2DTML 4R90H 4DWHA 3V4VH 3ES6B 4LLVB 5MENA 4H8WL 4NBXB 4XWOD 1SJHA 1G0YR 3HRZB 5HD8C 4WHYH 4IMKC 5DR5L 4LNVA 1BZQK 1MJUL 3OMZA 1T1ZB 3LQMA 3HE7B 4UT6H 1D3CA 4XI5D 1C7TA 3S5LB 1FN4B 4KUCD 3S37X 4BFIB 1X6LA 5MI0C 3A6OA 4XPFH 1C7SA 1JL8A 1CL7I 3VFRB 2HMID 1PYWA 4OF6A 2FO4A 5I1GL 4I3RL 4OI8A 4Q9QL 2J8UE 2XACC 4HJ0C 3T04D 1ZSDA 4G8EB 3C09B 1U93B 3RGVD 4HMDA 3VDAA 2BVTA 1T4KA 1ZLSL 5DI8A 1MCLA 4NQEE 3GMOB 4FFVC 1ZT7B 4WV1B 1TLKA 4Z7VB 4RCAA 3QPQC 3VWKD 4FQJL 4WNQA 5HBBA 5E99L 4ZODA 3GKZA 3SQOL 3L3IB 1Q0YH 4JQIH 1KCLA 2R2EA 3HC3L 3D39A 2BCKA 4LVNC 4MAYB 3OJDA 4HT1H 1Q0XL 4L3EA 4P2OC 4UAOC 2J88H 1FSKB 3QEUA 4PLKD 5LJYH 3VI3E 4GRWH 3PV7A 2FZ3B 3LN9A 2XN9E 3P4NA 1JTPA 1H3UA 2D31B 4YHML 1HILA 3H9ZA 1IFHL 1QZ1A 3CXDH 5C0CA 3QXDA 1K8DA 5IF0A 1ZHLB 4FQ1H 2ZOLB 4OB5L 5I76A 2DBLL 3E6FA 5F9OL 5JXAH 4UV4L 1A7RL 5HJ3A 3UX9B 1U3HA 3MBEA 1LP9F 5F72S 5C08D 5EH1A 4LDOB 3T77B 2W91A 3WIIL 4U6VL 2NY5H 3L3DB 1NC2A 1M7XA 3SOBL 3TFKC 4L8DA 1A6ZA 1X7QB 4PGEA 3NIDE 3VCLB 4KZEL 1S5IH 1LQSR 2NZIA 4CBPA 2APTA 1H0DA 4Z7VA 4QRQA 1Q72L 1R5IB 4U31A 4DGYH 3MO1B 1BECA 4KQ4L 4DN3L 3RY6A 3U4BL 1ITCA 1MFNA 9CGTA 2XZAH 1A3LL 4HDIB 4PTUB 3AM8C 4JFED 5T1MB 1NFDA 1YMMA 3T0EE 3W0WA 3VRLF 1FO0H 2XN9D 3IFLL 5DA0B 4R4NC 4ESKA 3FO2B 3QZWA 4PJHA 4NRYB 4X6DA 4RAVA 4K7PL 1KOAA 5DFVC 5DFWH 4LIQH 5I76B 1GOFA 2B1HH 3EYSH 4OLVH 2AJXH 5C0DB 3FRPA 2V2WB 3U46A 4ALAH 3DO3A 4HUVB 1OAYH 3AREB 5E8OB 1MHCB 3BUYB 1NLBL 3MLPA 4L4VB 4XNQB 4RGNC 1F4WL 3LZFH 3S35H 2DYPB 3ARGC 4CVWA 4PGEB 2OSLA 1WT5A 2VXSH 1EK3A 1KTDA 1BFTA 3NACH 4QRQB 4CRPA 3PGFH 1QSFD 4OLWL 2AK4A 1G6RA 3B2UD 1ZGLA 4CN6A 3NCJL 5EO9A 4Y16B 4RFEA 4QHMB 3HMXL 2VZUA 3KPQB 3DO7A 4JFEE 4NC0B 4WCYH 4KXZI 3J8F7 4IRJA 2GK0B 4R90L 1OPGH 1R5VB 3O2DL 2JJTA 2EYRB 1RJLB 2VDNL 2H26A 4LSSH 1ZE3C 1JMXA 2M8XA 3MRCB 3SBWC 3FJTA 2OXHA 3BEWA 3BRFA 4WI6A 3G5VA 1QRND 4MJ5A 3GBNL 4PG9B 4XWOC 3BDBA 4FQCL 5TDNA 1OTTC 1G6RH 2H9GA 4XMKL 4NUGH 3S8WA 5J56B 3GI9H 5GZOC 3BSZH 4OQTL 4S2SB 5B8CB 3QISA 3D0VB 1A6AB 4OM0L 3TO4C 4P5TA 4ZFZA 2HT4D 3OAZK 1PQZB 4XNQA 1JTTA 1FNEB 4ELMB 3H9SE 5ID1A 1OY3B 1LP9B 3GHEH 4YBQD 3UDWC 4ZUWB 3I6GA 3D2UA 2ICCA 4UU9B 3N1MC 1A5FL 1CDBA 4NCC1 1G9MC 1QKZH 1RUAL 3QUMB 3CH1A 3QPQD 3OR6A 3QAZB 5D1QA 3WCYA 1ZT4A 5B3JF 1X3DA 3CFKA 4EKXA 5J11C 5D7LB 4ZPVA 3U9PL 4ZNCD 3VXMA 2PO6D 5BMFH 2AXFA 1MCQA 2AV1B 4JQVA 2O61B 5D2LE 3WD5H 1WUNT 5HHQA 4CJ1A 4XBEH 5EPMA 4PLKC 4ZOEA 2VITB 4IIQC 4IOFD 3L3OA 1I8IA 1SJEB 5AD0B 1QSFE 3UTPE 1CZ8L 5EULV 5GIRA 2P5EB 4LDEB 2EYSB 1WIOA 3MJ9H 3EYFB 2HRPL 1FNEA 2QEJA 5JLZB 4WFFE 4KKBC 4U1NB 1KXVC 3WO3B 5BJTB 1NJ9A 5IM7A 1E4XH 4WW2B 2Y36H 5JDSA 1I1AB 2IADA 3L5WB 3QUML 1CK0L 4XI5C 2BSSB 3GMQA 1QFUH 1QFHA 1OHQA 3BN9D 2APBA 4RGNE 3QRGH 1FFQA 1OAZL 1MF2H 1P1ZA 1P9MC 4MZ2A 3GIZL 2DKSA 2JELH 5L8JB 5DMJB 3DV4A 1CT8B 1IE5A 3LKNB 4LVHC 3U7AA 1B0WA 1DLHA 1RUKL 3DIFA 1CR9H 3HR5B 4JO3H 4YXKH 1KJMA 5I8EA 1MCRA 1OF2A 3TEUA 2DQTH 1EHNA 3LKQB 4ETYA 5EBLB 1EGJH 2HJFB 2Q3AA 4YX2L 4ORGB 2AV1A 2B5IB 1J1PL 4PY7A 3UC0L 2A77H 5EPMB 3CPLA 1MI5D 1BJ1H 4K71C 1K8IA 3HFML 4GG8B 4I0PA 5DHVA 4PBVC 3SCMB 5C09D 5CJQH 2QQNH 4MWFB 2ICEA 4OCLC 4U7MA 4XCNA 4P2RD 2J8OA 2FR4A 2D2OA 3GSWB 1BD2E 3VWJB 1NMAL 3WEXA 4L8CA 3GBML 4K3EH 5BJTA 1BFSA 1ORQA 2WWKT 4R0LB 1U95B 4XHJD 2IADB 3O6ML 1PAMA 2VDQH 3RGVB 4C56D 3NA9H 5D93C 1CE1L 1K4DA 4JRXB 1J88A 4G6FB 2A9ML 2X4OA 4MX7A 2WUBH 4XP6H 3WO4B 4XVSL 3BPLB 1T5WB 1AJ7H 3BPCB 1MRCH 3VA2C 5C0FA 3C6SB 4ERSL 2Z91A 1XMWA 4KK5D 4OLUL 1K4CB 2EKSB 3PHQA 3V5DA 5FKPB 1TFHA 3FB5A 4GRLC 2PCPB 1JF5A 1VEPA 3QUZA 4JRXD 2DB8A 4AH2A 4M6MH 3CPLB 4M7ZB 4R7NA 2HVKA 3VGDA 1KT2A 4M93B 2QSCL 5CJBA 4HIXL 1V7MH 4OCSH 2YD9A 4HLZG 3U0TA 5JW4N 4NZUL 3FOLA 4YDKL 1WITA 4U2YA 4X99B 5FM5O 4LLQB 1CDCA 3WNOA 2VZ3A 2XXMB 5MEPA 4FFWD 4CNIA 5M95B 1QA9B 3ZE2E 4XCNB 2FR4B 1AQDA 3OKEA 1DBJH 3VWJA 1YQVL 3ULVH 4L8CB 2CXGA 4YR6B 1EXUA 5CINH 1IGYB 4QTIH 3GMLB 2H1PH 2AJZA 1DQLL 3DBXB 1JGLH 4CVXB 4BZ2L 3ECBA 1IKFH 4H88L 2QADC 1QO3B 4WDIB 2HT3C 2W9EH 4WW2F 4L29A 4IHOB 4JFOB 4RGMC 5JQ6L 1ZA6A 3PNWB 2YSSA 3MV8B 5KS9A 4POUB 4APQD 1A3RL 1OTSC 1NCAH 5I1DB 4YPJA 3CMOL 1NC4A 4GQPH 4L5FL 4NO5A 4PJ8B 5EZJA 2WAHA 3ULVF 3TBTB 4KY1L 4HWNA 4OIIH 2ED8A 4EBQL 3MR9B 3GSRB 5DJ8B 1MEXL 3RU8H 2X4RB 4XPAL 1LK2A 2AGJL 4LVEA 4D0DA 4Y5XC 2VLRD 3PP4H 4PTTB 1GZPA 1IGJA 1C16B 2P5ED 4OZIB 2G60H 2QQKH 2DQUH 3LEVH 4XNZC 3UAJD 2YPVL 3KLSA 3L9RB 5IROC 5H35A 5HDQL 4K94C 5ADOL 5JW4Q 3H0TB 3NGBC 1I9JH 3KPNB 4JLRA 1I3RA 4L4TA 5LXGL 2GFBA 3TIDA 1HHHB 1VKXB 1NH6A 5A3IC 3ZHLA 4WDIA 1FFOA 4IRZH 1F4YL 1BMGA 1PBYA 5IWLA 5IBTL 3TH4T 3MV8A 1J0KA 2AJSH 1A14L 1WVZA 4JZOB 3V4PH 4GBXC 4XVUC 5C70A 4PJ7B 1P84J 3PWLB 1JGDB 3QG6A 1AGEA 1FFNB 3LHPL 1T0NB 5F7FA 1P7KB 1K5NB 4LDLB 4UDTA 3BXNB 3UJIL 1XF4A 5AUMB 2DQIH 1YNKL 3HPLA 5DMIL 2XZCL 4OZFA 2FLRT 4X6FB 3NCMA 1MLCA 5DEGB 4WO4A 5C0GA 3LCYA 4FQIL 2CIIA 1MPAL 4ZTPH 2PTTB 1Y18B 3VXRE 3RFZC 1OLZA 2W92A 5FA4B 2ZCHL 3AXLA 4IMLA 3KPNA 4JLRB 3CFIC 1OAUH 3QDJD 3TA3B 4JY4A 5KG9A 3MLYL 2ZUSA 1CD0A 3FRUB 4A2MA 1Q72H 4OF5A 4QWWD 2Q8AL 5ENWB 5EBWA 5AYQA 1FAKT 3CXHK 2VKWA 4KROB 3TV3L 3HS0B 5ESVA 5DVOA 3MRKB 5EU6B 4PJIB 4X9GA 2CR6A 1YC8A 2CH8A 2RCSH 4R8WL 4URTB 4EDXB 2N7AA 1RZ7L 1G7JB 2CO7B 1FNSL 4ZFGL 3IXTA 4PJIE 1IM3A 5A16A 3HAEA 4Z78A 2CRZA 3GMMB 3OWEA 5DMIH 4DN4L 3ABZA 2CXKA 1MNUH 1RJYB 4K71B 4LGRB 4AENA 3PXHA 3FFCA 1AXTL 5JOFA 1T1XA 4O5LH 5JPNA 2O93L 1WCBB 3ARBA 3CFCH 1JI2A 4OV6F 4Y19D 3FT4A 4FXGA 4CGTA 3N0PB 5C07D 3HI1B 3S7GA 3UTTA 3OKOB 1RULL 5DD6B 4HMCA 2ZOKA 1WT5C 3R1GL 5KG9B 1GCFA 4KTEH 4NQVA 2CIKA 5KSVA 2HTLC 2NNAA 1A2YA 5SWQB 4M3KB 1T21B 5LXGH 1BFVH 1Z0NA 2VXQH 3U79A 2AEPH 4O2EB 4N0UE 4ONGL 1U8LB 2LVCA 4M7LH 4K23L 1R5WB 3BN3B 3MXWH 2UZXB 1RFDH 2Y72A 5E08H 1NCUA 2VL5A 5D2NE 4AY0A 4L4TE 2NY4C 3QUXB 2GT9A 2BVYA 3QIUD 3WXWL 2VB5A 5HHVL 4M7JL 5EZIL 5I16A 3GMMA 1PG7X 1QVOA 1T22A 3W39A 3VRIA 5I17B 1IGCL 4YHNA 5ESAB 3RVWD 4X4ME 4ELME 5HYEA 3V5KA 3FFCB 5FYKD 5KN5B 1UJ3B 4N9GB 4CDGC 2A6IA 5ACZA 1TDQA 4XXCA 4Q74A 3SJVA 5E7BA 4QRRD 4OGAC 2F53D 4GG6B 4RFNC 2F74A 2YC1A 3EFDL 5J1AA 4HGKC 4XNMB 5IQ9B 2OQJB 2ZOKB 5AZEL 1P5VA 2VLLB 4XPGH 4HKZB 4O51B 5CGTA 2HKHL 5DEFB 4JO4H 4NQVB 3DWTA 5MEQB 4UTAH 5IVOA 5C0EA 1T21A 5KVGH 3BZFA 2XTJB 5A3ID 3OF6A 4HLZH 4NKOB 3UJTH 1HHKA 5CBEB 1R5WA 4ODHH 2GJ6A 4BH7A 2XG4A 1JRHI 5DJZA 4XXDA 5TGBA 4AYFA 1CGYA 1EUTA 1S7XA 4JPKL 3WDHA 1E4WH 4XBGA 4Y8DC 4G7YL 3VXUD 1MREL 5ICYB 4NNXB 2E9WA 4JHZA 1EA9C 1KCUL 3FOMB 4BQCA 5E4EC 2NY3D 1JHKL 2FX9L 2EH8L 5DS8B 1OTSD 2B4CC 4LPYA 5ESAA 4YHNB 2VLME 4YAQA 3UTOA 2P7TA 1S9YA 1YEEL 5MHSE 3GUTA 4WHYG 4ZFOA 4N8PA 3BP7B 2NR6C 1OAXL 2F54E 1N3NA 4UDUB 5F89B 5JZ7D 3SE9L 3I3DA 4JFXB 1WBXB 3MNVB 4J8RA 4GKZB 4YZFF 1JRHL 2DKUA 3DRTA 5FM4A 3DROA 1KIPA 4BFGA 4NHUA 4D0CB 1V8HA 3QXUA 1TJIL 3TJEH 4ZO8A 1WCQA 4FTVB 1IAMA 2A1WL 4G8FA 4EUPH 3I2CH 1WZKA 1ETZB 1CVRA 5GRJL 2YK1H 4XP4H 3K2UL 2Z0BA 2JLLA 3NTCH 4P23C 1EFXD 5IHLB 5ITBL 1KC5H 1JZ5A 4P5MB 4JY6B 1CDYA 5DQ9B 4GO6B 4XCCL 4PJ8D 4LKXA 4XTRC 3W11C 2OR9L 1BEYL 5DJZB 4UT9H 1A1NB 5TF1L 1B9ZA 4CMMA 5SX4I 3C08H 4G3YH 3AU1B 3QQ9D 1WIUA 4QT5B 2J1KA 4XAWL 4Z0BL 3EOBA 4HPOL 1MVUB 1B4RA 2RB8A 4NDMA 3Q6GL 2O5XL 1C5DA 1N59B 4QKXB 4ODUB 4LASL 2E27L 2VLMD 4JCLA 1AP2A 3W2DL 2DJ4A 4RBPK 4GAJH 4IRJD 3V0AC 2P7TB 1JGVH 3SJVD 3ZT6A 5L0QB 5E2WH 2LABA 4XHQA 4ZUUA 4OZHF 4JFFB 4PFEA 3QCTH 4WY7H 5JHLL 3SKMB 1WBXA 3MNVA 1JFQL 2VN7A 1AHWA 1KCVL 3QDME 2J5LB 4HKBB 4G43B 1JMZA 3HE6D 4TNWK 1TNMA 4I2XE 4LPWA 5INCA 2Z31C 5KZCB 1C12A 3SGEH 1MF2L 1H8OA 3IDYB 5DTFB 3ZYIA 1SM3L 4CU6A 2IWGA 3D39B 2JJSA 2MJWA 1E6OL 2FATL 5KANI 4LKXB 1RMFH 2V5TA 3PHSA 3WIHA 1S78C 2CLZA 5BXFA 2ORBH 5E1AA 2YZ8A 2VDKH 5B4MD 4KKNA 3HC4L 3BW9B 2C26A 3T65A 1RZ8A 1I8MB 3RP1A 1ULVA 4MXWL 5T1KD 3OXRA 3W0WD 3QCVH 4PJGF 2DWEB 1JGEB 5FGBA 3KLAB 1NCTA 3QR2A 3F65A 1NGPH 2DIBA 3MBEB 4YHOH 5CD5C 1VFBA 2E9BA 5CBAB 4J3VA 3X3GH 3T0AA 2IQ9H 4ZUUB 3RVWC 4UILL 4W68A 3EBAA 2CGRL 4PS4H 5I1EH 2RIKA 3G6JB 2P8LB 4LRNL 4M8QA 3VE0B 4LU5L 3MRJA 3BP5B 5HI5D 2A73A 4PP1C 4OGAD 4LHUG 5C8JB 1UEYA 1T0MB 2ZNWA 2EH8H 2W60B 1UC6A 1SVZA 4MB4A 3BEVA 5GGQH 1ZS8B 1FL6B 5EB9A 3GK8H 3X3GL 4IOSD 4JFZH 4AEHL 4PTUA 1Z5LB 2CMRH 1CD1A 2MHAA 2AJVL 3F7VB 4XRCA 4WWKD 1EO7A 3IXAB 4GAGL 4O4YL 4R2GD 2YMXH 3WV0A 2DQHL 4PGZA 4WTZG 2H2PD 1X5HA 2F5AL 4J1UA 4F33A 2DM7A 5TF0A 1AFVH 3I6LD 1IAKA 5E8DL 3W0WE 4LMQI 4HJGB 4PJHB 3PWPA 1WSST 2VQ1B 3N1GC 2B5IC 4FNLL 3UTTD 3C8HA 3ZDXF 1FN4A 2J8UA 2BMKB 2VZVA 3LEXB 5B21A 3MUGB 3OGCA 3D69A 5DSCA 3LN4B 2WLZA 1JK8B 1PG7W 3IDXH 4U4BA 5FAAA 5D7IF 2GAZA 1D6VH 1FNLA 1FYTD 1YUHA 5D7SL 3D85A 1TVBA 4KTDL 4LCIH 4JAMB 4JO1H 2VJXA 1NL0H 1W0WB 2FHBA 4YGAB 2IBGA 1TETH 2CQVA 3WSQL 1U8OB 5IJVB 3LB6D 5KVMC 3RIFK 1T83C 4R7DA 5IBLC 5HYJE 1CQYA 1OP9A 1ZLWK 2A73B 2Q3ZA 5DD0L 3RJQB 3RA7H 4YFEA 5GSRA 1I8KB 4OF3A 5KSBA 2ESVD 3HG1A 2IBZX 3SDCB 4C58B 3EJJX 1ZS8A 2EDBA 4IDJL 4DKEL 2D7MA 4PJCB 1NCNA 1BBDL 3DGGA 5FB8B 2BCKB 4U1KA 3BISA 5TDPB 1RUML 2ICWJ 4G8GD 4S0TD 3Q5TA 3QZWG 4MA8L 2Y5EA 3LZFL 2F8OA 5JHDB 2FZ3A 4PIRF 5SWSA 4LFHD 4JQXC 5F9AC 4DGVL 4L1DA 4LL9A 4NM8H 5HHME 4XAWH 1SJVA 3RHWF 3V6OC 3F7YA 4ALAL 5C0CB 3BFOA 2CUHA 4JKKA 4KTEL 5FA3B 1NCWL 5EG6C 2J8UB 4K7PH 5HJ3B 5EO0A 4YWGL 4G6ML 1AD9B 3E2HB 3IFNL 4PLJD 1OGAE 1S9XA 4WO4D 3K2UH 3OV6A 1TVBB 1A6ZB 1T0PB 4U1MB 1XT5A 4Y4HD 2R56H 4JHWL 2EH7L 3U82B 2GW5A 1XGRA 2VZ1A 3BWAA 1PD6A 3AY4A 3PUCA 4G6AC 3S96A 2V7HA 1XGTA 4DW2H 4GXVH 2OZ4L 4OZHA 3HG1B 5CIPA 5CUSL 1FE8L 1SEQH 4PRPB 3DGGB 5FB8A 5EOCJ 3DNKA 1RZFH 1I85C 1H3PL 1GVIA 1BP3B 1TQCC 5C86A 3C8KB 1T04A 1T7VA 3MA9L 3VXSD 4Y2DB 1IVLA 1MREH 5EDXA 3SE3A 3LKOA 2APVA 1JI1A 1LVEA 4M3JA 1C08A 3TYFB 4PJBE 2ED7A 4LLMA 4NKMA 4UNUA 5EU3B 4AJ0A 4GMTH 2P5EA 3UJTL 3QHTC 2NY0B 3V2AR 5D72L 3Q6FB 2G9HA 4PRIB 4L4VA 4KK6C 5D5MB 1R6VA 2DWDB 4U1NA 5CD5D 4KQ3L 2EE9A 1MPAH 4NFBA 4ZD3H 3P77B 1WJ3A 5L2KB 3TO4A 4JO2L 3QQ3A 5F97E 5MEOB 3F6LA 4B7IA 4LPUA 2XWBA 5E99H 3EZJB 2C4XA 2AS5M 1FDLL 3QDAA 4DVBA 1FC1A 3DX6B 1S9VA 4JKPH 3HN3A 2AKRB 2WBJD 1U8JB 2R15A 5ALBL 2GK0A 1FLRH 1KJMB 1P4IH 3DX8A 4Z9KB 1UWEL 4MSWA 3JTTA 3IJSB 1M05B 4YC2B 4YXLH 5F3BB 2HJFA 3LS5H 4ORGA 4WUUB 4Y2DA 5EZIH 3QDMA 1IT9L 2GTZA 2NYYC 1IC4L 2X4SA 5DHVB 1YN6B 5DJXA 3DARA 2ZUXA 1V3JA 4Y19B 5GHWL 1GRWA 1MFBL 1MCJA 1FCGA 2E5EA 2Q8BH 1D9KA 3REWA 5HXMA 2PW1B 2HJLB 5DK0B 1GPOH 3NFNB 1CU4H 3LEVL 4JRXE 2G60L 2QQKL 4OI7A 2NY6B 2ZUYA 1HSBA 5D9SB 4X0KA 2EXWC 4CJ0A 4R0LA 2X6MA 2OTUB 1OB1B 3TO4B 5ID0A 4I0PD 1UB5A 1YYLH 3GHBL 4XX1E 2ERJB 5F21B 1KLUB 4FRWA 5BV7C 4KRPB 2DQDH 2R4SH 4PD4J 3QUMA 4MCYA 2P5WB 2V17H 5IJKC 3RZCD 4F9LA 2Y5TA 4P57A 4I48A 1CWVA 1JVKA 3UMTA 3GNMH 2PR4L 3ULUD 4MA3B 3OKKB 3THML 5HI5C 2R0ZL 3MRLA 1IBGH 5F3BA 2AXFB 4YHKL 3GRWL 1KCUH 1YPZE 3C9NA 5BVPL 3MLXH 3G5ZA 3LRSA 1DL7H 3VXNB 1KF9B 4R8WH 2X4SB 2BHYA 2R9HC 2IG2L 1AR1D 4KHTL 4S1QL 2R23A 4XCEA 1Q1JL 4Z77A 4ZMAT 5GRVL 4R2GC 5MEPB 1F4XH 3SDDC 5HDOA 5DJDA 1IQDB 4UOW0 1EJOL 3NA4A 4GKSB 2D7TH 2WV3A 2EYTA 3EJYC 4PLJC 4MDIB 4NYLB 5DK3A 3D0LB 1J05A 3BYTA 3KWWA 2A0LD 3NFPA 6FABL 1HIMH 2D7QA 3EO0B 4PRDB 4YHPB 2I9TB 4KJWD 1NUGA 5DJ2B 1FAIL 4Z7WB 1UJTA 1EAPA 4G5ZL 3L6FA 3ZDZE 2V2XA 2QSTA 3AM8A 3C8DA 4ZUVB 2Y4SA 5E2UL 3QULB 3ARFC 3SJVE 5C0IA 2I27N 4TSCH 4X9FA 5DUBA 1KEML 2WWMC 1HINL 5HYSG 2PW2B 5F9JA 3T09A 1OTUD 4HUMB 1FNGA 3DSFL 3TCXA 5IJKA 1I1AC 4PRPD 1IZKA 1EZVX 1S7SA 2XKNB 1BFOB 2VIRA 5DK2A 5IW3A 3SCMD 2JB6A 1L4IA 4Q6YA 3K1DA 3JV4A 5HYJA 1YYLL 3GHBH 2HA1A 1MCIA 3QDGB 3Q1SH 5C0ND 2AP2A 3KYMB 1OP5H 2H8PA 1WK0A 4Z77B 4XPHH 4BQ6A 3KHOA 1PX3A 3B9DA 4ONGH 3GFUA 1CXKA 1GZPB 1IGJB 5FYKE 4QHNB 5I75C 3EJZC 2HFGH 2OL3B 1QFPA 2HKFL 2FO1A 3D0LA 1KPRB 4I4WB 1T5XB 3H0TA 3HMXA 1JZ3A 1IC4H 3OJVC 4UBDD 3EYUH 4L4TB 2B1AL 4KZDH 4EOWH 1NPUA 1K4DB 2PYFA 4EN3C 1Y6MR 1RIUL 1AY1L 4MX7B 3PWNA 4Y5XA 4NRXB 3FZUD 1XH3B 2XOTA 5IHUH 5DRZB 1KLFA 1S7TA 4PJAB 4K3DL 1IQWL 1FNGB 5FKPA 3FB5B 1S8DA 4AIXA 3ARTA 4OIIL 3M1BA 4PJCF 4WFFD 1MY5A 2D03L 5ERWA 2Q86B 3A0OA 3HI6L 3RA7L 3KXFE 4P46D 3NN8B 1IC5L 2EE2A 5EIVA 2BZDA 2QSQA 2XWJA 3CSBA 1U8KB 5FEBA 2XTJC 3L7EB 2WUCH 3HNVL 4NQDD 4EUPB 5DLMH 2VE6B 2KBGA 5DC4B 3QRGL 4Y5YB 35C8L 3QIWC 4YDVA 4P5TD 5DEGA 1CE6B 3DLQR 3S5LG 4TOYL 2HLFD 4IRSB 4QXGH 2KQNA 1UKQA 2GUOB 1A9BA 2WQ8A 1N6UA 4XGZA 3M8OH 2EEDA 2O26U 3S4SB 3T2QA 4KKCC 4F2MA 2F5BH 4M1CD 1E4XI 4U3XA 5EA0L 2J2ZA 2WUCL 4K94H 4RFOL 3RWFB 5BRZE 4LLWB 2HP4A 1OWWA 1G9NH 2G75A 1G7PB 2F19H 5T5NG 3GJEA 3CZFB 2CMRL 1NBZB 1RJZA 1UXWA 1DBBL 1R3IL 3WFCL 1HHGB 1XH3A 2OZ4A 2QJDA 1IMHC 3UJJH 2YWYA 3MRHB 3EOTL 4OCXH 4OT1L 3ZKQD 3S6CA 3S9DB 5KSUA 4M6NL 1YECH 4ZYKB 3RZCC 5BZWA 1QFOA 2CR3A 3UBXB 4H0IA 2HFFA 4K2UL 4OCYL 3ULUC 5JO5A 1KNOB 3DXAE 5E8NA 4RGNB 4CW1B 1HKLL 3GM0A 3LQAH 3VRJA 5EIIA 2O5XH 3L7EA 3RWDA 1RJYA 3L5IA 5IB3B 5GSVA 3UO1H 4MXVE 3IDGA 4RMVA 4WI4A 2P1YA 3MRMB 4GLRI 2Q1EA 2NY0D 4I18A 1AO7A 4MAUH 4YWGH 5KTEL 3ESUF 2WSKA 4OZIA 1NAML 2YN5A 1FZMA 4OCNC 1PLGL 3TVMC 3DVGA 4FXKA 1MFEH 3GI8H 1A9EA 1HXMA 5GISH 1MHPL 4FQPA 3WYRA 4RA3A 1S3KH 2DD8H 4MJ6A 5FYLE 1ES0B 3CDFA 2X4NB 2A0LC 3PE9A 3TJEL 12E8H 5D5ME 4PJIF 3O6FD 3PIQB 5CJQL 4JJ5A 1W8OA 2HTKD 3LS5L 4I0PC 2R8SH 1IEAB 3QH3A 1WLHA 1DANU 3GSNA 1A6TB 5EZLA 1T0NA 2E7MA 2IPUK 1T6WA 1I1AD 2MCG1 5DT1L 4HIEA 4K3GA 3NABH 4UIMA 1MQ8A 4NM4L 2D4DA 5DMYA 1U8MA 1YZZA 4G7YH 3S35X 4JFPB 1R3IH 3RVTD 4YXKL 1Z3GL 4U1IB 4PV9A 3WFCH 3VFOA 5BVJA 1IGTB 4WTWA 3IDXL 2F19L 4NO2A 2LVEA 2CSPA 2XTJE 4H20H 5IVXE 1F58H 1FJ1B 2Y6SC 4KQ3H 4HIIB 5GGUA 3QQNA 3DVGB 2C3GA 4KVCL 4JRYD 2GQHA 4BFEA 2J7LA 1CK0H 3LVEA 3DYOA 3ULUH 3JUZA 2IG2H 5CEXB 4OFKA 4HIHB 4X7EC 1KCRH 3VXRA 5SWZD 4TOYH 5I73B 2UZIH 5ENWA 3MRIA 4L3ED 1PSKH 3JVGC 1AO7E 5C1MB 4EN3D 3IDMA 1NSNL 5DLML 5F96H 4GMSH 4HUKB 3ARGD 3EDJA 5IV2B 4JFDB 3MRKA 1OP3K 4EI5A 4PGDA 1W8NA 4AL8H 3MUY1 2X4UB 3QH3B 1HYSC 1A7BA 4NN5C 1QTYT 3WNNA 1EERB 2VAJA 4Y8AA 1XF2A 2CDFB 1QSED 3T4YA 2DQGH 4XBGB 3BX7C 3HI6H 5HHXH 2UUDH 3BI9X 3ULVD 5I19H 2QKIB 1WICA 2J6EA 2DQDL 2R4SL 4NKIL 1DLFH 2A9NL 3LSOA 2A9NH 2YUWA 5FYLD 4QRPB 4YAQB 5HDLA 4ERSH 1VFUA 4PUBH 2IANA 1KPUB 1IGTA 1FRGL 5KAQF 4B53A 1JPSH 3I3BA 5T5FH 1N4XL 1RZGB 4Q6IC 1FJ1A 3MYJA 1DE4A 1S5HA 2A6KB 4UV7L 3SOBH 1DFBH 2HH0H 1NGQL 3MFFB 4XH2A 1FL5B 2VISB 5HYSB 3STLB 4ELMF 1GJIA 3NFSL 4HF5L 4OLXH 5ITFA 5TDOB 3NCYS 2F58L 1UXSB 2FX7H 5DDHA 3RVXC 5C6TL 3ZKMD 5AYUL 1F3RB 4XPHL 3B6SA 4MZ3A 1KIQB 5HY9B 2BX5A 2JJSC 4QOKE 3TJHD 4RSVA 4Z7UB 4J3TA 1SJXA 4WFGE 1A7OL 4DEPC 2W0FB 1BD2D 1P4IL 1FLRL 1G9NC 1EHLL 2B20A 3QDMD 2ESVA 4UQ3B 3T3PF 5M94B 3T4YB 2EZ0D 2X09A 3EOBB 5DURD 4NN7C 2A77L 4JDVB 1N7MH 5B38G 2YA0A 1KELL 3ZTJG 1QLRB 2HVJA 1CICA 2ED9A 4PRHD 5FKAB 4QRPA 4TSCL 3V95A 5CLTA 2R69H 2OP4L 3EYQD 5JQHC 1U8NA 4NZRL 1UADC 3VGAC 1FIEA 4G6KL 4NOBA 2E7BA 4RISH 1A21A 5I1CL 1MHHB 2HN7B 2FGZA 3HE6B 3QJHB 5J1AB 1HIML 5L7XH 4M7JH 1JPFB 1OAZH 3KPMA 3IAQA 4HKBA 1MCWW 1SYVB 1DBAH 3SKOA 2XN9B 2FWOA 3MLYH 3WS6A 1RY7B 3UBXI 4YO0A 12E8L 3DVNA 3ROLA 2LU4A 4JFFD 4GAFB 1IM9D 2VDPH 2QBWA 5TH2B 3MJ8B 1KIQA 3MNWB 2AV7B 35C8H 5DC0A 1Z9LA 5MP6L 2WINB 4R4BA 2FNBA 3I50H 1HHKB 5CBEA 3O4LB 1BIHA 1IL1A 4LRIC 4UTBL 4FQQA 5F7UA 5LKNA 4AT6A 2NY5C 4UQ3A 4YDLB 3MZTA 1S7XB 4AZ8A 3SDXE 2NPLX 3BE1L 5L2KE 1OT2A 4YHKH 3BP6B 4JDVA 2NY6D 1GOGA 5JDJA 1ZT1B 5D7LD 1HWHB 3B9KA 4DW2L 5IK3A 1AGDB 2HLAB 4ZG1A 4CL7A 4MAYC 4V2BA 3WNPA 4FZ8L 5KVDL 5C9JA 5FHBL 3S4SG 5FHBH 2YOCA 3VFRA 2XZAL 4P3WA 1SEBB 5I1EL 3HNTL 4Q9RH 1A14H 2B1AH 4KZDL 1KXTB 4HBQA 2GTWA 4JFYB 3W9DA 5J06A 1ZT7A 2Z92A 4L9LB 4ZAKA 4NHUB 4E41A 5HHPA 2IH3B 2DQFB 3P4LA 1N64H 4G6JH 4P3DA 5IW6B 3QCVL 1ODAA 1X5IA 5LVEA 3GMPA 2R2EB 4IJ3B 4Q9BA 1DQTA 2NY7L 3CFBA 3HHRB 4MAYA 1BQHG 4JM2F 5A2LH 3O4LA 1LO0L 3IXAA 5A2FA 5ANME 3QA3A 2QQLL 3PF2A 1F3DJ 3VFVB 3HLAB 3QEGL 4U1HB 1KTKE 5CZXD 1KPVA 4V1DA 2D31A 5I1CH 1ADQL 4Q58C 2BSTA 1P5UA 4NDMB 5IESH 3ZDZF 4Y88A 2EIZA 3E6HA 4X5LA 5IF0B 3U2SA 4OQ1A 3GMRA 5DQJA 3MRRB 1T66D 1BHGA 5DYOA 5ECJE 4JKPL 2KUTA 1B2WL 3R4DA 2FD6L 3HG1D 1X44A 1TZIB 1H3VA 3WL9B 5EN2A 1GGCH 4JAMA 4KFZC 1BZ9B 2NZ9D 4WY7L 2IQAA 3EYOB 4RNRA 4ZFFA 1AHWB 1QRNE 1ZHKB 4UMGA 2YRZA 4KTYA 4ZD3L 1H0DB 4F37K 4LCYA 4L9LA 4ZAKB 5JHDE 2W9EL 3D85D 5JPMB 1PEZA 5SX5K 4QGTA 3RNKB 1JHLH 4NJ9H 4YHIB 1NLBH 5E00A 2ZPKL 3ROOB 3WFZA 1OAYL 1HSAB 1XR9A 3VD3A 4LCCA 4I2XA 4X6DF 2CLZB 1P7QB 2R1XB 1E27A 4KKLD 5T1DL 2L0DA 5ISZB 1OAKH 3TJHC 3RDTC 1NGQH 2GI7A 3T65B 1EEZA 1T1ZA 2YK1L 5GRJH 3U2SB 1WZLA 2A1WH 1KYOJ 1T6VN 1A1MA 4R6UA 1HYSD 1VFBB 3H6JA 3IF1B 5CUSH 3SGEI 3SDAA 3C6LB 1FHGA 1D5MB 5B39G 3SE9H 4XWGH 3K4DA 2P8PA 5KSAA 3KPRA 2IBZY 3QFJB 3TNMA 4NQDB 3BP5A 5JHDD 2NX5E 5E0QA 3SDXF 1ACZA 5D1ZA 4GRMA 4ZS6D 4OZHB 4UT7L 3GSUA 4RIRA 4YPGB 5DD3L 1DP0A 1FIGH 5KS9F 2NY5L 1PSKL 4MJ4A 3ZYZA 1CD1B 4FG6D 4G8GE 4LLAA 1MAMH 3C2AL 3LS4H 4OD2A 5T1KA 2EYRA 1QQDA 3X12B 3UTQA 3BQUB 2V9QA 3HZVB 2IMNA 4PJEB 1UFUA 3AY4C 1J9CT 3QHZH 5L7XL 1IAKB 4YE4H 1OCWL 3VJ6B 2X4TB 4I0CC 4HKXB 3ARFB 1ZHLA 4UTAL 5JTWA 5TDNB 4MNGA 3UYPA 2PUQT 3DV6B 4NHCL 4LLMB 4NKMB 5EU3A 2BNRE 2NQCA 5EU6D 4A6YA 3D69B 5DSCB 2RAMA 4S2SA 5B8CA 3P9WB 5HI4C 4DTGH 4F8QA 1DN2A 3QEQB 4TNVK 4NQXA 4YDIL 3D85B 1Q0YL 4JQIL 4YDKH 1IILE 2LU7A 1XFPA 4XAKD 5E5RB 3FT2A 5ID1B 8FABA 3MQIA 3C5JB 5FUCC 4Z7OF 3MLVH 4EUPG 1XGPA 3WN5C 1J87A 3KPRD 3AFLA 3ARYA 3VWKC 1HCFX 1HQRA 1JYNA 2XPGB 3IDUA 4P2CG 5FDWB 3GMNA 4R2GB 3MCLH 5KSBB 4ZPTA 4HCRL 2JELL 3DUSA 4BSJA 4W6YB 3BIKB 5IESL 1L7TL 3G6JF 3V4PL 2IANE 5AYUH 5GGRB 2OTWA 4GMTL 4XP6L 2YXMA 1MIMH 1MUJB 2FEDC 4P2QD 1EDQA 5KOVC 2AJYL 4XPBH 4Z7VE 3OHXA 3WHXA 2O61A 3MV9D 2I07A 5F1IB 4HH8A 2VDQL 1YEDB 4P4KC 3QFJE 5E4EB 5IKCA 1I4FA 1Q9KA 1DEDA 3UPCA 5CZXC 5IMMB 5EU6E 3QHFH 3MRFA 1RZFL 4RWYL 4AEHH 4A6YB 3O11A 3NBNA 1NFDE 5FGCE 3K8LA 4NBZB 3RWIA 4NQXB 3LD8B 5I30L 2DYPA 5JLZA 4D3CH 1KXQE 3MSPA 2NY6C 3MGTA 4R97B 4PJFE 4HUNB 5DJAB 4TNVF 3VFNB 3B8SA 2OTUA 4HK3J 3GBLA 5K33A 1KJ2L 2NZ9C 2WIIB 4F7CA 2V7HB 1ZGLB 4UZGA 1XF1A 5EO9B 4LQ1A 4YHOL 1CFNA 1NSNH 5F96L 4EN3B 4LVHB 1I75A 1R3LA 4WU7A 5F9DC 3IKCA 5IW1B 1R5VA 5SWZB 1A7PL 1UA6L 3RL2A 4ZO7A 5C6WH 4FTVE 2JB5H 3IT8D 5DJ0B 5E8EA 3LQAC 4YHZL 1AXSB 1EO8L 4DGVH 1QFUL 3FB8A 5CSGA 5E6ID 3TN0A 1C08B 1M71A 1MWAL 4MJID 4Q2ZA 4I0PB 1K8IB 2D9CA 2HKHH 2Q7YA 4UIKL 3C5ZC 2LFGA 4JKWA 4Z7QE 3TIEB 4NZJA 3WJJA 3GRWA 3V4UH 3PABA 1Z3GH 2VSDA 4P5TB 3KNBA 2G2RB 4DZ8B 1PZUB 5C0BE 1CI5A 1UB6A 3NVQA 2Z4QB 5DGQA 3GZKA 4ZUWA 3I6GB 1MVFA 1Q8MA 5ESQA 1LEIB 1UWXK 3BJLA 4PJ9C 4NNPL 1RZKL 3MPCA 4LSRH 4QNPE 1DQML 3QUZC 5EUOF 3ZLQC 1CFSA 1S9VB 4LBEA 4X4YB 3B9KD 3MJ9A 1RFDL 4W81A 1C8PA 2VLKE 3MLUH 1OGAD 5D7LA 4ZPVB 1F4WH 3PHQB 3RL2B 4B41A 1ZV5A 4KAQH 1LEKB 3MREA 1S7SB 2XKNA 4FP8L 4M7LL 1WISA 5T3XE 4AH2B 3QB7C 2I60H 3FB8B 3GSVA 3HA0A 4L4TD 1JNJA 2ERJC 4I3SH 4PJFB 5F1OB 1I8IB 1SJEA 1QLFB 4LCWD 3TIEA 3KYNA 4QRUA 4JFDE 3HCVA 1I7ZA 1HQ4A 1KENH 3WE6B 4OQTH 5D1XC 4ZDHA 4UV7H 5GGQL 3OKEB 4ZAKD 3IETB 5T5FL 5HI4D 2DQUL 1EXUB 1D5BB 2QHLA 4DFIA 4Y4FC 4HUXA 1BVKA 2ARJQ 2Q6WB 3V0WH 3TCLB 1K6QH 2B7DT 3RWCB 3ECBB 4ODTL 4KQ4H 4DN3H 3ARBD 3L5XL 4M9PA 1U8QB 4CN4A 1NEUA 3ARXA 3FQXB 4OM1H 3VG0L 1AGBA 3JWDC 5LGHL 1DBBH 3JUYA 3V6FA 1TZHB 3PHOB 3IYLW 1DQDH 1SQ2N 1XCQA 4RAUB 1VADB 2DMCA 1J1XL 3TV3H 2FB4L 1PY4A 5EA0H 5I1LA 1F3JA 1H8SA 1DQJB 1CS6A 3DYPA 3NACL 4Y2OA 3ZSSA 1OD7A 2X4PA 3GSVB 4YLQT 4PJFF 5EZJB 2MMXA 3MV7D 3TZVC 3RY4A 1YEHL 4GG8A 3VXUE 1FL3A 3GSRA 1QLFA 5D7JB 4MWFA 1Q1JH 1I7ZB 4UNVA 1PVHA 2ADGB 4HEME 4JR9L 1IQDA 2WP3T 4HS3A 3O2VH 1EFQA 1RSFA 1DZBA 5DUML 3VGBA 4XPGL 1EVTC 2RFXB 1GAFL 5HVGB 1U95A 4N1CA 4M5ZL 1JWSA 3EO0A 3P40A 4PRDA 2IAMB 5B22A 1I3RB 3VGAB 1U2HA 3UDWA 5DJ2A 2HJKB 4NKDA 3RWGB 3FB6B 1B90A 2B39A 2EDXA 3GJFA 4OZIF 2DQIL 4JRXA 4LLWA 4JN1L 1FFOB 5IR1B 3UZEA 2IAND 5F6HJ 3BPOC 1VERA 1A6WL 3QP3A 4WHDA 1KJ3L 5HHOE 3VFSA 4G9DA 5D6CA 3MJ7A 1VADA 1CCZA 5BZWB 2O5ZL 3EUUA 2GY5A 2CGRH 4LNRB 1BFOA 5C3TA 2EE6A 3IU4L 3CDCA 2AJ3B 3QUZB 2JIXB 2R0WL 4D8PA 3QCUH 2I5YH 3EIFA 4NQUA 5E8NB 2F9BT 4QGYA 4V2CB 1NCCL 2NX5A 1KT2B 4KDWA 4LSUL 1QP1A 4EI5D 2ZKHH 5KBNC 1L7IL 4KJYA 1QFWM 5DA4A 5DR5H 2DD8L 3LKSA 5HYQA 2H8PB 4MNQD 3MRMA 3R0MA 1Z9OA 4N1EA 4PRNB 1AGCA 4ZQKB 1KFAH 1J8HA 4LHJB 1YEJL 5JW4R 3DX9A 4LEOA 3P30H 2NW2A 4O02L 2VDML 1NMAH 2Q7NA 1GL4B 1KPRA 5LQBH 4GAYB 2DICA 3TBVB 2FGWH 3TO2A 4NKDB 1FGNL 2QQNL 2HYMA 4WI3A 4L3CB 1VFAA 3MRPA 3V5HB 2N1KA 4MHHG 4G7VH 4NRZB 1YMME 3T0EA 3I3EA 1N6VA 4Z95H 2X42A 4S1RH 1JE6A 3GGWA 5BV7H 2VWEE 1YEKL 1N0LA 4HC1H 1T80A 3NAAL 3GSNB 3W9EB 1TTUA 2ICWI 3SE4A 5JW3L 1NEZB 3RI5F 4ZSOB 4E42A 6FABH 1NDGA 1SMOA 2NX5B 4HIEB 3TBTA 5A16B 1U8KA 1KB5A 3VXSB 3W2DH 2F8VA 3MLRH 1JZ6A 3DURB 1WBYA 3QO0B 1OCWH 5HHOA 4EQ2A 4MGXA 4U1IA 3MGOA 3F58L 4F3FA 3DX9B 3C08L 5D96C 1FV1B 2XNAA 2A74B 3HG1E 3FT4B 4FXGB 4Y16D 3G6DL 5E6IC 1QRKA 1V3KA 2DQEL 5D2LA 1B88A 4HS6B 5EZOL 1VEMA 2PTVA 3S3JA 5IMKB 4PR5A 4TUJA 4CU7A 2J12B 3HNVH 1TCMA 4N5UA 4OCSL 4KHXH 4TULL 3D18A 2X05A 5KSVB 2WNGA 2CO6B 1TJIH 2EXYD 1A4KB 2ID5A 4OZFH 2IC2A 2DLEA 2P5WD 1PJ9A 3ARED 3OZ9L 5FUOL 1PDKA 2IPTL 3U4EA 4OKDA 3G6DH 4OLUH 4MQXD 5BMFL 2CKBH 3QIUB 1V7NL 3ZKNC 3CSYA 4PG2A 2ENYA 2GT9B 5F7KC 3TGXA 3QUZD 2MPAL 1RIHL 3MRGA 4JB9H 2JF1A 3UTPD 1AY1H 2Q76A 1KB5B 3HUJE 3ARWA 2W38A 1JHKH 2YEZA 2VLRB 4OZFB 1OARL 3TZVD 3PWJA 3RBGA 3EYUL 4U0QB 2IANB 4WWID 5ICXA 5KN5A 5D7IA 3QWOA 1AKJA 1H3GA 4NPYA 3RZCB 1OAKL 1F4YH 3FQWB 3X11B 4YQXL 1HNGA 4NGHH 3NAAH 2XNAB 3V79C 4KKAD 5F7DB 1JWUB 1DE4B 2A6KA 2EDWA 1ZANL 2CKBA 1QBLH 5BW7A 1OL0A 3BD4A 3U4AA 5LWYL 7CGTA 2IJ0C 2I24N 1RZJL 4P2QA 1HHIB 3BSZL 2FJHA 4J4PC 3D18B 3CFCL 3ARSA 2EC9T 2X1PA 2ZG2A 2AEIT 5C09A 3FQUB 4WGWB 4F37F 3DVFA 4I9WE 2DQTL 2VDMH 5JOEA 2AK4E 4M9OA 1M1SA 4W6WB 1IEAA 2CDGA 3MZGB 1UZ8B 5D1XA 2VDNH 3MRNA 1GGTA 3GKWL 4K3JH 2VUOA 4YHLH 2JCCE 3AUVA 3MNZA 4J7RA 1JV5A 5ICYA 1I8LA 5E2UH 3PJSB 3FCTB 4Q7DA 1IGMH 3NCJH 4Y89A 3SN6N 3SKJL 5JPNB 5JMRA 4NWTL 1MCEA 3FQWA 1JNHB 5C08B 5K9KB 2P5WE 5FUZL 1E4JA 4ZS7L 3MV7B 4AM0B 3BKJL 4MS8D 4GKOA 1S7QA 5J7CC 4H26A 5E8PB 2PF6A 2H1PL 2F53E 5JIIA 3KPMB 4HPYH 4KC3B 2ZCHH 1A6WH 1BQHA 1SYVA 4D0CA 4P2QB 3SDXB 1UH4A 3VDCA 3H9SA 4HFWB 1A7QL 5JXEA 2FH6A 3DVNB 4Y4KA 1G84A 2DDQL 2YN3A 4X8XA 2NXYC 4FFYL 3GK8L 4BYHA 1I1FB 3D87B 5FF6A 2DAVA 4WFGD 3C5ZA 3CLEL 3IGAB 4X7FC 2APXA 5IV2A 3RY5A 3MCG1 5DUMH 2GSIB 1JHTA 4DGIH 2CDFA 5HGHA 3U36A 4ODSH 4P2QE 4QT5A 2AAVA 1JV5B 4LRNH 1LHZA 3BP6A 3TVMA 3TT1H 5JUEH 1C5DB 4F57H 2D0GA 2DI7A 3LSOB 5GS1B 1CBVH 5DZNA 1H5BA 4AIZA 2WK2A 2XWTB 1RPQA 3TPUB 2LE9A 3RQ3A 1BQSA 1JNHA 5C08A 1NCWH 3IKKA 3CJJA 3QI9C 4ZO9A 5F1NB 3RPIA 4RX4A 1N5YH 1J1XH 4EEEA 3CSPA 4WI7A 3HC4H 1FL5A 1ZHNA 3RTQA 4Y16C 1CGTA 2Z35B 4QLRA 5HHPB 4O51A 4YJZL 4OM1L 2JCCB 5TDOA 3WUWG 3L5XH 1DN0A 1I9IL 4PRIE 1HKFA 5C0EB 1A4JA 3DHJA 3RRQA 1SM3H 1T1YA 2FH8A 3U7YL 4YHYC 1EIBA 4FA8A 4YEFA 1S9WA 4XPAH 4NFCA 2EXWD 3O2DH 2VDOH 2H2SC 4PB0L 2QADB 2ARJA 4LEXL 4XCFH 5HYJD 4NZRH 3SO5A 4NO0B 4JEGB 3IJHB 1OAQH 5CJ5A 4V1DB 2VN4A 1T1WB 1NUDA 1A1OB 1RK0B 1QLRA 3RTQC 3ZDYE 4N0FB 4NKQB 1MIEL 3MRBB 1CF8L 1EJ6A 4HUWA 5DJCA 1TZIA 2JTDA 3S35L 1ZSDB 4G8EA 4PJDE 3AVEA 1Y6NR 2VSCA 4QHUA 3VXTA 4HPOH 3QJHA 5ICZB 3GMOA 5IQ7L 2BJML 3F7QA 2R9HD 3DROB 5TF1H 1DUYA 2JCCF 4I13B 5E9DE 1EHXA 4HW6A 4NCDA 2F58H 4TUKH 1FVDB 5JPMA 3BEVB 1FP5A 3KPSA 4DQOL 4UT6L 2L7UA 5TE4H 4M6OL 4U1SA 4JFZL 1T1YB 3AS3A 5GGSB 3OKDB 2AV7A 2GYSA 2G5BB 2APWA 2BVOB 1X4YA 4HG4J 2D7OA 1X5LA 4GRLA 1HSAA 1XR9B 1C1EL 4MMXC 1M7IB 2DI8A 2B8OT 3QEUB 3S88L 4WHCA 2VLKD 5D7JC 4CMMB 5GS0L 4Y1AA 4Y2DD 1G0XA 2J8UF 3WD5L 3K8MA 1WZMA 4M93C 4X6CF 3H9YA 4LLYA 2XZQH 1T7WA 2NY3C 5J4MA 1TQBC 3ZTNH 1RK0A 4KJQD 7FABL 4NNYB 2WBJA 5B39B 1KCKA 1E28A 1B4JH 2EH7H 3QFDB 3L3DA 3PP3K 3G08A 1CXIA 4PRHB 4EI6B 5E2JA 1KSRA 3FFDB 3RX8A 3SKMA 2ZNXA 5J57B 4OF7A 1TZGH 1P4BL 2DLGA 2Z92B 3O6MH 1J5OL 1TJGH 1I8KA 4U1GC 5C0NC 2UZIL 2QR0A 5JQ6H 4RZCA 3V6ZB 1CBVL 4J12A 1J0ZA 3GO1H