2G62A

Crystal structure of human ptpa
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
308
structure length
302
Chain Sequence
NLYFQSRNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein phosphatase 2A, regulatory subunit B' (PR 53)
publication title The crystal structure of a human PP2A phosphatase activator reveals a novel fold and highly conserved cleft implicated in protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 110
structure length 302
sequence length 308
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2g62A02
2HV6A 2IXMA 2HV7A 2IXOA 2IXPA 2G62A 2IXNA 4LACB 4NY3A
chains in the Genus database with same CATH superfamily
4XWJA 2A6HF 3QTHA 2LSEA 3EJNA 3KH2A 1YLMA 2AVKA 1OCZC 4WJ0A 2KQ9A 3C63A 1GQAA 3AG4C 3S27A 4HE8D 1IW7F 1RJ9A 1QKRA 3NMKA 1R4TA 3C8GA 1QQ3A 4C3EA 3HLZA 1T6IA 4JJFA 3M1CB 2RSEB 1Q0KA 4MVRA 3F46A 3T6BA 4PJNA 3U0CA 1YA7O 1SMYF 2YLIA 3EQLF 4PFOA 1RCPA 1U6HA 1JOGA 4PK4A 1OKKD 4CSAA 1OR2A 4ONSA 1S05A 4ER9A 2QE9A 3FDQA 5CIVA 2XLOA 1AEPA 3E70C 3K7DA 2IBFA 3UMHA 3O6XA 1NFOA 2EIKC 3HNJA 5L0IA 2R7SA 3S28A 2EPMX 3ZIBA 2FGYA 2GFHA 4C7OA 3MFNA 1VLTA 4XPXA 4U5GA 4EUKB 5DS6A 2HZ8A 4GEHA 5KYWA 3POVA 3DMDA 2R7QA 4J7TA 4BEMJ 4DVZA 1DOWA 1CGME 1UFBA 2GWWA 2UUHA 4F4BA 1ZU4A 1D1AA 2VCAA 3KYIA 3JYHA 3CEXA 1G5ZA 2QLAA 3TULA 2UUIA 3OWTA 4JTCB 4CDAA 1G8XA 1E85A 3EHMA 1NU7D 3EH2A 3MYFA 3V5ZA 3ZC4A 1MMNA 4EKWA 4MVQA 1Q0MA 4CIHA 5L0CA 4Z9IA 1U89A 1TFOB 1UG7A 1CGNA 3RYLA 2WVOA 2XLWA 3FXHA 1EKYA 5JRAA 1LM3B 1MNEA 1A7VA 2EPNA 1ZHWA 4PJLA 4JEAA 3EGXA 5KYUB 4YN0B 2OKUA 1JPJA 1V54C 3I4UA 5JUAA 4PJJA 1QPUA 2AP3A 3AG3C 1S7ZA 4CSAC 4EBBA 3LS0A 2CDQA 2NUTB 3EZHA 1LKXA 4MVUA 3CZ6A 1OQCA 2DGJA 3GM2A 3IQ5A 3DM9B 4JE9A 3ZTZA 1A0BA 1RKEA 4XEKA 2DYRC 1JAFA 3G4ZA 2J46A 2MWQA 1LS4A 2CYDA 2XLHA 3U8VA 3B0VC 2PP4A 2AWCA 3BEHA 4LDQA 4ZLDA 2YKZA 4U5CE 4AL1A 4QI0A 2IOQA 3L1MA 2X0CA 5A6JA 4GQHA 1FFHA 4Q5SF 5A69A 2NG1A 1LE4A 3LEVA 3Q7LA 5AGFA 1TQGA 1VK5A 2KK1A 3AJMA 4IAQA 3IPMO 1CPRA 1APCA 1Z23A 4D4NA 1JRAA 2J9BA 1LVKA 4HFFB 5E33A 2OEXA 4IARA 3WODF 3GWNA 3SXYA 3C18A 4EHPA 3GODA 1J8YF 2XL4A 4RD9A 5EK0A 2OQMA 4PR9A 2LIGA 5L3VA 1PCXA 2G62A 1PV3A 2JPUA 4DOZA 1VTMP 1TWAA 2XXAA 4ULWA 3Q6NA 1CPQA 2OEVA 3AOUA 4I3MA 1FR0A 3FAPB 3O10A 1HMDA 1LPEA 1YJGA 2ASRA 2FFHA 2YZSA 2PNOA 2HUJA 4O6YA 2H7BA 2Y69C 3T6GB 1YA9A 3SXKA 1TR2A 4BJ1A 1GS9A 4MQ9F 4BJ5A 2HV7A 1ZW2A 2XLDA 1JMWA 4MVZA 4U9DA 2YHSA 1HE9A 1LIHA 3LJBA 4O6NA 3CSKA 5F5FA 2C04A 4BG0A 2X51A 2XM4A 3RH3A 3GM3A 5L0HA 1RMVA 2YRFA 3HNKA 1WATA 3PMRA 1L3PA 1Z3IX 3EZIA 3IHUA 4K0DA 3K1IA 4KNVA 4JC7A 3DE8A 2Q9AA 1JPNA 3RF3A 3U3FA 3US6A 4CS8A 1HE1A 3QZCA 4YT8A 2EIMC 1ORSC 4MVOA 2P0NA 1WN0A 3FOOA 4CS7A 2R03A 1RKCA 3B29A 1HW2A 1SZIA 3U2MA 5JS5A 2QY9A 5JSLA 1SF8A 2LQGA 3ECSA 1OW7A 3EGDA 2NSFA 3SP1A 4FX5A 1VMAA 4EBKA 2WVNA 4JJGA 3H2UA 3FOPA 2JD3A 4NC3A 1FMWA 2XM0A 1ZHTA 4G78A 1E83A 3GORA 3EFOB 1YARO 2HSQA 3O55A 5BUOA 2J0WA 5CI8A 4G7ZF 2YEVA 3KL4A 3SYNA 4AK9A 2XL6A 4FAPB 2IYLD 3CQZA 4X0RA 2Q9BA 1NBBA 3EPVA 3G50A 3T4RA 1BR2A 5L3QA 4CJGA 2ICWG 4J32B 1NFNA 2HJMA 1Q0GA 2OCCC 1ZHYA 4FWVA 1E86A 1C17M 5B3SC 2PX0A 4AL0A 3R2PA 4KC9A 2YQYA 2W45A 4CJOA 3K6BA 4QDLA 3NDBB 4P9TA 3DE9A 5B3IA 2A1DD 5DVWA 2B0HA 1T6QA 2XLEA 2LCHA 2Q3TA 4LLEA 2HFIA 1OKKA 3X1OA 1JR8A 3QVZA 4JRZA 1ZHZA 4OD4A 2TMVP 3FHDA 3GWLA 4G0HA 1OCRC 1Z5ZA 3K1IC 3RFYA 3VM6A 1BBHA 4KI2A 1L7CA 4CS8C 2NUPB 3NMJA 4AE4B 1T01A 1YZCA 4JIOA 3N0TA 1KU2A 4JURI 2L6FA 3W2WA 1VB5A 1CGOA 2GAQA 2E87A 2R02A 2W9YA 3LUTB 4O6MA 3VRCA 1O87A 2H8AA 4LERA 2XS1A 4N4WA 3VF0A 2P6VA 3ZTMA 1OW8A 2J0XA 1LI7A 3RQGA 2V3CC 4WGZA 3TQOA 3ZSUA 1OR3A 4KBLA 3C8GD 3S90A 2PF4E 2P1AA 2W4BA 3HNIA 1ST6A 4Q7CA 5B1AC 4CX9A 2C03A 4O7GA 4I1MA 5CI9A 4DRJB 1M2VB 4WGYA 2R25A 5AC4A 1WOLA 1YYXA 4IJJA 3V5XA 2FAPB 1Z63A 1ZYRF 2J9WA 2W4MA 3DD7A 3TOMA 4MVMA 2YLDA 4JCHA 3DM5A 3WAQA 1MNDA 3S84A 2P7VA 3RIPA 2ZXPA 2Y3GA 2GDCA 2KSFA 4MS2A 2OG2A 3TD7A 3VYWA 4Q4ZF 3U9MA 2YL3A 4ULVA 1G4US 4M63A 4EBJA 2VCCA 4PJMA 3IQCA 3JSZA 3PCVA 2D4UA 4HFKB 1NLXA 2Y3DA 1OCOC 2BC5A 1Y6DA 2NPUA 4JZAA 3UR3C 3MX3A 3PHF2 1N1CA 3EHNA 4PACA 4LACB 3Q6MA 5K0IA 3I5QA 3TK0A 2AU5A 3MYIA 3QW0A 3GEIA 4U5EE 3RVZA 2BL2A 1EI7A 4ZLCA 4PFPA 3NKDA 2Y39A 1DOVA 2YL7A 4BPMA 3SZRA 3KPHA 256BA 3DZAA 5JT4A 2BE5F 2DI3A 3B9QA 3GM1A 4K1OA 3A9CA 4CDVA 5KYXB 1D1CA 4IRUA 2L6HA 3UGPA 3LNRA 1OW6A 3U9JA 2LFFA 3L8IA 3UNGC 3AQBA 1WWPA 3JRMO 2R7OA 4DJ9A 4G7HF 3C62A 2R9RB 1ZZPA 3MBGA 2L7AA 5B1BC 4NCQA 4BJTA 1D0YA 5COFA 4DVYP 1M57C 4BJ6A 1O5HA 2M64A 3DAGA 5DQTA 2HMQA 2QTVA 1K40A 2HKVA 3L34A 1Q0FA 3C8ZA 3LLIA 4JCZA 2CNWD 4CS9A 5KYUA 3FAJA 4N6HA 3W8HA 4JTAB 1EA8A 4NTBA 2CCYA 4N06A 4E0HA 3DKAA 3IEEA 1AVOB 2V26A 2KJGA 3M15A 1QLEC 4JEBA 4DXWA 5A6KA 1HW1A 2OOCA 4EIYA 2EPLX 3GEEA 1BR4A 2ETSA 2IXOA 2NUTA 2GA0A 3C7JA 3LAYA 4LDRA 3U3BA 1OCCC 1IZMA 1BDJB 4YL0A 2Q00A 2ZXOA 5DS4A 1YVIA 2R05A 3JSEO 3S9OA 5A6AA 4MTGA 4YJWA 4YL1A 2J9UA 3RKOF 3GANA 4E17A 4L6RA 3UMIA 2H7OA 4U5FE 2P61A 2WVQA 4LDKA 4GYTA 2Q7RA 2AWYA 1ZU5A 3LEOA 4I1OB 4JKVA 5T3WA 5JLIA 3AGUA 3NYLA 2MHRA 3IQTA 4MNDA 2A6EF 2YWAA 3W8IA 3ZQVA 1F1MA 3MLGA 1C02A 5D91A 1T6UA 2LP4A 4QI2A 3VAYA 1M56C 1H6GA 3JRTA 1TKNA 4E7SA 4OIOF 2NSGA 2OU6A 1RJ9B 4OIQF 3S0XA 1VOMA 1VYKA 1TWHA 2ZXWC 3L0IA 4W8KA 2L9JA 5BQHA 5DS5A 4A4AA 3G4XA 1Q0DA 1V55C 4IWBA 1NG1A 3C8GB 4U5HA 1R5ID 2RD9A 3ZWIA 4YT4A 4MTOA 3A11A 3NG1A 4B6IA 3U8PA 4XEFA 4DRIB 1T5OA 3NYMA 2XRHA 3T9OA 1H9GA 3CAXA 4C3DA 4CS9C 1A7EA 3ASNC 3SXZA 4KNWA 2H7VC 1QZXA 2M4EA 3B71A 4W8PA 2WZGA 3RQEA 1ZVZA 4OIRF 3ABLC 4FESA 2B0JA 2LFDA 3T6JA 5IY5C 3AGTA 4BJ5C 3ABKC 2CW0F 1VYIA 2VH3A 4DBRA 3N24A 5A6BD 4C7OB 4NTFA 2WL8A 5KYYB 5KYWB 2J7PD 2ZXRA 3DI5A 5JP7A 4IGGA 2DB4A 1HY5A 4BEJA 2Y3BA 2F22A 3QW1A 3NYJA 2PFDA 1RXQA 2CGEA 2IXNA 3KKBA 4XQ1A 5F5HA 3LNMB 4XEVA 3OEOA 2KC3A 1WGWA 3M4BA 1OXBA 2D5RB 1H9TA 1SYQA 5F28E 3V7OA 4E18A 5AC5A 1D0XA 2HS5A 3ATPA 4E0IA 3DJUB 3FMSA 2EPKX 3H2VA 4N6CA 5E3AA 2LK4A 3JZ0A 1FNTc 3HJCA 3QMKA 3ZG1A 3EFOA 1K05A 1ORYA 1FFTC 4O79A 4XTKA 1NZEA 5COMA 1YZAA 2MYSA 4NY3A 4RDAA 1PD0A 4U5BE 5E3CA 3X2QC 3ZVRA 5BQIA 5T3TA 5FCLA 3PDMP 1YYJA 3EGXB 5D92A 5L0FA 2R7XA 2J8WA 5FZTA 2G3KA 3SXMA 3ITFA 1WASA 2O9XA 4I44A 4JVSA 2EINC 4YT5A 1Z7Qc 1Y4CA 4K7BA 4H4KC 1KTMA 2OJED 3FVYA 2HJ3A 3ABMC 1TWCA 1GGQA 1QVXA 3JCUQ 2VASA 3RW0A 3K66A 3W2VA 4CDYA 5EHHA 2R7TA 4UDVA 1QSPA 1MMAA 3JTLO 3M79A 2R7UA 3H65A 2QUPA 1I4YA 2HSBA 1MMDA 1RKEB 2DYSC 1AUEA 3DAFA 4MVSA 5DLJA 4D4XA 4E7ZA 2XL8A 3RVYA 4C3BA 3K33A 2IM8A 2KW3C 4DRHB 2ZD9A 5HV9A 4XPYA 3L8JA 4Z9HA 3TJ6A 2NUPA 2PX3A 1G4WR 4AE4A 1ZHXA 4JTDB 1K04A 3JYYA 3LLKA 2VC9A 1E84A 3ZDLA 4LLCA 2XLVA 4DBQA 3KMIA 2OJQA 1U0BB 4U9EA 2WZFA 3DWWA 1PD1A 3F47A 3TJ5A 2A69F 2HMZA 4P6IC 2IXPA 5EGYA 5GPGB 3SEOA 2R7RA 1I5NA 1OXKA 2L81A 3EG9B 2XXAB 1EQ1A 3I5PA 1BR1A 1YAUO 3E9VA 1M2VA 1B68A 3HNLA 4ANJA 3TOLA 1I4ZA 1KNYA 2EPOA 3IQ6A 4AX2A 5JVEA 4XPWA 1ZW3A 2QNLA 1FMVA 3AQCA 5COGA 5DQZA 2PBEA 3HKKA 1XZPA 1FAPB 2HV6A 3LS1A 2CNWA 4XLNF 1MMGA 3UGOA 3ZQYA 4CBEA 2YVKA 2XS8A 5L0JA 4XLPF 1NSGB 4NTAA 1LE2A 1VLSA 1M2OA 1YDIA 3R7CA 2IXMA 5KYNA 4MW3A 2WZLA 3K1HA 4R32A 1H7IA 4H54A 1C03A 5T1DB 1V74B 2I15A 3B0PA 1W2WA 2G3VA 2KGOA 3Q7GA 5E2QA 2XSEA 4IAOA 5BQGA 3S29A 1J8MF 3EGDB 3DJNB 1A41A 3NKEA 1MQVA 2YL0A 4MW8A 1V4AA 3UMKA 3J06A 3AG2C 2R7VA 3EG9A 4YT2A 5KYXA 1BZ4A 2L6GA 4P9FA 4OD5A 4EWCA 3WHNA 3DXJF 5TJ5E 2A68F 3O39A 1D0ZA 3N2ZB 2YL1A 3RQFA 2KYHA 3GEHA 1O3UA 1GM5A 4RBNA 3V5YA 1XWJA 2EILC 2A0BA 2Q4FA 3ASOC 4MTFA 4A2NB 2YLGA 3QVYA 4YWQA 1TFKB 2Q9CA 3M4CA 4Z9JA 1LS1A 3HTKC 5L0GA 1SR2A 4BJ6C 1ORJA 5L0DA 1Z6AA 2EIJC 4U5DE 1WTYA 2LD6A 1XZQA 5KYYA 1A7DA 2ZPAA 4J30B 4CIPA 2JX0A 1TWGA 4J7YA 1E2XA 1T9KA 3JT1A 3AG1C 3U5SA 3WG7C 5HSWA 2J45A 1FTSA 2VCBA 2A0UA 2Y3HA 3NMIA 4YK5A 3W4YA 2VB6A 3KYJA 3LESA 4IB4A 1M6TA 3U2LA 2Z15A 4WABA 5A6BA 3SNHA 3BRJA 2R7WA 1NU9C 4NQFA 3OA1A 1LI5A 4YL3A 4OIPF 4G7OF 2WB7A 2J7PA 2KNHA 2I8BA 1D1BA 4OINF 2XLMA 2J9VA 3EH1A 1HMOA 4HEAJ 4JW1A 3B0UX 3NRHA
chains in the Genus database with same CATH topology
4XWJA 2A6HF 2LSEA 3EJNA 3KH2A 1OCZC 4WJ0A 2KQ9A 3AG4C 3S27A 4HE8D 1IW7F 1RJ9A 4C3EA 3HLZA 4JJFA 3M1CB 3F46A 3T6BA 4PJNA 1SMYF 3EQLF 4PFOA 4PK4A 4CSAA 1OKKD 3FDQA 3E70C 3K7DA 3UMHA 3O6XA 2EIKC 2R7SA 3S28A 3ZIBA 2FGYA 2GFHA 4C7OA 4U5GA 5DS6A 4GEHA 5KYWA 3DMDA 2R7QA 4DVZA 4F4BA 1ZU4A 1D1AA 3JYHA 3OWTA 1G8XA 3EHMA 1NU7D 3EH2A 3ZC4A 1MMNA 4CIHA 3RYLA 2WVOA 1MNEA 1ZHWA 4PJLA 3EGXA 5KYUB 4YN0B 1JPJA 1V54C 3I4UA 4PJJA 3AG3C 1S7ZA 4CSAC 4EBBA 3LS0A 2CDQA 2NUTB 3EZHA 1LKXA 3CZ6A 2DGJA 3DM9B 2DYRC 3B0VC 2J46A 2MWQA 2PP4A 4ZLDA 4U5CE 4QI0A 2IOQA 1FFHA 4Q5SF 3LEVA 2NG1A 3Q7LA 1VK5A 1Z23A 4HFFB 5E33A 1LVKA 3WODF 3GODA 1J8YF 2XL4A 4RD9A 5L3VA 1PCXA 2G62A 4DOZA 1TWAA 2XXAA 4ULWA 3Q6NA 4I3MA 2FFHA 2YZSA 4O6YA 2H7BA 2Y69C 4BJ1A 1TR2A 4MQ9F 4BJ5A 2HV7A 2YHSA 3LJBA 4O6NA 3CSKA 5F5FA 2C04A 4BG0A 2X51A 3RH3A 3PMRA 1Z3IX 4K0DA 3EZIA 4KNVA 2Q9AA 1JPNA 4CS8A 3QZCA 4YT8A 2EIMC 4CS7A 1SZIA 2QY9A 1SF8A 3ECSA 3EGDA 3SP1A 4FX5A 1VMAA 2WVNA 4JJGA 2JD3A 1FMWA 1ZHTA 3EFOB 5BUOA 2J0WA 5CI8A 4G7ZF 2YEVA 3KL4A 3SYNA 4AK9A 2IYLD 3CQZA 4X0RA 2Q9BA 3EPVA 3T4RA 1BR2A 5L3QA 4J32B 2OCCC 4FWVA 1ZHYA 5B3SC 2PX0A 4KC9A 2W45A 3K6BA 4QDLA 3NDBB 2A1DD 5DVWA 2Q3TA 4LLEA 3X1OA 1OKKA 4OD4A 1ZHZA 3FHDA 4G0HA 1OCRC 1Z5ZA 3K1IC 3RFYA 4KI2A 4CS8C 2NUPB 4AE4B 3N0TA 1KU2A 4JURI 3W2WA 2E87A 2W9YA 4O6MA 1O87A 4LERA 2P6VA 2J0XA 2V3CC 3ZSUA 4KBLA 2PF4E 2W4BA 1ST6A 4Q7CA 5B1AC 2C03A 4O7GA 4I1MA 5CI9A 1M2VB 4IJJA 1Z63A 1ZYRF 2J9WA 2W4MA 3DD7A 4JCHA 3DM5A 1MNDA 2P7VA 3RIPA 2ZXPA 2Y3GA 3TD7A 3VYWA 2OG2A 4Q4ZF 4M63A 4PJMA 3JSZA 4HFKB 4JZAA 2Y3DA 1OCOC 3UR3C 3MX3A 3PHF2 1N1CA 3EHNA 4LACB 3Q6MA 3I5QA 4U5EE 4ZLCA 4PFPA 3NKDA 2Y39A 3SZRA 3DZAA 3B9QA 2BE5F 5KYXB 1D1CA 4IRUA 3UGPA 3LNRA 3UNGC 3AQBA 2R7OA 4G7HF 5B1BC 4BJTA 1D0YA 4DVYP 1M57C 4BJ6A 1O5HA 5DQTA 3DAGA 2QTVA 3L34A 3LLIA 2CNWD 4CS9A 5KYUA 3FAJA 3W8HA 4N06A 5KYYB 3IEEA 2V26A 2KJGA 1QLEC 1BR4A 2IXOA 2NUTA 3LAYA 1OCCC 1IZMA 2ZXOA 5DS4A 3RKOF 4YJWA 2J9UA 3GANA 3UMIA 2H7OA 4U5FE 2WVQA 4GYTA 1ZU5A 4I1OB 5T3WA 3NYLA 4MNDA 2A6EF 3W8IA 3MLGA 5D91A 4QI2A 3VAYA 1M56C 3JRTA 4E7SA 1TKNA 4OIOF 1RJ9B 4OIQF 3S0XA 1VOMA 1VYKA 1TWHA 2ZXWC 3L0IA 4W8KA 2L9JA 5DS5A 1V55C 4IWBA 4U5HA 1NG1A 4YT4A 3NG1A 4B6IA 3NYMA 2XRHA 4C3DA 4CS9C 3ASNC 4KNWA 2H7VC 1QZXA 2M4EA 2WZGA 4OIRF 3ABLC 4FESA 2B0JA 3T6JA 5IY5C 4BJ5C 3ABKC 2CW0F 1VYIA 2VH3A 4DBRA 3N24A 4C7OB 2WL8A 5KYWB 2J7PD 2ZXRA 4BEJA 2Y3BA 3NYJA 2PFDA 5F5HA 2CGEA 2IXNA 3KKBA 3OEOA 1WGWA 2D5RB 3V7OA 1D0XA 3DJUB 5E3AA 3HJCA 3QMKA 3ZG1A 3EFOA 4O79A 1FFTC 4XTKA 5E3CA 1NZEA 3POVA 4RDAA 2MYSA 4NY3A 4U5BE 1PD0A 3X2QC 3ZVRA 5T3TA 5FCLA 3EGXB 5D92A 2R7XA 2G3KA 3ITFA 2O9XA 4I44A 4JVSA 2EINC 4YT5A 4K7BA 4H4KC 3FVYA 3ABMC 1TWCA 3JCUQ 3W2VA 5HSWA 2VASA 2R7TA 3K66A 5EHHA 1MMAA 2R7UA 3H65A 3DAFA 1MMDA 5DLJA 2DYSC 4E7ZA 4C3BA 3K33A 2KW3C 2NUPA 2PX3A 4AE4A 1ZHXA 3LLKA 4LLCA 4DBQA 3KMIA 2WZFA 1PD1A 3F47A 2A69F 4P6IC 5EGYA 2IXPA 3SEOA 2R7RA 2L81A 3EG9B 2XXAB 3I5PA 1BR1A 3E9VA 1M2VA 4ANJA 4AX2A 1FMVA 3AQCA 5DQZA 2HV6A 3LS1A 2CNWA 4XLNF 1MMGA 3UGOA 4CBEA 4XLPF 1M2OA 2IXMA 5KYNA 2WZLA 3K1HA 5T1DB 3B0PA 1W2WA 2G3VA 2KGOA 3Q7GA 5E2QA 2XSEA 4IAOA 3S29A 1J8MF 3EGDB 3DJNB 3NKEA 3UMKA 3AG2C 2R7VA 3EG9A 4YT2A 5KYXA 4OD5A 4EWCA 3DXJF 2A68F 3O39A 1D0ZA 3N2ZB 4RBNA 2EILC 3ASOC 4A2NB 4YWQA 2Q9CA 1LS1A 3HTKC 4BJ6C 1Z6AA 2EIJC 4U5DE 5KYYA 2ZPAA 4J30B 1TWGA 3JT1A 3AG1C 3WG7C 2J45A 1FTSA 2Y3HA 2VB6A 3LESA 2Z15A 3SNHA 2R7WA 1NU9C 3OA1A 4OIPF 4G7OF 2WB7A 2J7PA 2KNHA 2I8BA 1D1BA 4OINF 2J9VA 3EH1A 4HEAJ 4JW1A 3B0UX 3NRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HV6 A;  2IXM A;  2HV7 A;  2IXO A;  2IXP A;  2G62 A;  2IXN A;  4LAC B;  4NY3 A; 
#chains in the Genus database with same CATH topology
 4XWJ A;  2A6H F;  3QTH A;  2LSE A;  3EJN A;  3KH2 A;  1YLM A;  2AVK A;  1OCZ C;  4WJ0 A;  2KQ9 A;  3C63 A;  1GQA A;  3AG4 C;  3S27 A;  4HE8 D;  1IW7 F;  1RJ9 A;  1QKR A;  3NMK A;  1R4T A;  3C8G A;  1QQ3 A;  4C3E A;  3HLZ A;  1T6I A;  4JJF A;  3M1C B;  2RSE B;  1Q0K A;  4MVR A;  3F46 A;  3T6B A;  4PJN A;  3U0C A;  1YA7 O;  1SMY F;  2YLI A;  3EQL F;  4PFO A;  1RCP A;  1U6H A;  1JOG A;  4PK4 A;  1OKK D;  4CSA A;  1OR2 A;  4ONS A;  1S05 A;  4ER9 A;  2QE9 A;  3FDQ A;  5CIV A;  2XLO A;  1AEP A;  3E70 C;  3K7D A;  2IBF A;  3UMH A;  3O6X A;  1NFO A;  2EIK C;  3HNJ A;  5L0I A;  2R7S A;  3S28 A;  2EPM X;  3ZIB A;  2FGY A;  2GFH A;  4C7O A;  3MFN A;  1VLT A;  4XPX A;  4U5G A;  4EUK B;  5DS6 A;  2HZ8 A;  4GEH A;  5KYW A;  3POV A;  3DMD A;  2R7Q A;  4J7T A;  4BEM J;  4DVZ A;  1DOW A;  1CGM E;  1UFB A;  2GWW A;  2UUH A;  4F4B A;  1ZU4 A;  1D1A A;  2VCA A;  3KYI A;  3JYH A;  3CEX A;  1G5Z A;  2QLA A;  3TUL A;  2UUI A;  3OWT A;  4JTC B;  4CDA A;  1G8X A;  1E85 A;  3EHM A;  1NU7 D;  3EH2 A;  3MYF A;  3V5Z A;  3ZC4 A;  1MMN A;  4EKW A;  4MVQ A;  1Q0M A;  4CIH A;  5L0C A;  4Z9I A;  1U89 A;  1TFO B;  1UG7 A;  1CGN A;  3RYL A;  2WVO A;  2XLW A;  3FXH A;  1EKY A;  5JRA A;  1LM3 B;  1MNE A;  1A7V A;  2EPN A;  1ZHW A;  4PJL A;  4JEA A;  3EGX A;  5KYU B;  4YN0 B;  2OKU A;  1JPJ A;  1V54 C;  3I4U A;  5JUA A;  4PJJ A;  1QPU A;  2AP3 A;  3AG3 C;  1S7Z A;  4CSA C;  4EBB A;  3LS0 A;  2CDQ A;  2NUT B;  3EZH A;  1LKX A;  4MVU A;  3CZ6 A;  1OQC A;  2DGJ A;  3GM2 A;  3IQ5 A;  3DM9 B;  4JE9 A;  3ZTZ A;  1A0B A;  1RKE A;  4XEK A;  2DYR C;  1JAF A;  3G4Z A;  2J46 A;  2MWQ A;  1LS4 A;  2CYD A;  2XLH A;  3U8V A;  3B0V C;  2PP4 A;  2AWC A;  3BEH A;  4LDQ A;  4ZLD A;  2YKZ A;  4U5C E;  4AL1 A;  4QI0 A;  2IOQ A;  3L1M A;  2X0C A;  5A6J A;  4GQH A;  1FFH A;  4Q5S F;  5A69 A;  2NG1 A;  1LE4 A;  3LEV A;  3Q7L A;  5AGF A;  1TQG A;  1VK5 A;  2KK1 A;  3AJM A;  4IAQ A;  3IPM O;  1CPR A;  1APC A;  1Z23 A;  4D4N A;  1JRA A;  2J9B A;  1LVK A;  4HFF B;  5E33 A;  2OEX A;  4IAR A;  3WOD F;  3GWN A;  3SXY A;  3C18 A;  4EHP A;  3GOD A;  1J8Y F;  2XL4 A;  4RD9 A;  5EK0 A;  2OQM A;  4PR9 A;  2LIG A;  5L3V A;  1PCX A;  2G62 A;  1PV3 A;  2JPU A;  4DOZ A;  1VTM P;  1TWA A;  2XXA A;  4ULW A;  3Q6N A;  1CPQ A;  2OEV A;  3AOU A;  4I3M A;  1FR0 A;  3FAP B;  3O10 A;  1HMD A;  1LPE A;  1YJG A;  2ASR A;  2FFH A;  2YZS A;  2PNO A;  2HUJ A;  4O6Y A;  2H7B A;  2Y69 C;  3T6G B;  1YA9 A;  3SXK A;  1TR2 A;  4BJ1 A;  1GS9 A;  4MQ9 F;  4BJ5 A;  2HV7 A;  1ZW2 A;  2XLD A;  1JMW A;  4MVZ A;  4U9D A;  2YHS A;  1HE9 A;  1LIH A;  3LJB A;  4O6N A;  3CSK A;  5F5F A;  2C04 A;  4BG0 A;  2X51 A;  2XM4 A;  3RH3 A;  3GM3 A;  5L0H A;  1RMV A;  2YRF A;  3HNK A;  1WAT A;  3PMR A;  1L3P A;  1Z3I X;  3EZI A;  3IHU A;  4K0D A;  3K1I A;  4KNV A;  4JC7 A;  3DE8 A;  2Q9A A;  1JPN A;  3RF3 A;  3U3F A;  3US6 A;  4CS8 A;  1HE1 A;  3QZC A;  4YT8 A;  2EIM C;  1ORS C;  4MVO A;  2P0N A;  1WN0 A;  3FOO A;  4CS7 A;  2R03 A;  1RKC A;  3B29 A;  1HW2 A;  1SZI A;  3U2M A;  5JS5 A;  2QY9 A;  5JSL A;  1SF8 A;  2LQG A;  3ECS A;  1OW7 A;  3EGD A;  2NSF A;  3SP1 A;  4FX5 A;  1VMA A;  4EBK A;  2WVN A;  4JJG A;  3H2U A;  3FOP A;  2JD3 A;  4NC3 A;  1FMW A;  2XM0 A;  1ZHT A;  4G78 A;  1E83 A;  3GOR A;  3EFO B;  1YAR O;  2HSQ A;  3O55 A;  5BUO A;  2J0W A;  5CI8 A;  4G7Z F;  2YEV A;  3KL4 A;  3SYN A;  4AK9 A;  2XL6 A;  4FAP B;  2IYL D;  3CQZ A;  4X0R A;  2Q9B A;  1NBB A;  3EPV A;  3G50 A;  3T4R A;  1BR2 A;  5L3Q A;  4CJG A;  2ICW G;  4J32 B;  1NFN A;  2HJM A;  1Q0G A;  2OCC C;  1ZHY A;  4FWV A;  1E86 A;  1C17 M;  5B3S C;  2PX0 A;  4AL0 A;  3R2P A;  4KC9 A;  2YQY A;  2W45 A;  4CJO A;  3K6B A;  4QDL A;  3NDB B;  4P9T A;  3DE9 A;  5B3I A;  2A1D D;  5DVW A;  2B0H A;  1T6Q A;  2XLE A;  2LCH A;  2Q3T A;  4LLE A;  2HFI A;  1OKK A;  3X1O A;  1JR8 A;  3QVZ A;  4JRZ A;  1ZHZ A;  4OD4 A;  2TMV P;  3FHD A;  3GWL A;  4G0H A;  1OCR C;  1Z5Z A;  3K1I C;  3RFY A;  3VM6 A;  1BBH A;  4KI2 A;  1L7C A;  4CS8 C;  2NUP B;  3NMJ A;  4AE4 B;  1T01 A;  1YZC A;  4JIO A;  3N0T A;  1KU2 A;  4JUR I;  2L6F A;  3W2W A;  1VB5 A;  1CGO A;  2GAQ A;  2E87 A;  2R02 A;  2W9Y A;  3LUT B;  4O6M A;  3VRC A;  1O87 A;  2H8A A;  4LER A;  2XS1 A;  4N4W A;  3VF0 A;  2P6V A;  3ZTM A;  1OW8 A;  2J0X A;  1LI7 A;  3RQG A;  2V3C C;  4WGZ A;  3TQO A;  3ZSU A;  1OR3 A;  4KBL A;  3C8G D;  3S90 A;  2PF4 E;  2P1A A;  2W4B A;  3HNI A;  1ST6 A;  4Q7C A;  5B1A C;  4CX9 A;  2C03 A;  4O7G A;  4I1M A;  5CI9 A;  4DRJ B;  1M2V B;  4WGY A;  2R25 A;  5AC4 A;  1WOL A;  1YYX A;  4IJJ A;  3V5X A;  2FAP B;  1Z63 A;  1ZYR F;  2J9W A;  2W4M A;  3DD7 A;  3TOM A;  4MVM A;  2YLD A;  4JCH A;  3DM5 A;  3WAQ A;  1MND A;  3S84 A;  2P7V A;  3RIP A;  2ZXP A;  2Y3G A;  2GDC A;  2KSF A;  4MS2 A;  2OG2 A;  3TD7 A;  3VYW A;  4Q4Z F;  3U9M A;  2YL3 A;  4ULV A;  1G4U S;  4M63 A;  4EBJ A;  2VCC A;  4PJM A;  3IQC A;  3JSZ A;  3PCV A;  2D4U A;  4HFK B;  1NLX A;  2Y3D A;  1OCO C;  2BC5 A;  1Y6D A;  2NPU A;  4JZA A;  3UR3 C;  3MX3 A;  3PHF 2;  1N1C A;  3EHN A;  4PAC A;  4LAC B;  3Q6M A;  5K0I A;  3I5Q A;  3TK0 A;  2AU5 A;  3MYI A;  3QW0 A;  3GEI A;  4U5E E;  3RVZ A;  2BL2 A;  1EI7 A;  4ZLC A;  4PFP A;  3NKD A;  2Y39 A;  1DOV A;  2YL7 A;  4BPM A;  3SZR A;  3KPH A;  256B A;  3DZA A;  5JT4 A;  2BE5 F;  2DI3 A;  3B9Q A;  3GM1 A;  4K1O A;  3A9C A;  4CDV A;  5KYX B;  1D1C A;  4IRU A;  2L6H A;  3UGP A;  3LNR A;  1OW6 A;  3U9J A;  2LFF A;  3L8I A;  3UNG C;  3AQB A;  1WWP A;  3JRM O;  2R7O A;  4DJ9 A;  4G7H F;  3C62 A;  2R9R B;  1ZZP A;  3MBG A;  2L7A A;  5B1B C;  4NCQ A;  4BJT A;  1D0Y A;  5COF A;  4DVY P;  1M57 C;  4BJ6 A;  1O5H A;  2M64 A;  3DAG A;  5DQT A;  2HMQ A;  2QTV A;  1K40 A;  2HKV A;  3L34 A;  1Q0F A;  3C8Z A;  3LLI A;  4JCZ A;  2CNW D;  4CS9 A;  5KYU A;  3FAJ A;  4N6H A;  3W8H A;  4JTA B;  1EA8 A;  4NTB A;  2CCY A;  4N06 A;  4E0H A;  3DKA A;  3IEE A;  1AVO B;  2V26 A;  2KJG A;  3M15 A;  1QLE C;  4JEB A;  4DXW A;  5A6K A;  1HW1 A;  2OOC A;  4EIY A;  2EPL X;  3GEE A;  1BR4 A;  2ETS A;  2IXO A;  2NUT A;  2GA0 A;  3C7J A;  3LAY A;  4LDR A;  3U3B A;  1OCC C;  1IZM A;  1BDJ B;  4YL0 A;  2Q00 A;  2ZXO A;  5DS4 A;  1YVI A;  2R05 A;  3JSE O;  3S9O A;  5A6A A;  4MTG A;  4YJW A;  4YL1 A;  2J9U A;  3RKO F;  3GAN A;  4E17 A;  4L6R A;  3UMI A;  2H7O A;  4U5F E;  2P61 A;  2WVQ A;  4LDK A;  4GYT A;  2Q7R A;  2AWY A;  1ZU5 A;  3LEO A;  4I1O B;  4JKV A;  5T3W A;  5JLI A;  3AGU A;  3NYL A;  2MHR A;  3IQT A;  4MND A;  2A6E F;  2YWA A;  3W8I A;  3ZQV A;  1F1M A;  3MLG A;  1C02 A;  5D91 A;  1T6U A;  2LP4 A;  4QI2 A;  3VAY A;  1M56 C;  1H6G A;  3JRT A;  1TKN A;  4E7S A;  4OIO F;  2NSG A;  2OU6 A;  1RJ9 B;  4OIQ F;  3S0X A;  1VOM A;  1VYK A;  1TWH A;  2ZXW C;  3L0I A;  4W8K A;  2L9J A;  5BQH A;  5DS5 A;  4A4A A;  3G4X A;  1Q0D A;  1V55 C;  4IWB A;  1NG1 A;  3C8G B;  4U5H A;  1R5I D;  2RD9 A;  3ZWI A;  4YT4 A;  4MTO A;  3A11 A;  3NG1 A;  4B6I A;  3U8P A;  4XEF A;  4DRI B;  1T5O A;  3NYM A;  2XRH A;  3T9O A;  1H9G A;  3CAX A;  4C3D A;  4CS9 C;  1A7E A;  3ASN C;  3SXZ A;  4KNW A;  2H7V C;  1QZX A;  2M4E A;  3B71 A;  4W8P A;  2WZG A;  3RQE A;  1ZVZ A;  4OIR F;  3ABL C;  4FES A;  2B0J A;  2LFD A;  3T6J A;  5IY5 C;  3AGT A;  4BJ5 C;  3ABK C;  2CW0 F;  1VYI A;  2VH3 A;  4DBR A;  3N24 A;  5A6B D;  4C7O B;  4NTF A;  2WL8 A;  5KYY B;  5KYW B;  2J7P D;  2ZXR A;  3DI5 A;  5JP7 A;  4IGG A;  2DB4 A;  1HY5 A;  4BEJ A;  2Y3B A;  2F22 A;  3QW1 A;  3NYJ A;  2PFD A;  1RXQ A;  2CGE A;  2IXN A;  3KKB A;  4XQ1 A;  5F5H A;  3LNM B;  4XEV A;  3OEO A;  2KC3 A;  1WGW A;  3M4B A;  1OXB A;  2D5R B;  1H9T A;  1SYQ A;  5F28 E;  3V7O A;  4E18 A;  5AC5 A;  1D0X A;  2HS5 A;  3ATP A;  4E0I A;  3DJU B;  3FMS A;  2EPK X;  3H2V A;  4N6C A;  5E3A A;  2LK4 A;  3JZ0 A;  1FNT c;  3HJC A;  3QMK A;  3ZG1 A;  3EFO A;  1K05 A;  1ORY A;  1FFT C;  4O79 A;  4XTK A;  1NZE A;  5COM A;  1YZA A;  2MYS A;  4NY3 A;  4RDA A;  1PD0 A;  4U5B E;  5E3C A;  3X2Q C;  3ZVR A;  5BQI A;  5T3T A;  5FCL A;  3PDM P;  1YYJ A;  3EGX B;  5D92 A;  5L0F A;  2R7X A;  2J8W A;  5FZT A;  2G3K A;  3SXM A;  3ITF A;  1WAS A;  2O9X A;  4I44 A;  4JVS A;  2EIN C;  4YT5 A;  1Z7Q c;  1Y4C A;  4K7B A;  4H4K C;  1KTM A;  2OJE D;  3FVY A;  2HJ3 A;  3ABM C;  1TWC A;  1GGQ A;  1QVX A;  3JCU Q;  2VAS A;  3RW0 A;  3K66 A;  3W2V A;  4CDY A;  5EHH A;  2R7T A;  4UDV A;  1QSP A;  1MMA A;  3JTL O;  3M79 A;  2R7U A;  3H65 A;  2QUP A;  1I4Y A;  2HSB A;  1MMD A;  1RKE B;  2DYS C;  1AUE A;  3DAF A;  4MVS A;  5DLJ A;  4D4X A;  4E7Z A;  2XL8 A;  3RVY A;  4C3B A;  3K33 A;  2IM8 A;  2KW3 C;  4DRH B;  2ZD9 A;  5HV9 A;  4XPY A;  3L8J A;  4Z9H A;  3TJ6 A;  2NUP A;  2PX3 A;  1G4W R;  4AE4 A;  1ZHX A;  4JTD B;  1K04 A;  3JYY A;  3LLK A;  2VC9 A;  1E84 A;  3ZDL A;  4LLC A;  2XLV A;  4DBQ A;  3KMI A;  2OJQ A;  1U0B B;  4U9E A;  2WZF A;  3DWW A;  1PD1 A;  3F47 A;  3TJ5 A;  2A69 F;  2HMZ A;  4P6I C;  2IXP A;  5EGY A;  5GPG B;  3SEO A;  2R7R A;  1I5N A;  1OXK A;  2L81 A;  3EG9 B;  2XXA B;  1EQ1 A;  3I5P A;  1BR1 A;  1YAU O;  3E9V A;  1M2V A;  1B68 A;  3HNL A;  4ANJ A;  3TOL A;  1I4Z A;  1KNY A;  2EPO A;  3IQ6 A;  4AX2 A;  5JVE A;  4XPW A;  1ZW3 A;  2QNL A;  1FMV A;  3AQC A;  5COG A;  5DQZ A;  2PBE A;  3HKK A;  1XZP A;  1FAP B;  2HV6 A;  3LS1 A;  2CNW A;  4XLN F;  1MMG A;  3UGO A;  3ZQY A;  4CBE A;  2YVK A;  2XS8 A;  5L0J A;  4XLP F;  1NSG B;  4NTA A;  1LE2 A;  1VLS A;  1M2O A;  1YDI A;  3R7C A;  2IXM A;  5KYN A;  4MW3 A;  2WZL A;  3K1H A;  4R32 A;  1H7I A;  4H54 A;  1C03 A;  5T1D B;  1V74 B;  2I15 A;  3B0P A;  1W2W A;  2G3V A;  2KGO A;  3Q7G A;  5E2Q A;  2XSE A;  4IAO A;  5BQG A;  3S29 A;  1J8M F;  3EGD B;  3DJN B;  1A41 A;  3NKE A;  1MQV A;  2YL0 A;  4MW8 A;  1V4A A;  3UMK A;  3J06 A;  3AG2 C;  2R7V A;  3EG9 A;  4YT2 A;  5KYX A;  1BZ4 A;  2L6G A;  4P9F A;  4OD5 A;  4EWC A;  3WHN A;  3DXJ F;  5TJ5 E;  2A68 F;  3O39 A;  1D0Z A;  3N2Z B;  2YL1 A;  3RQF A;  2KYH A;  3GEH A;  1O3U A;  1GM5 A;  4RBN A;  3V5Y A;  1XWJ A;  2EIL C;  2A0B A;  2Q4F A;  3ASO C;  4MTF A;  4A2N B;  2YLG A;  3QVY A;  4YWQ A;  1TFK B;  2Q9C A;  3M4C A;  4Z9J A;  1LS1 A;  3HTK C;  5L0G A;  1SR2 A;  4BJ6 C;  1ORJ A;  5L0D A;  1Z6A A;  2EIJ C;  4U5D E;  1WTY A;  2LD6 A;  1XZQ A;  5KYY A;  1A7D A;  2ZPA A;  4J30 B;  4CIP A;  2JX0 A;  1TWG A;  4J7Y A;  1E2X A;  1T9K A;  3JT1 A;  3AG1 C;  3U5S A;  3WG7 C;  5HSW A;  2J45 A;  1FTS A;  2VCB A;  2A0U A;  2Y3H A;  3NMI A;  4YK5 A;  3W4Y A;  2VB6 A;  3KYJ A;  3LES A;  4IB4 A;  1M6T A;  3U2L A;  2Z15 A;  4WAB A;  5A6B A;  3SNH A;  3BRJ A;  2R7W A;  1NU9 C;  4NQF A;  3OA1 A;  1LI5 A;  4YL3 A;  4OIP F;  4G7O F;  2WB7 A;  2J7P A;  2KNH A;  2I8B A;  1D1B A;  4OIN F;  2XLM A;  2J9V A;  3EH1 A;  1HMO A;  4HEA J;  4JW1 A;  3B0U X;  3NRH A; 
#chains in the Genus database with same CATH homology
 4XWJ A;  2A6H F;  2LSE A;  3EJN A;  3KH2 A;  1OCZ C;  4WJ0 A;  2KQ9 A;  3AG4 C;  3S27 A;  4HE8 D;  1IW7 F;  1RJ9 A;  4C3E A;  3HLZ A;  4JJF A;  3M1C B;  3F46 A;  3T6B A;  4PJN A;  1SMY F;  3EQL F;  4PFO A;  4PK4 A;  4CSA A;  1OKK D;  3FDQ A;  3E70 C;  3K7D A;  3UMH A;  3O6X A;  2EIK C;  2R7S A;  3S28 A;  3ZIB A;  2FGY A;  2GFH A;  4C7O A;  4U5G A;  5DS6 A;  4GEH A;  5KYW A;  3DMD A;  2R7Q A;  4DVZ A;  4F4B A;  1ZU4 A;  1D1A A;  3JYH A;  3OWT A;  1G8X A;  3EHM A;  1NU7 D;  3EH2 A;  3ZC4 A;  1MMN A;  4CIH A;  3RYL A;  2WVO A;  1MNE A;  1ZHW A;  4PJL A;  3EGX A;  5KYU B;  4YN0 B;  1JPJ A;  1V54 C;  3I4U A;  4PJJ A;  3AG3 C;  1S7Z A;  4CSA C;  4EBB A;  3LS0 A;  2CDQ A;  2NUT B;  3EZH A;  1LKX A;  3CZ6 A;  2DGJ A;  3DM9 B;  2DYR C;  3B0V C;  2J46 A;  2MWQ A;  2PP4 A;  4ZLD A;  4U5C E;  4QI0 A;  2IOQ A;  1FFH A;  4Q5S F;  3LEV A;  2NG1 A;  3Q7L A;  1VK5 A;  1Z23 A;  4HFF B;  5E33 A;  1LVK A;  3WOD F;  3GOD A;  1J8Y F;  2XL4 A;  4RD9 A;  5L3V A;  1PCX A;  2G62 A;  4DOZ A;  1TWA A;  2XXA A;  4ULW A;  3Q6N A;  4I3M A;  2FFH A;  2YZS A;  4O6Y A;  2H7B A;  2Y69 C;  4BJ1 A;  1TR2 A;  4MQ9 F;  4BJ5 A;  2HV7 A;  2YHS A;  3LJB A;  4O6N A;  3CSK A;  5F5F A;  2C04 A;  4BG0 A;  2X51 A;  3RH3 A;  3PMR A;  1Z3I X;  4K0D A;  3EZI A;  4KNV A;  2Q9A A;  1JPN A;  4CS8 A;  3QZC A;  4YT8 A;  2EIM C;  4CS7 A;  1SZI A;  2QY9 A;  1SF8 A;  3ECS A;  3EGD A;  3SP1 A;  4FX5 A;  1VMA A;  2WVN A;  4JJG A;  2JD3 A;  1FMW A;  1ZHT A;  3EFO B;  5BUO A;  2J0W A;  5CI8 A;  4G7Z F;  2YEV A;  3KL4 A;  3SYN A;  4AK9 A;  2IYL D;  3CQZ A;  4X0R A;  2Q9B A;  3EPV A;  3T4R A;  1BR2 A;  5L3Q A;  4J32 B;  2OCC C;  4FWV A;  1ZHY A;  5B3S C;  2PX0 A;  4KC9 A;  2W45 A;  3K6B A;  4QDL A;  3NDB B;  2A1D D;  5DVW A;  2Q3T A;  4LLE A;  3X1O A;  1OKK A;  4OD4 A;  1ZHZ A;  3FHD A;  4G0H A;  1OCR C;  1Z5Z A;  3K1I C;  3RFY A;  4KI2 A;  4CS8 C;  2NUP B;  4AE4 B;  3N0T A;  1KU2 A;  4JUR I;  3W2W A;  2E87 A;  2W9Y A;  4O6M A;  1O87 A;  4LER A;  2P6V A;  2J0X A;  2V3C C;  3ZSU A;  4KBL A;  2PF4 E;  2W4B A;  1ST6 A;  4Q7C A;  5B1A C;  2C03 A;  4O7G A;  4I1M A;  5CI9 A;  1M2V B;  4IJJ A;  1Z63 A;  1ZYR F;  2J9W A;  2W4M A;  3DD7 A;  4JCH A;  3DM5 A;  1MND A;  2P7V A;  3RIP A;  2ZXP A;  2Y3G A;  3TD7 A;  3VYW A;  2OG2 A;  4Q4Z F;  4M63 A;  4PJM A;  3JSZ A;  4HFK B;  4JZA A;  2Y3D A;  1OCO C;  3UR3 C;  3MX3 A;  3PHF 2;  1N1C A;  3EHN A;  4LAC B;  3Q6M A;  3I5Q A;  4U5E E;  4ZLC A;  4PFP A;  3NKD A;  2Y39 A;  3SZR A;  3DZA A;  3B9Q A;  2BE5 F;  5KYX B;  1D1C A;  4IRU A;  3UGP A;  3LNR A;  3UNG C;  3AQB A;  2R7O A;  4G7H F;  5B1B C;  4BJT A;  1D0Y A;  4DVY P;  1M57 C;  4BJ6 A;  1O5H A;  5DQT A;  3DAG A;  2QTV A;  3L34 A;  3LLI A;  2CNW D;  4CS9 A;  5KYU A;  3FAJ A;  3W8H A;  4N06 A;  5KYY B;  3IEE A;  2V26 A;  2KJG A;  1QLE C;  1BR4 A;  2IXO A;  2NUT A;  3LAY A;  1OCC C;  1IZM A;  2ZXO A;  5DS4 A;  3RKO F;  4YJW A;  2J9U A;  3GAN A;  3UMI A;  2H7O A;  4U5F E;  2WVQ A;  4GYT A;  1ZU5 A;  4I1O B;  5T3W A;  3NYL A;  4MND A;  2A6E F;  3W8I A;  3MLG A;  5D91 A;  4QI2 A;  3VAY A;  1M56 C;  3JRT A;  4E7S A;  1TKN A;  4OIO F;  1RJ9 B;  4OIQ F;  3S0X A;  1VOM A;  1VYK A;  1TWH A;  2ZXW C;  3L0I A;  4W8K A;  2L9J A;  5DS5 A;  1V55 C;  4IWB A;  4U5H A;  1NG1 A;  4YT4 A;  3NG1 A;  4B6I A;  3NYM A;  2XRH A;  4C3D A;  4CS9 C;  3ASN C;  4KNW A;  2H7V C;  1QZX A;  2M4E A;  2WZG A;  4OIR F;  3ABL C;  4FES A;  2B0J A;  3T6J A;  5IY5 C;  4BJ5 C;  3ABK C;  2CW0 F;  1VYI A;  2VH3 A;  4DBR A;  3N24 A;  4C7O B;  2WL8 A;  5KYW B;  2J7P D;  2ZXR A;  4BEJ A;  2Y3B A;  3NYJ A;  2PFD A;  5F5H A;  2CGE A;  2IXN A;  3KKB A;  3OEO A;  1WGW A;  2D5R B;  3V7O A;  1D0X A;  3DJU B;  5E3A A;  3HJC A;  3QMK A;  3ZG1 A;  3EFO A;  4O79 A;  1FFT C;  4XTK A;  5E3C A;  1NZE A;  3POV A;  4RDA A;  2MYS A;  4NY3 A;  4U5B E;  1PD0 A;  3X2Q C;  3ZVR A;  5T3T A;  5FCL A;  3EGX B;  5D92 A;  2R7X A;  2G3K A;  3ITF A;  2O9X A;  4I44 A;  4JVS A;  2EIN C;  4YT5 A;  4K7B A;  4H4K C;  3FVY A;  3ABM C;  1TWC A;  3JCU Q;  3W2V A;  5HSW A;  2VAS A;  2R7T A;  3K66 A;  5EHH A;  1MMA A;  2R7U A;  3H65 A;  3DAF A;  1MMD A;  5DLJ A;  2DYS C;  4E7Z A;  4C3B A;  3K33 A;  2KW3 C;  2NUP A;  2PX3 A;  4AE4 A;  1ZHX A;  3LLK A;  4LLC A;  4DBQ A;  3KMI A;  2WZF A;  1PD1 A;  3F47 A;  2A69 F;  4P6I C;  5EGY A;  2IXP A;  3SEO A;  2R7R A;  2L81 A;  3EG9 B;  2XXA B;  3I5P A;  1BR1 A;  3E9V A;  1M2V A;  4ANJ A;  4AX2 A;  1FMV A;  3AQC A;  5DQZ A;  2HV6 A;  3LS1 A;  2CNW A;  4XLN F;  1MMG A;  3UGO A;  4CBE A;  4XLP F;  1M2O A;  2IXM A;  5KYN A;  2WZL A;  3K1H A;  5T1D B;  3B0P A;  1W2W A;  2G3V A;  2KGO A;  3Q7G A;  5E2Q A;  2XSE A;  4IAO A;  3S29 A;  1J8M F;  3EGD B;  3DJN B;  3NKE A;  3UMK A;  3AG2 C;  2R7V A;  3EG9 A;  4YT2 A;  5KYX A;  4OD5 A;  4EWC A;  3DXJ F;  2A68 F;  3O39 A;  1D0Z A;  3N2Z B;  4RBN A;  2EIL C;  3ASO C;  4A2N B;  4YWQ A;  2Q9C A;  1LS1 A;  3HTK C;  4BJ6 C;  1Z6A A;  2EIJ C;  4U5D E;  5KYY A;  2ZPA A;  4J30 B;  1TWG A;  3JT1 A;  3AG1 C;  3WG7 C;  2J45 A;  1FTS A;  2Y3H A;  2VB6 A;  3LES A;  2Z15 A;  3SNH A;  2R7W A;  1NU9 C;  3OA1 A;  4OIP F;  4G7O F;  2WB7 A;  2J7P A;  2KNH A;  2I8B A;  1D1B A;  4OIN F;  2J9V A;  3EH1 A;  4HEA J;  4JW1 A;  3B0U X;  3NRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...