2G5RA

Crystal structure of siglec-7 in complex with methyl-9-(aminooxalyl-amino)-9-deoxyneu5ac (oxamido-neu5ac)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
114
Chain Sequence
KDYSLTMQSSVTVQEGMCVHVRCSFSYPSQTDSDPVHGYWFRAGKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sialic acid-binding Ig-like lectin 7
publication title The structure of siglec-7 in complex with sialosides: leads for rational structure-based inhibitor design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 29
structure length 114
sequence length 121
ec nomenclature
pdb deposition date 2006-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2g5rA00
2NY1C 4KROB 4ODSL 3FB5B 1MCBA 2UY7A 4HQQL 1CICA 4N5UA 3VWJB 3RNKB 3B5GA 4PRDA 1QP1A 4PJ5A 1JNHA 3I2CL 2I9TA 3PNWA 2FHBA 5CEZL 3ZDXE 5ESVB 2C5DC 3T0DA 1QTYT 3WFEL 3K74B 2Y4SA 3W82A 5CAYB 4AIOA 1F58L 1QACA 4Y16B 4LIQE 5ANMA 4AH2A 4EIZC 1N7MH 3ZO0A 4CNIA 2NW2B 5IR1A 1PVHA 1NDGA 1A0QH 1BBDH 1X5XA 5C6WH 4MJ6A 2ICWI 4O5LH 3ULUL 4OZFH 3ZTNH 4OZHF 2LAAA 4G42B 3ZT7A 3BGMB 1VEOA 2C3GA 1LK3L 4NYLA 2FEDC 1CU4H 1T04A 3T4YB 1MRCH 3LY6A 2Z35A 2AI0L 3MV8E 1JZ4A 2QSVA 1DBJH 3UYOD 3KPPB 3GJFK 2AEIT 5CJXA 1F90L 1BZQK 5CBAA 2GY5A 3O9WB 3GIVA 3MNZA 4OI8A 5L8KB 2C7UA 3GMPB 1DQLL 5IVOA 5GGSA 4YDKL 3B5TA 4CVXB 3TZVB 1BQLH 1ZLVH 5T3ZD 4HGMA 2Q8BL 5F88A 1TNNA 5T1LD 2H3NB 5DD6B 3MV8A 3QH3A 3QCTH 4R4ND 5F9OH 2P5EB 3QUML 3ARWA 5D7JB 2VZ3A 2EEAA 1ZS8A 3N1MC 3QXAB 5A43C 4AENA 4OIAA 1S3KL 2WBJA 3LPGA 5ACZB 4DFIA 5CJ5A 3VXRB 1OOAA 5KSUA 1PZ5B 3BPOB 3JV6B 4KGJA 2Y06L 3SGEH 2EXYC 4FFWD 3FRUA 1W72B 5D1QC 3NIDE 3L1OL 2NY4C 1T5XB 2Y5TB 1ETZB 1C16B 1DQML 4JFDB 1KJ2B 2W9DL 2JIXB 4IRJD 1J87A 1RK0B 4XZUA 1IC5L 2ORBH 4PRID 2EDFA 5CWSA 4F57L 3OKOB 5FECB 3FONA 4OCSH 4XNZC 2E9WA 1T0PB 4NFDA 2HA1A 1QHOA 4LQ1A 3MRBA 4OLWL 1H0DA 3AY4A 4XAWH 1VFAA 3V6OE 1DL7H 2QR0A 3ARRA 1DEDA 2HLAB 3NIGE 5E8EB 3TPUA 4PYHA 4OM0L 1YEJH 4OLVL 3KPLB 1XGYH 4F7TB 2EYSA 2IGFH 4H88L 4LAQH 4OCXL 3T0EA 3EYFB 4NUGL 3QT2A 1O0VA 1E4WL 3RBSA 4JN2B 5D7KE 5K9JH 3D69A 1UM4H 5HVHB 1UCBL 2OL3A 4ZS6D 5TQ2L 5E2WH 1CDHA 1F13A 4GO6B 2W9EL 1AXIB 4MB4A 3A0OA 4DCQB 3V6OA 3V5DB 2D0FA 4XVSL 3UEZA 1CGUA 3MODH 4M62H 3KLHD 3ECBB 2VO5A 2NNAA 3FO2B 4QOKE 1QSZA 2BNQD 1A22B 1SJHA 4PJFE 4PJBB 3CFIC 1AR1D 4N0RA 2VLKE 3Q6FA 1MH5A 2R0LH 5TGBA 1VHPA 1T1ZA 2XWBA 4QHMB 4PJXE 4ZAKD 3D0LB 5KVFH 3QNZB 3MR9B 2XN9D 1P9MA 5CKAA 8FABB 5JXAL 4J1UB 4K7PY 3UBXB 5FCUH 3MRMB 4NKDA 3SDYL 4JFPB 5JA8B 3MJ6A 4HIEB 4QHUB 3LZFL 4HKZB 4BSWA 5FO7B 2YZ1A 4DEPB 4QOKA 4PJFA 1MNUL 4PJDE 2VLKA 1BGXH 4LCWA 4X99B 3UAJC 3T2NH 3N1PC 1I1YA 4PJXA 1M7DA 1S7RB 4PP1C 1OP9A 2YXFA 4LVOC 1KLUB 3UJJL 1FZKB 1PKOA 1N3NB 4QLRA 3STLA 3UO1H 2CK0L 5F3BA 1J8HE 3GMOA 4C83A 2AXFA 1KCRL 3DSNA 1BJ8A 3EIFA 1A14L 4G43B 3VXNB 4F7PA 1MHPL 3BPCA 1VGEL 3HZMB 4PJDA 1IGML 3BGFB 1N26A 6FABL 5LJYH 3W11D 5L9DL 1NKRA 3INUH 3QIUD 1QLEH 2E27H 3U30C 5KVEL 3HR5B 5DGQA 4KRPD 5JA9A 3QXTA 1J8KA 1KJ3L 1PKQB 3EYVB 3TM6A 4HHAB 1MREL 4EUPG 1J8HA 1KNOA 2UZIL 3SE3C 5KSBF 4PJAF 3ZZ1A 2BC4B 2Q76A 4FMFA 5FYJH 5HYJB 4QHKJ 1II4E 4W68A 5F1IA 2YBRB 5GGUA 4LBEB 3FOLB 3O2DL 2PETA 5ISZE 3KLDA 4E41E 3QIWD 3TT3H 1FRGL 3MYJB 4QRRD 5CJBA 1OGAD 3N50A 4HFWA 5DRZA 4JDVB 3HKFA 3QO0B 5IM7B 3ZDZE 4PRAA 3MRPB 1G0YR 2F5AL 3WFHA 4OGYH 3LEVL 2QHRH 2J6EA 2Y36H 1HQRB 3BI9X 4JPKL 5FUZL 3PWNA 2R2EB 1NCCL 5DUPL 1AGCA 2JB6A 3GEWB 3RP1A 4U6HA 1S5HA 2NX5B 1NCDL 5JZ7D 2RCSL 4UOW0 1YA5A 4WFHE 1PDKA 5ISZA 3VWKA 5H35A 5TFSL 1U3HA 4S11A 1NEZA 2GAZA 1BQHG 3DSFL 4FTVD 5CLWA 4DAGH 1QFPA 1MVFA 5BV7B 3MLWL 4ELMF 3Q6GL 3RWDB 4XH2B 1PQZB 3QDJD 4RGOH 2A9NH 5EU4B 2APWA 4Y2DB 1FZOA 2OJEA 4HZLA 2NW3A 4KV5F 3G6JE 5HHPB 3GB7A 5IMLA 3UXFA 4PTUA 1F4YH 1C1EH 4YZFE 3WDHA 1LDPL 4X6DF 1HDMA 1AY1H 4MDIA 2GEEA 3LN9A 1K85A 3GMMA 3G5VA 1RPQA 5DQDL 2GT9A 3K2MC 1F8TH 5FHBH 3ARUA 1AH1A 3D1MC 4JQIH 4V1DD 3ESUF 3RVUC 5MI0C 1JHKL 3O3UN 3LQAL 2VWEC 1TVHA 4GMTH 2YD6A 4JRWA 4YO0B 4RAUA 5SWSE 1RZGA 2CD0A 2IBZY 4YBQC 1YMMA 1EAPA 3G6JA 3AREA 4N9GB 3HPLB 2E7BA 3VMNA 4HUWA 4KJWC 4W6WB 4APQA 4OLEA 3UDWA 4EDWH 4H25A 1IGCL 2R23B 4FQ1L 4XPTL 4PLJC 3FQNB 4Y7MA 5B39G 2DBLH 3DX7A 5D5MF 3W0WE 4Z76A 4KDTC 4IMKA 5HGAB 5GRUL 3KDMB 5DURD 4Y5YB 4DKFH 5ACLA 4YDJA 1MCCA 3CFJA 3ZYOA 2ICWA 4QHLA 5SWSA 4WW1B 1UWGL 2NCMA 2XTLA 4Z7NE 3HNTH 4JFQB 1JCKA 4R90L 2MCPL 5BJTA 4WWKC 2DIJA 5EZOH 5TDNA 4OZGB 1MCOH 3T1WA 5BW7C 1JFQH 5JXEA 5LGJB 5ENWB 3OGCB 3H3PL 4O2FA 4NN6C 5EO1B 1FNSL 4HH8A 1GRWA 1YC8A 4NQCD 3HFML 4U2YA 3HE7C 4HKJB 2GYSA 4PFEA 1UJ3A 3T0AA 5T1LB 5I1IH 4XXCA 4LOUD 5DK2B 5I19L 4HDIA 3GGWA 1Y6KR 4K8RC 4LQFH 3RA7H 3GSOB 1FG9C 2OTPA 4WFFD 3V8OA 3CVIH 1M4KA 4KFZC 3E6FA 1C12A 4L1HA 1K3ZA 3QRGL 3UTQB 4XBEH 1O7SA 4NHCH 3T04D 3IF1B 3EJZD 3EYQD 4XRCA 3IDIB 3RKDD 4IRJB 5D8JH 1D5BB 1N7ML 3GMNA 1I3RA 1FP5A 4JAMB 2FEEL 4HJ0D 2Z4QA 5DMGC 4GXVH 3BUTA 1A0QL 1BBDL 4NFBA 3ZTNL 3CSYA 4PJ8A 3OR7B 3H0TA 4M03A 3LAFA 5GZOC 1PFCA 2EIBA 1CU4L 3H9HA 5IQ9A 5I1DB 3QSKB 1DBJL 5CMAB 1K5NA 3WE6A 4R97B 2FJHB 3PWPE 4LKXA 3R4DA 3AM8C 2DQCL 4F9LC 3F5WA 2YN5A 5IHZB 3L3OB 4Q9CA 1XZ0A 1JTOA 4L9DA 1PY9A 1S5IH 3C8HA 3PE9A 1KTLA 4ZPVA 4I8DA 3GRWH 3NIDF 3RFZC 4JFYA 4JANA 4QTHA 4YFLF 5FYKE 2H9GA 3BT2H 5CEZE 2F54D 3G5YA 2VL4A 3QCTL 3LQMA 5F9OL 1ZXQA 3MSPA 2K3TA 4M4RA 2EO1A 4KVCH 3IDGA 1GAFH 4FA8A 2GITA 3KHOA 5DYOB 4POUB 4F3FB 3PWPA 1CGXA 1ZT7B 2KZ1B 4OAWA 2SEBB 4JR9L 4ZAKB 1AGDA 3C60B 2XN9B 3ULUE 5F72S 3MLYH 3S34L 5FO9A 1P7QA 3ET9F 4YIQB 3F7PC 5JDSB 5F9AC 3LIZL 3NIGF 5DJZB 3C5JA 1A9EB 1RU9H 3HI5H 3LH2H 3V0WL 3QUXC 2DMBA 1RUAH 2L0DA 4PG9B 5C6PB 1T0NB 3KPNB 3JUYA 3MRHA 1TQCC 4OCSL 4PJ9B 3OR6B 2CGRH 2DD8H 3QXUA 1CN4A 2B1HH 1EFQA 1HI6B 4KI1A 1E4XL 5IP4A 5E1AB 1ZKAA 1CD0A 1TZHB 4XAWL 4ZTPH 4KKNA 1DL7L 2OMBA 2NLJA 3CLFH 3MFFA 3WL9A 1FV1A 3QQ9C 1YEJL 4M61B 5E99H 1XGYL 4UDTB 4LAQL 4HH9B 5E95B 1I9EA 3CD4A 5H37G 1J05B 1ED3B 4CVZB 1MCFA 5K9JL 4Z78B 5F70A 3BIAX 4RFEB 1GPOH 1UM4L 4LPYA 3TIDB 1WAAE 2DICA 3MXVH 1XGRA 2YRLA 2CIIA 4L29A 4KRPB 3S5LA 3MODL 4M62L 4F7CB 5M95B 4IS6B 4N5ED 4UBDD 4PBWD 3SCMB 3RWEB 2CH8A 5FO8B 5A2LH 4DUXA 2A6IA 3QUMA 1HH9B 4U4BA 4DN4H 3T0XA 1YEHH 2R0LL 1C5CH 4FG6D 4PJDF 5IB5A 5CZXD 5KVFL 4X4YA 3HRPA 1DLFH 2DWEA 2OCFD 4HKXB 1U8QB 3U48A 4D9QD 5FCUL 2HVJA 4YAQA 1WAAA 4BH8A 3VXOA 4MA8H 4Q9QH 1CD1B 3IYLW 2F74B 4QXTA 2V5RA 4MQSB 3RHWF 4U1NB 5DZOA 2YD7A 5AYUH 1NFDF 4MSWB 4LLQA 2RJMA 1BGXL 1UKQA 4Y8AA 1IQDA 5E7BA 3NN8A 3OB0H 3T2NL 5IB3B 1XGPB 1EA9C 4PG2C 3QUKA 5I2IA 3TO4D 3BYYA 5DRXA 1T20A 1DVFD 1YY8A 3KWWB 3QXWA 5EC1B 3FTGA 3UO1L 3WEXA 5JOFA 2R1XB 4I0PD 1QQDB 3KPMB 3JV0A 4HS6A 4ZOCA 1S7XA 3QDJB 4JDZB 5FM5O 1H5BB 1BHGA 3W9DB 1ORQB 2HJLB 3BDYH 4FXGA 4JRYB 5HBBA 3INUL 3PQYE 1I3UA 5CHNB 2E5EA 2E27L 3VFUB 1IC4H 3MRCB 3GSXA 3DV6A 4RAHA 2A6DA 1TJHH 5DK0B 4L8SC 3VFTB 3WNOA 1QRNB 4RAVA 1TVBA 4BQ6A 1HHJB 4Q2ZB 3ZDZF 1LWRA 4M7LL 1SJEB 3GJFB 5FYJL 4HG4J 4J2XA 2CDGB 1VEMA 5EO0B 2UUDK 3K1KC 4GG8A 5E94A 3PWUA 5DR5H 3O6FB 4S1QH 1A1NA 3K0WA 4R2GB 5C0RH 2A77H 3PQYA 3TT3L 1IM9A 1MAML 1XGUA 3AFLA 1RHFA 3S8WA 2DQDH 1UQSA 2E9IA 5E5MA 4NO5A 3EJJX 4J4PD 2EDLA 5D2NE 3STBA 2J8UB 4X5XB 3HE6B 4N0UE 5I8EA 3DLQR 3UTOA 4OGYL 2P48B 2QKIB 4YGAB 3LKRA 3OKYA 3PUCA 5E56A 4U1KB 4C58B 1IL1B 4S0TD 5IEKB 2O93L 5DC0A 3G6JF 1CL7H 3CDCA 2HT3C 4EN3D 2Q7YB 1LE9B 1AIFB 5LWYL 2D31A 2ZKHH 2YSSA 4E0RB 5DJ2A 3DXAA 2XFXA 3HI1B 4Y4FD 1A4KB 3STZB 4ODTH 5I8CB 1GGYA 4XBGA 3GMQA 4PJIB 4DAGL 4HFUL 2IMNA 3QEQE 5EUKA 5D2NA 4MX7B 4XAKE 4RGOL 2A9NL 5DFTA 4N0UA 2XNAB 3HI6H 1M1SA 3MRJA 4OV6F 1AGEB 2G75A 2VXVH 3T4AB 5C0EA 4UU9A 1F4YL 1C1EL 4EBQH 1S7QA 3ROOA 1F2XK 4JPWH 3ZKSD 1IZKA 1AY1L 4PS4H 1S9VA 1MCPH 4PP2A 5KVGH 1JNNH 3MRGA 4U1SB 4KUZL 4GW5A 1F8TL 4WI7A 5FHBL 1CXFA 3C5SA 5HJ3A 5GS1C 4JQIL 4Q9RH 2DWDA 1U92B 4XPBH 2UYLB 4O2EB 3AS2A 3EYSH 3QEQA 4GMTL 2UWEE 4L3ED 5BOZG 5HGBB 1JPFB 1YEDB 4CADA 2CKBL 5DJ6B 1M05A 4Z7NF 5IB4A 2R1WA 2V5MA 3QRFM 3O2DA 3VI3F 1MJUL 3EW3B 2KH2B 3OWEA 2AK4D 5JUEH 2DBLL 4QRQA 1P84K 2AK1H 4OCNC 2PXYC 4JCMA 1UH4A 4DKFL 1JGEB 4J3VA 2AJ3A 4TNWK 5KZCD 2UWEA 3IS1X 2Q86A 3KS0H 4BA8A 4HKBA 3P9LB 1U95A 2EXWC 3DX9B 4GRWH 5FUCE 5EBLB 4OFDA 3HNTL 3FFCB 3EO0A 4OFPA 3J7HA 4R96B 1IAOA 2ZUXA 5EZOL 3UBXI 4H5SA 4BZ2H 4AEHH 5ITFA 1JFQL 2G5BB 4JFOB 5D7IF 4P5KA 4GXUN 1T83C 2NXZD 3IU3A 1T66D 2HMIC 4TVPL 2LVEA 2W38A 4P4KD 4K3EH 1T3FA 1G7PB 1HE7A 4P5MB 1K9TA 1UCTA 1JZ8A 5C0AE 3KLAB 3VXPA 5J3HC 1YYLH 5KSAB 4FN0A 5EU5A 3DRTB 3U9UA 3KR3L 3C09C 4FQQB 5D1ZD 5D6DA 5I1IL 4FQXC 3ZT6A 3EFFB 5C8JA 4ONGL 2A9MH 3RA7L 3VH8A 4YH6A 3AMLA 2ICWJ 4QHNB 3CVIL 2AKRA 3V4UH 3MRFB 2PKDA 1YUHA 2GTZB 4C59B 1ZOXA 5HHQA 1A6ZB 3FQTB 1IMHC 3DYMA 4FQJH 4XBEL 5GGQL 4G6FD 4NHCL 3NA4A 1QO3B 3Q5OA 1HYSC 4PY7B 4UQ2B 1D9KC 5AAWA 5I16A 1NPUA 1AI1H 3U6RA 1G7HB 1U8MA 5D8JL 1QLRA 2HN7A 2BVPB 3NGBB 4LRIA 5J1SC 1XF2A 3PL6C 5CCKL 3SJVD 4GXVL 4E9LA 1JI1A 5LXGH 1IM3B 3SKOA 3LKQB 2HFEB 2ARJA 5HPMA 3DMMB 2OMNA 1AR2A 3BUYB 4G9FD 2ZSWA 5EZLB 3ALPA 3SDCC 2ED8A 3JVGC 1TETH 2DYPB 1OAKH 5D1XD 2VAAB 3FT4A 3RZCB 4PTTA 4G6AD 2HTLC 1T89C 2BVYA 5EU6E 4ZYKA 3N1QC 4I4WB 3P4MB 4GKSA 1A1MA 4A6YH 1S5IL 1HHKA 2D4DA 1N5AA 3GRWL 3ULUF 2AQ1A 5ESQB 2F9BT 3CUPA 3BT2L 4LKCA 2XTJE 2X9WA 1OT2A 5EIIB 4KWUA 3MLSH 3LB6D 1ZT1B 1S7UB 4AK1A 1GAFL 3QIBB 3QQ3B 5H94B 4NQXB 3DBXB 4RWYH 4POYA 3ZLQC 2YWYA 4HS3A 2BOBB 2H26A 4XNMA 5A2KH 3MLYL 5GGVH 1W0VB 4CMHC 3V5HB 2GSGA 4AIXA 2FYYA 2X4QA 2VZVA 4Y19B 4KROC 3L5WB 1RQ5A 5DZNA 5BRZB 1BIIA 4YHIB 1RU9L 1BBJB 3IFPB 3HI5L 3LH2L 2VMFA 4P59H 1X5ZA 2H2SD 1BX2B 4X6BB 2ITCA 5E00B 4XWOC 2OYPA 2CGRL 2DD8L 1OSZB 2ZZUT 3O3EA 3TBTA 1SBSL 4YDIH 4ZTPL 5FOJA 4HUUA 2WMPA 4NKMB 2E9BA 1EEQA 3CLFL 1JUFB 4NDMB 4WWID 2ZNWA 5E99L 2FO4B 2ESVD 3QJHB 5L6YH 3FOMB 4PR5B 5M7QA 3IDUA 2VERN 5J12B 3OF6D 2R0KL 4BFGA 3VXUB 4JG0H 5D93B 2XZCH 5FV2A 1J0ZA 2HYMA 2BHZA 3OV6A 1GPOL 1ZWIB 2ZCLH 3B8SA 3MXVL 3VXTA 3O9WC 4FFVD 4XHJC 3I75B 5DXWA 3WLWC 3H8NA 3C5ZD 4GKZB 5CJOH 5IJKA 5F89A 3IKCB 3TPKA 4P4RA 2IJ0C 4KZDH 5DVMA 2P5WE 4OZFG 5GGVY 2J8HA 1Q9LB 2MQCA 2D2OA 4HCRH 1YPZB 2EZ0C 4M6AA 4DN4L 1YEHL 1C5CL 1U8NA 5C0JA 2OTUB 4Y5VB 5KOMC 1BVKB 3MUJA 1X44A 5D7JC 3DVGA 1DLFL 1J9CT 2QSQA 2D7OA 3V95A 5E8NA 3RVWD 4MA8L 3TZVA 4Q9QL 2J1KA 2APVA 3BPOC 5CGTA 5JNYB 4A2LA 1SM3H 2GTWB 5LGHH 3ZE1E 3L9RA 3OSKA 4MHHG 4L9LA 5AYUL 2P5WA 1KB9J 5F9WC 2PTTB 2V9QA 1CXEA 3FQXA 4IOSD 3RWIA 2VL5B 1ZLWK 1C7TA 3EOAA 4FZEH 5GIRA 3IJSB 1TZIB 4CU8A 1I75A 3FJTA 1CFVH 3PDDA 3HZYB 3DHMA 1YEKL 3EOTH 2F53B 1EO5A 6CGTA 2C1PB 3KXFD 3NCJH 3FQUB 3VA6A 1NUGA 1RV6X 1G84A 3OKKA 1QSEE 1A4JA 2NYYC 4XC3H 1GH7A 2CIKB 2J5LB 1AXSA 4LRNH 3BDYL 3OPZH 5FECA 2BXYA 4JN1L 1GGUA 4GW1A 1QKZH 1IC4L 4MQXD 1RD6A 4Z7UE 4NCC2 1TJHL 4N8VA 4OFVA 2Q6WB 2C3VB 2X1PA 3RDTD 1TCMA 1JN6B 2DM4A 3QDGD 4WJ5A 2HLAA 1TJIL 4GQ9H 4YFDB 4EIGB 2WSKA 1QSEA 1EAJA 1B90A 2FH8A 2R1YA 4JDTH 3D18A 5JMOC 4JJ5A 4L3EB 1FL6B 4H1LG 5DR5L 1Q9WB 4Y2OA 2AQ3A 3PP4H 4S1QL 3IU4L 1I8LA 5C0RL 2A77L 3MNWA 4GKNB 3WIHH 1NGQH 4U6XB 4BSVB 3LKNB 3O8XD 4Z7UA 5CSBA 2DQDL 5HDLA 5GS0D 2BDNH 4RZCA 2HT2D 2H2PD 1KTDB 3CFDA 1VA9A 4P3WA 3SY0B 5J1AB 1GJIA 1ZHNB 2H41A 3Q3GA 4K3JH 3W2DH 1SEBB 1J1PH 2V5YA 1HEZB 1CL7L 5B38A 5KZCB 4YXHH 3TBSB 3QJFB 3BKMH 2ZKHL 4GSDH 4EI5A 4QHMA 1W0WB 4X5WA 3S36H 4RGNE 8FABA 3DETC 2HVKA 4GBXB 4KK9D 1RUMH 4Q0XH 2HJKA 5EORH 1ZLUK 4NQSA 4NBZB 4JM2B 4HIEA 3HC3H 3HG1D 3OKDB 2O5XL 4PGCB 3QUZD 3HI6L 2UWEF 4P4KB 2VXVL 1P7HL 4U0RC 1NGWA 1G7JB 2VE6A 4U49A 4GKOA 2GFBA 4EBQL 3I50H 4OLUH 1IGJB 3REVB 3N9GH 2RGSA 4PS4L 1KPRB 1MCPL 5KVGL 1JNNL 1R3IH 2BVQA 3BJLA 1FL3A 3BGFC 1KLUA 1D5MB 4Q9RL 1ADQA 3IDJA 4XPBL 2WK2A 4FHBD 1GIGH 3EYSL 5FF6B 4MWFB 3V7MA 2AW2A 4KK6D 1XIWB 5ABDE 2B1AH 3FN3A 1IC7H 1RVFH 5KSVA 3MJGX 2R2HA 4Y1AA 1DE4A 4G43A 5FGCB 3SKJH 4G6JH 2K7QA 3MLXL 1OF2A 3UCRA 5JUEL 5F1SA 3X13B 3OJDB 2AK1L 1M6OA 2WAHA 5IK3B 3FMGH 2G2RB 2H1PH 2EDJA 4RBPH 4F58H 4NO0B 1INQA 5JOPE 3V6FB 3B43A 1WWAX 1X5HA 4P2RE 2BC4A 2CDFB 5K9OB 3IGAA 1JV5B 5EU7C 1UC6A 4X7DC 1I1AD 2NX5E 4E5XB 1CDJA 4LSTH 3T1FA 1QBAA 5D1QA 4JY6B 4BZ2L 5D1XB 2NY2D 1R3LA 1FNEA 1W72H 2B2XH 3CGTA 4PGDB 3TGXA 1W2KT 1U8KA 3BVNB 2NY0D 4RA0C 2ARWA 3ULVC 1DR9A 3VXQA 4WFEE 5IM7A 5DJDA 4K3EL 3HZKB 3TNMB 1EUTA 2JJTC 1KUMA 2AJXH 3MRPA 1MAJA 3ZE2E 1IGFH 4OD2B 3HMXH 3L3HB 4P2RA 1YYLL 1MY5A 2X5PA 3IDMA 2ILLA 3IRPX 3O6KH 5MHSD 2BZDA 1BFOB 4OZ4B 1TLKA 3KPOB 4NNXA 5IIEB 4CUCA 3V4UL 4HZAA 4MJIB 3L3IA 1GSMA 4Z7VB 4FQJL 5I1CH 2BK8A 1FC2D 1PQZA 3L5XH 3ILQC 3SDXB 4NGHH 3NPSB 1AI1L 4NOBA 4P23A 4D8PB 3VGDA 2CKBA 4F7EB 1RK1A 3CFKB 2GQHA 4J3SA 5CINH 4PJEE 5C07D 5J6GA 3FQWA 5MERA 1B0GA 3BW9B 1J86A 3BEWB 4ZFOB 5EPMA 2EKJA 5LXGL 5GGRY 4HV8A 4TVPE 5JIPA 3KYMB 3LEYL 3DVIA 5FA3B 1VFMA 3TF7C 1DQJB 3VXMB 1LP9E 5I1HH 2WZPD 1SJXA 5DEGB 1TETL 1OAKL 3B9KA 2BSTB 2I5YH 2BNRB 3E8UH 4PJEA 3FQNA 4OZGE 5KJRH 3BP5A 5E4EB 5D96B 3SO3C 4A6YL 3DX8B 3OB8A 5C09E 1VADA 1CCZA 2PN5A 4LLDA 4OLYH 2DJUA 1OAQH 3C5ZB 3UX9B 1HK6A 1LP9A 5F7DB 4ETQB 3LRSB 5AZ2H 4OV5A 4PB9H 5D6CA 4JZJB 2V7NA 3MLSL 5HVFB 1P69B 5J89A 3QEHB 4OT1H 5IT2H 2XZQH 3LPFA 2BVUA 4KKCD 5EBMB 1RAMA 1G7QA 1AP2A 5FYKU 4RWYL 1YEGH 4OZGA 4G8FA 2W0PA 2AJYH 3MROB 5GSRB 3LKOB 4LPTA 3ILPB 5GGVL 2EDXA 5DUMH 1ZT4A 4S0SD 5C09A 3NZ8A 5T3XH 4JY4B 4LCCA 4FFZH 1MHEA 5D71H 4L4TE 3V9FA 3QNYA 1HKLH 1LEKB 1P53A 4P59L 3VW3H 1HHGA 1FJ1B 3P3YA 1C08B 3VGBA 2OS7A 1Q38A 2YD1A 3BWAA 3VRLF 4IRJC 4BUHA 4ORGB 1QA9A 4YDIL 3B8YA 3CJJA 1CXHA 2L4OA 1J0JA 5IJVA 3UTQA 1RIUH 4D9RD 1DUYB 2NZ9D 2O61A 5JTWA 3PHSA 1NMBH 4F7MA 1I4FB 5ID1A 5SX4I 3VA2C 2BSRA 4L4TA 5J13C 5L6YL 3L95B 3QR2A 3VGGA 1U8PB 1DBMH 2DIBA 3DVFA 3P9MA 4LHJB 4XCYB 2OBGA 1D5BA 4O02H 1EK3A 2XZCL 3VCLB 2WW8A 4JAMA 2ZCLL 4R97C 3ZKXB 2GHWB 5CJOL 1N0XH 2B7DT 1A6PA 1EJOH 4HIHA 1T5WA 3OR7A 2IWGA 5E7FA 4M48H 1MCQA 5D2LE 2X89A 4KZDL 3IAPA 1XT5A 2QV2A 2X4OA 2DRUA 3LN5B 4ONHA 1NL0H 3ZE1F 5I1DA 2ENYA 1NCUA 2R29L 4HCRL 5BOPA 4HG4K 4LSSH 3LSOA 3PIQB 3ULVH 3HAEH 3KLHC 4DZ8B 1U58B 2VWEE 1AO7D 5SWZD 1AR1C 1QPXA 4NQDE 4UIMA 4AM0A 4HX1A 1W0YT 1P2CB 4ZAKC 3PDGA 5D2LA 1SM3L 1WC7B 2OR8A 4D0BA 5LGHL 5I71B 4HMEA 1A6TA 3AXLB 2Z91A 3N85H 3FAXA 3IDYB 5CSZB 5A2FA 5TE7L 4LF3A 3TN0A 5EBWA 3SKNA 1H15A 2CO7B 4FZEL 4JGMA 1CE6A 1CFVL 3O3AB 1QUNA 2XRAH 3D2UB 1IAII 4NQDA 4Z7UF 2LAGB 3QFDA 3EOTL 1MY7A 3ARBB 1NGYB 3G6DH 3QWOA 1JNLH 3NCJL 4DW2H 1WZLA 1F2QA 4Z7OF 2J8OA 3VGHA 3C6SA 4GH7B 2ITDA 4XC3L 2VKWA 3ARFD 2H32A 1NGXB 2BY0A 5DJ8B 3VXSD 5AUMA 3O2VH 3T0WA 5E8OB 1S9WB 4LRNL 3OPZL 3BPNC 4X6FB 1J7VR 1KJMA 3HC0A 1QKZL 4XB7A 3DURA 4ZFZB 5HYSB 4WU7B 5L2KE 1SBBA 2Z9TA 4U33A 3OG6B 1X5LA 3W11C 4OGXH 1EEZA 3D39D 4PGEB 3QIUC 1Z0NA 4JHWH 5T1DL 2AJZB 3VG9C 3GSUB 2AAVA 2XG4A 4WWKA 3V2AR 3V8CA 4JDTL 2VIRA 3A6OA 4KRPC 2D7PA 5DT1H 5LVEA 3VD9A 4GRMA 5BW7A 3VFGH 1D7FA 3EGSB 2W0FB 3GMRB 3PP4L 3M45A 4LMQE 3VD4A 4PJ5D 4HXAH 5TF0A 4OZHB 5CIPH 4Z78A 3WIHL 4P2OA 4YXKH 1NGQL 4MNHA 3S96A 1TJGH 3TIDA 2BDNL 1CG9A 5L2KA 2VDOH 1NCBH 2J88H 2FO1A 1RJLA 3DUSA 2NY1D 4KI5E 1BZ9A 5T3ZH 4K3JL 3W2DL 1J1PL 1S7SB 4YXHL 2W92A 3BKML 4GSDL 3IJHB 1BD2E 1BVLB 3RX7A 2BVOB 5F96H 3OXSB 2G9HA 4KMQA 4RIRB 1E4KA 1A3RH 1RUML 4UINL 3BZ4B 4Q0XL 5HGDA 5EORL 4WW2C 4OUUA 4ZSOE 1VKXB 3HC3L 1RJZB 5F9JA 3S97C 2DDQH 4M7KH 2F74A 3X3GL 1DBBH 3O6LH 1Z6JT 1ITBB 5J11C 3OAYK 4E42A 2COQA 3I50L 4OLUL 4JLRA 1YDPA 5E0QA 2DKMA 3N9GL 3IT8D 4WV1B 3BZEB 5CEYB 4JRYE 3MREB 5IKCB 1R5IB 1BD2A 4HULB 2AXGB 4J3XA 3MV8D 3B4NA 4AEIH 3TC9A 3G6AB 1GIGL 4ZSOA 5E24E 3QFJB 2IEPA 3GSQA 3S9DB 2WBJD 3OAUH 5TDOB 2B1AL 1IC7L 1RVFL 1QQDA 2BSSB 4EDXB 2A1WH 1PGRB 2QL1A 3QZWA 4KQ3H 4F9LA 3SKJL 1X5GA 5FDYA 4GRLA 4BFEA 1H5BA 3CSGA 4G6JL 4X6CA 3RX8A 4S1SH 2HJLA 1IQWH 1CFQA 5ADPL 1H3TA 4JRYA 5FKPA 2MHAB 4GLRI 4OF3A 1HXYB 4S1DC 4K3DH 5C07B 4R2GC 1U8HB 4ZXBD 1D6EB 2X42A 3FMGL 4KGLA 2H1PL 2J8UE 2VJXA 2EXYD 2FJFB 4R0LB 1T03H 1T1WB 3ZE2F 1V7MH 1NC2A 1U8JB 2IANB 4OKVA 3KPQB 1JMXA 2GK0A 2AJSH 4I48B 1AD0B 5F3HB 3W9EB 1FVCB 4LSTL 4NKIH 4PJGE 3K4DA 2IADB 3K4AA 3WXWH 3MMEA 1KELH 1J0HA 1W72L 2B2XL 4M3KB 1FG2A 2Z93B 3HCVB 4KXZI 3QUXA 5DMJB 2FZ3A 2AJXL 1FFNA 2DI9A 1IGFL 2I9LB 3HE6A 4WUKH 3HMXL 3PABB 5I1KH 1KCSH 2QKIA 3ARDB 5IV2A 4GG6B 1MHCB 5DJXA 3RQ3A 1RMFH 1C5BH 3O6KL 5DD0H 3KNBA 5F7HA 1QFWH 1D5ZA 1S7TA 4GAGH 4Q6IB 2ATKA 4PJGA 1TQBB 4PJEF 5HVGB 2CMRH 1X6LA 5KVDH 3RVVD 5I8CA 4PJHE 3HZVB 4OIBA 2A6JB 5INDB 5I1CL 4YGVA 1LK2A 4MX7A 5D7KD 3IJYA 2Y72A 2OR9H 3L5XL 2R56H 3O4LB 4NGHL 2IQAB 4XP5H 2ZUTA 5GRZA 2B0SL 5IF0B 2YA0A 4PLKD 2RBLA 4WNQB 5CINL 5HI5C 1PG7H 1JTPA 1JZ7A 3EJZC 4OZGF 3VFVB 1WTLA 4H26B 3QI9B 4PJHA 3RKDC 3L5HA 5LQBH 1FZJB 4OQ1A 1K4CA 4DQOH 4KRNA 4GS7B 3RL2B 4HJ0C 1I8KA 3GSVB 3S5LG 2YWZA 5I1HL 1FPTH 3CDYA 1WIPA 1YEEL 1MRFH 1YEDA 1FCGA 4CMMA 5DJ6A 4IMLB 4ONOA 4FXKA 1ZK9A 4WHYH 2HKFL 2I5YL 3E8UL 4NZUH 3U46B 3ALXA 5KJRL 5IW3A 1DDHB 3UAJD 5J6HA 5JORA 1IRAY 3QXDB 4ZUWB 4LCYB 5JW4N 4PJAB 2PCPB 3HHRB 4LLWA 4NRZA 3I3EA 5CEXB 4OLYL 4I0KA 1NANH 1A6AA 3QG7L 1OAQL 5IROC 1MCSA 4YHZH 5AZ2L 4PB9L 1GZPA 4NSKA 3DX9A 4PGJA 3ROLB 5EBLA 4OT1L 1D5XA 5IT2L 2XZQL 3H7BB 1EERB 3M17B 2OZ4H 1HINH 4LLMA 2X4PB 1J8HD 2H45A 4PRHE 5C9JB 1PX4A 1N59A 1YEGL 1OGTB 4ZUVA 3FT2B 3N1FC 2AJYL 1P1ZA 4KDVA 1YNLH 5T1KB 3RWFA 2P45B 4W4OC 2VLME 4NO3B 1HN1A 2ERJC 4R6UA 5T3XL 4FFZL 4NWTH 5D71L 5IHUH 3VFMB 3MA7B 3QPQD 4HWBL 2Z8SA 1HKLL 3VW3L 4C4KO 1CDBA 5MENB 2I07B 5MEQB 1KB9K 1KG0A 1SY6H 5JO5B 4PRHA 4QHNA 1T2XA 1G6RB 1SQ2N 4OF0A 4I5BB 4K3GA 3CC5A 2ICEB 3C9NB 2BJMH 32C2B 3EKCA 3FQTA 1RIUL 4NQVA 1OM3H 4WI6A 1J88A 4E41D 1QO3A 4GQPH 1NMBL 3GJFH 1UB5B 5EZJB 5SWQA 5SX5K 4AIZA 2BNUB 1DBML 3BN9D 3IDNB 3PJSA 4LHUB 2E6QA 4O02L 5FDWB 2A6KA 3BH8B 1F3JB 5L0QB 3FN0H 3L3KB 2VZ1A 4Y4HB 3ES6B 4A6YA 5EG6C 5JHDD 1N0XL 1EJOL 4M48L 2HFEA 4Y4KD 1B0WA 4QT5A 3DMMA 3UP1A 1ZVSA 4YDVB 1NL0L 5CP3H 1MPAH 4H0HB 5EZLA 4MLSA 4HK0A 4OCLC 4LSSL 4N90E 1VFUA 3RZCA 3ULVL 1IT9H 1WZ1H 4N5EC 1CICB 2UVFA 3GSWA 4ZFGH 4XNQA 4QF1B 4DKDC 4PRDB 2OK0H 3JWOC 5CJQH 3ARED 1JNHB 2I9TB 3TLRA 1BFSA 2W65B 3PNWB 4APQD 5C0CD 3ETBF 1MCNA 2O5ZH 5K9KA 5KN5A 1ZVYA 5CZXC 1OARH 3CZFB 1R3JA 5ICXA 4AH2B 4NUJA 3N85L 5ANMB 4ZOAA 5HYQA 1MI5D 5IR1B 1MIMH 4MNGE 1MFCH 1S7UA 1NDGB 2KDGA 4HBQA 3TJHC 3QIBA 4QY8A 2YZ8A 4LGSB 3VFWA 1L9NA 3BE1H 5SWSD 1JMZA 3MA9H 2XRAL 2IPUK 1ND0A 2ZUUA 4NPYB 1WIUA 1T04B 4FXLA 2Z35B 4F2MA 4ZD3H 4RMSA 1JNLL 1EEYA 4DW2L 2FECL 4HWUA 1EVTC 3TO4C 3L5WA 5CBAB 1T80A 4Y8DC 3WFBH 3OG4B 3AU1A 3GIVB 5SX4H 3W0WD 2CRZA 5JXED 2C7UB 3O2VL 4MNGA 4QO1A 4I0PC 5GGSB 4IOIA 3H3KA 3MXWH 4LVHB 2K9UA 5F88B 4C55A 4RDQF 5DTFA 2E8ZA 2ZCHH 3EOBA 3MV8B 3QH3B 4OLZH 5GQBA 4OGXL 3CFEA 4NRYA 4JHWL 4WI5A 4XVUD 1ZS8B 5E8DH 4KI5F 3SKUD 4I18C 4AENB 2PO6A 5DT1L 2N4IA 4HCRA 1R5VA 1EHNA 3VFGL 5KSUB 2VDNH 2V2XA 3HE7D 4IRSD 3FRUB 4HXAL 4HK3N 3QP3A 4YXKL 1Q0XH 1AE6H 1ZANL 3CU1A 4U1JA 1TJGL 4QRUB 4Y5VC 3O11B 4K8RD 1KN4H 1E0OB 2VDOL 1NCBL 1KCUH 2J88L 4MAUH 4XZUB 2YS4A 3PF2A 5CWSB 1RJYA 4MVBD 5LG1A 5T3ZL 3FONB 1IC1A 3EDEA 5FYLD 3RY6C 4LCUA 1MAKA 4UZGA 5K9QI 4J4PC 1I9JL 2X9YA 3MRBB 4U3CA 2I60H 1H0DB 2CDEA 1UXWB 3SEPA 3TPUB 1A3RL 1Z9OA 4EN3C 3B6SB 2VXSH 2EYSB 3CVHH 3T0EB 4Y4FC 1DBBL 3O6LL 1JTTA 3PXHA 3D69B 1EFXD 4JY5H 3O45A 2OL3B 2LABA 2GJ6D 2MFNA 1FGNH 3BPLB 4MD4A 4MCYA 5F9DC 4GW4A 4NT6A 4AEIL 1KYOJ 2NNAB 2XY2A 1Z5LA 1SJHB 1FNGA 1I85A 2F5BH 3RGHA 4YBLB 3C87A 3PWPD 2J8UF 4R7DA 1MH5B 3OAUL 3SN6N 2A1WL 3L7EA 5TGBB 1H3WM 2XWBB 4KQ3L 4F9PA 1FYTE 5TF1H 2D7MA 4JPIA 4S1SL 1IQWL 4NKDB 5FHAH 5FYKD 2NMSA 2KQMA 3WIHA 2DMCA 2CKNA 4K3DL 4XB8A 3CH8A 3QDME 1HWHB 4QOKB 4C54A 1Y6NR 4PJFB 2BSED 1DEEA 2VLKB 5ACMA 1U93B 1T03L 4KHXH 4LCWB 1OQXA 2KZWA 1JP5A 1V7ML 2YC1B 1I1YB 4PBVC 4PJXB 2Z31D 1M7DB 2W60A 1FYTA 2AJSL 3JWOH 3QXVA 1Q9WA 4K94C 4IDLA 4NKIL 1FAKT 3JBG7 3QUYD 1S8DA 5F3BB 3X11A 1XCQA 1KELL 1TTUA 4C83B 2AXFB 5IVXB 4PJ7B 3QDMA 3VD7A 3TYGH 4PJHF 3T65A 3BRGC 3CAFA 5A3IC 4U7SA 5DUBA 4GBXC 4F7PB 3BPCB 4WUKL 5I1KL 4PJDB 2VLJD 5CFHA 1KCSL 3UTZA 1A64A 1NAMH 3NZHH 1RMFL 3QEUA 1C5BL 2NXZC 5DD0L 1T66C 1QFWL 1J10A 4EUPH 3DGGB 3QJFA 4P4KC 4ZOBA 1CIUA 3DHJA 4GAGL 4L3CA 1A02N 4WTZA 3GBLA 3TO2A 1J8HB 1KNOB 5GJSH 5KVDL 2MQ0A 5D1ZC 4OI7A 3SGDI 4JM2A 1CGSH 5F1IB 1E6OH 2EDBA 3T8XA 3VGAB 2OR9L 4PGCA 2D0HA 5JW4Q 2R56L 4XP5L 4LPXA 5FGCE 3JSSA 2DB8A 3MBEA 5BS0D 3VFNA 5BXFA 4YQXH 4HFWB 5DRZB 1PG7L 1U8IB 1CFNA 3FO0H 4PRAB 1JPST 2MJWA 3WFHB 4KK8C 2YKLH 5LQBL 3PWNB 2BOCA 1CI5A 2JB6B 3P77A 4MB5A 1KPUA 5FV1L 4U6HB 1S5HB 3V7AE 3CK0H 3S3PA 5GPRA 4LNVA 2EE3A 4WEMB 3TEUA 2YR3A 3TA3A 2DLEA 1FPTL 3VWKB 5ISZB 1BF2A 1MRFL 3VFRA 4MA1B 5JHLH 1U3HB 3WMSA 1EDQA 1NEZB 2GAZB 2X4SA 2XWTA 5GGRA 1EVUA 4NZUL 2D9QB 1F3DJ 1FLRH 5GRXG 1OHQA 2X4UA 5J0BA 1U2HA 3C2SA 2NW3B 2OJEB 4Z7WE 5IK3A 5D1XC 3GB7B 4PTUB 4G6AC 4NO0A 1GZQA 1ORSA 2BX5A 3MOAH 3BESR 1NFIA 5I17B 4OCMC 4P3CH 3HMXA 1QBMH 5IFHL 4YHZL 5K9OA 4HIXL 4HUNB 4PRPE 3PWVA 1JV5A 4MDIB 3T2PA 3GMMB 3TVMA 3G5VB 2OZ4L 1HINL 3CXHK 1GGBH 3U4EA 1A7PH 4PRBB 1S7WA 1TVHB 4RAUB 3LB6C 1YNLL 1AC0A 1RY7B 1MJ8H 4Z7WA 1YMMB 1EAPB 3G6JB 2RQ8A 3AREB 4P99A 3PQYD 5IEHA 4HUWB 4APQB 4NWTL 4YHNA 5IHUL 2AXJA 4L8BA 1H8SA 1ZHLA 4PRPA 4WEBH 3UPCA 1M71A 4YK4B 5IMOA 1RZ7H 1NCNA 3HNSH 1B9ZA 2B8OT 1QPPA 3DX7B 4LPWA 4Z76B 2DAVA 1WK0A 1SY6L 4OCYH 2IAMA 2QLVB 1JPGA 1JGVH 2CLZB 2DQGH 4ZPTA 4YDJB 4Y5XC 5IIEA 3CFJB 4QHLB 1ZLVK 4K9EC 5LKNA 3MRNA 3DRQB 4AG4H 3OJ2C 4MNQE 3NMEA 2BJML 3FRPA 1OM3L 3X14A 5BJTB 4JVUA 5TDNB 4QRSA 3OX8B 4F7EA 3CFKA 3NOIA 5BVJA 3D48R 3MGOA 4YC2B 4Q74A 1VESA 2YMXH 4O2FB 1T2QH 1CD9B 3FN0L 3NCFB 2CK2A 4JQVA 1YQ2A 3ARPA 4MNQA 4Z5RA 1FO0H 3KYMA 5D96C 5E4EC 4FS0A 1UJ3B 5T3XE 1YNTA 4NNPH 2NY6D 4K94H 1DQJA 1OB1A 2ICCA 4TSAL 1JL8A 1MPAL 4HDIB 3GGWB 2PR4L 4FFVC 3C5ZC 4S10A 1LMKA 5FKAB 4G8GE 2BSTA 4JZJC 1IT9L 1C12B 5C0BE 3LS4H 4ZFGL 4TUKL 4UTBH 1IZJA 3GK8H 4D9LH 5EA0H 3DX8A 1EPFA 4HUXA 2XA3A 4XRCB 5E08H 2O5ZL 4OFYA 4YBHA 4WHTA 1OARL 4Y88A 5FM4A 4ZUSA 3HUJE 3WV0A 3GMNB 4Z0XA 5L2JA 4HWBA 4WCYH 4UT7H 1DN0A 1MIML 5DJ0A 3VDCA 2R4RH 4WUUE 3QEHA 1MFCL 3MLTA 2Z4QB 3IKKA 5KOVC 3ARGB 4G8GA 3JXAA 4M7LT 4D0CA 1UZ6E 3CSYB 5C0BA 4PJ8B 1X3DA 4F33A 3ZKMC 3H0TB 1WSST 3RY4A 1VSCA 4NC1E 1P6AB 3H9HB 3LKOA 3ILPA 5IQ9B 4QRPE 5EU7E 4ZD3L 2UY6A 3HB3C 1BEYH 1K5NB 3WE6B 2PXYD 3NFNA 3QWQB 2GJZA 1FSKC 5F6IC 3HUJA 5B8CC 4LKXB 3WFBL 1MLCA 2Y1VA 3C6LA 3F5WB 5FGBC 1YPZF 4WUUA 4Z9KB 1XZ0B 3ULVE 1YC7A 1KTLB 3MXWL 4TSCH 4ZPVB 1MWAH 3W39A 4JFYB 4JANB 2H9GB 3MOBH 3G5YB 4M9PA 4OLZL 2ZCHL 4QRPA 1NUNB 1QHPA 3ZKXC 3MRDB 1E27A 1QOKA 3IDGB 5E8DL 2HMID 4EJ1C 2GITB 3D0VA 2YD2A 3PWPB 4XT1C 5CBEA 4UV4H 2AEQH 3WKMH 4OAWB 2FR4A 5DA4A 2D7NA 3RDTC 5J3HD 2XT1B 2VDNL 3BAEL 2R9HC 1AGDB 3RGVA 3HAEA 3BD4A 4XPAH 1Q0XL 1AE6L 5FO9B 2WP3O 1P7QB 2JJTA 5C0AD 4BFBD 1KN4L 2XY1A 3C5JB 4LU5H 2VZOA 3WUWB 3MNVA 4KAQL 1AKJD 4MAUL 4XCNB 2DL9A 4HUMB 1X5KA 1T7WA 2BY1A 5C6TH 1M7IA 4HIIB 2MWCA 3MRHB 3O8XC 1HOCA 5IUSA 5DVOA 1HYSD 2HT2C 2H2PC 5I71C 3VJ6B 1D9KD 2I60L 3SDAA 4HPYH 3SE8H 2JELH 3U1SH 1CLCA 2NLJB 3MFFB 1FV1B 5J06A 2FL5A 5H37H 1R3HB 3PL6D 3DUUA 2VXSL 1CDUA 5C0DA 2P24A 3CVHL 4X4ZA 1A6UH 1K3IA 1MQKH 1HSAA 1DQQA 4YHYB 3ARBC 3AXLA 4KK9C 3I02A 4JY5L 2CUHA 5I6XB 1AC6A 1OAUH 3SDCD 4IHOB 3DJ9A 4XP6H 1XGRB 3EOYG 2CIIB 4KHTL 4L29B 4OB5H 3O3AA 2B20A 1FFOA 1ZSDA 5HYFA 4CJ0A 3NCBB 1RIHH 2EE2A 2X70A 4YNYB 2F5BL 4RWHA 4NP4H 1NGYA 1WWCA 2A6IB 3QUMB 2DS4A 3MCKA 3WYRA 1ZMYA 2UUDH 5T3ZE 1JF6A 5EU6D 5IFAL 3E2HB 1L6ZA 3ZL4L 3CXDH 2DWEB 1VFOA 3RX5A 1JYXA 5TF1L 2HVJB 4YAQB 5FHAL 3IAQA 4BH8B 3VXOB 4R26H 5CIPA 4HUVA 1CZ8H 4JFHD 2XTJD 4LGRB 4C4KT 1FBIH 2Y9RT 4QXTB 1L6XA 2F8XC 4JM2F 4M8VA 2VR9A 1Q1JH 4LLQB 2AJZA 1LEIB 1IQDB 1BFTA 4I0CC 3NN8B 1H9VA 1F6AA 1WLHA 4FABH 2X09A 3QUKB 3U7YL 5I2IB 5DRXB 3F7VA 1T20B 4JFEB 3JWOL 5F21B 3VWJD 1YY8B 1N64H 2W0FA 4PRIE 4QXUH 3GSNH 5IBTL 5BZWB 3FTGB 3WEXB 5JOFB 4JVWA 5HD8D 3S36X 3B2VH 1I1AC 5EDXA 5EFIA 3SGKC 3TYGL 1EBAA 4HS6B 1I1RA 1LILA 2DF3A 4FQIH 1QSVA 4Y16D 4Q9BA 3MUZ1 2PYEB 4NN7B 5CS7A 3LD8B 3DO3A 4AZ8A 1NAML 3QHZH 4FXGB 3NZHL 1RZKC 1UFUA 2NY0C 1NLBH 4J8RA 2ZOLA 3DV6B 2QADB 4PRIA 3AB0C 2A6DB 5T5NF 4QCIB 1ZA3A 1MLBA 4RAVB 1TVBB 5GJSL 4RIRA 3R8QA 1AHWA 2XICA 4JEGB 2R4SH 2WWKO 2F58H 1CGSL 1XF3B 3O9WD 4GG8B 5E94B 1RJCA 4KY1L 1KIPA 2APTA 4GXUM 1A1NB 3PHOB 2BNQE 1IM9B 1XGUB 2NXYB 4NRXA 3TZVD 4P9ML 1G7MA 4WV1A 4YQXL 3D87B 5CEYA 1UQSB 5E5MB 2EZ0D 4R3SA 5IKCA 4NO5B 3FO0L 4EEEA 3BISA 5GGTH 3EO1A 4NCDA 2P5WD 1QBLL 2P5ED 5I8EB 5D7JD 3FB7A 3LKRB 2YKLL 1LO4H 5C86A 3RWJA 2GCYA 2MMXA 1SVZA 4NZTH 3CK0L 5J57B 1JHTA 2YSSB 5DJ2B 3DXAB 2XFXB 1KT2A 3TYFA 5EUOE 5JHLL 4OJFH 2BNQA 4R0LC 1NDMA 1F3RB 2MPAL 3RUGA 2C26A 4G7VH 3GMQB 1CVRA 1MJJA 4R7NA 4UV7H 1FLRL 5EUKB 2JIXD 3RTQA 5D2NB 3U9PH 4U1IA 1HNGA 4N0UB 2APFA 3MRJB 1N4XH 5C0EB 5GS0H 4UU9B 5C08E 3MOAL 4A2MA 1S7QB 2NZIA 4OQTH 2YUZA 3ROOB 4P3CL 1QBML 1KLFA 3SDXF 1U3ZA 1S9VB 1W8NA 4LLUA 3MRGB 5EUOA 1KCLA 1SEQH 4EOWH 1AD0A 3PWLA 4FFYH 4GW5B 3C5SB 4ZQKA 5HJ3B 1GGBL 4YFLI 5I75B 1A7PL 2VDML 3QEQB 1ODAA 3BO8A 1GHFH 2Z93A 2F8OA 5ILTH 1MJ8L 4UILH 5DC9B 2HLFD 2X4TA 2A0LD 1J1OH 5C08A 4CADB 3MBXH 4RRPA 4F15B 3FFDB 3RIFF 3UROR 5IB4B 2R1WB 4WEBL 4WGVB 3RVXD 3EBAA 3M07A 1RZ7L 3HNSL 3SDDA 4QRQB 3NFSL 3V0VA 2DLHA 1CD8A 4OCYL 1JGVL 2DQGL 2NY5C 1NBQA 3QIUA 3LDBC 2AJ3B 1QFHA 1OGAE 2UWEB 5ADOH 3CFBA 4AG4L 4YXLH 2YEZA 4HS8H 4XNYH 1U95B 3HZVA 3MLUH 1GXEA 3EO0B 5I73B 1IAOB 3GMLA 1BM3H 3GM0A 3W5MA 1V05A 3AUVA 4H5SB 4RX4D 3OKLA 4GS7C 5ITFB 4Z77A 4ZNEE 4JGUA 1CGVA 2NZ9C 2VOTA 3IU3B 2YMXL 2XPGA 1T2QL 3CH1A 1Y0LA 3QIWA 1T3FB 1OGAA 3QI9A 3VXPB 3LKPB 2OX5A 3U2SA 1FO0L 3U9UB 1I7UA 4NNPL 4K94L 4RGND 4PD4K 3RL2A 3IETA 5C8JB 3BRDA 3VH8B 4ZNEA 1UWEH 2PF6A 4WW2A 1YUHB 3K2UH 1J0IA 1F4AA 3LS4L 5HHQB 3O6ML 1UZ6F 3KJ4B 4HW6A 3P0YH 4UTBL 4IIQA 3GK8L 1X5AA 4QXGH 4WHYG 1YQVH 4D9LL 4NKOA 5EA0L 3H3BC 1RZKH 2VZTA 4D2NA 5E08L 4V1DE 5I16B 4RDQG 4PREA 1CTOA 1ONQA 1DLHB 4X9BA 5DVLA 3U6RB 4XX1G 1U8MB 4QRTA 1QLRB 2HN7B 1V3LA 5T33H 4WCYL 4UT7L 3L6FA 1XF2B 2R4RL 3ROLA 1Z3GH 4DK3A 1CGTA 2PW1A 5KTEH 2Q20A 4FQHA 5HPMB 1OGTA 2ZOKB 2XOTA 1X5FA 1UKSA 5T1KA 3TBWA 1F97A 2ZSWB 4GUPA 2EDOA 4V1DA 5I30H 1BEYL 1MCRA 1FVEA 1KXTB 4PTTB 2EDHA 2EYRA 1T7YA 5ICZA 3BXNA 3IB4A 4ZYKB 1SYSB 4GKSB 1LQSR 5JOPD 1HHKB 4TSCL 1MWAL 1N5AB 2VNCA 5FOBA 4P2RD 2HFFA 2V7HA 3SGJC 2N1KA 2W9LA 3CUPB 5HHOE 1ITCA 3MOBL 4LKCB 2NX5D 1KN2L 5L0QC 32C2A 4LLAA 4NC2B 1KYOK 4LVNB 4C57C 5CP3A 3KPSE 4UV4L 2AEQL 5I1LA 3V4VH 1MCDA 4NQCE 2IPKA 1T7XA 4WFED 4HS3B 3E3QC 4U05A 3FN9A 2H26B 3OKEA 4XNMB 1BOYA 2IMMA 2EO9A 4XPAL 1WUNT 4Y2DD 3GUTA 2H8PA 3BH8A 2GSGB 2FYYB 2PTVA 3EUUA 2X4QB 4I13B 2YPLB 5E70A 3ME0A 1DANU 1DZBA 5HHOA 3CSBA 4LU5L 1BIIB 2XTJB 2YUWA 2EDTA 5I1GH 2Q1EA 5C6TL 4YDVA 1UB6A 3U83A 4NM4H 1ZLWH 2ITCB 3NFPA 1MCIA 1NGZB 3KPSA 1A7RH 5AD0A 4NQCA 3MV11 4KUCF 3O3EB 3TBTB 4H8WC 1JYWA 5E5UB 1H8OA 3BEVA 3R06A 4HPYL 2X7LA 4HUUB 4PV8A 3SE8L 4CN1A 2JELL 4QF1A 3JWDH 1T21B 2W65A 4HJGA 2I25N 3B9KD 1A6UL 1UADC 4I3GA 1MQKL 3CZFA 2IQ9H 2NQCA 1P84J 2NY5H 1WFUA 1I7ZA 5CJXC 4TVPD 1OAUL 1F5WA 3MV01 3VXTB 4XP6L 4OB5L 2IFFH 3H2WA 5F89B 3VI4F 2VDLH 4OUOA 4P4RB 4NPYA 2UVEA 1RIHL 3WIFA 5DO2D 4NP4L 7CGTA 4X8XA 2WLYA 3BZFB 1U8NB 5E5RB 5C0JB 1NAKH 2ZP0T 2F54E 3DVGB 2FJGB 3B3IA 5DD5H 2HTKC 5E8NB 4M7ZC 4HGWA 3C2AH 2WBJC 4R26L 4YHOH 1CZ8L 3S3JA 3R0NA 2EECA 4RFOL 5E2TH 1FBIL 2VQ1B 3S7GA 2KL6A 3WJLA 1RZIA 1ZTXH 3L9RB 3LPWA 4L9LB 3IVKA 2P5WB 5J8OA 5CZVH 1Q1JL 3LN4A 1RZJH 3IFLH 2R69H 3FQXB 3RWIB 5FEBA 2BXZA 3EJYC 4ACPA 4FABL 3EOAB 5GIRB 4JZNA 2F54A 4ZXBC 2KQNA 3ARXA 1I1FA 4NJ9H 1N64L 2NPLX 1Q8MA 4QXUL 3GSNL 3TP4A 1EHAA 4W4OA 4FZ8H 4QRUA 3O11A 4G8IA 3B2VL 3OKKB 4YUEH 3AS3A 1A4JB 1UENA 4FQIL 1E4JA 3T0EE 1AFVH 1FNLA 2YD4A 1AXSB 2A73B 3M8OH 4HSQA 3QHZL 3MJ8A 1NLBL 4GW1B 4XNUH 1CGWA 1WWBX 5TJWK 5I18H 1G9NC 2X89D 4N8VB 1QR1A 1UXWA 3M1BA 4KDWA 5D7LE 4GAYA 4DUVA 4WJ5B 2OP4H 5H2BB 1OAYH 4H1LH 1F45A 5DS8A 5DZLA 4U6YA 3MACH 2R4SL 1QSEB 2F58L 3B6SA 3EZ8A 3QO1A 2R1YB 3D18B 4JJ5B 2X6MA 4CBPA 5FGRA 1GGIH 1F02I 2I26N 4ZO7A 2VQUA 5E03A 1J12A 4YBLC 3RVVC 1KGCE 3N0PB 3MNWB 5EUOF 3WIIH 4OLXH 5TE4H 4Z7UB 3PXJA 4HUKB 4RZCB 1P9MC 3CFDB 5GGTL 5D7LA 5GJTH 2A83A 5DHXB 2GSIB 3TN0D 3Q3GB 4D9QE 4DGVH 5D7SH 4PLKC 5B38B 4W6YB 4NZTL 4M8QA 3VFSA 4LCWE 2Y25A 4M93C 2XWJA 4EI5B 2JB5H 4X5WB 4NQDD 4GG6F 4OJFL 3C60D 2HVKB 3RU8H 3WNNA 4ONFH 4G7VL 4ETYA 2HJKB 1FIEA 4NQSB 4UV7L 4UI2A 4P9HH 2AP2A 5IVXE 4PJ7E 2QSCH 3DVNA 5F7EH 1N4XL 1V3JA 5GS0L 1NGWB 3MLPA 2VE6B 1F11A 2GFBB 5KG9A 4PJ9D 5GRVL 4OQTL 1U93A 5GRWA 2YC1A 5F8RC 2C3XA 2R0ZH 4DTGH 2N7BA 1R5WA 2BVQB 4RGNB 5C0FA 1SEQL 1FL3B 4EOWL 4EUPA 5FB8A 1AJ7H 2CLRA 1NGPH 4MJ5B 3IDJB 4YHLL 1IEBA 2CRMA 5E6ZA 2CXGA 2Q7NA 3TO4A 4XMLH 2DN7A 5IVXA 2FH6A 4PJ7A 1GHFL 1DVFA 4M5YH 3X17A 5ILTL 3P0GB 2R2HB 2AEPH 1CFSA 5KSVB 4UILL 3HC4L 3ESVF 3RWGB 1B4RA 3HLAA 1J1OL 4Y1AB 1DE4B 2WP3T 5CLTA 4P2OD 4LIQH 1KSRA 4I0PA 1OF2B 3MQIA 1A3QA 2EH7H 1JNJA 4MA7H 3NABH 5DGRA 4UNVA 1U3JA 1XF4A 3DGGA 1M6OB 3PGDA 1DUZA 2WM0A 3SCMD 1SHMA 3QPQC 1INQB 1PG7X 5ADOL 1G0XA 3LHPH 4I18A 4YXLL 4HS8L 3IGAB 4XNYL 3MLUL 1MHHA 4JO1H 2CPCA 3K81A 3T1FB 1BM3L 4U1LA 5D1QB 3WD5H 1FFQA 3OAZK 2MTPA 5HYEA 2NY4B 3MRKA 5IBUB 1R3LB 4P46A 1FNEB 5HPOA 1U8KB 1A2YB 4MA1C 3VXQB 4KI5D 2L7JA 1U8IA 2Y6SD 4BSJA 1HCFX 1U3HC 5DJDB 1DANT 4GMSH 4X98A 4R4BA 2VITA 5EB9A 3BN9C 1TFHA 4P2RB 1KC5H 4XNZB 3IDMB 3RY6A 4J4PA 1BD2D 2GIYA 3H9ZA 1X4YA 5CJ8A 5TQ0H 2X41A 5C0GA 3CIQA 3ZDYE 4NNXB 1UWEL 3OXRA 1ZA6A 4Y4KC 5DHVA 4EN3A 3L3IB 5DWUH 3ZTJG 3K2UL 2BY2A 4N8PA 3P0YL 4QXGL 1YQVL 4Y4FA 3TBYB 2IBGA 3GI8H 2YD8A 3T08A 4GRLD 1YMME 4JRYD 3J8F7 4P23B 5B39A 2CKBB 3LV3A 5I17A 1RK1B 4MQTB 3T77A 2BHUA 1G1CA 5T33L 3AREC 5J6GB 3FQWB 1LEGA 5MERB 1B0GB 1LHZA 3ABZA 4APQC 4GOSA 4ZUTA 1Z3GL 3AC0A 1QRND 1VFBA 5KTEL 5EPMB 5IMMA 3NIFF 3JTSA 4YK4C 4HV8B 2EDDA 1NC2D 4PRBA 1JWSA 1QLFA 4IMKC 3CX5K 2QHLA 3JV4A 3O6FD 1XF1A 4S1DD 2JJVA 5I30L 3RI5K 4R2GD 4JO4H 2PYFA 3BRFA 1KB5H 3B9KB 1TIUA 4LVEA 4PJEB 1CXKA 5IVZA 1T1YA 4L8CA 3BP5B 4HMCA 3HE6D 2CLZA 1VADB 7FABH 4LLDB 1JF1A 5JXEC 1CQYA 3ZHKA 4YC2C 4WIQA 1JZ5A 1LP9B 1BAFH 3SOBH 4OV5B 3DRQA 4HEPG 5D6CB 3GBML 2V7NB 1FO0A 4NZDA 3L3DA 4LVOB 3K3QA 3KAAA 1HKFA 2CUMA 2OQJA 1G7QB 3B9AA 1CWVA 1EBPA 4HAFA 1AP2B 2V5TA 2WWKT 3V4VL 4XXCC 3UTSB 3OX8A 1YNKH 4G8FB 2HT4D 3WNKA 4IRZH 4PLOB 4XVUC 1ZT4B 5C09B 1QFOA 1UM5H 2ADJB 1MCHA 3OJMB 3NZ8B 4LCCB 1PEWA 1MHEB 5I1GL 3QNYB 4IRSC 1BJMA 3ZDXF 3PHQA 4LASH 3KYKH 1HHGB 3NH7H 4NM4L 1JRHH 5IBLD 3BWAB 5GSVA 1CR9H 4FNLH 1A7RL 1QZ1A 4FMKA 1QA9B 2FIRT 3U0PA 5FKAA 5D1ZA 3MZTA 2DMKA 5INCA 4MVBC 2ENSA 5IJVB 5HI5D 5HHXH 4WEUD 2O61B 3JWDL 4GJTB 4F7MB 5FFLA 3SJVE 1Q94A 2EDWA 4CW1A 5ID1B 4WTZG 2BSRB 4L4TB 4L4VB 3UZVB 1T4KA 5CD3A 3P9MB 2IQ9L 4G9FE 4NM8H 2NY5L 4O51B 2CJUH 2QSTA 2YXMA 4MZ3A 4OSUH 3ARGA 4O5LL 4QXWA 4D3CH 1JWUA 1MWAA 1T5WB 2IFFL 4HIHB 3MV9E 2VDLL 2J6EH 2D4FA 5IW6A 2X4OB 5C3LD 2XKNA 3FFCD 3SJVA 1MRCL 4ONHB 2VUOA 1BMGA 4P5TA 3D25A 1NAKL 3LSOB 1G7IA 4G9FA 4OBRA 4G9DA 1NEUA 5DD5L 2P8LB 1IAMA 3C2AL 4UIMB 4AM0B 4HX1B 4YHOL 1AXTH 1FN4B 1BQLL 3MV9A 5E2TL 5KSAD 5D2LB 5T5NG 4D0BB 4P3DB 1CLYH 3HRZA 5FA4A 3QPXH 4U31A 1A6TB 2Z91B 5CZVL 3SBWA 4ISVA 3V6ZA 1RZJL 2JJUA 3MRDA 4LF3B 3TN0B 3IFLL 2R69L 1P6FA 5EBWB 2K1MA 2YUVA 3SKNB 2WQRA 1H15B 2Y23A 5ESAA 3RAJH 5F1NA 3S37X 1KIRB 1CE6B 4X0KA 2EC8A 5BQ7A 3F58H 3V7AG 1INDH 4NJ9L 3V4PH 4NQDB 4JKWA 3QFDB 2EEDA 3QDHA 3IXTA 3QWOB 3L3JA 3V0AC 5HGHA 3LS5H 2Z31C 1IKNA 3WUWA 3ULUC 3C6SB 2R2BB 2ITDB 4JFFE 2H32B 5A1AA 3T3ME 2ORBL 4XCNA 3QUYC 1AFVL 5FAAA 5CUSH 5AUMB 3M8OL 4HIIA 4AEFA 4ZNCD 1KJMB 3HC0B 4Y5XA 1MOEA 5E8PA 3DURB 3VJ6A 4YHYC 5I18L 1UXSA 4M00A 3EDDA 1RIVH 3DMMD 2Q3AA 2OP4L 1EEZB 5ALCH 2HH0H 2EIEA 4RBPK 1R3HA 2DYPD 4WWKB 4BH7A 2VIRB 4JFFA 3RZCD 4PJFF 2IGFL 1WTGT 4GRMB 2EE9A 4JE4B 1GGIL 1CVSC 4NNYA 1NKOA 4S1RH 4P2OB 1XR8A 2ESVA 4MNHB 4OLXL 4PJXF 3S96B 3WJJA 4YX2H 3VDBA 5TE4L 2X9XA 3LMJH 5HHNB 5E2WL 2CUIA 4FQCH 4IHOA 1S9KC 1F42A 1CG9B 2Z92B 5L2KB 3LVEA 3EYOA 1EEUA 5GJTL 1RJLB 3BQUA 3DUSB 1S9YA 1BZ9B 5IVXF 4PJ7F 2FLBT 4DGVL 5D7SL 4YNYA 5DJAA 4XHQA 3B9DA 4CN4A 3QIBD 4N90D 1S7VB 2Q87A 1HXMA 3BJ91 3F65A 4GAJH 1AGFA 1CLOH 2JB5L 1PEZA 4TUOA 4B7LA 3P4LA 4JFEE 3RU8L 2G9HB 1U41A 4ONFL 4F37F 5HGDB 4Y19D 4OUUB 3S4SB 5BRZD 2E7HA 5F9JB 4R8WH 2Y07H 4P9HL 3TJHD 1FVDA 2QSCL 4ODHH 5F7EL 3UPRA 5FK9A 1BWWA 2P8MA 3SE4C 2DQJH 4K8RH 1OL0A 4E42B 2PYEE 2BHYA 4JLRB 1B88A 1YDPB 3KXFE 4OZIE 1LEIA 2A2QT 3LEXB 5LCVH 2FEEI 2R0ZL 5E2UH 1H3GA 1A9BA 1BD2B 1VGKA 3P4OA 1N8ZA 3LD8C 4RQQA 3QQ4A 4JFEA 5FYLH 1NGPL 1LNUB 4LPVA 2NY3B 3E6HA 2FX9H 5BZWA 4ZSOB 4P2YA 3GSQB 2PO6D 4LNRA 2ADGA 5KS9E 4XMLL 4UUJA 5K9QG 4M5YL 3ZHDA 5IWLA 2AEPL 5DI8A 3QZWB 1TVDA 3VXUD 2PYEA 4GRLB 4YHPA 3KXFA 4X6CB 3P73A 3MGAA 3QDGE 4LIQL 5I76A 4OZIA 3S35X 5C0NC 5JW4M 1CFQB 5EN2A 5FKPB 1G9MC 1QLEL 4MA7L 3NABL 5ERWA 3ARSA 2B5IB 2LU7A 2EDEA 1L0XA 4JRXE 4QCIA 1PG7W 4RMVA 5KS9A 1J0KA 5HYIA 3LHPL 3RIFK 1SMAA 1NC2B 3BD3A 4OKVB 1XF3A 4TYUA 4Z6AT 3I3DA 2GK0B 3RDTA 1YY9D 4JO1L 1JGUH 2BERA 4YJZL 3QDGA 3WD5L 3PHOA 3DXAE 3FAWA 1VACB 3SGEI 3MMEB 3HS0A 1IGTA 3ZDYF 4ODSH 1FG2B 4HQQH 3BKJH 2AGJH 1ZAGA 3ZSSA 2XZAH 3QUXB 4X4XA 3S6CA 2OM5A 4JRXA 5LAXA 5FYKH 3WUZA 2FZ3B 1FFNB 43C9A 5I9QB 2VLLA 4LSDA 2QHRL 2Y36L 5IV2B 3O8XA 1KC5L 5D2NC 5DJXB 4NCC1 1MJ7H 4LLYA 5GISH 3KNBB 3WBDA 3VG0H 2P7TB 1D5ZB 4YZFF 3DYPA 5TQ0L 1S7TB 5GHWH 2ATKB 1GOFA 2XXMB 4PJGB 4XTRC 2ID5A 2LE9A 1E4XI 4UNUA 2F53D 1DQTA 4PGZA 5DWUL 3I6LD 2NY6C 4I9WE 4X8JA 4UT6H 1MCKA 4YGVB 1LK2B 3IJYB 3GM8A 3GI8L 5I75C 3GJEB 3L5IA 5E1HB 3T2OA 1P5UA 3FB8A 5HI3D 3S98A 3V5KA 3NTCH 4G8EA 4UQ3A 1OP3K 3HG1A 3RIAF 3DOSA 3CPLA 3QUZA 4MS8D 1K2DA 3O81A 1P7KA 1LO3H 1KV3A 2O26U 2BCKA 5DFWH 3CNKA 4PJHB 2DQIH 2WUCH 1K4CB 4KJPC 1ZV5A 4X7SH 1OW0C 1I8KB 4N68A 4K7FA 4LSVH 1X6NA 5AAMA 4GRWB 5SX5H 1XH3A 5T1MA 3WN5C 4JO4L 4CMMB 1MFDH 2J12B 3FFDA 2P8PA 4FXKB 1KB5L 1NBZA 4EDWL 3QDMD 4DKEH 5I73C 2Y06H 5J6HB 5JORB 2HJFA 3B9VA 4ODWA 4CU6A 4LLWB 4NRZB 3VMOA 7FABL 1XCTA 4XXDA 1A6AB 5AYQA 1Z0MA 3IDXH 5IMKA 3KGRA 2W9DH 2DKUA 5F97E 5IFJB 1BAFL 4LP5A 1GZPB 4NSKB 5HYSG 2YD3A 1D5XB 2MKLC 1A7OH 4CAGA 5A3ID 1E6JH 4LLMB 4NWUH 3MZGB 5BZDB 4GBXD 3IFNH 5FUCC 5D6DC 1N59B 2YRPA 1MCOL 4JM2D 4ZUVB 4N0FA 1YNKL 1FNFA 4HF5H 1P1ZB 3RL1A 1H8NA 5JQHC 3ZYIA 1I1AA 4IRZL 4QYOA 3WO4B 5MHSE 3RWFB 4U6TA 1UM5L 4OM0H 2WINB 1TDQA 4WI9A 1HCVA 3KJ4C 4H88H 3LKPA 3KPRE 3JWNC 4HJJH 4LASL 3KYKL 4MGXA 3NH7L 3PDOA 1JRHL 4YFEA 1KG0B 3D5OF 3U0TB 4TTGA 4PRHB 4X7TB 4YEEA 3F6IA 4LQFL 4YDLC 1CR9L 4FNLL 1MFBH 4HC1H 3CC5B 4LRIC 1WT5A 3IS0X 1XIWD 25C8H 4NQVB 1NSNH 1UH2A 1IFHH 5K59E 5DJCA 1UKTA 3QULA 4MAYA 5SWQB 1G9MH 4AIZB 1M7XA 3GFUA 1NQBA 3KPRA 2AXHA 3NBNA 1DLHA 4DOHE 4KK8D 3PJSB 4NM8L 4JZOA 4TN9A 4XP4H 3VU2A 3BKYH 2CJUL 1JE6A 2A6KB 4OSUL 4NO0D 5AWNH 5J9PB 4A6YB 5FIEA 4AL8H 1OVZA 2ZOKA 4QT5B 3T2QA 2ZUQC 1ZVSB 2VDRH 3TVMD 5F7KC 5DJYB 4HK0B 3RNQA 4JFXA 3UZEA 5HXMA 3NCCB 5E6IA 3F8UB 1MFNA 2MNUA 4D94A 4L8DA 3GSWB 4XNQB 4LVNC 2YRZA 3L3GA 4MLIA 1SJVA 1SYSA 1G1YA 4XP9H 1AXTL 3MJ9H 3F12B 5K9KB 5KN5B 4PRPD 2YPLE 1CLYL 2NY7H 1R3JB 3QPXL 5ICXB 4ODXA 4NUJB 3PP3H 1A7NH 5HYQB 3W81A 1IGMH 2IAMD 1CGYA 3T3MF 4KVCL 2CQVA 3BP4A 5GS1B 4QY8B 2XTJC 3RAJL 3VFWB 2BVEA 4MJID 2VLRB 3F58L 2FGZA 1INDL 5EO9A 2V6HA 5CD5C 3V4PL 3EFDH 3FCTA 1ND0B 2RFXA 5HI4C 1KXVC 4F2MB 1MREH 3TBVA 3MGTA 1EEYB 3LS5L 2YPLA 3VWJC 2AQ2A 3AU1B 1E28B 5AEAA 1RUAL 5CUSL 3WSQH 4D9RE 4MNGB 1YN6A 4XPGH 3WFZA 4NIKB 5HD8C 4WO4A 3C8KB 2BVTA 1FHGA 4IOIB 1TXKA 1NGZA 2E9JA 1X7QA 3D3VB 2B1HL 4Y16C 4ZO9A 3FHQA 3WHXA 1RIVL 2M1KA 5DTFB 1WAAF 3VXMD 3EOBB 4OZFA 4AT6A 3CFEB 3D85B 4NRYB 5ALCL 2C3WA 2HH0L 3DPBA 4AMKH 3LCYA 1T21A 1JF5A 4CGTA 2X1XR 4K55A 5DUPH 2PO6B 4N1EA 3VE0B 2BNRD 1R5VB 3IXAA 3MRIB 3HNVH 3B2UD 2V2XB 4S1RL 1F6LL 1ULVA 5TFSH 1BLNA 4YX2L 4U1JB 3LMJL 4NC0B 4J7RA 2C4FU 2DTMH 1CTNA 4OFYD 2P4AB 4FQCL 4I1NB 4UAOB 4LDLB 3TIEA 1KACB 3P9WB 1RJYB 2EIZA 3MRQA 2FGWH 3TZVC 3O4OB 4HLZG 3GBNH 4G8GD 3BMVA 4NQUA 1R24A 4LCUB 1I8IA 3CCHA 3FO1A 4XCEA 5C0BD 2FSEA 3G04A 4GAJL 3BZFA 1RUPH 2CLVA 2JLLA 4OZIF 3MTRA 1CLOL 4KK5C 2CDEB 3MLVH 2FJGA 4J3UA 4QNPE 5C7XH 3HMWH 1ZEAH 3ARZA 4OM1H 4DGIH 5A2IH 4R8WL 2Y07L 1G9EA 1HHHA 4ODHL 4DWHA 5AG9A 4FP8H 4BKLA 3VGEA 2VQ1A 3G9VA 5KS9F 2OTWA 4WUUD 3ZKMD 2DQJL 4K8RL 4U1MA 4KKAD 3QNXA 4UDUA 2E3VA 2YK1H 3O45B 2RAMA 1T6WA 4XPTH 5LCVL 5E2UL 3HB3D 1IAIM 2OSLA 4MD4B 4MCYB 3AAZA 3DYOA 4WHCA 1JVKA 4QRPD 5FYLL 2EC9T 3PG2A 4GW4B 1X4ZA 1INEH 4NT6B 5F44A 1Z5LB 1FNGB 2FX9L 4UOJA 2JJWA 4LCIH 3S88H 5JPNA 3MFGB 4R7DB 4H1LA 3FKUS 3QWRA 1Z9LA 3L7EB 2DKSA 4JPIB 2A73A 2HWZH 3H9SE 5D5ME 1H3VA 3QA3A 4N1HB 1WZMA 1GYAA 3ARFA 2HLFC 3I6GA 2A0LC 2AERT 3MC0A 4XNXH 2J7LA 4EZMA 2MCG1 1RI8A 5HVHC 3BIKA 2R9HD 4FOMA 5H2BA 1DEEB 3RVXC 4GFTB 4QKXB 4OD1H 1BQUA 4C56B 1CE1H 4K71B 2W60B 5DC4B 1FYTB 1JGUL 4KJQD 4MA3A 3D39A 4WVRA 1YJDC 1UWXH 3A6BH 1S8DB 4RMTA 2KKQA 3CFCH 3GKWH 3H9SA 5D5MA 3X11B 1XCQB 3WNPA 3D6GA 2P1YA 4EI5C 2QBWA 4DUWA 2JF1A 3QDMB 3BKJL 3QRGH 2AGJL 4BFIA 2GY7B 1NMCB 3T65B 1JK8A 2XZAL 3MJ7A 5DUBB 5FYKL 1MEXH 4LHUG 1Q9KA 1N6UA 2GSIA 3UTZB 1BZ7A 1L7IH 1MJ7L 3QEUB 4TTDC 5GISL 3VG0L 4DEPC 5GHWL 3D2UD 4L3CB 5JIKA 4LPUA 3BX7C 1A5FH 2ZCKH 3RVTD 3TO2B 3ARBD 4ODTL 4WFGD 3VD3A 1FYHB 4RGNC 5DFVC 4UT6L 5KAQF 1RZFH 3T8XB 2HFTA 3OBAA 1IEAA 4KUCD 5FYJE 4Y1AE 1U36A 3AROA 3MBEB 2D03H 3NTCL 4M6NH 3BP6A 4JPWL 5T5FH 3VFNB 5BXFB 5CILH 1CT8A 2DQCH 5E2VH 1LO3L 1KEMH 1CFNB 3ZE0E 1BVZA 3SQBA 4MJ5A 3N1GC 2DQIL 3ZYJA 3WO3B 2WUCL 2BOCB 5EOTA 3U4BH 1K8IA 3P77B 1KPUB 1CF8H 1CFTA 2HG5A 4X7SL 1MSPA 4ESKA 4TOYH 4LSVL 3TA3B 3RWGA 2Y7QB 1JPSH 3VFRB 4CVWA 1MFDL 4MXWH 3U36B 2X4SB 2XWTB 2JTDA 4MQ7A 5GGRB 4N8CH 5DRWB 3TJEH 4DKEL 4JR9H 4ZO8A 1UM6H 1X9QA 2W91A 2X4UB 4YHKH 1T1XB 3GSRB 5ID0A 3S34H 5JDJA 2EKSA 5F9WB 1GZQB 1ORSB 1YZZA 3LIZH 3GI9H 1W8OA 3IDXL 1NFIB 3WDIA 1JIBA 1OP5K 1X4XA 3V0WH 2YD5A 4LSRH 3PWVB 4ZXBA 4LMQI 4K7PH 4K07A 3TVMB 1A7OL 1E6JL 4NWUL 4U2ZA 3IFNL 2K7PA 2R8SH 5C71A 3U4EB 3T0BA 4AEHL 1E4XH 1S7WB 4HF5L 4NN5B 1OY3B 2W1NA 3BOVA 5I0DA 2YOCA 1A2YA 4Z7WB 3TFKC 1BJ1H 1KJ2H 1U91A 1OD9A 1A1OA 3FZUD 5IEHB 3MV7E 4YHNB 5K59F 2ATPB 5BV7C 1K8DA 5A40E 4L8BB 3QISA 1ZHLB 4PRPB 4HJJL 1M71B 5IMOB 4G80A 1KJVA 2XV6B 4Y2DC 5K33A 3UTPD 4TQEH 3LQZA 3DROA 2A9ML 2IAMB 4P23C 5AZEH 4X7FC 1JPGB 1MFBL 3U7AA 4ZPTB 5DEZA 3WFCH 3BH9A 3QFJD 4HC1L 1MUJA 3SPVA 3MRNB 2JK5B 1UVQA 25C8L 5DSCA 5B4MD 1NSNL 2BMKA 1IFHL 4O2CA 3TBYA 4YHMH 3X14B 3MV7A 4CU7A 1G9ML 4WDIA 5C0IA 4QRSB 4UMGA 3RTQD 1KB5A 5BVJB 3MGOB 4XP4L 3BKYL 1K6QH 3THMH 1OSPH 1YMHA 2C4FT 3B9KC 5AWNL 4PY8I 3S3SA 2HP4A 3RWHA 4AL8L 4MNQB 4Z5RB 2IAND 1YNTB 4MZ2A 1OB1B 1HSBA 2VDRL 1CL7I 1YJDH 4P2CG 5JPMA 4Y5YC 1SVCP 1KIQA 1MIEH 5KANI 1QD0A 2DLFH 4XMPH 4JHAH 2E6JA 5DHYA 3F6LA 5DO2C 3UTSE 4XI5D 5C08D 5AG8A 5LBSH 4U7KA 4XP9L 4QWWD 4U0RB 4HUXB 2YPKB 3R0MA 1GC1C 2APXA 3ARDD 3MJ9L 4WHTB 1NFDE 2NY7L 4ZUSB 3SDDD 3VDAA 4WTWA 1HILB 1A7NL 3AS0A 4Z0XB 5L2JB 1DN0B 5DJ0B 4LCCC 3MLTB 4P2QE 4G8GB 4D0CB 3UYPA 1FORH 5IHLB 3BSZH 5C0BB 4F33B 2A74A 3EFDL 1ADQH 2WIMA 3UTSA 2IALA 3F7YB 5JQ6H 4ZG1A 3O4LD 2ADJA 3FL7A 4XPHH 3DTXB 5IG7A 1XR9A 3NFNB 4M7LH 1NFDA 2GJZB 4AY0A 1IEHA 3HUJB 1MLCB 3C6LB 4L4VE 2HKHH 3WSQL 5DQ9A 4WUUB 3BDBA 2VR4A 2WNGA 4XPGL 4P2QA 1MAMH 1T2JA 3G08A 3QI9D 3W39B 5A16A 2FCBA 2VAJA 3I3BA 3SE3A 1U8LA 3FHAA 1KLGB 3K4ZA 4QRPB 1P4BH 1I7RA 2DL2A 1E27B 2KBGA 4AMKL 1B2WH 3SKMA 1TNMA 3D0VB 5CBEB 5JHDE 5F7UA 4L4VA 2FR4B 5LWYH 3HNVL 1MFAH 1KF9B 3RGVB 4E41A 4JG0L 1QYGH 3HAEB 3DECA 1CDCA 3VFOA 4G7YH 4O51A 5ICYA 4KU1A 4WTXA 3C8DA 2DTML 4QNPF 4HFUH 1GGCH 3MNVB 2EE6A 3O3BA 3GRWA 2MQ3A 2JCCE 1M7IB 3KPTA 3OGOE 2FGWL 5C70A 3GBNL 4OFKA 1HOCB 3MYZA 3CXHJ 3PGCB 5JHDA 5C0CE 1WEJH 1EHLH 1KPVA 4Y4KA 1RUPL 2AS5M 4KKBD 3MLVL 3SDAB 5DMKA 3TN0C 5T1KD 1EGJH 4KUZH 4XGZA 1MI5E 4BZYA 5C7XL 2P8LA 3HMWL 1ZEAL 3I6KA 2FL5B 4OM1L 1I3VA 4X80H 5BV7H 1QBBA 3DUUB 3WLBA 4DGIL 4RGMB 5C0DB 2P24B 1FN4A 4DZBA 1NEZG 1YEFH 4LSPH 2R0WH 4FP8L 2VUYA 3C60C 1HSAB 1DQQB 2JCCA 4P3DA 5SV3A 2DBJA 5MEND 3WFDH 4ZFFA 1NMAH 2JKXA 2CKBH 3I02B 1NUDA 1HH6A 5C0CA 2YK1L 1BOGA 1UT9A 1MJUH 1NC4A 4P57A 1RFDH 2FWOA 4NO2B 4XC1H 4FRWA 2ED7A 4Y0GA 4CVUA 4F37K 1KIRA 5L8JB 3K1DA 1MI5A 1INEL 3OKMA 1FFOB 1ZSDB 4PJ9C 2X70B 4LCIL 3S88L 5SV4A 4U3HA 5A2JH 1L9MA 3MCKB 3G5XA 3O2WH 5I8OH 1FL5A 2R2BA 1NBYB 4LHUD 3MUHL 3VI3E 4KQ4H 1ZGLA 1AQDA 3TCLB 2HWZL 4KDTA 3KYOA 3SO3B 1QSFE 2DOCA 5CIPB 5HHOD 2IG2H 4Y4HD 3UC0H 4HUVB 1ES0A 3W0WA 2FX7H 3RPIA 1MCEA 1C5DA 4TVPH 5CGYC 4P2OC 4XNXL 4F8QA 5FCSH 3ULSA 4WI2A 8CGTA 1LE5A 1IE5A 3KPSD 4GQ9L 2VZSA 1L0QA 4M02A 3KHQA 1F6AB 4OD1L 3Q1SH 2M26A 1CE1L 3KR3H 4M1CC 3F7VB 4X5LA 1CICD 3SCMC 4ONGH 2NTSP 1QSFA 1GC1H 3A6BL 5D7IE 3P4NA 3CFCL 3GKWL 5FYLE 3LRHA 3CLEH 5HHNA 4ELKA 5EFIB 2Z92A 3OHXA 5GGQH 3HE7A 4IRSA 2Q8AH 1E4KC 1MEXL 1XF5B 3OJVC 4F80A 4N1CA 5EULV 1NBVH 4L5FH 1L7IL 1RZ8A 4K2UH 1S7VA 1I8MA 2D7TH 4J8RB 5F8QC 2ZOLB 3G9AB 4KI5C 2Y6SC 1EZVY 4PRIB 2ED9A 1GOGA 2VN7A 2AV7A 3S36L 4I2XE 5D7IA 5CCKH 1A5FL 4UB0H 1ZA3B 2ZCKL 1MLBB 1G7LA 4LGPB 3ZE0F 1FNHA 1AHWB 3DWTA 5J13B 4R9HA 3S4SA 2GJ6E 5HVWA 1RZFL 2OI9B 1U42A 5BO1H 2NY3C 3TH3T 3QYCA 1KIPB 4ENEC 5EC2A 2APBA 2FRGP 4M6NL 2D03L 2FIKA 3FQRA 4X6CE 4NRXB 5T5FL 3WS3A 3TH2T 1G7MB 1CFBA 5CILL 3LEXA 4JPVH 4R3SB 5E2VL 1KEML 1R3IL 4GRLC</