2G6FX

Crystal structure of the sh3 domain of betapix in complex with a high affinity peptide from pak2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
GPLGSVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 7
publication title Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 11
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2g6fX00
2VKNA 1RI9A 2ECZA 2KNBB 1QWFA 4OMMA 2L3SA 2RPNA 1WFWA 4AFZC 2GTJA 2RNAA 1SEMA 2X3WD 2RQWA 2KXDA 3QWYA 3REBB 2JTEA 1AEYA 2GGRA 4J9EA 1AWJA 3M0UA 1NG2A 2O31A 3I9QA 1UJYA 4ESRA 1M3CA 5IH2A 1U06A 2KRMA 2CSQA 2IIMA 4LUEA 2DBKA 4J9FA 2NUZA 2I0NA 1HJDA 1YN8A 2YUQA 4RTTA 2K2MA 4K11A 1E6HA 2D8JA 2DE0X 4Y92A 1AZGB 4JPBW 1T3SA 1JO8A 4JZ3A 4JZ4A 4HVUA 4GLMA 1OV3A 2KXCA 2OJ2A 2MCNA 2RQVA 2CH4A 2HSPA 1AZEA 2EKHA 3GBQA 2ED0A 3SHWA 1M3AA 1TUCA 2KBTA 4RTZA 1SHFA 3JV3A 2EPDA 2DILA 2K3BA 2KROA 4RTUA 1PHTA 2KRSA 5EC7A 1EFNA 3EG0A 4ORZA 1KIKA 2V1RA 3VS7A 2W0ZA 1QKWA 1UFFA 4M4ZA 3EG1A 1FYNA 1QCFA 4RTYA 5ECAA 1OPKA 2DRKA 2DYBA 2RN8A 1GL5A 2EYWA 2K9GA 2KT8A 2CH4W 2V1QA 2BZ8A 5FWCA 3M0PA 2A37A 1H3HA 4RUGA 1I1JA 1BK2A 1RLQC 1UJ0A 3UA7A 1S1NA 1Y57A 2KRNA 3NMZC 3M0QA 1MV0B 1M8MA 1QKXA 1UHCA 1AWWA 1ABQA 2RQTA 1CKAA 2BZYA 3A98A 2LCSA 2RQUA 4LUDA 2O2OA 5IHNA 3VS0A 2FPFA 3VS3A 1K9AA 1IO6A 4J9DA 4OMOA 3C0CA 3I35A 5HCKA 3U23A 1G83A 2G6FX 1K76A 2KYBA 2W10A 1GFDA 2O88A 1J3TA 2DM1A 2PZ1A 3UA6A 1NLPC 3I5RA 1JQQA 2ROLA 5IHKA 4Z89A 3EHQA 1PWTA 2JS2A 1WIEA 2AKLA 3H41A 1AWXA 1GBQA 1B3QA 1ZUUA 5IHIA 1UUEA 2JXBA 3EHRA 1BBZA 2PTKA 3NPFA 4RTXA 4J9BA 1GCQC 1K0SA 1YWPA 2DL8A 3I5SA 2L0AA 2FEIA 3CQTA 2JM9A 1NM7A 1H8KA 1UE9A 2BTTA 2LX7A 2CREA 3M0RA 4AG1C 5L23A 3RNJA 3PE0A 1WX6A 3UF4A 2EGAA 4E6RA 5IXFA 2RQRA 1PNJA 1GBRA 2K79A 3NHNA 2LZ6B 2O9VA 2CT3A 3SEMA 2A36A 2DF6A 4D8DA 4CC7A 2EQIA 4CC2A 1UGVA 1X2QA 1UTIA 3QWXX 4J9IA 4LE9A 1E7OA 4EIKA 2J06A 2JMCA 3THKA 3ULRB 1B07A 2D8HA 2C0IA 3VS5A 1VYVA 3VS2A 2D0NA 2LQWA 2D1XA 2FRWA 2X3XD 2MIOA 3UATA 1SSHA 1M27C 2AZVA 2EBPA 1NEBA 2J05A 4A63B 1JU5C 1XOVA 4QT7A 1Z9QA 3H0IA 3LH5A 3VRYA 3IQLA 1T3LA 2VVKA 2EYZA 1WLPB 1H92A 2EGEA 2LP5A 2RMOA 4HVWA 4J9CA 1WDXA 2J6KA 2FO0A 5GJVB 4ZNXA 5FW9A 1U3OA 1W70A 2CUBA 2E5KA 2KE9A 4GBQA 1YP5A 1ZSGA 2GNCA 4LNPA 1SHGA 1VA7A 1T0HA 1V1CA 2DJQA 1ZX6A 1M3BA 3H0FA 1MV3A 1FMKA 2F2WA 3R6NA 4F16A 1A0NB 1VYUA 3VS4A 1I0CA 1X6BA 2KGTA 1SRMA 3NGPA 3VRZA 3EG2A 2P4RA 2YUPA 1ZLMA 1AOJA 2LJ3A 2ROTA 4IIOA 2ABLA 1I07A 2VWFA 1PKSA 1KJWA 2K7AA 5GJWB 4RTWA 1OOTA 4HCKA 1VYTA 1WXTA 2B86A 2DMOA 1NEGA 3EG3A 2LMJA 2YDLA 1GFCA 2KEAA 2XMFA 4X1VA 2H8HA 2M0YA 1W6XA 2JT4A 1UG1A 4OMPA 2L3PA 2C0TA 4Z8AA 1K0XA 1QWEA 1Y0MA 2DL3A 2HDAA 2JM8A 1AVZC 1YWOA 2KT1A 2LQNA 1PKTA 4AFUC 2AK5A 2DX1A 2GQIA 1E6GA 4JJBA 2JS0A 1N5ZA 1RUWA 2JMAA 1SRLA 3ZL7C 2ED1A 4Z88A 1X69A 2JW4A 3REAB 2LNHB 2A08A 2GBQA 1WXUA 2YSQA 2ESWA 4DEYA 1GCQA 1X43A 2MOXA 1ZUKA 2ENMA 2OAWA 1SPKA 1K4US 3RBBB 2BZXA 2O9SA 4JJCA 5FWBA 2DL4A 3VS1A 2QDLA 2YT6A 3FJ5A 3TSWA 4AFSC 1GRIA 2FRYA 2CUDA 2CT4A 3KFVA 2AZSA 4OMNA 2PNIA 1BB9A 4F14A 2CDTA 2KYMA 1ABOA 1X27A 3TSZA 2J6OA 4F17A 1QLYA 2J6FA 1G2BA 2A28A 4RTVA 1YNZA 2FG0A 4OMQA 1UHFA 1NLOC 2SEMA 4JJDA 3PVLA 2DLPA 2F2XA 1X2KA 2YUOA 3M0SA 2M51A 4CC4B 5I22A 1HD3A 4CC3A 2SRCA 2LJ0A 2DVJA 2K6DA 1K1ZA 1AD5A 2AKKA 1WA7A 1TG0A 1GCPA 2CSIA 1JXOA 4J9GA 1YCSB 2LJ1A 1NYFA 1NYGA 4J9HA 1KSWA 1JXMA 1KFZA 1MUZA 2FPDA 1TUDA 3VS6A 1CKBA 2DBMA 2EVRA 2YUNA 4KRTA 2J7IA 2EYYA 4IIMA 3M0TA 3PVQA 4FSSA 2RF0A 1UECA 4OMLA 1PRLC 2L3QA 2HCKA 1U5SA 2F2VA 3EGUA 2KR3A 2C0OA 2NWMA 1PRMC 4D8KA 1WYXA 4AG2C 1JEGA 1ARKA 4DEXA 2DL5A 4HVVA 4R0KA 2EYXA 1LCKA 2DRMA 1ZUYA 2DA9A 1T0JA 1OEBA 5I11A 2DL7A 1RLPC 4AFQC 1CSKA 1M30A 4HXJA 1HSQA 2GTOA 2DNUA 2HBWA 2EGCA 2OI3A 3H0HA 1Z9ZA 1X6GA 1WXBA 1BU1A 2FPEA 1AWOA 1OPLA 2HEQA 1UDLA 1WI7A 1ZBJA 4LN2A 5IXBA 2EW3A 3TVTA 1W1FA 3O5ZA 2L2PA 4WCIA
chains in the Genus database with same CATH superfamily
5GAOm 4C5HA 2E3HA 1OU9A 1HK9A 2JZ2A 4AT1B 4WTOB 2DK3A 3OYGA 4OMMA 2L3SA 4BDYA 2YLBA 2GTJA 2RNAA 1SEMA 2X3WD 1TOVA 4ZGEB 2M16A 3QWYA 2RJFA 3PIPA 4IUPA 1AEYA 1NE8A 4O6JA 3OYLA 4JRQA 4HT9A 3MEWA 1IRXA 4BE1A 1UJYA 5LJ3e 4ESRA 2KRMA 2NUTB 2CSQA 2IIMA 1VIEA 4J9FA 4BI3A 4RKUE 1O75A 3M9QA 1MMGA 2YUQA 4JRIA 2K2MA 1BCOA 4K11A 1N8RU 1H641 1N8RC 4Y92A 2VV5A 3OW2A 2DIGA 1VQ9A 1NPPA 4X9DA 1KC8U 4HVUA 2QQSA 3P8HA 4X34A 2JOYA 3SHWA 4RTZA 5I2MA 3JV3A 2DILA 2GCXA 2KROA 2Z0WA 3V8JA 3CC7Q 4M75A 1PHTA 4PNOA 3L1AA 1QMCA 1UB4A 3EG0A 2BE7D 4ORZA 4C8QA 5A0LA 2W0ZA 4FYXB 2FHDA 3FIFA 3M4YA 3INZA 3P8DA 2P0QA 3GF5A 2LRQA 3CCRQ 3OYMA 3G6ET 3JCMe 1RAHB 4XQ3A 4RTYA 5M9OA 1OPKA 1YJ9Q 2RN8A 2QA4A 3KBGA 1KG1A 1U1TA 3A8HB 2BZ8A 4M77E 5FU7B 2A37A 4RUGA 1UJ0A 5A0DA 2KI7A 3UA7A 1PG5B 1Y57A 1UHCA 1QKXA 4M7AG 1IZ6A 2XD0A 2RQTA 4F7UA 3CD6A 1CKAA 3OYHA 1RABB 4IUUA 4PJOA 1QVFS 3OS1A 3NTHA 6AT1B 1K9MU 4ME7A 1M1FA 2HD0A 2PVDB 4M7DC 4EMHA 4OMOA 3EGXA 3C0CA 1KQ1A 3LH0A 4M75B 3FB9A 1PSEA 3MP6A 1K76A 4C8QB 1I4K1 5CK9A 3QBYA 1VQ4T 5GANh 3CCQQ 2RH2A 2L3RA 2KSSA 4LXCA 3M59A 2ROLA 5IHKA 3GIBA 4C92A 4BE0A 2ZAEA 4EMKA 2AKLA 2DJZA 3H41A 5GMKj 1B3QA 1M2OA 2KQWA 3EHRA 1GCQC 4Y91A 1YWPA 2DL8A 1HYOA 3CBMA 4PFOA 2IG0A 4Q5WA 3OBWA 3CCUA 4PJOB 1OI1A 1IHVA 1H8KA 2BTTA 1VQLQ 2RO0A 5DLOA 5KYYA 3QDRB 3RR6A 4E7ZA 3CC2T 1KK7A 3JB9F 3EFOA 2K79A 3NHNA 3EGXB 2O9VA 3SEMA 1H3ZA 2A36A 2YWWA 3V7SA 1MMDA 1QVGP 1X2QA 3OW2S 1VQNT 1RAGB 3QWXX 1Q82R 1Q82C 1DJ7B 4WF2A 1M90U 2J06A 2JMCA 1NJIU 3THKA 4EMKB 1SF9A 1VQ7Q 1VYVA 3VS2A 1M90C 3A8OB 3OMCA 4M77D 2LQWA 2X3XD 9ATCB 1KQSA 2MIOA 3HRTA 4C5GA 3JCMX 4A63B 2EKOA 4MZMA 3CCVT 3H0IA 5HKCA 5KYYB 2OX7A 3EFOB 3RKWA 2DEUA 1H92A 2EGEA 3CCJA 3OMGA 3G71Q 4E7JA 3JSCA 3WVEB 4DOVA 2J6KA 2FYKA 4GLKA 2E5KA 1C1AA 1ZSGA 3OYYA 2GNCA 3EH2A 4BE2A 2AT1B 1VA7A 3QZ9B 1V1CA 2DJQA 1N9RA 2QGGA 1ZX6A 2PUKB 1MV3A 2G3RA 2L8DA 3R6NA 1SG5A 2ZPHB 1X6BA 4EMGA 1WHKA 2PVOB 2YUPA 4ELYC 3N5BB 3LGFA 3EFSA 3EH1A 3UDCA 4J6WA 1WXTA 2DMOA 2NYSA 3M53A 2LMJA 2YDLA 4OP0A 3C94A 3AT1B 2XMFA 2FZGB 2JT4A 4A53A 2L3PA 2C0TA 4Z8AA 2RJDA 2R5AA 2DL3A 2PVGB 3CC7T 2LQNA 1PKTA 3CCLQ 2O4XA 2D0QB 4P5NA 1E6GA 2JS0A 1TTHB 3CCRT 1N5ZA 2QQ9A 3CC4T 2OTLQ 3CBOA 4DBRA 4FT4A 4Z88A 3REAB 2LNHB 1QVFP 2JJ9A 2YSQA 1X43A 5CKEA 5FU7C 1SSFA 4AMCA 1M1GA 3RBBB 2O9SA 2XHCA 4JJCA 2COYA 5FWBA 2QXFA 4HCZA 2QDLA 1GRIA 1RAIB 2E10A 3QIIA 2CT4A 1I5OB 1Q7YU 1BI3A 2JNGA 1TXQA 1BB9A 2RHXA 1KQSS 1Q7YC 1ABOA 1BKBA 5GAOl 2J6OA 1OX9A 1S72Q 4M77G 5GAOn 3JCMP 2QEXT 3UWNA 2ZPIB 1W2BA 4M75C 3CMEA 2FG0A 3LX7A 2O4XB 3MP1A 4C8QC 1NLOC 5A2QE 3CCQT 1R0CB 1X2KA 2YUOA 1OZ2A 3M0SA 4M78F 4CC4B 1YIJQ 1VQMA 2LJ0A 1AD5A 2AKKA 1WA7A 3E9GA 1R0BG 3H6ZA 1D3BB 4KUDK 4ELZC 4D6WA 3VV0A 1VQ8T 1MUZA 2FPDA 1R77A 3CCET 1TUDA 1VQLT 4PJOC 2YRDA 3OW2P 2HQEA 3EFRA 5CCAA 1VQ6A 2J7IA 2M9UA 5KCHA 4N4IA 2HKNA 3Q1JA 1VQNA 2RD1A 2QI2A 2ZPEB 4ZN3A 2HCKA 1Y96A 1U5SA 2F2VA 2C0OA 3L42A 1PRMC 4D8KA 1LJOA 4AG2C 2EJGA 1U8RA 3QPHA 1ARKA 3H9NA 4R0KA 1LCKA 4C92C 2LNVA 5GMKm 1WQ7A 5D6XA 4EMKC 2NUPA 5I11A 2DL7A 2RHUA 4IURA 1M30A 1D0XA 4BD3A 3CXCA 4FT2A 1WQWA 2QQRA 2HBWA 2H3EB 5DLQE 3I55Q 2EGCA 2VGMA 1BU1A 2KK4A 4FIBA 1AWOA 1G5VA 1UDLA 1WI7A 3CEYA 1ZBJA 4B9XA 3WVDB 4JRPA 4N4HA 5GAMe 5KH6A 4ZTJA 2RI5A 1WJQA 2ZCFB 2CP0A 3G6EQ 1TH7A 2X4YA 4DA4A 1YJNA 2YRCA 3LW5E 2FZKB 4KGZB 4IUQA 3RUXA 3SB2A 2ECZA 2KNBB 3G71T 2GQVA 2RJCA 1W4SA 3BW1A 2A3LA 1XQHA 3REBB 3OYKA 1F1BB 1AWJA 4KULA 3M0UA 2O31A 5CIUA 3DLMA 2Y4YA 1PD1A 1U06A 2NUPB 1Q81U 1JBMA 4KBMB 2DO3A 5KYWA 4C0DB 1Q81C 2ZPBB 1YN8A 2VASA 4RTTA 1UEBA 3G7ZA 4OB2B 1E6HA 4MZPA 1VQ4Q 4XTWA 1FMVA 1T3SA 1JO8A 2OTJQ 3CC7A 4XU3A 2DZ9A 2OJ2A 2MCNA 2CH4A 1AZEA 4FYVB 4LD9K 2KBTA 4M7DF 1WHHA 1YJWQ 2K3BA 5KYXA 3CCRA 3M55A 3M5AA 2K5LA 2KRSA 2C06A 1YJ9A 4HKEA 5EC7A 3V8LA 3VS7A 1QKWA 3CCLT 4QKUA 5LJ3j 4M4ZA 4C0FA 4QQ6A 2HSEB 4E7HA 2P4TA 2E41A 3L2VA 3CC2Q 2DYBA 2X9HA 4KGXB 1M9SA 4IKFA 2EYWA 5KYWB 2KT8A 3MEVA 3M0PA 1RLQC 1G3TA 1KQSP 2KRNA 1M8MA 5FRMA 3FC3A 1AWWA 2BZYA 3A98A 4MMKA 2E3IA 2DPPB 4OB1B 4LUDA 3OB9A 1MHNA 3JCMV 4LDXA 2DTOA 3JCMb 3E2UA 5IHNA 4OGCA 3JB9D 3VS0A 3QG1A 1K9AA 3CCQA 5KYXB 3TU4K 1S72T 3EGDA 2DVEA 1GFDA 4PJLA 3E1SA 1YHQQ 3UA6A 2PZ1A 1NLPC 1FMWA 3I5RA 1JQQA 5GANe 4Z89A 1Y71A 1YIJT 2JS2A 3JCMc 3QXEB 2HL3A 2PUOB 1VQLA 2PTKA 5GAOr 2X4JA 1R8OB 1K0SA 1NPRA 2YLCA 3I5SA 2BE9B 2L0AA 5A0GA 2GFAA 1PC0A 3M0RA 2CREA 4OVAA 4AG1C 1WX6A 3M57A 2EGAA 4KT0E 5IXFA 2RQRA 1PNJA 4C92D 4DOWA 1GBRA 4N4GA 5IN1A 1I5LA 5GAN6 2RI3A 3EGDB 1V29B 2B8AA 2DF6A 2EJ9A 2DXUA 2DTIA 2EQIA 4CC2A 1VQ7A 1UTIA 5C6SA 3VYGA 4V2SA 4J9IA 2VB6A 1E7OA 2LX9A 5GAN2 1JRIA 3JB9H 3V7CA 4M78E 2D0NA 4MZTA 3OY9A 2K2VA 3PMTA 5GAOq 3UATA 3I55T 1I81A 2CZ6B 2EBPA 4HT8A 2MMPA 2JTFA 3MCAB 1JU5C 2CP7A 1XOVA 2X51A 4QT7A 3G71A 2K5FA 3IQLA 3CC4Q 1T3LA 3OBYA 2DEQA 3QYGB 2M0OA 2EFIA 5KYNA 4M7AA 4CRIA 1P92A 1WDXA 1OX8A 1OYXA 5L8RE 5GAN8 3M56A 1U3OA 4GBQA 4LNPA 4HA8A 3VYHB 2VYTA 1M3BA 2EQJA 3LWHA 2V26A 4E2FB 5KE2A 2A0FB 2F2WA 4KH1B 1RAEB 3QUIA 3ZFJA 1I0CA 1SRMA 3NGPA 2P4RA 2DERA 1YITT 2QEXQ 3AHUA 1I07A 1PKSA 3V7RA 5FU6B 1OOTA 4RG8A 2B86A 2OTJT 1G3YA 1GFCA 2BUDA 4M7AB 4OMFB 3URGA 4RG2A 3CCLA 2FL7A 4OMPA 1EZZB 1YJWT 1WGSA 1K0XA 1RAFB 2JM8A 2OTLA 2VC8A 1YWOA 3VJPA 3PIOA 3CCSA 1VQ8Q 4M75F 3CCEQ 4N0AA 1VQPT 4IUTA 3RERA 2RA2A 4C8QF 2JTMA 1ZA2B 4QQDA 4M78D 2JMAA 1SRLA 2ED1A 2JW4A 2DYIA 4OGEA 2DXTA 3CPWA 1D0ZA 2GBQA 1TSFA 3CXCP 3BDLA 2MOXA 2ENMA 2OAWA 1BIBA 5CKBA 1Q82U 3NTKA 2R5MA 3CMAT 4ZGDB 4F7UF 3JCMQ 2DD4A 1S72A 2CUDA 4PJOF 2MYSA 3KFVA 3HPWA 3CCMQ 4OMNA 4OB3B 5LJ5j 4F14A 2F69A 3TSZA 5AYFA 5D6WA 4F17A 2LTOA 2HZYA 4M7DE 3MJXA 1YIJA 4RTVA 1YNZA 1HXDA 1B34A 4OMQA 2Y4XA 1YHQT 3FLGA 4XTVA 4PFZA 3S3OA 1HD3A 4CC3A 2DVJA 1U1SA 4C92F 1VQKT 4B6MA 2CSIA 1WJRA 2LQKA 4FL6A 3MP8A 3GLXA 1NYGA 2A7YA 1G3SA 3LGLA 1QVPA 4A54A 2EQKA 3CBPA 1Q86R 1Q86C 3GNFB 3ME9A 1CKBA 4FW2A 2EVRA 2YUNA 3PVQA 1XNIA 5FRNA 4OMLA 4A4EA 3O8VA 2E1HA 2KAFA 4FW1A 4DQ2A 5HY6A 1VQOQ 1B34B 2KR3A 2NWMA 3ASKA 5GMKi 4LDWA 2CS7A 3FRNA 3A8MB 3I55A 3UPUA 2P0KA 4J6YA 1QCOA 2I2LA 1RLPC 1CSKA 1RL2A 5D7UA 2QTXA 3FEOA 4XU1A 3G6EA 4C0GA 1WXBA 2HEQA 5HK0A 4E47A 4LN2A 2YXYA 2QG9B 2QTVA 4BACA 1X01A 3VUZA 4WCIA 2EIFA 3HSBA 1RI9A 4X9CA 4JLIA 1QWFA 2MWOA 4M78G 2RK2A 2RPNA 4A4FA 3M54A 3J7AF 1D0YA 4M7DD 2KXDA 1D3BA 2JTEA 1BCMA 2MWPA 3OS0A 2GGRA 1C6VX 1KD1R 1KD1C 2RJEA 5LJ3g 1NG2A 3I9QA 3HRSA 2M1HA 4M77A 3PGGA 5CR2A 3FDRA 2DBKA 2NUZA 1VQ4A 4JRKA 2I0NA 1BI0A 1RI0A 2OTJA 1VQ5Q 3JCMW 1M1KR 3TREA 3PNWC 1BIAA 1M1KC 1YBYA 2Y90A 1OQKA 1Y7XA 3X24B 5GAMj 4XTZA 2D8JA 1YJWA 3JRZA 2KMTA 4JPBW 5FU6C 4E7SA 1YFNA 4J8OA 2RQVA 2HSPA 2EKHA 1FXXA 3SD4A 2WSFE 1M3AA 1SHFA 2EPDA 1BI2A 2CGHA 2R58A 4A4KA 4NL2A 4RTUA 3CC2A 2LVMA 1IHWA 2LCCA 3JCMf 1UFFA 3JCMg 4DBQA 1WHLA 1D1CA 4M77B 3OYAA 3EG1A 3BDUA 4MMLA 1FYNA 2DRKA 5GMKh 5CQXA 2HKQB 2IPOB 3C12A 2QAZA 3PT9A 2P84A 5FWCA 3PTAA 1I1JA 2RB6A 2EQUA 2QDYB 1MV0B 1ABQA 1YCYA 2AIRB 4L5GA 4OF1A 2LCSA 2XIDA 2RQUA 2QGFB 1XTDA 2O2OA 3CCMT 2HMAA 1YHQA 4PFPA 4C5EA 2CP5A 1IO6A 3OYNA 3CCVA 3I35A 4BY6B 3U23A 2G6FX 3S6WA 2M02A 1JB0E 3A8LB 2DXBA 1J3TA 1YI2Q 4M75E 1IXDA 4J6XA 1TU0B 3OYCA 4TVRA 3EHQA 4C8QE 1PWTA 1WIEA 1AWXA 1GBQA 1ZUUA 2JXBA 4RTXA 1QP3A 4J9BA 3UT1A 3I56Q 1QVGA 4M7DG 4J5YA 2FEIA 3CQTA 2JM9A 3C95A 3MEUA 4ANJA 2LT4A 2GFUA 4YTLA 1UE9A 2MPXC 5DM7R 3RNJA 4F7UE 2E6ZA 2KY9A 5KYUA 4PJOE 2L5QA 4C0ZA 2HNIA 3M58A 5CKFA 3LYIA 1W2BS 3MKDA 1YITQ 2CZ0B 4CC7A 1VQOT 1UGVA 2X4XA 1FWZA 1TUGB 3KXTA 2QA4T 3VUBA 1BI1A 3TEEA 2VXFA 5I21A 2ATCB 5GANj 4LE9A 1TWBA 3ULRB 3PMIA 1B07A 2D8HA 3VS5A 3CD6T 5LL6S 1KQ2A 2CYZB 2RHZA 4C92E 1X6OA 2E6NA 2K4YA 1M27C 3CC4A 2J05A 1VQPQ 1Z9QA 3VRYA 4NOYA 3QHSA 3CMEQ 5KYUB 2VVKA 2EYZA 2E5QA 2JN0A 1ZQ1A 2RMOA 2K3XA 4ZNXA 1G3WA 1W70A 4IUVA 1YP5A 4HCCA 4M75D 3CMAQ 3OYIA 2QQBA 3DB4A 3H0FA 4PK4A 4C8QD 1K8AR 1FMKA 2ZPFB 1K8AC 3F70A 2QEXA 3NFCA 4F16A 3CXCS 4ZTFA 2K57A 4MDXA 1VYUA 8AT1B 1K73R 4OB0B 3RMQA 3C4SA 3VRZA 5I2SA 1VQ6Q 1KHIA 2XDDA 1VQ5T 1AOJA 2RI2A 2LJ3A 2ABLA 2VWFA 1KJWA 5GJWB 3L2RA 2PQWA 4RTWA 5LJ3d 3HKSA 4HCKA 2DTHA 5CKHA 3OYDA 3A5ZB 4F04B 1NEGA 3R6OA 3EG3A 1QVFA 2MAMA 3DLLA 4PJOD 2DD5A 5LJ5f 5LJ5g 2DZCA 3ZBDA 2KEAA 1VQ8A 1VQKQ 4X1VA 2H8HA 3CCEA 3OYJA 4O5VA 1JJ2A 4DBFA 1N27A 5J39A 4XU0A 1Y0MA 2RM4A 3SDZA 2KT1A 4J83A 4JS5A 2XDPA 4AFUC 2AK5A 2DX1A 4JJBA 3RESA 1IREB 4FM4B 4M77C 2DETA 1X69A 3KUFA 3P8BB 2EJFA 3MO8A 5KE3A 1WXUA 2ESWA 4DEYA 2X4WA 5KCOA 1WZOA 1YJNQ 1SPKA 2YHTA 1K4US 2BZXA 3CCMA 4XTUA 3CCJT 5GAN5 2DL4A 3FJ5A 3JCMd 2FRYA 3A8GB 2AZSA 2PNIA 2CDTA 2LT1A 2QYZA 4QW2A 3RMSA 3OS2A 3ZEHA 1QLYA 2J6FA 1G2BA 4XTYA 4BY6C 1UGSB 5J3BA 1N8RR 3J81E 1UHFA 1YI2T 2SEMA 4JJDA 3G4SQ 2F2XA 5I22A 2FVUA 2CKKA 2DIQA 1KC8R 1ZSZA 1KC8C 1WNLA 1GCPA 3RDVA 2RHIA 1JXOA 2VXEA 4J9GA 2LJ1A 1NYFA 4J9HA 1KSWA 1JXMA 3I56T 4FYYB 1KFZA 2JVVA 1W2BP 4UC4A 3VS6A 2E70A 1PM3A 4M75G 2XI9A 5GAN7 4PKCC 3X20B 1VQOA 4C8QG 2EYYA 3OSVA 2COZA 3V8KA 2WSEE 1PRLC 3ER0A 3DB3A 3JB9G 2L3QA 5IT9E 4C0DC 4QQGA 1LPLA 2LQ8A 3HTRA 4Z02A 4DEXA 2DL5A 4HVVA 1MGQA 3HFOA 2EYXA 2ZZDA 4F7UG 1ZSZB 1ZUYA 2DA9A 4RCBA 1JJ2S 2COWA 1K9MR 4AFQC 2MF2A 4HXJA 4PJOG 1K9MC 1HSQA 1O9SA 2QASA 2GTOA 2QK0A 2V8KA 2DNUA 3OA6A 4PJJA 1ZA1B 2FPEA 1OPLA 2E65A 5GAMf 5GAMg 1UGPB 2EW3A 2HL5C 4DBHA 3BFMA 3O5ZA 3L2UA 3X28B 2VKNA 3MPUB 3CMET 3X26B 5FLXE 5IAYA 2ZPGB 4FYWB 3OYFA 1WFWA 4AFZC 4M7AF 1QP2A 2HAXA 4C92G 4ATOA 5GMKl 2RQWA 4F7UB 1VQMT 3RKXA 3OS5A 4J9EA 4NS5A 5AT1B 2EYQA 5LJ3h 3S3NA 3BY7A 2CZ7B 2X35A 1M3CA 1VQ5A 5IH2A 2MK5A 2JUFA 2ZGWA 4LUEA 4ZN1A 1OULA 4FCYA 1WPYA 4B9WA 1HJDA 4FU6A 3QJ6A 1RADB 1LVKA 1VQ6T 1OU8A 2DFUA 4KGVB 2DE0X 1AZGB 4C92B 2CP2A 4JZ3A 3LWIA 4JZ4A 4GLMA 5CKDA 4LDVA 1OV3A 2KXCA 3RIRA 1M90R 1NJIR 1NJIC 3GBQA 2XG8D 2ED0A 2FB7A 1TUCA 1M4ZA 1D09B 1OZ3A 1PSFA 3A1PA 3VU3C 1VQ9Q 3CPFA 3G1JA 2PU9B 2MI6A 1Q86U 1EFNA 1KIKA 2V1RA 3JCMJ 3JCMh 1NZ9A 3EG9A 2XU8A 1X75C 1QCFA 2KDSA 2F1LA 3SWNA 5ECAA 1ZHIA 5LJ5d 1WHJA 3LLRA 3QJYA 1GL5A 2K9GA 3OYBA 2CH4W 2V1QA 5GMKe 3L2ZA 1QCNA 1H3HA 1BK2A 1VIFA 2DAQA 1YJNT 1S1NA 3NMZC 3M0QA 2QA4Q 1MNEA 4JLGA 3M4GA 2HBPA 1PD0A 3E19A 1KHCA 2CZ1B 3S3MA 3CD6Q 2FPFA 3VS3A 1BYMA 1SKUB 1YI2A 3HL8A 2AHJB 2RK1A 4J9DA 1D1AA 5HCKA 4BI4A 1G83A 3OYEA 4KH0B 3E9FA 2KYBA 2W10A 2O88A 2R57A 2DM1A 5GANf 3OQ5A 3EG9B 5GANg 4M78A 3JAME 3G4ST 4BUGA 8ATCB 3SWNB 3I56A 1M5Q1 3CPWS 4QVZA 5LJ5e 2QQAA 5IHIA 4J7FA 1UUEA 4II1A 3JB9J 1BBZA 3NPFA 3QKJA 2HQHA 1QW1A 2V8IA 1KD1U 4J7IA 1UGQB 5LJ3f 1NM7A 4QVDA 1D1BA 2LX7A 5L23A 3PE0A 3UF4A 3GOXA 5FROA 4E6RA 2D9TA 3CCSQ 1YITA 4FSXA 3RKYA 1NBEB 1YJ9T 3HFNA 2LCLA 3CCUQ 4PLIA 2LZ6B 3META 2CT3A 2CP6A 1M1KU 1C0MA 1JJ2P 4PJNA 4D8DA 3TQ7P 1FX7A 1VOMA 5CVIA 3HP9A 4JDSA 4M78B 3L2QA 5DY9A 4EIKA 4EPCA 1LNXA 2C0IA 4LDYA 1Q7YR 4XK8E 1ZSZC 3QYHB 4A4GA 2D1XA 1VUBA 2FRWA 1VQPA 4M7AC 1UGRB 2DKGA 1SSHA 2AZVA 2LC4A 1MNDA 1NEBA 5GAN4 1AHJB 3TCJA 4EDUA 1IGUA 1PCXA 2XKOC 3LH5A 4VUBA 2P0PA 1WLPB 5J26A 3HHTB 2LP5A 3CMAA 2EQMA 4HVWA 1ZBXA 4J9CA 2FO0A 5GJVB 5FW9A 4L59A 1B7TA 2CUBA 2KE9A 2VGNA 4A4HA 4XU2A 5GAMd 3CCJQ 4NL3A 1SHGA 1T0HA 2EWNA 1AT1B 4E7IA 3GNGA 4XAXB 3X25B 2IVWA 1A0NB 4PJMA 4M77F 2XICA 3VS4A 2CP3A 2KGTA 2BKDN 4RCCA 3EG2A 1N9SA 1ZLMA 2ROTA 4IIOA 3T9NA 2XDBA 2K7AA 1VQKA 2LDMA 2HQXA 2BIVA 1VYTA 4N0AC 2GF7A 4E7KA 1I8FA 1QQJA 1Q95G 2XK0A 5LJ5h 1VQ7T 2NLUA 4M7DA 1EIFA 2M0YA 2V8JA 1W6XA 1UG1A 2EAYA 4PLLA 1VQ9T 1TS9A 1QWEA 2WACA 2HDAA 4BDZA 4M7AE 1AVZC 3MEAA 4BB7A 3FJPA 2K5IA 2GQIA 1N6AA 4C5IA 5C0MA 2E12A 1RUWA 3ZL7C 2O01E 3MHXA 3D7SB 2A08A 1WHMA 1GCQA 1Y96B 1ZUKA 4L6V5 4JUVA 4LDUA 2H3JA 3VS1A 3TSWA 2YT6A 4LD6A 4MDWA 4AFSC 1ACMB 5CAIA 3SFMA 1WJSA 5GAOp 2FZCB 4M7DB 2OAUA 3NTIA 3PFSA 2KYMA 2RHYA 1Q81R 1X27A 4KUIA 2YRVA 4JJNK 1RAAB 4R56A 3G4SA 3CPWP 1GXIE 5EG2A 3DKMA 1M8VA 2A28A 3J80E 2K3YA 3PVLA 3QO3A 2DLPA 2M51A 1RACB 1M2VA 2SRCA 2K6DA 1K1ZA 3SWNC 3WXMB 1TG0A 3QSUA 5GAN3 4QVCA 5D6YA 1YCSB 1XJWB 1EX4A 4R55A 1VQMQ 2D6FA 3QDFA 5GANd 4XTXA 1K8AU 1IGQA 2DBMA 2E4HA 4PL6A 3L2WA 4RMOA 2OTLT 4KRTA 3CCST 1K73U 4IIMA 3M0TA 2F5KA 4FSSA 2RF0A 5HK3A 1WHGA 3QZ5B 1MMAA 1UECA 2WSCE 4BI8B 1G8XA 3CCUT 1IB8A 4GY5A 1K73C 3OSSC 4M7AD 3VKIA 3BE3A 4E7LA 5CQYA 3EGUA 4CI0C 1LOJA 1VQNQ 1Y07A 1WYXA 2F5TX 3JB9I 3EAEA 3H8ZA 1JEGA 2VUBA 4M78C 3HRUA 1M2VB 4JS4A 4HCBA 1V76A 2KVQG 2E64A 2DRMA 4Y28E 1T0JA 1OEBA 2DXCA 2NUTA 1QVGS 2OI3A 2L89A 3H0HA 1Z9ZA 1X6GA 5CO7A 3GP8A 4ZGJB 5GAMh 7AT1B 5IXBA 3TVTA 3CCVQ 1W1FA 2L2PA 3GPLA 1MMNA
chains in the Genus database with same CATH topology
2VKNA 1RI9A 2ECZA 2KNBB 1QWFA 4OMMA 2L3SA 2RPNA 1WFWA 4AFZC 2GTJA 2RNAA 1SEMA 2X3WD 2RQWA 2KXDA 3QWYA 3REBB 2JTEA 1AEYA 2GGRA 4J9EA 1AWJA 3M0UA 1NG2A 2O31A 3I9QA 1UJYA 4ESRA 1M3CA 5IH2A 1U06A 2KRMA 2CSQA 2IIMA 4LUEA 2DBKA 4J9FA 2NUZA 2I0NA 1HJDA 1YN8A 2YUQA 4RTTA 2K2MA 4K11A 1E6HA 2D8JA 2DE0X 4Y92A 1AZGB 4JPBW 1T3SA 1JO8A 4JZ3A 4JZ4A 4HVUA 4GLMA 1OV3A 2KXCA 2OJ2A 2MCNA 2RQVA 2CH4A 2HSPA 1AZEA 2EKHA 3GBQA 2ED0A 3SHWA 1M3AA 1TUCA 2KBTA 4RTZA 1SHFA 3JV3A 2EPDA 2DILA 2K3BA 2KROA 4RTUA 1PHTA 2KRSA 5EC7A 1EFNA 3EG0A 4ORZA 1KIKA 2V1RA 3VS7A 2W0ZA 1QKWA 1UFFA 4M4ZA 3EG1A 1FYNA 1QCFA 4RTYA 5ECAA 1OPKA 2DRKA 2DYBA 2RN8A 1GL5A 2EYWA 2K9GA 2KT8A 2CH4W 2V1QA 2BZ8A 5FWCA 3M0PA 2A37A 1H3HA 4RUGA 1I1JA 1BK2A 1RLQC 1UJ0A 3UA7A 1S1NA 1Y57A 2KRNA 3NMZC 3M0QA 1MV0B 1M8MA 1QKXA 1UHCA 1AWWA 1ABQA 2RQTA 1CKAA 2BZYA 3A98A 2LCSA 2RQUA 4LUDA 2O2OA 5IHNA 3VS0A 2FPFA 3VS3A 1K9AA 1IO6A 4J9DA 4OMOA 3C0CA 3I35A 5HCKA 3U23A 1G83A 2G6FX 1K76A 2KYBA 2W10A 1GFDA 2O88A 1J3TA 2DM1A 2PZ1A 3UA6A 1NLPC 3I5RA 1JQQA 2ROLA 5IHKA 4Z89A 3EHQA 1PWTA 2JS2A 1WIEA 2AKLA 3H41A 1AWXA 1GBQA 1B3QA 1ZUUA 5IHIA 1UUEA 2JXBA 3EHRA 1BBZA 2PTKA 3NPFA 4RTXA 4J9BA 1GCQC 1K0SA 1YWPA 2DL8A 3I5SA 2L0AA 2FEIA 3CQTA 2JM9A 1NM7A 1H8KA 1UE9A 2BTTA 2LX7A 2CREA 3M0RA 4AG1C 5L23A 3RNJA 3PE0A 1WX6A 3UF4A 2EGAA 4E6RA 5IXFA 2RQRA 1PNJA 1GBRA 2K79A 3NHNA 2LZ6B 2O9VA 2CT3A 3SEMA 2A36A 2DF6A 4D8DA 4CC7A 2EQIA 4CC2A 1UGVA 1X2QA 1UTIA 3QWXX 4J9IA 4LE9A 1E7OA 4EIKA 2J06A 2JMCA 3THKA 3ULRB 1B07A 2D8HA 2C0IA 3VS5A 1VYVA 3VS2A 2D0NA 2LQWA 2D1XA 2FRWA 2X3XD 2MIOA 3UATA 1SSHA 1M27C 2AZVA 2EBPA 1NEBA 2J05A 4A63B 1JU5C 1XOVA 4QT7A 1Z9QA 3H0IA 3LH5A 3VRYA 3IQLA 1T3LA 2VVKA 2EYZA 1WLPB 1H92A 2EGEA 2LP5A 2RMOA 4HVWA 4J9CA 1WDXA 2J6KA 2FO0A 5GJVB 4ZNXA 5FW9A 1U3OA 1W70A 2CUBA 2E5KA 2KE9A 4GBQA 1YP5A 1ZSGA 2GNCA 4LNPA 1SHGA 1VA7A 1T0HA 1V1CA 2DJQA 1ZX6A 1M3BA 3H0FA 1MV3A 1FMKA 2F2WA 3R6NA 4F16A 1A0NB 1VYUA 3VS4A 1I0CA 1X6BA 2KGTA 1SRMA 3NGPA 3VRZA 3EG2A 2P4RA 2YUPA 1ZLMA 1AOJA 2LJ3A 2ROTA 4IIOA 2ABLA 1I07A 2VWFA 1PKSA 1KJWA 2K7AA 5GJWB 4RTWA 1OOTA 4HCKA 1VYTA 1WXTA 2B86A 2DMOA 1NEGA 3EG3A 2LMJA 2YDLA 1GFCA 2KEAA 2XMFA 4X1VA 2H8HA 2M0YA 1W6XA 2JT4A 1UG1A 4OMPA 2L3PA 2C0TA 4Z8AA 1K0XA 1QWEA 1Y0MA 2DL3A 2HDAA 2JM8A 1AVZC 1YWOA 2KT1A 2LQNA 1PKTA 4AFUC 2AK5A 2DX1A 2GQIA 1E6GA 4JJBA 2JS0A 1N5ZA 1RUWA 2JMAA 1SRLA 3ZL7C 2ED1A 4Z88A 1X69A 2JW4A 3REAB 2LNHB 2A08A 2GBQA 1WXUA 2YSQA 2ESWA 4DEYA 1GCQA 1X43A 2MOXA 1ZUKA 2ENMA 2OAWA 1SPKA 1K4US 3RBBB 2BZXA 2O9SA 4JJCA 5FWBA 2DL4A 3VS1A 2QDLA 2YT6A 3FJ5A 3TSWA 4AFSC 1GRIA 2FRYA 2CUDA 2CT4A 3KFVA 2AZSA 4OMNA 2PNIA 1BB9A 4F14A 2CDTA 2KYMA 1ABOA 1X27A 3TSZA 2J6OA 4F17A 1QLYA 2J6FA 1G2BA 2A28A 4RTVA 1YNZA 2FG0A 4OMQA 1UHFA 1NLOC 2SEMA 4JJDA 3PVLA 2DLPA 2F2XA 1X2KA 2YUOA 3M0SA 2M51A 4CC4B 5I22A 1HD3A 4CC3A 2SRCA 2LJ0A 2DVJA 2K6DA 1K1ZA 1AD5A 2AKKA 1WA7A 1TG0A 1GCPA 2CSIA 1JXOA 4J9GA 1YCSB 2LJ1A 1NYFA 1NYGA 4J9HA 1KSWA 1JXMA 1KFZA 1MUZA 2FPDA 1TUDA 3VS6A 1CKBA 2DBMA 2EVRA 2YUNA 4KRTA 2J7IA 2EYYA 4IIMA 3M0TA 3PVQA 4FSSA 2RF0A 1UECA 4OMLA 1PRLC 2L3QA 2HCKA 1U5SA 2F2VA 3EGUA 2KR3A 2C0OA 2NWMA 1PRMC 4D8KA 1WYXA 4AG2C 1JEGA 1ARKA 4DEXA 2DL5A 4HVVA 4R0KA 2EYXA 1LCKA 2DRMA 1ZUYA 2DA9A 1T0JA 1OEBA 5I11A 2DL7A 1RLPC 4AFQC 1CSKA 1M30A 4HXJA 1HSQA 2GTOA 2DNUA 2HBWA 2EGCA 2OI3A 3H0HA 1Z9ZA 1X6GA 1WXBA 1BU1A 2FPEA 1AWOA 1OPLA 2HEQA 1UDLA 1WI7A 1ZBJA 4LN2A 5IXBA 2EW3A 3TVTA 1W1FA 3O5ZA 2L2PA 4WCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKN A;  1RI9 A;  2ECZ A;  2KNB B;  1QWF A;  4OMM A;  2L3S A;  2RPN A;  1WFW A;  4AFZ C;  2GTJ A;  2RNA A;  1SEM A;  2X3W D;  2RQW A;  2KXD A;  3QWY A;  3REB B;  2JTE A;  1AEY A;  2GGR A;  4J9E A;  1AWJ A;  3M0U A;  1NG2 A;  2O31 A;  3I9Q A;  1UJY A;  4ESR A;  1M3C A;  5IH2 A;  1U06 A;  2KRM A;  2CSQ A;  2IIM A;  4LUE A;  2DBK A;  4J9F A;  2NUZ A;  2I0N A;  1HJD A;  1YN8 A;  2YUQ A;  4RTT A;  2K2M A;  4K11 A;  1E6H A;  2D8J A;  2DE0 X;  4Y92 A;  1AZG B;  4JPB W;  1T3S A;  1JO8 A;  4JZ3 A;  4JZ4 A;  4HVU A;  4GLM A;  1OV3 A;  2KXC A;  2OJ2 A;  2MCN A;  2RQV A;  2CH4 A;  2HSP A;  1AZE A;  2EKH A;  3GBQ A;  2ED0 A;  3SHW A;  1M3A A;  1TUC A;  2KBT A;  4RTZ A;  1SHF A;  3JV3 A;  2EPD A;  2DIL A;  2K3B A;  2KRO A;  4RTU A;  1PHT A;  2KRS A;  5EC7 A;  1EFN A;  3EG0 A;  4ORZ A;  1KIK A;  2V1R A;  3VS7 A;  2W0Z A;  1QKW A;  1UFF A;  4M4Z A;  3EG1 A;  1FYN A;  1QCF A;  4RTY A;  5ECA A;  1OPK A;  2DRK A;  2DYB A;  2RN8 A;  1GL5 A;  2EYW A;  2K9G A;  2KT8 A;  2CH4 W;  2V1Q A;  2BZ8 A;  5FWC A;  3M0P A;  2A37 A;  1H3H A;  4RUG A;  1I1J A;  1BK2 A;  1RLQ C;  1UJ0 A;  3UA7 A;  1S1N A;  1Y57 A;  2KRN A;  3NMZ C;  3M0Q A;  1MV0 B;  1M8M A;  1QKX A;  1UHC A;  1AWW A;  1ABQ A;  2RQT A;  1CKA A;  2BZY A;  3A98 A;  2LCS A;  2RQU A;  4LUD A;  2O2O A;  5IHN A;  3VS0 A;  2FPF A;  3VS3 A;  1K9A A;  1IO6 A;  4J9D A;  4OMO A;  3C0C A;  3I35 A;  5HCK A;  3U23 A;  1G83 A;  2G6F X;  1K76 A;  2KYB A;  2W10 A;  1GFD A;  2O88 A;  1J3T A;  2DM1 A;  2PZ1 A;  3UA6 A;  1NLP C;  3I5R A;  1JQQ A;  2ROL A;  5IHK A;  4Z89 A;  3EHQ A;  1PWT A;  2JS2 A;  1WIE A;  2AKL A;  3H41 A;  1AWX A;  1GBQ A;  1B3Q A;  1ZUU A;  5IHI A;  1UUE A;  2JXB A;  3EHR A;  1BBZ A;  2PTK A;  3NPF A;  4RTX A;  4J9B A;  1GCQ C;  1K0S A;  1YWP A;  2DL8 A;  3I5S A;  2L0A A;  2FEI A;  3CQT A;  2JM9 A;  1NM7 A;  1H8K A;  1UE9 A;  2BTT A;  2LX7 A;  2CRE A;  3M0R A;  4AG1 C;  5L23 A;  3RNJ A;  3PE0 A;  1WX6 A;  3UF4 A;  2EGA A;  4E6R A;  5IXF A;  2RQR A;  1PNJ A;  1GBR A;  2K79 A;  3NHN A;  2LZ6 B;  2O9V A;  2CT3 A;  3SEM A;  2A36 A;  2DF6 A;  4D8D A;  4CC7 A;  2EQI A;  4CC2 A;  1UGV A;  1X2Q A;  1UTI A;  3QWX X;  4J9I A;  4LE9 A;  1E7O A;  4EIK A;  2J06 A;  2JMC A;  3THK A;  3ULR B;  1B07 A;  2D8H A;  2C0I A;  3VS5 A;  1VYV A;  3VS2 A;  2D0N A;  2LQW A;  2D1X A;  2FRW A;  2X3X D;  2MIO A;  3UAT A;  1SSH A;  1M27 C;  2AZV A;  2EBP A;  1NEB A;  2J05 A;  4A63 B;  1JU5 C;  1XOV A;  4QT7 A;  1Z9Q A;  3H0I A;  3LH5 A;  3VRY A;  3IQL A;  1T3L A;  2VVK A;  2EYZ A;  1WLP B;  1H92 A;  2EGE A;  2LP5 A;  2RMO A;  4HVW A;  4J9C A;  1WDX A;  2J6K A;  2FO0 A;  5GJV B;  4ZNX A;  5FW9 A;  1U3O A;  1W70 A;  2CUB A;  2E5K A;  2KE9 A;  4GBQ A;  1YP5 A;  1ZSG A;  2GNC A;  4LNP A;  1SHG A;  1VA7 A;  1T0H A;  1V1C A;  2DJQ A;  1ZX6 A;  1M3B A;  3H0F A;  1MV3 A;  1FMK A;  2F2W A;  3R6N A;  4F16 A;  1A0N B;  1VYU A;  3VS4 A;  1I0C A;  1X6B A;  2KGT A;  1SRM A;  3NGP A;  3VRZ A;  3EG2 A;  2P4R A;  2YUP A;  1ZLM A;  1AOJ A;  2LJ3 A;  2ROT A;  4IIO A;  2ABL A;  1I07 A;  2VWF A;  1PKS A;  1KJW A;  2K7A A;  5GJW B;  4RTW A;  1OOT A;  4HCK A;  1VYT A;  1WXT A;  2B86 A;  2DMO A;  1NEG A;  3EG3 A;  2LMJ A;  2YDL A;  1GFC A;  2KEA A;  2XMF A;  4X1V A;  2H8H A;  2M0Y A;  1W6X A;  2JT4 A;  1UG1 A;  4OMP A;  2L3P A;  2C0T A;  4Z8A A;  1K0X A;  1QWE A;  1Y0M A;  2DL3 A;  2HDA A;  2JM8 A;  1AVZ C;  1YWO A;  2KT1 A;  2LQN A;  1PKT A;  4AFU C;  2AK5 A;  2DX1 A;  2GQI A;  1E6G A;  4JJB A;  2JS0 A;  1N5Z A;  1RUW A;  2JMA A;  1SRL A;  3ZL7 C;  2ED1 A;  4Z88 A;  1X69 A;  2JW4 A;  3REA B;  2LNH B;  2A08 A;  2GBQ A;  1WXU A;  2YSQ A;  2ESW A;  4DEY A;  1GCQ A;  1X43 A;  2MOX A;  1ZUK A;  2ENM A;  2OAW A;  1SPK A;  1K4U S;  3RBB B;  2BZX A;  2O9S A;  4JJC A;  5FWB A;  2DL4 A;  3VS1 A;  2QDL A;  2YT6 A;  3FJ5 A;  3TSW A;  4AFS C;  1GRI A;  2FRY A;  2CUD A;  2CT4 A;  3KFV A;  2AZS A;  4OMN A;  2PNI A;  1BB9 A;  4F14 A;  2CDT A;  2KYM A;  1ABO A;  1X27 A;  3TSZ A;  2J6O A;  4F17 A;  1QLY A;  2J6F A;  1G2B A;  2A28 A;  4RTV A;  1YNZ A;  2FG0 A;  4OMQ A;  1UHF A;  1NLO C;  2SEM A;  4JJD A;  3PVL A;  2DLP A;  2F2X A;  1X2K A;  2YUO A;  3M0S A;  2M51 A;  4CC4 B;  5I22 A;  1HD3 A;  4CC3 A;  2SRC A;  2LJ0 A;  2DVJ A;  2K6D A;  1K1Z A;  1AD5 A;  2AKK A;  1WA7 A;  1TG0 A;  1GCP A;  2CSI A;  1JXO A;  4J9G A;  1YCS B;  2LJ1 A;  1NYF A;  1NYG A;  4J9H A;  1KSW A;  1JXM A;  1KFZ A;  1MUZ A;  2FPD A;  1TUD A;  3VS6 A;  1CKB A;  2DBM A;  2EVR A;  2YUN A;  4KRT A;  2J7I A;  2EYY A;  4IIM A;  3M0T A;  3PVQ A;  4FSS A;  2RF0 A;  1UEC A;  4OML A;  1PRL C;  2L3Q A;  2HCK A;  1U5S A;  2F2V A;  3EGU A;  2KR3 A;  2C0O A;  2NWM A;  1PRM C;  4D8K A;  1WYX A;  4AG2 C;  1JEG A;  1ARK A;  4DEX A;  2DL5 A;  4HVV A;  4R0K A;  2EYX A;  1LCK A;  2DRM A;  1ZUY A;  2DA9 A;  1T0J A;  1OEB A;  5I11 A;  2DL7 A;  1RLP C;  4AFQ C;  1CSK A;  1M30 A;  4HXJ A;  1HSQ A;  2GTO A;  2DNU A;  2HBW A;  2EGC A;  2OI3 A;  3H0H A;  1Z9Z A;  1X6G A;  1WXB A;  1BU1 A;  2FPE A;  1AWO A;  1OPL A;  2HEQ A;  1UDL A;  1WI7 A;  1ZBJ A;  4LN2 A;  5IXB A;  2EW3 A;  3TVT A;  1W1F A;  3O5Z A;  2L2P A;  4WCI A; 
#chains in the Genus database with same CATH topology
 5GAO m;  4C5H A;  2E3H A;  1OU9 A;  1HK9 A;  2JZ2 A;  4AT1 B;  4WTO B;  2DK3 A;  3OYG A;  4OMM A;  2L3S A;  4BDY A;  2YLB A;  2GTJ A;  2RNA A;  1SEM A;  2X3W D;  1TOV A;  4ZGE B;  2M16 A;  3QWY A;  2RJF A;  3PIP A;  4IUP A;  1AEY A;  1NE8 A;  4O6J A;  3OYL A;  4JRQ A;  4HT9 A;  3MEW A;  1IRX A;  4BE1 A;  1UJY A;  5LJ3 e;  4ESR A;  2KRM A;  2NUT B;  2CSQ A;  2IIM A;  1VIE A;  4J9F A;  4BI3 A;  4RKU E;  1O75 A;  3M9Q A;  1MMG A;  2YUQ A;  4JRI A;  2K2M A;  1BCO A;  4K11 A;  1N8R U;  1H64 1;  1N8R C;  4Y92 A;  2VV5 A;  3OW2 A;  2DIG A;  1VQ9 A;  1NPP A;  4X9D A;  1KC8 U;  4HVU A;  2QQS A;  3P8H A;  4X34 A;  2JOY A;  3SHW A;  4RTZ A;  5I2M A;  3JV3 A;  2DIL A;  2GCX A;  2KRO A;  2Z0W A;  3V8J A;  3CC7 Q;  4M75 A;  1PHT A;  4PNO A;  3L1A A;  1QMC A;  1UB4 A;  3EG0 A;  2BE7 D;  4ORZ A;  4C8Q A;  5A0L A;  2W0Z A;  4FYX B;  2FHD A;  3FIF A;  3M4Y A;  3INZ A;  3P8D A;  2P0Q A;  3GF5 A;  2LRQ A;  3CCR Q;  3OYM A;  3G6E T;  3JCM e;  1RAH B;  4XQ3 A;  4RTY A;  5M9O A;  1OPK A;  1YJ9 Q;  2RN8 A;  2QA4 A;  3KBG A;  1KG1 A;  1U1T A;  3A8H B;  2BZ8 A;  4M77 E;  5FU7 B;  2A37 A;  4RUG A;  1UJ0 A;  5A0D A;  2KI7 A;  3UA7 A;  1PG5 B;  1Y57 A;  1UHC A;  1QKX A;  4M7A G;  1IZ6 A;  2XD0 A;  2RQT A;  4F7U A;  3CD6 A;  1CKA A;  3OYH A;  1RAB B;  4IUU A;  4PJO A;  1QVF S;  3OS1 A;  3NTH A;  6AT1 B;  1K9M U;  4ME7 A;  1M1F A;  2HD0 A;  2PVD B;  4M7D C;  4EMH A;  4OMO A;  3EGX A;  3C0C A;  1KQ1 A;  3LH0 A;  4M75 B;  3FB9 A;  1PSE A;  3MP6 A;  1K76 A;  4C8Q B;  1I4K 1;  5CK9 A;  3QBY A;  1VQ4 T;  5GAN h;  3CCQ Q;  2RH2 A;  2L3R A;  2KSS A;  4LXC A;  3M59 A;  2ROL A;  5IHK A;  3GIB A;  4C92 A;  4BE0 A;  2ZAE A;  4EMK A;  2AKL A;  2DJZ A;  3H41 A;  5GMK j;  1B3Q A;  1M2O A;  2KQW A;  3EHR A;  1GCQ C;  4Y91 A;  1YWP A;  2DL8 A;  1HYO A;  3CBM A;  4PFO A;  2IG0 A;  4Q5W A;  3OBW A;  3CCU A;  4PJO B;  1OI1 A;  1IHV A;  1H8K A;  2BTT A;  1VQL Q;  2RO0 A;  5DLO A;  5KYY A;  3QDR B;  3RR6 A;  4E7Z A;  3CC2 T;  1KK7 A;  3JB9 F;  3EFO A;  2K79 A;  3NHN A;  3EGX B;  2O9V A;  3SEM A;  1H3Z A;  2A36 A;  2YWW A;  3V7S A;  1MMD A;  1QVG P;  1X2Q A;  3OW2 S;  1VQN T;  1RAG B;  3QWX X;  1Q82 R;  1Q82 C;  1DJ7 B;  4WF2 A;  1M90 U;  2J06 A;  2JMC A;  1NJI U;  3THK A;  4EMK B;  1SF9 A;  1VQ7 Q;  1VYV A;  3VS2 A;  1M90 C;  3A8O B;  3OMC A;  4M77 D;  2LQW A;  2X3X D;  9ATC B;  1KQS A;  2MIO A;  3HRT A;  4C5G A;  3JCM X;  4A63 B;  2EKO A;  4MZM A;  3CCV T;  3H0I A;  5HKC A;  5KYY B;  2OX7 A;  3EFO B;  3RKW A;  2DEU A;  1H92 A;  2EGE A;  3CCJ A;  3OMG A;  3G71 Q;  4E7J A;  3JSC A;  3WVE B;  4DOV A;  2J6K A;  2FYK A;  4GLK A;  2E5K A;  1C1A A;  1ZSG A;  3OYY A;  2GNC A;  3EH2 A;  4BE2 A;  2AT1 B;  1VA7 A;  3QZ9 B;  1V1C A;  2DJQ A;  1N9R A;  2QGG A;  1ZX6 A;  2PUK B;  1MV3 A;  2G3R A;  2L8D A;  3R6N A;  1SG5 A;  2ZPH B;  1X6B A;  4EMG A;  1WHK A;  2PVO B;  2YUP A;  4ELY C;  3N5B B;  3LGF A;  3EFS A;  3EH1 A;  3UDC A;  4J6W A;  1WXT A;  2DMO A;  2NYS A;  3M53 A;  2LMJ A;  2YDL A;  4OP0 A;  3C94 A;  3AT1 B;  2XMF A;  2FZG B;  2JT4 A;  4A53 A;  2L3P A;  2C0T A;  4Z8A A;  2RJD A;  2R5A A;  2DL3 A;  2PVG B;  3CC7 T;  2LQN A;  1PKT A;  3CCL Q;  2O4X A;  2D0Q B;  4P5N A;  1E6G A;  2JS0 A;  1TTH B;  3CCR T;  1N5Z A;  2QQ9 A;  3CC4 T;  2OTL Q;  3CBO A;  4DBR A;  4FT4 A;  4Z88 A;  3REA B;  2LNH B;  1QVF P;  2JJ9 A;  2YSQ A;  1X43 A;  5CKE A;  5FU7 C;  1SSF A;  4AMC A;  1M1G A;  3RBB B;  2O9S A;  2XHC A;  4JJC A;  2COY A;  5FWB A;  2QXF A;  4HCZ A;  2QDL A;  1GRI A;  1RAI B;  2E10 A;  3QII A;  2CT4 A;  1I5O B;  1Q7Y U;  1BI3 A;  2JNG A;  1TXQ A;  1BB9 A;  2RHX A;  1KQS S;  1Q7Y C;  1ABO A;  1BKB A;  5GAO l;  2J6O A;  1OX9 A;  1S72 Q;  4M77 G;  5GAO n;  3JCM P;  2QEX T;  3UWN A;  2ZPI B;  1W2B A;  4M75 C;  3CME A;  2FG0 A;  3LX7 A;  2O4X B;  3MP1 A;  4C8Q C;  1NLO C;  5A2Q E;  3CCQ T;  1R0C B;  1X2K A;  2YUO A;  1OZ2 A;  3M0S A;  4M78 F;  4CC4 B;  1YIJ Q;  1VQM A;  2LJ0 A;  1AD5 A;  2AKK A;  1WA7 A;  3E9G A;  1R0B G;  3H6Z A;  1D3B B;  4KUD K;  4ELZ C;  4D6W A;  3VV0 A;  1VQ8 T;  1MUZ A;  2FPD A;  1R77 A;  3CCE T;  1TUD A;  1VQL T;  4PJO C;  2YRD A;  3OW2 P;  2HQE A;  3EFR A;  5CCA A;  1VQ6 A;  2J7I A;  2M9U A;  5KCH A;  4N4I A;  2HKN A;  3Q1J A;  1VQN A;  2RD1 A;  2QI2 A;  2ZPE B;  4ZN3 A;  2HCK A;  1Y96 A;  1U5S A;  2F2V A;  2C0O A;  3L42 A;  1PRM C;  4D8K A;  1LJO A;  4AG2 C;  2EJG A;  1U8R A;  3QPH A;  1ARK A;  3H9N A;  4R0K A;  1LCK A;  4C92 C;  2LNV A;  5GMK m;  1WQ7 A;  5D6X A;  4EMK C;  2NUP A;  5I11 A;  2DL7 A;  2RHU A;  4IUR A;  1M30 A;  1D0X A;  4BD3 A;  3CXC A;  4FT2 A;  1WQW A;  2QQR A;  2HBW A;  2H3E B;  5DLQ E;  3I55 Q;  2EGC A;  2VGM A;  1BU1 A;  2KK4 A;  4FIB A;  1AWO A;  1G5V A;  1UDL A;  1WI7 A;  3CEY A;  1ZBJ A;  4B9X A;  3WVD B;  4JRP A;  4N4H A;  5GAM e;  5KH6 A;  4ZTJ A;  2RI5 A;  1WJQ A;  2ZCF B;  2CP0 A;  3G6E Q;  1TH7 A;  2X4Y A;  4DA4 A;  1YJN A;  2YRC A;  3LW5 E;  2FZK B;  4KGZ B;  4IUQ A;  3RUX A;  3SB2 A;  2ECZ A;  2KNB B;  3G71 T;  2GQV A;  2RJC A;  1W4S A;  3BW1 A;  2A3L A;  1XQH A;  3REB B;  3OYK A;  1F1B B;  1AWJ A;  4KUL A;  3M0U A;  2O31 A;  5CIU A;  3DLM A;  2Y4Y A;  1PD1 A;  1U06 A;  2NUP B;  1Q81 U;  1JBM A;  4KBM B;  2DO3 A;  5KYW A;  4C0D B;  1Q81 C;  2ZPB B;  1YN8 A;  2VAS A;  4RTT A;  1UEB A;  3G7Z A;  4OB2 B;  1E6H A;  4MZP A;  1VQ4 Q;  4XTW A;  1FMV A;  1T3S A;  1JO8 A;  2OTJ Q;  3CC7 A;  4XU3 A;  2DZ9 A;  2OJ2 A;  2MCN A;  2CH4 A;  1AZE A;  4FYV B;  4LD9 K;  2KBT A;  4M7D F;  1WHH A;  1YJW Q;  2K3B A;  5KYX A;  3CCR A;  3M55 A;  3M5A A;  2K5L A;  2KRS A;  2C06 A;  1YJ9 A;  4HKE A;  5EC7 A;  3V8L A;  3VS7 A;  1QKW A;  3CCL T;  4QKU A;  5LJ3 j;  4M4Z A;  4C0F A;  4QQ6 A;  2HSE B;  4E7H A;  2P4T A;  2E41 A;  3L2V A;  3CC2 Q;  2DYB A;  2X9H A;  4KGX B;  1M9S A;  4IKF A;  2EYW A;  5KYW B;  2KT8 A;  3MEV A;  3M0P A;  1RLQ C;  1G3T A;  1KQS P;  2KRN A;  1M8M A;  5FRM A;  3FC3 A;  1AWW A;  2BZY A;  3A98 A;  4MMK A;  2E3I A;  2DPP B;  4OB1 B;  4LUD A;  3OB9 A;  1MHN A;  3JCM V;  4LDX A;  2DTO A;  3JCM b;  3E2U A;  5IHN A;  4OGC A;  3JB9 D;  3VS0 A;  3QG1 A;  1K9A A;  3CCQ A;  5KYX B;  3TU4 K;  1S72 T;  3EGD A;  2DVE A;  1GFD A;  4PJL A;  3E1S A;  1YHQ Q;  3UA6 A;  2PZ1 A;  1NLP C;  1FMW A;  3I5R A;  1JQQ A;  5GAN e;  4Z89 A;  1Y71 A;  1YIJ T;  2JS2 A;  3JCM c;  3QXE B;  2HL3 A;  2PUO B;  1VQL A;  2PTK A;  5GAO r;  2X4J A;  1R8O B;  1K0S A;  1NPR A;  2YLC A;  3I5S A;  2BE9 B;  2L0A A;  5A0G A;  2GFA A;  1PC0 A;  3M0R A;  2CRE A;  4OVA A;  4AG1 C;  1WX6 A;  3M57 A;  2EGA A;  4KT0 E;  5IXF A;  2RQR A;  1PNJ A;  4C92 D;  4DOW A;  1GBR A;  4N4G A;  5IN1 A;  1I5L A;  5GAN 6;  2RI3 A;  3EGD B;  1V29 B;  2B8A A;  2DF6 A;  2EJ9 A;  2DXU A;  2DTI A;  2EQI A;  4CC2 A;  1VQ7 A;  1UTI A;  5C6S A;  3VYG A;  4V2S A;  4J9I A;  2VB6 A;  1E7O A;  2LX9 A;  5GAN 2;  1JRI A;  3JB9 H;  3V7C A;  4M78 E;  2D0N A;  4MZT A;  3OY9 A;  2K2V A;  3PMT A;  5GAO q;  3UAT A;  3I55 T;  1I81 A;  2CZ6 B;  2EBP A;  4HT8 A;  2MMP A;  2JTF A;  3MCA B;  1JU5 C;  2CP7 A;  1XOV A;  2X51 A;  4QT7 A;  3G71 A;  2K5F A;  3IQL A;  3CC4 Q;  1T3L A;  3OBY A;  2DEQ A;  3QYG B;  2M0O A;  2EFI A;  5KYN A;  4M7A A;  4CRI A;  1P92 A;  1WDX A;  1OX8 A;  1OYX A;  5L8R E;  5GAN 8;  3M56 A;  1U3O A;  4GBQ A;  4LNP A;  4HA8 A;  3VYH B;  2VYT A;  1M3B A;  2EQJ A;  3LWH A;  2V26 A;  4E2F B;  5KE2 A;  2A0F B;  2F2W A;  4KH1 B;  1RAE B;  3QUI A;  3ZFJ A;  1I0C A;  1SRM A;  3NGP A;  2P4R A;  2DER A;  1YIT T;  2QEX Q;  3AHU A;  1I07 A;  1PKS A;  3V7R A;  5FU6 B;  1OOT A;  4RG8 A;  2B86 A;  2OTJ T;  1G3Y A;  1GFC A;  2BUD A;  4M7A B;  4OMF B;  3URG A;  4RG2 A;  3CCL A;  2FL7 A;  4OMP A;  1EZZ B;  1YJW T;  1WGS A;  1K0X A;  1RAF B;  2JM8 A;  2OTL A;  2VC8 A;  1YWO A;  3VJP A;  3PIO A;  3CCS A;  1VQ8 Q;  4M75 F;  3CCE Q;  4N0A A;  1VQP T;  4IUT A;  3RER A;  2RA2 A;  4C8Q F;  2JTM A;  1ZA2 B;  4QQD A;  4M78 D;  2JMA A;  1SRL A;  2ED1 A;  2JW4 A;  2DYI A;  4OGE A;  2DXT A;  3CPW A;  1D0Z A;  2GBQ A;  1TSF A;  3CXC P;  3BDL A;  2MOX A;  2ENM A;  2OAW A;  1BIB A;  5CKB A;  1Q82 U;  3NTK A;  2R5M A;  3CMA T;  4ZGD B;  4F7U F;  3JCM Q;  2DD4 A;  1S72 A;  2CUD A;  4PJO F;  2MYS A;  3KFV A;  3HPW A;  3CCM Q;  4OMN A;  4OB3 B;  5LJ5 j;  4F14 A;  2F69 A;  3TSZ A;  5AYF A;  5D6W A;  4F17 A;  2LTO A;  2HZY A;  4M7D E;  3MJX A;  1YIJ A;  4RTV A;  1YNZ A;  1HXD A;  1B34 A;  4OMQ A;  2Y4X A;  1YHQ T;  3FLG A;  4XTV A;  4PFZ A;  3S3O A;  1HD3 A;  4CC3 A;  2DVJ A;  1U1S A;  4C92 F;  1VQK T;  4B6M A;  2CSI A;  1WJR A;  2LQK A;  4FL6 A;  3MP8 A;  3GLX A;  1NYG A;  2A7Y A;  1G3S A;  3LGL A;  1QVP A;  4A54 A;  2EQK A;  3CBP A;  1Q86 R;  1Q86 C;  3GNF B;  3ME9 A;  1CKB A;  4FW2 A;  2EVR A;  2YUN A;  3PVQ A;  1XNI A;  5FRN A;  4OML A;  4A4E A;  3O8V A;  2E1H A;  2KAF A;  4FW1 A;  4DQ2 A;  5HY6 A;  1VQO Q;  1B34 B;  2KR3 A;  2NWM A;  3ASK A;  5GMK i;  4LDW A;  2CS7 A;  3FRN A;  3A8M B;  3I55 A;  3UPU A;  2P0K A;  4J6Y A;  1QCO A;  2I2L A;  1RLP C;  1CSK A;  1RL2 A;  5D7U A;  2QTX A;  3FEO A;  4XU1 A;  3G6E A;  4C0G A;  1WXB A;  2HEQ A;  5HK0 A;  4E47 A;  4LN2 A;  2YXY A;  2QG9 B;  2QTV A;  4BAC A;  1X01 A;  3VUZ A;  4WCI A;  2EIF A;  3HSB A;  1RI9 A;  4X9C A;  4JLI A;  1QWF A;  2MWO A;  4M78 G;  2RK2 A;  2RPN A;  4A4F A;  3M54 A;  3J7A F;  1D0Y A;  4M7D D;  2KXD A;  1D3B A;  2JTE A;  1BCM A;  2MWP A;  3OS0 A;  2GGR A;  1C6V X;  1KD1 R;  1KD1 C;  2RJE A;  5LJ3 g;  1NG2 A;  3I9Q A;  3HRS A;  2M1H A;  4M77 A;  3PGG A;  5CR2 A;  3FDR A;  2DBK A;  2NUZ A;  1VQ4 A;  4JRK A;  2I0N A;  1BI0 A;  1RI0 A;  2OTJ A;  1VQ5 Q;  3JCM W;  1M1K R;  3TRE A;  3PNW C;  1BIA A;  1M1K C;  1YBY A;  2Y90 A;  1OQK A;  1Y7X A;  3X24 B;  5GAM j;  4XTZ A;  2D8J A;  1YJW A;  3JRZ A;  2KMT A;  4JPB W;  5FU6 C;  4E7S A;  1YFN A;  4J8O A;  2RQV A;  2HSP A;  2EKH A;  1FXX A;  3SD4 A;  2WSF E;  1M3A A;  1SHF A;  2EPD A;  1BI2 A;  2CGH A;  2R58 A;  4A4K A;  4NL2 A;  4RTU A;  3CC2 A;  2LVM A;  1IHW A;  2LCC A;  3JCM f;  1UFF A;  3JCM g;  4DBQ A;  1WHL A;  1D1C A;  4M77 B;  3OYA A;  3EG1 A;  3BDU A;  4MML A;  1FYN A;  2DRK A;  5GMK h;  5CQX A;  2HKQ B;  2IPO B;  3C12 A;  2QAZ A;  3PT9 A;  2P84 A;  5FWC A;  3PTA A;  1I1J A;  2RB6 A;  2EQU A;  2QDY B;  1MV0 B;  1ABQ A;  1YCY A;  2AIR B;  4L5G A;  4OF1 A;  2LCS A;  2XID A;  2RQU A;  2QGF B;  1XTD A;  2O2O A;  3CCM T;  2HMA A;  1YHQ A;  4PFP A;  4C5E A;  2CP5 A;  1IO6 A;  3OYN A;  3CCV A;  3I35 A;  4BY6 B;  3U23 A;  2G6F X;  3S6W A;  2M02 A;  1JB0 E;  3A8L B;  2DXB A;  1J3T A;  1YI2 Q;  4M75 E;  1IXD A;  4J6X A;  1TU0 B;  3OYC A;  4TVR A;  3EHQ A;  4C8Q E;  1PWT A;  1WIE A;  1AWX A;  1GBQ A;  1ZUU A;  2JXB A;  4RTX A;  1QP3 A;  4J9B A;  3UT1 A;  3I56 Q;  1QVG A;  4M7D G;  4J5Y A;  2FEI A;  3CQT A;  2JM9 A;  3C95 A;  3MEU A;  4ANJ A;  2LT4 A;  2GFU A;  4YTL A;  1UE9 A;  2MPX C;  5DM7 R;  3RNJ A;  4F7U E;  2E6Z A;  2KY9 A;  5KYU A;  4PJO E;  2L5Q A;  4C0Z A;  2HNI A;  3M58 A;  5CKF A;  3LYI A;  1W2B S;  3MKD A;  1YIT Q;  2CZ0 B;  4CC7 A;  1VQO T;  1UGV A;  2X4X A;  1FWZ A;  1TUG B;  3KXT A;  2QA4 T;  3VUB A;  1BI1 A;  3TEE A;  2VXF A;  5I21 A;  2ATC B;  5GAN j;  4LE9 A;  1TWB A;  3ULR B;  3PMI A;  1B07 A;  2D8H A;  3VS5 A;  3CD6 T;  5LL6 S;  1KQ2 A;  2CYZ B;  2RHZ A;  4C92 E;  1X6O A;  2E6N A;  2K4Y A;  1M27 C;  3CC4 A;  2J05 A;  1VQP Q;  1Z9Q A;  3VRY A;  4NOY A;  3QHS A;  3CME Q;  5KYU B;  2VVK A;  2EYZ A;  2E5Q A;  2JN0 A;  1ZQ1 A;  2RMO A;  2K3X A;  4ZNX A;  1G3W A;  1W70 A;  4IUV A;  1YP5 A;  4HCC A;  4M75 D;  3CMA Q;  3OYI A;  2QQB A;  3DB4 A;  3H0F A;  4PK4 A;  4C8Q D;  1K8A R;  1FMK A;  2ZPF B;  1K8A C;  3F70 A;  2QEX A;  3NFC A;  4F16 A;  3CXC S;  4ZTF A;  2K57 A;  4MDX A;  1VYU A;  8AT1 B;  1K73 R;  4OB0 B;  3RMQ A;  3C4S A;  3VRZ A;  5I2S A;  1VQ6 Q;  1KHI A;  2XDD A;  1VQ5 T;  1AOJ A;  2RI2 A;  2LJ3 A;  2ABL A;  2VWF A;  1KJW A;  5GJW B;  3L2R A;  2PQW A;  4RTW A;  5LJ3 d;  3HKS A;  4HCK A;  2DTH A;  5CKH A;  3OYD A;  3A5Z B;  4F04 B;  1NEG A;  3R6O A;  3EG3 A;  1QVF A;  2MAM A;  3DLL A;  4PJO D;  2DD5 A;  5LJ5 f;  5LJ5 g;  2DZC A;  3ZBD A;  2KEA A;  1VQ8 A;  1VQK Q;  4X1V A;  2H8H A;  3CCE A;  3OYJ A;  4O5V A;  1JJ2 A;  4DBF A;  1N27 A;  5J39 A;  4XU0 A;  1Y0M A;  2RM4 A;  3SDZ A;  2KT1 A;  4J83 A;  4JS5 A;  2XDP A;  4AFU C;  2AK5 A;  2DX1 A;  4JJB A;  3RES A;  1IRE B;  4FM4 B;  4M77 C;  2DET A;  1X69 A;  3KUF A;  3P8B B;  2EJF A;  3MO8 A;  5KE3 A;  1WXU A;  2ESW A;  4DEY A;  2X4W A;  5KCO A;  1WZO A;  1YJN Q;  1SPK A;  2YHT A;  1K4U S;  2BZX A;  3CCM A;  4XTU A;  3CCJ T;  5GAN 5;  2DL4 A;  3FJ5 A;  3JCM d;  2FRY A;  3A8G B;  2AZS A;  2PNI A;  2CDT A;  2LT1 A;  2QYZ A;  4QW2 A;  3RMS A;  3OS2 A;  3ZEH A;  1QLY A;  2J6F A;  1G2B A;  4XTY A;  4BY6 C;  1UGS B;  5J3B A;  1N8R R;  3J81 E;  1UHF A;  1YI2 T;  2SEM A;  4JJD A;  3G4S Q;  2F2X A;  5I22 A;  2FVU A;  2CKK A;  2DIQ A;  1KC8 R;  1ZSZ A;  1KC8 C;  1WNL A;  1GCP A;  3RDV A;  2RHI A;  1JXO A;  2VXE A;  4J9G A;  2LJ1 A;  1NYF A;  4J9H A;  1KSW A;  1JXM A;  3I56 T;  4FYY B;  1KFZ A;  2JVV A;  1W2B P;  4UC4 A;  3VS6 A;  2E70 A;  1PM3 A;  4M75 G;  2XI9 A;  5GAN 7;  4PKC C;  3X20 B;  1VQO A;  4C8Q G;  2EYY A;  3OSV A;  2COZ A;  3V8K A;  2WSE E;  1PRL C;  3ER0 A;  3DB3 A;  3JB9 G;  2L3Q A;  5IT9 E;  4C0D C;  4QQG A;  1LPL A;  2LQ8 A;  3HTR A;  4Z02 A;  4DEX A;  2DL5 A;  4HVV A;  1MGQ A;  3HFO A;  2EYX A;  2ZZD A;  4F7U G;  1ZSZ B;  1ZUY A;  2DA9 A;  4RCB A;  1JJ2 S;  2COW A;  1K9M R;  4AFQ C;  2MF2 A;  4HXJ A;  4PJO G;  1K9M C;  1HSQ A;  1O9S A;  2QAS A;  2GTO A;  2QK0 A;  2V8K A;  2DNU A;  3OA6 A;  4PJJ A;  1ZA1 B;  2FPE A;  1OPL A;  2E65 A;  5GAM f;  5GAM g;  1UGP B;  2EW3 A;  2HL5 C;  4DBH A;  3BFM A;  3O5Z A;  3L2U A;  3X28 B;  2VKN A;  3MPU B;  3CME T;  3X26 B;  5FLX E;  5IAY A;  2ZPG B;  4FYW B;  3OYF A;  1WFW A;  4AFZ C;  4M7A F;  1QP2 A;  2HAX A;  4C92 G;  4ATO A;  5GMK l;  2RQW A;  4F7U B;  1VQM T;  3RKX A;  3OS5 A;  4J9E A;  4NS5 A;  5AT1 B;  2EYQ A;  5LJ3 h;  3S3N A;  3BY7 A;  2CZ7 B;  2X35 A;  1M3C A;  1VQ5 A;  5IH2 A;  2MK5 A;  2JUF A;  2ZGW A;  4LUE A;  4ZN1 A;  1OUL A;  4FCY A;  1WPY A;  4B9W A;  1HJD A;  4FU6 A;  3QJ6 A;  1RAD B;  1LVK A;  1VQ6 T;  1OU8 A;  2DFU A;  4KGV B;  2DE0 X;  1AZG B;  4C92 B;  2CP2 A;  4JZ3 A;  3LWI A;  4JZ4 A;  4GLM A;  5CKD A;  4LDV A;  1OV3 A;  2KXC A;  3RIR A;  1M90 R;  1NJI R;  1NJI C;  3GBQ A;  2XG8 D;  2ED0 A;  2FB7 A;  1TUC A;  1M4Z A;  1D09 B;  1OZ3 A;  1PSF A;  3A1P A;  3VU3 C;  1VQ9 Q;  3CPF A;  3G1J A;  2PU9 B;  2MI6 A;  1Q86 U;  1EFN A;  1KIK A;  2V1R A;  3JCM J;  3JCM h;  1NZ9 A;  3EG9 A;  2XU8 A;  1X75 C;  1QCF A;  2KDS A;  2F1L A;  3SWN A;  5ECA A;  1ZHI A;  5LJ5 d;  1WHJ A;  3LLR A;  3QJY A;  1GL5 A;  2K9G A;  3OYB A;  2CH4 W;  2V1Q A;  5GMK e;  3L2Z A;  1QCN A;  1H3H A;  1BK2 A;  1VIF A;  2DAQ A;  1YJN T;  1S1N A;  3NMZ C;  3M0Q A;  2QA4 Q;  1MNE A;  4JLG A;  3M4G A;  2HBP A;  1PD0 A;  3E19 A;  1KHC A;  2CZ1 B;  3S3M A;  3CD6 Q;  2FPF A;  3VS3 A;  1BYM A;  1SKU B;  1YI2 A;  3HL8 A;  2AHJ B;  2RK1 A;  4J9D A;  1D1A A;  5HCK A;  4BI4 A;  1G83 A;  3OYE A;  4KH0 B;  3E9F A;  2KYB A;  2W10 A;  2O88 A;  2R57 A;  2DM1 A;  5GAN f;  3OQ5 A;  3EG9 B;  5GAN g;  4M78 A;  3JAM E;  3G4S T;  4BUG A;  8ATC B;  3SWN B;  3I56 A;  1M5Q 1;  3CPW S;  4QVZ A;  5LJ5 e;  2QQA A;  5IHI A;  4J7F A;  1UUE A;  4II1 A;  3JB9 J;  1BBZ A;  3NPF A;  3QKJ A;  2HQH A;  1QW1 A;  2V8I A;  1KD1 U;  4J7I A;  1UGQ B;  5LJ3 f;  1NM7 A;  4QVD A;  1D1B A;  2LX7 A;  5L23 A;  3PE0 A;  3UF4 A;  3GOX A;  5FRO A;  4E6R A;  2D9T A;  3CCS Q;  1YIT A;  4FSX A;  3RKY A;  1NBE B;  1YJ9 T;  3HFN A;  2LCL A;  3CCU Q;  4PLI A;  2LZ6 B;  3MET A;  2CT3 A;  2CP6 A;  1M1K U;  1C0M A;  1JJ2 P;  4PJN A;  4D8D A;  3TQ7 P;  1FX7 A;  1VOM A;  5CVI A;  3HP9 A;  4JDS A;  4M78 B;  3L2Q A;  5DY9 A;  4EIK A;  4EPC A;  1LNX A;  2C0I A;  4LDY A;  1Q7Y R;  4XK8 E;  1ZSZ C;  3QYH B;  4A4G A;  2D1X A;  1VUB A;  2FRW A;  1VQP A;  4M7A C;  1UGR B;  2DKG A;  1SSH A;  2AZV A;  2LC4 A;  1MND A;  1NEB A;  5GAN 4;  1AHJ B;  3TCJ A;  4EDU A;  1IGU A;  1PCX A;  2XKO C;  3LH5 A;  4VUB A;  2P0P A;  1WLP B;  5J26 A;  3HHT B;  2LP5 A;  3CMA A;  2EQM A;  4HVW A;  1ZBX A;  4J9C A;  2FO0 A;  5GJV B;  5FW9 A;  4L59 A;  1B7T A;  2CUB A;  2KE9 A;  2VGN A;  4A4H A;  4XU2 A;  5GAM d;  3CCJ Q;  4NL3 A;  1SHG A;  1T0H A;  2EWN A;  1AT1 B;  4E7I A;  3GNG A;  4XAX B;  3X25 B;  2IVW A;  1A0N B;  4PJM A;  4M77 F;  2XIC A;  3VS4 A;  2CP3 A;  2KGT A;  2BKD N;  4RCC A;  3EG2 A;  1N9S A;  1ZLM A;  2ROT A;  4IIO A;  3T9N A;  2XDB A;  2K7A A;  1VQK A;  2LDM A;  2HQX A;  2BIV A;  1VYT A;  4N0A C;  2GF7 A;  4E7K A;  1I8F A;  1QQJ A;  1Q95 G;  2XK0 A;  5LJ5 h;  1VQ7 T;  2NLU A;  4M7D A;  1EIF A;  2M0Y A;  2V8J A;  1W6X A;  1UG1 A;  2EAY A;  4PLL A;  1VQ9 T;  1TS9 A;  1QWE A;  2WAC A;  2HDA A;  4BDZ A;  4M7A E;  1AVZ C;  3MEA A;  4BB7 A;  3FJP A;  2K5I A;  2GQI A;  1N6A A;  4C5I A;  5C0M A;  2E12 A;  1RUW A;  3ZL7 C;  2O01 E;  3MHX A;  3D7S B;  2A08 A;  1WHM A;  1GCQ A;  1Y96 B;  1ZUK A;  4L6V 5;  4JUV A;  4LDU A;  2H3J A;  3VS1 A;  3TSW A;  2YT6 A;  4LD6 A;  4MDW A;  4AFS C;  1ACM B;  5CAI A;  3SFM A;  1WJS A;  5GAO p;  2FZC B;  4M7D B;  2OAU A;  3NTI A;  3PFS A;  2KYM A;  2RHY A;  1Q81 R;  1X27 A;  4KUI A;  2YRV A;  4JJN K;  1RAA B;  4R56 A;  3G4S A;  3CPW P;  1GXI E;  5EG2 A;  3DKM A;  1M8V A;  2A28 A;  3J80 E;  2K3Y A;  3PVL A;  3QO3 A;  2DLP A;  2M51 A;  1RAC B;  1M2V A;  2SRC A;  2K6D A;  1K1Z A;  3SWN C;  3WXM B;  1TG0 A;  3QSU A;  5GAN 3;  4QVC A;  5D6Y A;  1YCS B;  1XJW B;  1EX4 A;  4R55 A;  1VQM Q;  2D6F A;  3QDF A;  5GAN d;  4XTX A;  1K8A U;  1IGQ A;  2DBM A;  2E4H A;  4PL6 A;  3L2W A;  4RMO A;  2OTL T;  4KRT A;  3CCS T;  1K73 U;  4IIM A;  3M0T A;  2F5K A;  4FSS A;  2RF0 A;  5HK3 A;  1WHG A;  3QZ5 B;  1MMA A;  1UEC A;  2WSC E;  4BI8 B;  1G8X A;  3CCU T;  1IB8 A;  4GY5 A;  1K73 C;  3OSS C;  4M7A D;  3VKI A;  3BE3 A;  4E7L A;  5CQY A;  3EGU A;  4CI0 C;  1LOJ A;  1VQN Q;  1Y07 A;  1WYX A;  2F5T X;  3JB9 I;  3EAE A;  3H8Z A;  1JEG A;  2VUB A;  4M78 C;  3HRU A;  1M2V B;  4JS4 A;  4HCB A;  1V76 A;  2KVQ G;  2E64 A;  2DRM A;  4Y28 E;  1T0J A;  1OEB A;  2DXC A;  2NUT A;  1QVG S;  2OI3 A;  2L89 A;  3H0H A;  1Z9Z A;  1X6G A;  5CO7 A;  3GP8 A;  4ZGJ B;  5GAM h;  7AT1 B;  5IXB A;  3TVT A;  3CCV Q;  1W1F A;  2L2P A;  3GPL A;  1MMN A; 
#chains in the Genus database with same CATH homology
 2VKN A;  1RI9 A;  2ECZ A;  2KNB B;  1QWF A;  4OMM A;  2L3S A;  2RPN A;  1WFW A;  4AFZ C;  2GTJ A;  2RNA A;  1SEM A;  2X3W D;  2RQW A;  2KXD A;  3QWY A;  3REB B;  2JTE A;  1AEY A;  2GGR A;  4J9E A;  1AWJ A;  3M0U A;  1NG2 A;  2O31 A;  3I9Q A;  1UJY A;  4ESR A;  1M3C A;  5IH2 A;  1U06 A;  2KRM A;  2CSQ A;  2IIM A;  4LUE A;  2DBK A;  4J9F A;  2NUZ A;  2I0N A;  1HJD A;  1YN8 A;  2YUQ A;  4RTT A;  2K2M A;  4K11 A;  1E6H A;  2D8J A;  2DE0 X;  4Y92 A;  1AZG B;  4JPB W;  1T3S A;  1JO8 A;  4JZ3 A;  4JZ4 A;  4HVU A;  4GLM A;  1OV3 A;  2KXC A;  2OJ2 A;  2MCN A;  2RQV A;  2CH4 A;  2HSP A;  1AZE A;  2EKH A;  3GBQ A;  2ED0 A;  3SHW A;  1M3A A;  1TUC A;  2KBT A;  4RTZ A;  1SHF A;  3JV3 A;  2EPD A;  2DIL A;  2K3B A;  2KRO A;  4RTU A;  1PHT A;  2KRS A;  5EC7 A;  1EFN A;  3EG0 A;  4ORZ A;  1KIK A;  2V1R A;  3VS7 A;  2W0Z A;  1QKW A;  1UFF A;  4M4Z A;  3EG1 A;  1FYN A;  1QCF A;  4RTY A;  5ECA A;  1OPK A;  2DRK A;  2DYB A;  2RN8 A;  1GL5 A;  2EYW A;  2K9G A;  2KT8 A;  2CH4 W;  2V1Q A;  2BZ8 A;  5FWC A;  3M0P A;  2A37 A;  1H3H A;  4RUG A;  1I1J A;  1BK2 A;  1RLQ C;  1UJ0 A;  3UA7 A;  1S1N A;  1Y57 A;  2KRN A;  3NMZ C;  3M0Q A;  1MV0 B;  1M8M A;  1QKX A;  1UHC A;  1AWW A;  1ABQ A;  2RQT A;  1CKA A;  2BZY A;  3A98 A;  2LCS A;  2RQU A;  4LUD A;  2O2O A;  5IHN A;  3VS0 A;  2FPF A;  3VS3 A;  1K9A A;  1IO6 A;  4J9D A;  4OMO A;  3C0C A;  3I35 A;  5HCK A;  3U23 A;  1G83 A;  2G6F X;  1K76 A;  2KYB A;  2W10 A;  1GFD A;  2O88 A;  1J3T A;  2DM1 A;  2PZ1 A;  3UA6 A;  1NLP C;  3I5R A;  1JQQ A;  2ROL A;  5IHK A;  4Z89 A;  3EHQ A;  1PWT A;  2JS2 A;  1WIE A;  2AKL A;  3H41 A;  1AWX A;  1GBQ A;  1B3Q A;  1ZUU A;  5IHI A;  1UUE A;  2JXB A;  3EHR A;  1BBZ A;  2PTK A;  3NPF A;  4RTX A;  4J9B A;  1GCQ C;  1K0S A;  1YWP A;  2DL8 A;  3I5S A;  2L0A A;  2FEI A;  3CQT A;  2JM9 A;  1NM7 A;  1H8K A;  1UE9 A;  2BTT A;  2LX7 A;  2CRE A;  3M0R A;  4AG1 C;  5L23 A;  3RNJ A;  3PE0 A;  1WX6 A;  3UF4 A;  2EGA A;  4E6R A;  5IXF A;  2RQR A;  1PNJ A;  1GBR A;  2K79 A;  3NHN A;  2LZ6 B;  2O9V A;  2CT3 A;  3SEM A;  2A36 A;  2DF6 A;  4D8D A;  4CC7 A;  2EQI A;  4CC2 A;  1UGV A;  1X2Q A;  1UTI A;  3QWX X;  4J9I A;  4LE9 A;  1E7O A;  4EIK A;  2J06 A;  2JMC A;  3THK A;  3ULR B;  1B07 A;  2D8H A;  2C0I A;  3VS5 A;  1VYV A;  3VS2 A;  2D0N A;  2LQW A;  2D1X A;  2FRW A;  2X3X D;  2MIO A;  3UAT A;  1SSH A;  1M27 C;  2AZV A;  2EBP A;  1NEB A;  2J05 A;  4A63 B;  1JU5 C;  1XOV A;  4QT7 A;  1Z9Q A;  3H0I A;  3LH5 A;  3VRY A;  3IQL A;  1T3L A;  2VVK A;  2EYZ A;  1WLP B;  1H92 A;  2EGE A;  2LP5 A;  2RMO A;  4HVW A;  4J9C A;  1WDX A;  2J6K A;  2FO0 A;  5GJV B;  4ZNX A;  5FW9 A;  1U3O A;  1W70 A;  2CUB A;  2E5K A;  2KE9 A;  4GBQ A;  1YP5 A;  1ZSG A;  2GNC A;  4LNP A;  1SHG A;  1VA7 A;  1T0H A;  1V1C A;  2DJQ A;  1ZX6 A;  1M3B A;  3H0F A;  1MV3 A;  1FMK A;  2F2W A;  3R6N A;  4F16 A;  1A0N B;  1VYU A;  3VS4 A;  1I0C A;  1X6B A;  2KGT A;  1SRM A;  3NGP A;  3VRZ A;  3EG2 A;  2P4R A;  2YUP A;  1ZLM A;  1AOJ A;  2LJ3 A;  2ROT A;  4IIO A;  2ABL A;  1I07 A;  2VWF A;  1PKS A;  1KJW A;  2K7A A;  5GJW B;  4RTW A;  1OOT A;  4HCK A;  1VYT A;  1WXT A;  2B86 A;  2DMO A;  1NEG A;  3EG3 A;  2LMJ A;  2YDL A;  1GFC A;  2KEA A;  2XMF A;  4X1V A;  2H8H A;  2M0Y A;  1W6X A;  2JT4 A;  1UG1 A;  4OMP A;  2L3P A;  2C0T A;  4Z8A A;  1K0X A;  1QWE A;  1Y0M A;  2DL3 A;  2HDA A;  2JM8 A;  1AVZ C;  1YWO A;  2KT1 A;  2LQN A;  1PKT A;  4AFU C;  2AK5 A;  2DX1 A;  2GQI A;  1E6G A;  4JJB A;  2JS0 A;  1N5Z A;  1RUW A;  2JMA A;  1SRL A;  3ZL7 C;  2ED1 A;  4Z88 A;  1X69 A;  2JW4 A;  3REA B;  2LNH B;  2A08 A;  2GBQ A;  1WXU A;  2YSQ A;  2ESW A;  4DEY A;  1GCQ A;  1X43 A;  2MOX A;  1ZUK A;  2ENM A;  2OAW A;  1SPK A;  1K4U S;  3RBB B;  2BZX A;  2O9S A;  4JJC A;  5FWB A;  2DL4 A;  3VS1 A;  2QDL A;  2YT6 A;  3FJ5 A;  3TSW A;  4AFS C;  1GRI A;  2FRY A;  2CUD A;  2CT4 A;  3KFV A;  2AZS A;  4OMN A;  2PNI A;  1BB9 A;  4F14 A;  2CDT A;  2KYM A;  1ABO A;  1X27 A;  3TSZ A;  2J6O A;  4F17 A;  1QLY A;  2J6F A;  1G2B A;  2A28 A;  4RTV A;  1YNZ A;  2FG0 A;  4OMQ A;  1UHF A;  1NLO C;  2SEM A;  4JJD A;  3PVL A;  2DLP A;  2F2X A;  1X2K A;  2YUO A;  3M0S A;  2M51 A;  4CC4 B;  5I22 A;  1HD3 A;  4CC3 A;  2SRC A;  2LJ0 A;  2DVJ A;  2K6D A;  1K1Z A;  1AD5 A;  2AKK A;  1WA7 A;  1TG0 A;  1GCP A;  2CSI A;  1JXO A;  4J9G A;  1YCS B;  2LJ1 A;  1NYF A;  1NYG A;  4J9H A;  1KSW A;  1JXM A;  1KFZ A;  1MUZ A;  2FPD A;  1TUD A;  3VS6 A;  1CKB A;  2DBM A;  2EVR A;  2YUN A;  4KRT A;  2J7I A;  2EYY A;  4IIM A;  3M0T A;  3PVQ A;  4FSS A;  2RF0 A;  1UEC A;  4OML A;  1PRL C;  2L3Q A;  2HCK A;  1U5S A;  2F2V A;  3EGU A;  2KR3 A;  2C0O A;  2NWM A;  1PRM C;  4D8K A;  1WYX A;  4AG2 C;  1JEG A;  1ARK A;  4DEX A;  2DL5 A;  4HVV A;  4R0K A;  2EYX A;  1LCK A;  2DRM A;  1ZUY A;  2DA9 A;  1T0J A;  1OEB A;  5I11 A;  2DL7 A;  1RLP C;  4AFQ C;  1CSK A;  1M30 A;  4HXJ A;  1HSQ A;  2GTO A;  2DNU A;  2HBW A;  2EGC A;  2OI3 A;  3H0H A;  1Z9Z A;  1X6G A;  1WXB A;  1BU1 A;  2FPE A;  1AWO A;  1OPL A;  2HEQ A;  1UDL A;  1WI7 A;  1ZBJ A;  4LN2 A;  5IXB A;  2EW3 A;  3TVT A;  1W1F A;  3O5Z A;  2L2P A;  4WCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...