2G6FX

Crystal structure of the sh3 domain of betapix in complex with a high affinity peptide from pak2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
b'GPLGSVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 7
publication title Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 11
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2g6fX00
3R6NA 5GJWB 3JV3A 2DE0X 2FG0A 1U3OA 3PVQA 1X2KA 1X69A 1OPKA 4RTWA 4AFZC 1BB9A 2YSQA 1SRMA 2DL7A 5IHIA 1N5ZA 4GBQA 2DX1A 4EIKA 3VS3A 1AVZC 2K7AA 3UA6A 4AG1C 1AWJA 1YCSB 4RTZA 2FRWA 1NM7A 2H8HA 4RTUA 1M3CA 3SEMA 2JS0A 4CC3A 2LNHB 2KYBA 1RLPC 1T0HA 1WI7A 1WYXA 1WXTA 2JT4A 2D1XA 2VWFA 4JJCA 1W6XA 4LUEA 1NLOC 2EVRA 2GBQA 2ECZA 2EYYA 2MIOA 1OEBA 4F14A 1KSWA 1WLPB 1ZUUA 4Y92A 5I11A 1JEGA 2VVKA 1X2QA 4IIMA 1AOJA 2BZ8A 2O31A 4OMOA 4LNPA 4DEXA 1AZEA 5HCKA 3RNJA 3EG3A 2KROA 5IHNA 1JXMA 3EG1A 5FW9A 1I1JA 1RUWA 1ZUKA 1JO8A 1WXBA 2C0OA 2DL8A 2JTEA 1YN8A 2L0AA 1AWXA 1Y0MA 2AKKA 1QLYA 2LQNA 1AWOA 2LQWA 2MCNA 1WIEA 2RN8A 2SRCA 1UUEA 2CSQA 1QKWA 4JZ4A 2A37A 1Z9ZA 2CREA 2G6FX 4LUDA 4K11A 2K2MA 5IH2A 3O5ZA 1VYTA 1JXOA 1M30A 1ZUYA 1YWPA 2RNAA 2YUQA 2CUBA 2ED0A 1NYFA 3M0SA 4RTYA 1HSQA 3EG2A 2KR3A 2C0TA 1NYGA 1X6BA 2RQWA 2BTTA 1SPKA 2NUZA 1MUZA 4Z88A 4X1VA 1G2BA 1RI9A 1PNJA 4HCKA 2AK5A 2DVJA 3M0QA 2A08A 2DL5A 2LMJA 4AFSC 1GFCA 3EHQA 1YP5A 1VYVA 1QCFA 2I0NA 3EG0A 3C0CA 2J6KA 2V1QA 3M0RA 1HD3A 4A63B 3H0HA 1IO6A 2HEQA 2JS2A 2K79A 4HXJA 1K0XA 4GLMA 3TSZA 2JM8A 2A36A 1FMKA 4J9GA 1YNZA 3EGUA 1H92A 2F2XA 2FPEA 4LE9A 1WXUA 2DA9A 2DBMA 2SEMA 2PNIA 1LCKA 1NEBA 2EQIA 2FEIA 1QWFA 2KYMA 2M0YA 1W70A 4CC7A 1GBRA 2CT3A 2KEAA 4QT7A 2KE9A 2OAWA 1Y57A 1AWWA 1EFNA 1PKSA 2QDLA 3U23A 3CQTA 1T0JA 2KGTA 3VS1A 1K0SA 2ABLA 2LJ0A 3LH5A 2L3PA 4RTXA 1UE9A 2ED1A 4WCIA 4F16A 1G83A 2EYZA 2X3XD 1I07A 2DJQA 2DF6A 2P4RA 2E5KA 2GGRA 4ZNXA 1OOTA 3TVTA 2OJ2A 2EGCA 2DRMA 1GCPA 2D8JA 2DNUA 2RQUA 1UJ0A 3VS6A 1T3LA 2AKLA 1WFWA 2ROTA 4LN2A 1JQQA 4RTVA 1GCQA 3UA7A 2X3WD 2JMAA 4CC2A 5EC7A 3VRYA 1V1CA 2IIMA 2L2PA 2FPFA 3M0UA 3A98A 2LP5A 2A28A 1NLPC 1UHFA 1I0CA 1GRIA 2DL4A 2NWMA 2AZVA 1OPLA 3GBQA 2K3BA 2J06A 2RQTA 4E6RA 1A0NB 2EKHA 3VS7A 1SRLA 2RQVA 3NPFA 1M27C 2YT6A 3VS4A 3EHRA 5ECAA 1ZBJA 1NG2A 3FJ5A 3I5SA 2EPDA 3H41A 2RQRA 1PWTA 3I9QA 2FO0A 3IQLA 1RLQC 1BU1A 1VYUA 1TUCA 4Z89A 1B07A 1QWEA 1T3SA 4J9BA 1PRLC 2DYBA 3VS2A 2DMOA 1CKAA 4JJDA 1K4US 2K6DA 1ZX6A 2D8HA 4OMQA 2ROLA 2CH4W 4D8KA 2J6FA 1UJYA 3H0FA 4KRTA 3I35A 3RBBB 2EYXA 2XMFA 2CH4A 2HCKA 1AD5A 4HVVA 3NGPA 1YWOA 2C0IA 2LX7A 1X43A 1XOVA 2L3SA 4HVUA 2DRKA 3H0IA 1FYNA 2DILA 1MV3A 1UDLA 2FRYA 1NEGA 4OMNA 2PZ1A 4R0KA 2O9VA 3QWYA 2CDTA 1SHFA 1E6GA 1X6GA 2RMOA 2DBKA 2GTJA 3ULRB 1W1FA 1UG1A 3VS5A 2BZXA 2YUOA 4J9CA 1WDXA 2JW4A 2YUNA 2CT4A 2AZSA 2CUDA 1U5SA 3ZL7C 1X27A 1M3BA 1BBZA 2B86A 4JZ3A 1ZSGA 1E7OA 1PHTA 3NHNA 1WX6A 2LJ1A 4Z8AA 4RTTA 3NMZC 1M3AA 2EW3A 2D0NA 4OMLA 1PRMC 2GTOA 2J7IA 1QKXA 3SHWA 3REAB 4DEYA 1U06A 1UFFA 1KIKA 2KT8A 2O2OA 4J9FA 2L3QA 5IXFA 4J9DA 2KRSA 5FWBA 4OMMA 1KFZA 1SSHA 2JMCA 1J3TA 1UHCA 2CSIA 1K1ZA 1H8KA 1VA7A 2KXCA 2KXDA 2HDAA 3VRZA 1E6HA 2RPNA 2EBPA 2FPDA 2YDLA 1UGVA 2F2WA 1HJDA 4JJBA 1MV0B 2KNBB 2ENMA 2W0ZA 3VS0A 1ZLMA 4J9IA 2YUPA 1GL5A 2O88A 2PTKA 2VKNA 2KRMA 3TSWA 1AZGB 4RUGA 2DL3A 3PE0A 1SEMA 2MOXA 2M51A 2V1RA 2EGEA 4IIOA 3M0PA 3UF4A 1ARKA 4HVWA 3I5RA 2LZ6B 3THKA 4ESRA 1UECA 4JPBW 1TUDA 1M8MA 5GJVB 4D8DA 4ORZA 4F17A 2EGAA 1KJWA 1CSKA 1S1NA 4J9HA 2F2VA 4FSSA 3M0TA 2KT1A 2OI3A 2KBTA 2LJ3A 2W10A 2DM1A 3QWXX 1Z9QA 1CKBA 1GFDA 2O9SA 4OMPA 1WA7A 4AFUC 2K9GA 1PKTA 5IHKA 1B3QA 2DLPA 1H3HA 1ABOA 1ABQA 5L23A 5FWCA 2EYWA 1AEYA 1GCQC 2HSPA 1K76A 1BK2A 1TG0A 3PVLA 3UATA 1JU5C 1SHGA 1GBQA 1K9AA 4AG2C 4CC4B 4J9EA 2JM9A 1OV3A 2HBWA 3KFVA 5IXBA 4AFQC 3REBB 2BZYA 2J05A 2ESWA 2JXBA 5I22A 1UTIA 2GQIA 2RF0A 2GNCA 2KRNA 2LCSA 2J6OA 4M4ZA
chains in the Genus database with same CATH superfamily
2RI2A 5GJWB 2PVDB 2P0PA 3TEEA 3CCJT 2DXTA 2CGHA 2DE0X 3LLRA 5I2SA 4C8QG 2YSQA 5KCOA 2FZGB 1N5ZA 3CCSA 1Q7YU 1IGUA 2RHUA 1UGQB 3EFSA 1P92A 4EDUA 1AVZC 4AG1C 2K3XA 1YCSB 1TOVA 2DK3A 2H8HA 5CKFA 4EPCA 4HCZA 1RLPC 3CCVT 1WI7A 4JDSA 2RA2A 1ZBXA 4JJCA 4XU2A 3HHTB 1W6XA 4ZGDB 3A8HB 5CAIA 2XI9A 1KC8C 2ECZA 2MIOA 3I55Q 4F14A 1WLPB 4Y92A 4JRQA 4PJOB 1IB8A 5I11A 2VVKA 1X2QA 3EG9B 1YJNT 4LNPA 1XQHA 5LJ3d 1M90U 3INZA 2KROA 1JXMA 2MWPA 1PD1A 2JTFA 1WXBA 3CD6T 2JTEA 7AT1B 1YN8A 2AKKA 1QLYA 1VQPT 3SDZA 1PSEA 2MCNA 1WIEA 1UUEA 1Q7YC 2CSQA 1QKWA 3CC2T 2XG8D 4OB1B 4M7DG 3KUFA 3O5ZA 1H641 1QVFS 1D1AA 4KUDK 3EGDB 1OQKA 3M0SA 4RTYA 1EZZB 3EGXA 1G8XA 5LJ3j 3I55A 4JRPA 3FB9A 3E9FA 2EWNA 4C8QE 2NUZA 1G3SA 2QEXQ 4Z88A 5GAOl 4D6WA 2DVJA 2NUPA 2DL5A 1I8FA 1M90C 2LMJA 4X9CA 1Y07A 5KYYB 3CC4T 1M1KU 1QCFA 4PFPA 5GAMf 2VB6A 3M0RA 2KSSA 5FU7C 4KGVB 3RUXA 4A63B 3J80E 3H0HA 4C92G 2MI6A 2R5AA 3AT1B 4GLMA 2DFUA 4PJOD 1HYOA 2M0OA 3TSZA 4LDYA 4F7UB 1FMKA 4LDUA 3OYAA 4BD3A 3GIBA 2F2XA 3HPWA 2OTJT 2QYZA 1WXUA 2LNVA 2LCCA 2O01E 3OS5A 3C12A 2QEXA 2EQIA 4AT1B 1QWFA 1IZ6A 2M0YA 5HY6A 2OAWA 1PKSA 4C5HA 1TS9A 1YJWT 2KGTA 1Q86U 3CPWS 1M1KC 2DXBA 4C8QF 3QDRB 4RTXA 2XHCA 3G4ST 4WCIA 1QW1A 3E2UA 4QVCA 2IVWA 1G83A 3DB3A 1I07A 1UGSB 3L2WA 5C0MA 3JRZA 1K73U 2DF6A 1VQ8T 1TU0B 1VIEA 2DRMA 3JCMf 3CEYA 4IUUA 4PKCC 2F69A 4XTXA 3QJ6A 1MNEA 1FWZA 1T3LA 3UPUA 3SWNB 2AKLA 4RTVA 4LN2A 1VQNT 4OMFB 4IUVA 1NBEB 5EC7A 2XICA 1M5Q1 1VUBA 4M78B 2DJZA 5GAN7 3A98A 3OMCA 2LP5A 1UHFA 2X35A 3L2QA 2YHTA 1Q86C 1VOMA 4E47A 3OYBA 1Y71A 2AZVA 5KYXB 1BCMA 4C0FA 2K3YA 2KK4A 3A8LB 3GBQA 4FM4B 4E6RA 4M75B 4LD9K 5ECAA 3GOXA 3FJ5A 1K73C 2EKOA 1YJ9T 2QK0A 1BU1A 1VYUA 5FU6B 3BDUA 3UWNA 4VUBA 4J9BA 3VS2A 2DMOA 3BW1A 1BI3A 5LJ5f 2K6DA 3RKYA 3CCQQ 1K9MR 3OSSC 4OMQA 3CCST 5GAOp 2J6FA 1UJYA 4E7ZA 3H0FA 2RHZA 3JCMW 4KRTA 3RBBB 2XMFA 2HCKA 1QVFA 1AD5A 2I2LA 2BE7D 3NGPA 3META 3S3OA 2FYKA 4ELYC 2KQWA 2XIDA 2DILA 1MV3A 3HRUA 4QVZA 1UDLA 3M58A 1XTDA 2RHXA 2X9HA 4OMNA 3QWYA 3M4YA 2HKQB 3JB9J 3EH1A 4MZTA 2LT1A 2RMOA 2DBKA 5GAN2 1WNLA 4LDVA 5IT9E 4DOVA 4C0GA 5KYUB 1Y96B 1X01A 2GF7A 3KXTA 3CCEQ 2NUTA 4M78D 1XJWB 2JW4A 4BACA 2YUNA 5IAYA 3MEWA 2CUDA 1U5SA 2GCXA 2XDPA 1OX9A 3TU4K 2B86A 3O8VA 3CCMQ 3NHNA 5GMKj 3DLLA 1WX6A 2E3IA 4M75D 3HL8A 2CP6A 3VYHB 3PNWC 1MMNA 3L2ZA 1M3AA 2EW3A 2D0NA 2EAYA 2A3LA 1PRMC 4OB2B 2XU8A 3SHWA 1OX8A 4M77F 3KBGA 2M1HA 5LJ3f 1RAGB 2L3QA 1M9SA 2YRCA 5IXFA 5CVIA 2KRSA 1KFZA 1VQMA 1SSHA 4M7AC 1VA7A 2KXCA 2KAFA 2HDAA 3VRZA 1E6HA 4C0DC 4M77C 2JOYA 2RPNA 2VGMA 2R57A 3CCEA 2YDLA 1UGVA 3X28B 3HRTA 3CPWA 4E7SA 3CPFA 1JBMA 4XTUA 2KNBB 1RL2A 4PJOG 3C94A 3CPWP 2LQKA 3P8BB 5GAOq 2HAXA 4MZPA 1ZLMA 2O88A 3JB9D 2VKNA 3CCMA 3ZBDA 3OS1A 4PJNA 3OYGA 4XK8E 5KYWB 1BCOA 1MMDA 5GAMg 3I56Q 1ARKA 3CCLQ 2FHDA 3RR6A 2COYA 2XDDA 4XTZA 1M2VB 4JPBW 3TCJA 4R56A 1N8RU 2YLBA 5GJVB 1R77A 1YFNA 1KJWA 4C5GA 4C92B 5CIUA 1IRXA 4R55A 2OI3A 4KBMB 1X6OA 4DOWA 4QW2A 1CKBA 2YWWA 1R0CB 1WA7A 2QGFB 2V26A 2DLPA 4L6V5 4EMGA 4C8QA 4KT0E 1YI2A 3BE3A 1PCXA 1K8AC 3QSUA 1SHGA 1VQKT 3I56A 3CMAQ 4LDXA 4CC4B 3CMET 3CCLA 4RCCA 1PC0A 1OU8A 2JNGA 4C5EA 4PJLA 2CP5A 2BZYA 2M02A 5CKHA 4M7DD 2DPPB 1BI1A 3CBOA 3QUIA 2DTHA 5GAMh 1N8RC 2YLCA 3H9NA 1PD0A 1B34A 1U3OA 2FG0A 1X2KA 3PVQA 1X69A 4RTWA 4GLKA 1BB9A 1WHMA 2DL7A 4N4HA 2V8KA 4E7IA 1G3TA 1FXXA 3MP6A 1VQ7T 3VS3A 3UA6A 2VYTA 1AWJA 1BI2A 4RTZA 1NM7A 3JCMV 4RTUA 3SEMA 2JS0A 2LNHB 4HT8A 2DYIA 2D1XA 2E41A 2QDYB 3FIFA 8ATCB 1I81A 2CP0A 5CKEA 4C92D 4XTWA 5GMKl 2EQMA 4ATOA 1EIFA 2BZ8A 2O31A 4OMOA 1BIAA 3A8GB 2DTOA 3G71Q 2ATCB 5IHNA 2DTIA 3EG1A 2JTMA 1I1JA 1ZUKA 2D9TA 1JO8A 2C0OA 1VQOQ 3BY7A 2DD4A 3M53A 1AWXA 1Q82R 3CCUA 4ZTFA 2LQNA 4BDZA 1AWOA 1S72Q 5DM7R 4KGXB 2X4XA 3JCMh 4RG8A 1Z9ZA 2E6NA 3CC7Q 4LUDA 4K11A 1UGRB 2DXUA 3P8DA 3ZFJA 3E1SA 4Y28E 5IH2A 4M78G 4WTOB 2AT1B 1QMCA 3SFMA 3NFCA 3OY9A 2RNAA 1IHVA 4A4KA 1YIJT 2CUBA 3EG2A 4F7UE 6AT1B 1X6BA 3VU3C 1N9SA 2BTTA 3QG1A 3QXEB 4KULA 3LGLA 2NYSA 4BDYA 3MEUA 4M75G 2X51A 4RCBA 4OGCA 3G71A 1RI9A 4HCKA 4J83A 1BI0A 2A08A 4DBHA 5LJ5d 3EHQA 2DXCA 3OSVA 3LWHA 1YP5A 1ZSZB 1VYVA 1VQ5Q 4N0AC 3C0CA 1MMGA 3OYIA 1S72A 2VXEA 3DB4A 1HD3A 3EGXB 2RO0A 5FROA 2M16A 4FT4A 2JS2A 3OYYA 3CC7A 4ZGJB 4LDWA 2ZPBB 3M9QA 3GLXA 2JVVA 2AHJB 2A0FB 2LRQA 3RERA 1YNZA 3EGUA 1VQMT 3OA6A 3DLMA 3JB9G 2H3EB 1MGQA 2DBMA 2DA9A 2PNIA 1R0BG 3JCMJ 5LJ5j 3M59A 5LJ3g 1AHJB 2KYMA 4MMLA 4CC7A 1GBRA 1IXDA 2KEAA 5A0GA 2E6ZA 4JRIA 1SF9A 4B9XA 5GAN4 4XU0A 1Y57A 3VUZA 1NPRA 1EFNA 4A4HA 4A4FA 4BY6C 3G6EQ 1VQ5A 1MHNA 1WGSA 1RAIB 1VQ4A 4O5VA 4F7UF 1T0JA 3VS1A 2DEUA 1VIFA 2LJ0A 3LH5A 1LNXA 2L3PA 1B7TA 1WQWA 1QVPA 3L2UA 2DJQA 1NPPA 3C4SA 2P4RA 2GGRA 1BIBA 2OJ2A 2EGCA 2XKOC 5GANe 2MWOA 3NTIA 1QVGP 1X75C 3QYHB 3VS6A 4N4IA 1QP2A 3QDFA 5GAOn 4QVDA 1JQQA 2X3WD 2JMAA 2GFUA 3VRYA 4JJNK 5HKCA 1ZA1B 4EMKC 3M0UA 2VUBA 1YI2T 4HCBA 3JCMQ 1KHCA 1SKUB 5LJ3h 1KC8R 1OU9A 2KVQG 1OPLA 1WHJA 1A0NB 2E1HA 3GP8A 3BFMA 2EKHA 3RMQA 2RQVA 1LVKA 4OP0A 1VQ6Q 1M27C 2YT6A 3EHRA 1ZBJA 3I5SA 2V8IA 3I9QA 2O4XB 2OTLQ 3WVEB 3C95A 2KMTA 5GAOm 1TUCA 2ZPEB 1B07A 2Y4YA 3VYGA 1WPYA 1KQ1A 2QI2A 3FRNA 4JJDA 1D3BB 4PNOA 1Q7YR 3VUBA 2CH4W 4D8KA 2QA4Q 3TQ7P 4PK4A 1Y7XA 5IN1A 1VQLT 3JB9H 3H8ZA 1WZOA 4HVVA 3MJXA 1YWOA 2C0IA 3OBWA 2LX7A 2RI5A 3JCMP 1XOVA 3M55A 2FRYA 3G1JA 1VQ6A 4IUQA 1E6GA 1OI1A 1X6GA 1KQSP 2GTJA 1M90R 4PFZA 2OTLA 1PSFA 1W1FA 1D0YA 1W2BS 2E10A 3OS2A 2K57A 2COZA 1KG1A 2BZXA 2DO3A 2EQUA 2HQHA 3RMSA 5GAN6 4M7DE 3JB9F 1YITQ 4OB3B 5GAOr 3LGFA 4AMCA 3CCUT 1ZSGA 3M57A 1PHTA 1K9MU 3HP9A 3EH2A 2L3RA 3EG9A 1NJIU 4PL6A 4Z8AA 3JCMb 2HL3A 1KD1U 4RTTA 2PVGB 4OMLA 3RIRA 4C8QC 1LOJA 2GTOA 3A1PA 3UT1A 2XDBA 2P84A 3REAB 3OYLA 1JJ2A 4M7AG 3LW5E 4OF1A 2WSCE 1KIKA 3EFOA 4J9DA 1JJ2P 4OMMA 2JMCA 5I2MA 4N0AA 1K1ZA 4C92E 3FJPA 2EJ9A 1HJDA 4JJBA 4QKUA 1MV0B 1UB4A 3CCRQ 2QQBA 1YITA 2MK5A 2X4JA 2ENMA 2RJDA 3EGDA 3HFNA 1W4SA 4J9IA 2YUPA 3JCMX 1GL5A 2GQVA 5GANd 3M5AA 1YHQQ 2KRMA 1AZGB 4RUGA 3G7ZA 5KCHA 1SEMA 3FC3A 1K9MC 3OMGA 2HMAA 2VV5A 3UF4A 3N5BB 1M1GA 4M7DF 1NJIC 4E7LA 1KD1C 5FU7B 4ESRA 1VQ9T 2EIFA 2BIVA 4FYXB 5KYYA 3ZEHA 3CXCP 1M8MA 4F17A 4ORZA 3J7AF 4JUVA 4M7DC 4J9HA 1DJ7B 2F2VA 4HT9A 1FMWA 5EG2A 2DM1A 3LYIA 1WJSA 1D0XA 3JSCA 3CCRA 5GANj 1WHKA 1PKTA 1Q86R 1VQ4T 1B3QA 3MP8A 4F7UA 3NTHA 4ME7A 1ABQA 4A4GA 5L23A 4PJJA 1YHQA 1AEYA 1GCQC 2HSPA 1K76A 1BK2A 1TG0A 4C92F 3M56A 4AG2C 2JM9A 3KFVA 5IXBA 4AFQC 1M1FA 2ESWA 4KH0B 2G3RA 4J7FA 3WVDB 4EMKA 4HA8A 3CCQA 2VASA 2CZ0B 5GMKh 3JV3A 3QPHA 3QYGB 5HK0A 2HNIA 2RHYA 2VC8A 2VXFA 3ER0A 1SSFA 2QTXA 3OS0A 4AFZC 4BE0A 2ZPGB 4RG2A 4GBQA 2DX1A 3CCJQ 4EIKA 2PU9B 1ACMB 4J6XA 1NZ9A 2FRWA 1YBYA 1D0ZA 4JS5A 1M3CA 4CC3A 1RAHB 2KYBA 3SWNA 1T0HA 4NOYA 2VWFA 3I55T 2DZCA 4LUEA 1W2BA 1NLOC 2GBQA 1M4ZA 3CCVQ 1B34B 1W2BP 1JEGA 1AOJA 3A5ZB 1AZEA 3EG3A 4E2FB 4QQ6A 1K8AU 1WJQA 1YJNQ 2WSEE 2DL8A 3URGA 4DBRA 3V8JA 2L0AA 4C5IA 3CCJA 1Y0MA 4C0ZA 3TREA 3CD6Q 2RN8A 2RD1A 2ZGWA 2CP2A 1TTHB 3QKJA 2CZ1B 1I5LA 2G6FX 2K2MA 1VQPQ 3HTRA 4CRIA 3CC2Q 1M30A 1ZUYA 4ANJA 3OYEA 2E12A 1NYFA 2FZCB 3CCVA 1HSQA 2QEXT 2NLUA 2LDMA 1H3ZA 1MUZA 3FEOA 2EFIA 2QQSA 1WHGA 3LX7A 4KUIA 4X1VA 5AT1B 1PNJA 2AK5A 5D6WA 1QCOA 1G3WA 4AFSC 3OW2A 3EG0A 2J6KA 3OW2P 2V1QA 1G3YA 4BUGA 3A8MB 1SG5A 3CD6A 3CC4Q 2JN0A 1IO6A 5GMKi 2K79A 5KYUA 2CS7A 1VQPA 2RJCA 4J7IA 2K4YA 4LXCA 3CC2A 2A36A 4PJOE 4J9GA 4BE1A 1U1TA 2FPEA 1M2OA 1QVGS 4N4GA 3JCMg 4RMOA 2SEMA 3S3NA 4IURA 1NEBA 2FEIA 2DVEA 2OTJQ 1W70A 2LVMA 4XAXB 4QT7A 1Q81U 3OYJA 4M7AB 4X34A 1AWWA 4ZTJA 4C0DB 4M77B 3CQTA 5A0DA 1K0SA 3EFRA 3CMAA 3CC4A 1UE9A 2ED1A 1YJWQ 2EYZA 2X3XD 4LD6A 4M7DA 4UC4A 5GMKm 3QIIA 1N8RR 3G4SQ 4ZNXA 2ZAEA 3TVTA 5FRNA 4QQGA 1GCPA 2DNUA 5GAN3 2IPOB 2CP3A 3X20B 3AHUA 1OZ2A 1WJRA 1GCQA 3UA7A 3MEAA 2P0QA 1RAAB 3Q1JA 3DKMA 4CC2A 5GANf 4HKEA 5LJ5g 1V1CA 2IIMA 2RK1A 4PLLA 2L2PA 4PJOF 2FPFA 1VQNQ 1M2VA 1Q81C 3X24B 3OYMA 3VV0A 1U8RA 2E70A 3F70A 4C92A 4RKUE 2DL4A 1RACB 4NS5A 4PJOC 2K3BA 2RQTA 3MO8A 1SRLA 2CZ6B 3NPFA 3G4SA 4II1A 3LH0A 2BUDA 2EPDA 3H41A 1I4K1 1PWTA 1KQSS 3IQLA 1RLQC 3CCQT 1BKBA 1QWEA 2MMPA 4M7AD 3RESA 3QZ9B 5CCAA 1VQOA 1YJ9Q 1CKAA 2LQ8A 4M77D 5DY9A 3P8HA 2D8HA 4J6YA 2ROLA 1ZQ1A 5CQXA 1D09B 4F04B 2MYSA 1VQNA 2EYXA 2CH4A 4KGZB 3CCSQ 1G5VA 2FL7A 2QQ9A 3GNFB 5FLXE 1N6AA 4OB0B 1X43A 3E9GA 2NUPB 2DRKA 5LJ5h 2YRVA 2D0QB 3MKDA 3ME9A 2PZ1A 2MPXC 1RAEB 4R0KA 2O9VA 2CDTA 3CCET 1RI0A 1WHHA 1JJ2S 2PQWA 1JB0E 2RB6A 5CQYA 4MDXA 2X4YA 4L59A 4IKFA 4A53A 4GY5A 1Q95G 2EQKA 1YJ9A 2YUOA 4J9CA 1WDXA 1KK7A 4J6WA 2P4TA 4BI3A 2F1LA 3CCMT 4M78E 1HXDA 1X27A 2FVUA 3V8LA 3QO3A 4JZ3A 1O9SA 1TWBA 5CKDA 3NMZC 5KE3A 4M75E 1QVGA 4PFOA 2J7IA 3MCAB 4FSXA 1QKXA 4E7JA 5D7UA 5J26A 4EMHA 4J9FA 2ZZDA 2RK2A 3CXCS 2HKNA 3GF5A 4E7KA 1J3TA 2LCLA 2QGGA 5I21A 3WXMB 2DETA 2CSIA 1H8KA 2KXDA 3A8OB 2QASA 1IHWA 2EBPA 2KI7A 1RAFB 2F2WA 2EJFA 3RKWA 3OYHA 3G6EA 3OBYA 1AT1B 2KY9A 2W0ZA 2JZ2A 3RKXA 3I56T 3EFOB 4DA4A 3PE0A 3NTKA 3CCLT 3QHSA 2EGEA 2E65A 3M0PA 4BI4A 1V29B 2DD5A 3I5RA 4M78F 1TXQA 1UECA 3SWNC 3VJPA 3V7SA 1ZSZA 2WACA 4D8DA 3CBMA 2D6FA 3PFSA 2QG9B 3FDRA 4MMKA 3OYDA 2HBPA 4FSSA 2KT1A 4M78C 2W10A 2XD0A 4M75F 1UGPB 1C0MA 2JJ9A 2O9SA 4OMPA 2DZ9A 5GMKe 4AFUC 1IREB 3QZ5B 1H3HA 2CKKA 3EAEA 5FWCA 1OULA 4M75C 3CMAT 2DKGA 1U1SA 4XU3A 2RJFA 2F5KA 3UATA 2RH2A 2GFAA 4BY6B 1R8OB 3M4GA 1GBQA 5DLQE 1KQSA 2HL5C 4J9EA 3FLGA 1WHLA 1OV3A 4FW1A 5FU6C 1LPLA 3REBB 1VQKQ 2RM4A 3GPLA 4JLIA 2JXBA 2YRDA 3CMEQ 4E7HA 4PLIA 1UTIA 3PGGA 2E4HA 3X26B 2MF2A 5I22A 4IUTA 2GQIA 2QXFA 4XQ3A 2GNCA 4PJMA 4FIBA 5KYNA 4M4ZA 3R6NA 2QA4A 4FL6A 4WF2A 1OPKA 1SRMA 5IHIA 4PJOA 4B6MA 2HSEB 2K7AA 5GANg 2EQJA 1C1AA 1PG5B 4OGEA 1F1BB 2NUTB 3MPUB 1VQ7Q 1LJOA 1WYXA 2JT4A 1WXTA 2FB7A 4EMKB 1WQ7A 3OQ5A 4M77G 2Z0WA 2KDSA 2EVRA 3JAME 1VQKA 2EYYA 1OEBA 1KSWA 4JRKA 3CBPA 1ZUUA 3G71T 3CMEA 9ATCB 2K2VA 4IIMA 4ZN1A 3HSBA 1M1KR 1OZ3A 4DEXA 2L8DA 1VQOT 2M9UA 5FRMA 5HCKA 3RNJA 4ELZC 1TH7A 3PT9A 4XTYA 5FW9A 1RUWA 1S72T 2RJEA 1MMAA 3JB9I 5KH6A 2ZCFB 4L5GA 3CC7T 2QQAA 4NL3A 3L2VA 5GAN8 2OX7A 4Y91A 3OW2S 3PIPA 2LQWA 3L42A 4B9WA 2SRCA 1IGQA 2O4XA 4JZ4A 2A37A 2CREA 3CXCA 1O75A 5LL6S 1VQ7A 1I5OB 4FCYA 1NE8A 4ZGEB 1VYTA 1D3BA 1JXOA 1YWPA 2COWA 2YUQA 2ED0A 3HRSA 2HD0A 4FU6A 4A54A 5GANh 1HK9A 2KR3A 2C0TA 1NYGA 4ZN3A 2RQWA 1YIJQ 1BYMA 1SPKA 5GAMe 2E5QA 1G2BA 2K5FA 1VQ5T 3M0QA 3QBYA 4DQ2A 1GFCA 1TSFA 1UEBA 2I0NA 4M7AE 1C6VX 1FX7A 1NJIR 4M77E 1K73R 4J5YA 1KD1R 4X9DA 4YTLA 3PMIA 3S3MA 2HEQA 4HXJA 2FZKB 1K0XA 3MHXA 3JCMc 1QVFP 4MDWA 2Y90A 4C92C 2JM8A 2DERA 2K5LA 4MZMA 5HK3A 1H92A 4C8QB 5L8RE 1QCNA 2EYQA 1YCYA 2YXYA 4LE9A 2BKDN 1YIJA 1LCKA 2A7YA 2V8JA 1VQMQ 3M54A 3G6ET 2CT3A 2VGNA 3OYNA 3HFOA 3PMTA 2KE9A 4BI8B 5CK9A 2QDLA 3U23A 1N27A 2ABLA 3JCMe 4F16A 2QTVA 5CR2A 4XTVA 2H3JA 4M78A 3UDCA 2E5KA 4QQDA 1OOTA 4M7AF 1M8VA 2D8JA 2RQUA 1UJ0A 5J3BA 5KYXA 5CKBA 4M75A 1WFWA 2ROTA 1JRIA 4TVRA 4FYYB 2LTOA 4O6JA 3VKIA 3J81E 2B8AA 4M7DB 3ASKA 4JS4A 1QP3A 4BB7A 2A28A 1NLPC 1I0CA 2AIRB 2PUOB 2CP7A 1GRIA 1V76A 1VQ6T 2HZYA 4Q5WA 1YI2Q 2NWMA 1OYXA 2J06A 4C8QD 3VS7A 2PUKB 2OTLT 1FMVA 3VS4A 5LJ5e 1NG2A 2LX9A 2RQRA 2FO0A 2ZPFB 4FYWB 4Z89A 1T3SA 2QA4T 1PRLC 1YJNA 2DYBA 4J8OA 3S6WA 1K4US 1ZHIA 1ZX6A 2DEQA 3H6ZA 2DAQA 2Y4XA 2CZ7B 3I35A 1Q82U 1Y96A 2HQEA 5GAMd 4HCCA 2L5QA 1VQLQ 4HVUA 2L3SA 3H0IA 2ZPHB 1FYNA 4JLGA 4CI0C 5D6XA 4NL2A 4V2SA 1NEGA 2L89A 3V8KA 2E64A 1EX4A 2E3HA 4DBFA 1SHFA 3QJYA 3HKSA 3ULRB 1YITT 3D7SB 3OB9A 1RADB 1UG1A 4FW2A 1K8AR 1ZSZC 3VS5A 2RHIA 2JUFA 2CT4A 2AZSA 1MNDA 3ZL7C 1M3BA 3V7RA 4F7UG 1KHIA 1BBZA 3SB2A 4DBQA 1E7OA 5GAMj 4FT2A 2P0KA 4OVAA 2LJ1A 5LJ3e 3CCUQ 2BE9B 5GAN5 4FYVB 1Q82C 1VQLA 3L2RA 3GNGA 3E19A 3MEVA 3OYFA 2LT4A 2QQRA 2XK0A 4DEYA 1KQ2A 1U06A 1UFFA 1VQ8Q 2KT8A 2O2OA 3BDLA 2X4WA 1QQJA 5KYWA 3L1AA 5FWBA 2RI3A 3PTAA 2OTJA 1ZA2B 4XU1A 1UHCA 3V7CA 3CCRT 1TUGB 5A0LA 3JCMd 1XNIA 2MAMA 2FPDA 5AYFA 1YHQT 2ZPIB 3VS0A 2LC4A 1PM3A 2PTKA 8AT1B 1YJWA 3TSWA 2DL3A 2CYZB 3LWIA 2MOXA 2M51A 3PIOA 2V1RA 2WSFE 4IIOA 4HVWA 3RDVA 2LZ6B 2QAZA 3THKA 1TUDA 1VQ8A 5CO7A 2EGAA 5C6SA 1VQ9Q 3OYKA 1CSKA 1S1NA 3M0TA 2KBTA 2LJ3A 3QWXX 3OYCA 1Z9QA 1Q81R 3R6OA 3X25B 1GFDA 5A2QE 2K5IA 5KE2A 2K9GA 5IHKA 3SD4A 1ABOA 2EJGA 4IUPA 2DIQA 2R58A 2EYWA 3PVLA 2OAUA 1VQ4Q 1GXIE 1JU5C 2F5TX 1KC8U 4KH1B 2HQXA 5D6YA 1K9AA 4Z02A 2HBWA 3MP1A 2DIGA 1D1CA 5M9OA 5DLOA 4M7AA 1N9RA 4BE2A 2R5MA 5J39A 2IG0A 1RABB 2J05A 2PVOB 2C06A 4A4EA 4P5NA 4M77A 2RF0A 1VQ9A 2KRNA 3T9NA 2LCSA 2J6OA 1D1BA
chains in the Genus database with same CATH topology
3R6NA 5GJWB 3JV3A 2DE0X 2FG0A 1U3OA 3PVQA 1X2KA 1X69A 1OPKA 4RTWA 4AFZC 1BB9A 2YSQA 1SRMA 2DL7A 5IHIA 1N5ZA 4GBQA 2DX1A 4EIKA 3VS3A 1AVZC 2K7AA 3UA6A 4AG1C 1AWJA 1YCSB 4RTZA 2FRWA 1NM7A 2H8HA 4RTUA 1M3CA 3SEMA 2JS0A 4CC3A 2LNHB 2KYBA 1RLPC 1T0HA 1WI7A 1WYXA 1WXTA 2JT4A 2D1XA 2VWFA 4JJCA 1W6XA 4LUEA 1NLOC 2EVRA 2GBQA 2ECZA 2EYYA 2MIOA 1OEBA 4F14A 1KSWA 1WLPB 1ZUUA 4Y92A 5I11A 1JEGA 2VVKA 1X2QA 4IIMA 1AOJA 2BZ8A 2O31A 4OMOA 4LNPA 4DEXA 1AZEA 5HCKA 3RNJA 3EG3A 2KROA 5IHNA 1JXMA 3EG1A 5FW9A 1I1JA 1RUWA 1ZUKA 1JO8A 1WXBA 2C0OA 2DL8A 2JTEA 1YN8A 2L0AA 1AWXA 1Y0MA 2AKKA 1QLYA 2LQNA 1AWOA 2LQWA 2MCNA 1WIEA 2RN8A 2SRCA 1UUEA 2CSQA 1QKWA 4JZ4A 2A37A 1Z9ZA 2CREA 2G6FX 4LUDA 4K11A 2K2MA 5IH2A 3O5ZA 1VYTA 1JXOA 1M30A 1ZUYA 1YWPA 2RNAA 2YUQA 2CUBA 2ED0A 1NYFA 3M0SA 4RTYA 1HSQA 3EG2A 2KR3A 2C0TA 1NYGA 1X6BA 2RQWA 2BTTA 1SPKA 2NUZA 1MUZA 4Z88A 4X1VA 1G2BA 1RI9A 1PNJA 4HCKA 2AK5A 2DVJA 3M0QA 2A08A 2DL5A 2LMJA 4AFSC 1GFCA 3EHQA 1YP5A 1VYVA 1QCFA 2I0NA 3EG0A 3C0CA 2J6KA 2V1QA 3M0RA 1HD3A 4A63B 3H0HA 1IO6A 2HEQA 2JS2A 2K79A 4HXJA 1K0XA 4GLMA 3TSZA 2JM8A 2A36A 1FMKA 4J9GA 1YNZA 3EGUA 1H92A 2F2XA 2FPEA 4LE9A 1WXUA 2DA9A 2DBMA 2SEMA 2PNIA 1LCKA 1NEBA 2EQIA 2FEIA 1QWFA 2KYMA 2M0YA 1W70A 4CC7A 1GBRA 2CT3A 2KEAA 4QT7A 2KE9A 2OAWA 1Y57A 1AWWA 1EFNA 1PKSA 2QDLA 3U23A 3CQTA 1T0JA 2KGTA 3VS1A 1K0SA 2ABLA 2LJ0A 3LH5A 2L3PA 4RTXA 1UE9A 2ED1A 4WCIA 4F16A 1G83A 2EYZA 2X3XD 1I07A 2DJQA 2DF6A 2P4RA 2E5KA 2GGRA 4ZNXA 1OOTA 3TVTA 2OJ2A 2EGCA 2DRMA 1GCPA 2D8JA 2DNUA 2RQUA 1UJ0A 3VS6A 1T3LA 2AKLA 1WFWA 2ROTA 4LN2A 1JQQA 4RTVA 1GCQA 3UA7A 2X3WD 2JMAA 4CC2A 5EC7A 3VRYA 1V1CA 2IIMA 2L2PA 2FPFA 3M0UA 3A98A 2LP5A 2A28A 1NLPC 1UHFA 1I0CA 1GRIA 2DL4A 2NWMA 2AZVA 1OPLA 3GBQA 2K3BA 2J06A 2RQTA 4E6RA 1A0NB 2EKHA 3VS7A 1SRLA 2RQVA 3NPFA 1M27C 2YT6A 3VS4A 3EHRA 5ECAA 1ZBJA 1NG2A 3FJ5A 3I5SA 2EPDA 3H41A 2RQRA 1PWTA 3I9QA 2FO0A 3IQLA 1RLQC 1BU1A 1VYUA 1TUCA 4Z89A 1B07A 1QWEA 1T3SA 4J9BA 1PRLC 2DYBA 3VS2A 2DMOA 1CKAA 4JJDA 1K4US 2K6DA 1ZX6A 2D8HA 4OMQA 2ROLA 2CH4W 4D8KA 2J6FA 1UJYA 3H0FA 4KRTA 3I35A 3RBBB 2EYXA 2XMFA 2CH4A 2HCKA 1AD5A 4HVVA 3NGPA 1YWOA 2C0IA 2LX7A 1X43A 1XOVA 2L3SA 4HVUA 2DRKA 3H0IA 1FYNA 2DILA 1MV3A 1UDLA 2FRYA 1NEGA 4OMNA 2PZ1A 4R0KA 2O9VA 3QWYA 2CDTA 1SHFA 1E6GA 1X6GA 2RMOA 2DBKA 2GTJA 3ULRB 1W1FA 1UG1A 3VS5A 2BZXA 2YUOA 4J9CA 1WDXA 2JW4A 2YUNA 2CT4A 2AZSA 2CUDA 1U5SA 3ZL7C 1X27A 1M3BA 1BBZA 2B86A 4JZ3A 1ZSGA 1E7OA 1PHTA 3NHNA 1WX6A 2LJ1A 4Z8AA 4RTTA 3NMZC 1M3AA 2EW3A 2D0NA 4OMLA 1PRMC 2GTOA 2J7IA 1QKXA 3SHWA 3REAB 4DEYA 1U06A 1UFFA 1KIKA 2KT8A 2O2OA 4J9FA 2L3QA 5IXFA 4J9DA 2KRSA 5FWBA 4OMMA 1KFZA 1SSHA 2JMCA 1J3TA 1UHCA 2CSIA 1K1ZA 1H8KA 1VA7A 2KXCA 2KXDA 2HDAA 3VRZA 1E6HA 2RPNA 2EBPA 2FPDA 2YDLA 1UGVA 2F2WA 1HJDA 4JJBA 1MV0B 2KNBB 2ENMA 2W0ZA 3VS0A 1ZLMA 4J9IA 2YUPA 1GL5A 2O88A 2PTKA 2VKNA 2KRMA 3TSWA 1AZGB 4RUGA 2DL3A 3PE0A 1SEMA 2MOXA 2M51A 2V1RA 2EGEA 4IIOA 3M0PA 3UF4A 1ARKA 4HVWA 3I5RA 2LZ6B 3THKA 4ESRA 1UECA 4JPBW 1TUDA 1M8MA 5GJVB 4D8DA 4ORZA 4F17A 2EGAA 1KJWA 1CSKA 1S1NA 4J9HA 2F2VA 4FSSA 3M0TA 2KT1A 2OI3A 2KBTA 2LJ3A 2W10A 2DM1A 3QWXX 1Z9QA 1CKBA 1GFDA 2O9SA 4OMPA 1WA7A 4AFUC 2K9GA 1PKTA 5IHKA 1B3QA 2DLPA 1H3HA 1ABOA 1ABQA 5L23A 5FWCA 2EYWA 1AEYA 1GCQC 2HSPA 1K76A 1BK2A 1TG0A 3PVLA 3UATA 1JU5C 1SHGA 1GBQA 1K9AA 4AG2C 4CC4B 4J9EA 2JM9A 1OV3A 2HBWA 3KFVA 5IXBA 4AFQC 3REBB 2BZYA 2J05A 2ESWA 2JXBA 5I22A 1UTIA 2GQIA 2RF0A 2GNCA 2KRNA 2LCSA 2J6OA 4M4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6N A;  5GJW B;  3JV3 A;  2DE0 X;  2FG0 A;  1U3O A;  3PVQ A;  1X2K A;  1X69 A;  1OPK A;  4RTW A;  4AFZ C;  1BB9 A;  2YSQ A;  1SRM A;  2DL7 A;  5IHI A;  1N5Z A;  4GBQ A;  2DX1 A;  4EIK A;  3VS3 A;  1AVZ C;  2K7A A;  3UA6 A;  4AG1 C;  1AWJ A;  1YCS B;  4RTZ A;  2FRW A;  1NM7 A;  2H8H A;  4RTU A;  1M3C A;  3SEM A;  2JS0 A;  4CC3 A;  2LNH B;  2KYB A;  1RLP C;  1T0H A;  1WI7 A;  1WYX A;  1WXT A;  2JT4 A;  2D1X A;  2VWF A;  4JJC A;  1W6X A;  4LUE A;  1NLO C;  2EVR A;  2GBQ A;  2ECZ A;  2EYY A;  2MIO A;  1OEB A;  4F14 A;  1KSW A;  1WLP B;  1ZUU A;  4Y92 A;  5I11 A;  1JEG A;  2VVK A;  1X2Q A;  4IIM A;  1AOJ A;  2BZ8 A;  2O31 A;  4OMO A;  4LNP A;  4DEX A;  1AZE A;  5HCK A;  3RNJ A;  3EG3 A;  2KRO A;  5IHN A;  1JXM A;  3EG1 A;  5FW9 A;  1I1J A;  1RUW A;  1ZUK A;  1JO8 A;  1WXB A;  2C0O A;  2DL8 A;  2JTE A;  1YN8 A;  2L0A A;  1AWX A;  1Y0M A;  2AKK A;  1QLY A;  2LQN A;  1AWO A;  2LQW A;  2MCN A;  1WIE A;  2RN8 A;  2SRC A;  1UUE A;  2CSQ A;  1QKW A;  4JZ4 A;  2A37 A;  1Z9Z A;  2CRE A;  2G6F X;  4LUD A;  4K11 A;  2K2M A;  5IH2 A;  3O5Z A;  1VYT A;  1JXO A;  1M30 A;  1ZUY A;  1YWP A;  2RNA A;  2YUQ A;  2CUB A;  2ED0 A;  1NYF A;  3M0S A;  4RTY A;  1HSQ A;  3EG2 A;  2KR3 A;  2C0T A;  1NYG A;  1X6B A;  2RQW A;  2BTT A;  1SPK A;  2NUZ A;  1MUZ A;  4Z88 A;  4X1V A;  1G2B A;  1RI9 A;  1PNJ A;  4HCK A;  2AK5 A;  2DVJ A;  3M0Q A;  2A08 A;  2DL5 A;  2LMJ A;  4AFS C;  1GFC A;  3EHQ A;  1YP5 A;  1VYV A;  1QCF A;  2I0N A;  3EG0 A;  3C0C A;  2J6K A;  2V1Q A;  3M0R A;  1HD3 A;  4A63 B;  3H0H A;  1IO6 A;  2HEQ A;  2JS2 A;  2K79 A;  4HXJ A;  1K0X A;  4GLM A;  3TSZ A;  2JM8 A;  2A36 A;  1FMK A;  4J9G A;  1YNZ A;  3EGU A;  1H92 A;  2F2X A;  2FPE A;  4LE9 A;  1WXU A;  2DA9 A;  2DBM A;  2SEM A;  2PNI A;  1LCK A;  1NEB A;  2EQI A;  2FEI A;  1QWF A;  2KYM A;  2M0Y A;  1W70 A;  4CC7 A;  1GBR A;  2CT3 A;  2KEA A;  4QT7 A;  2KE9 A;  2OAW A;  1Y57 A;  1AWW A;  1EFN A;  1PKS A;  2QDL A;  3U23 A;  3CQT A;  1T0J A;  2KGT A;  3VS1 A;  1K0S A;  2ABL A;  2LJ0 A;  3LH5 A;  2L3P A;  4RTX A;  1UE9 A;  2ED1 A;  4WCI A;  4F16 A;  1G83 A;  2EYZ A;  2X3X D;  1I07 A;  2DJQ A;  2DF6 A;  2P4R A;  2E5K A;  2GGR A;  4ZNX A;  1OOT A;  3TVT A;  2OJ2 A;  2EGC A;  2DRM A;  1GCP A;  2D8J A;  2DNU A;  2RQU A;  1UJ0 A;  3VS6 A;  1T3L A;  2AKL A;  1WFW A;  2ROT A;  4LN2 A;  1JQQ A;  4RTV A;  1GCQ A;  3UA7 A;  2X3W D;  2JMA A;  4CC2 A;  5EC7 A;  3VRY A;  1V1C A;  2IIM A;  2L2P A;  2FPF A;  3M0U A;  3A98 A;  2LP5 A;  2A28 A;  1NLP C;  1UHF A;  1I0C A;  1GRI A;  2DL4 A;  2NWM A;  2AZV A;  1OPL A;  3GBQ A;  2K3B A;  2J06 A;  2RQT A;  4E6R A;  1A0N B;  2EKH A;  3VS7 A;  1SRL A;  2RQV A;  3NPF A;  1M27 C;  2YT6 A;  3VS4 A;  3EHR A;  5ECA A;  1ZBJ A;  1NG2 A;  3FJ5 A;  3I5S A;  2EPD A;  3H41 A;  2RQR A;  1PWT A;  3I9Q A;  2FO0 A;  3IQL A;  1RLQ C;  1BU1 A;  1VYU A;  1TUC A;  4Z89 A;  1B07 A;  1QWE A;  1T3S A;  4J9B A;  1PRL C;  2DYB A;  3VS2 A;  2DMO A;  1CKA A;  4JJD A;  1K4U S;  2K6D A;  1ZX6 A;  2D8H A;  4OMQ A;  2ROL A;  2CH4 W;  4D8K A;  2J6F A;  1UJY A;  3H0F A;  4KRT A;  3I35 A;  3RBB B;  2EYX A;  2XMF A;  2CH4 A;  2HCK A;  1AD5 A;  4HVV A;  3NGP A;  1YWO A;  2C0I A;  2LX7 A;  1X43 A;  1XOV A;  2L3S A;  4HVU A;  2DRK A;  3H0I A;  1FYN A;  2DIL A;  1MV3 A;  1UDL A;  2FRY A;  1NEG A;  4OMN A;  2PZ1 A;  4R0K A;  2O9V A;  3QWY A;  2CDT A;  1SHF A;  1E6G A;  1X6G A;  2RMO A;  2DBK A;  2GTJ A;  3ULR B;  1W1F A;  1UG1 A;  3VS5 A;  2BZX A;  2YUO A;  4J9C A;  1WDX A;  2JW4 A;  2YUN A;  2CT4 A;  2AZS A;  2CUD A;  1U5S A;  3ZL7 C;  1X27 A;  1M3B A;  1BBZ A;  2B86 A;  4JZ3 A;  1ZSG A;  1E7O A;  1PHT A;  3NHN A;  1WX6 A;  2LJ1 A;  4Z8A A;  4RTT A;  3NMZ C;  1M3A A;  2EW3 A;  2D0N A;  4OML A;  1PRM C;  2GTO A;  2J7I A;  1QKX A;  3SHW A;  3REA B;  4DEY A;  1U06 A;  1UFF A;  1KIK A;  2KT8 A;  2O2O A;  4J9F A;  2L3Q A;  5IXF A;  4J9D A;  2KRS A;  5FWB A;  4OMM A;  1KFZ A;  1SSH A;  2JMC A;  1J3T A;  1UHC A;  2CSI A;  1K1Z A;  1H8K A;  1VA7 A;  2KXC A;  2KXD A;  2HDA A;  3VRZ A;  1E6H A;  2RPN A;  2EBP A;  2FPD A;  2YDL A;  1UGV A;  2F2W A;  1HJD A;  4JJB A;  1MV0 B;  2KNB B;  2ENM A;  2W0Z A;  3VS0 A;  1ZLM A;  4J9I A;  2YUP A;  1GL5 A;  2O88 A;  2PTK A;  2VKN A;  2KRM A;  3TSW A;  1AZG B;  4RUG A;  2DL3 A;  3PE0 A;  1SEM A;  2MOX A;  2M51 A;  2V1R A;  2EGE A;  4IIO A;  3M0P A;  3UF4 A;  1ARK A;  4HVW A;  3I5R A;  2LZ6 B;  3THK A;  4ESR A;  1UEC A;  4JPB W;  1TUD A;  1M8M A;  5GJV B;  4D8D A;  4ORZ A;  4F17 A;  2EGA A;  1KJW A;  1CSK A;  1S1N A;  4J9H A;  2F2V A;  4FSS A;  3M0T A;  2KT1 A;  2OI3 A;  2KBT A;  2LJ3 A;  2W10 A;  2DM1 A;  3QWX X;  1Z9Q A;  1CKB A;  1GFD A;  2O9S A;  4OMP A;  1WA7 A;  4AFU C;  2K9G A;  1PKT A;  5IHK A;  1B3Q A;  2DLP A;  1H3H A;  1ABO A;  1ABQ A;  5L23 A;  5FWC A;  2EYW A;  1AEY A;  1GCQ C;  2HSP A;  1K76 A;  1BK2 A;  1TG0 A;  3PVL A;  3UAT A;  1JU5 C;  1SHG A;  1GBQ A;  1K9A A;  4AG2 C;  4CC4 B;  4J9E A;  2JM9 A;  1OV3 A;  2HBW A;  3KFV A;  5IXB A;  4AFQ C;  3REB B;  2BZY A;  2J05 A;  2ESW A;  2JXB A;  5I22 A;  1UTI A;  2GQI A;  2RF0 A;  2GNC A;  2KRN A;  2LCS A;  2J6O A;  4M4Z A; 
#chains in the Genus database with same CATH topology
 2RI2 A;  5GJW B;  2PVD B;  2P0P A;  3TEE A;  3CCJ T;  2DXT A;  2CGH A;  2DE0 X;  3LLR A;  5I2S A;  4C8Q G;  2YSQ A;  5KCO A;  2FZG B;  1N5Z A;  3CCS A;  1Q7Y U;  1IGU A;  2RHU A;  1UGQ B;  3EFS A;  1P92 A;  4EDU A;  1AVZ C;  4AG1 C;  2K3X A;  1YCS B;  1TOV A;  2DK3 A;  2H8H A;  5CKF A;  4EPC A;  4HCZ A;  1RLP C;  3CCV T;  1WI7 A;  4JDS A;  2RA2 A;  1ZBX A;  4JJC A;  4XU2 A;  3HHT B;  1W6X A;  4ZGD B;  3A8H B;  5CAI A;  2XI9 A;  1KC8 C;  2ECZ A;  2MIO A;  3I55 Q;  4F14 A;  1WLP B;  4Y92 A;  4JRQ A;  4PJO B;  1IB8 A;  5I11 A;  2VVK A;  1X2Q A;  3EG9 B;  1YJN T;  4LNP A;  1XQH A;  5LJ3 d;  1M90 U;  3INZ A;  2KRO A;  1JXM A;  2MWP A;  1PD1 A;  2JTF A;  1WXB A;  3CD6 T;  2JTE A;  7AT1 B;  1YN8 A;  2AKK A;  1QLY A;  1VQP T;  3SDZ A;  1PSE A;  2MCN A;  1WIE A;  1UUE A;  1Q7Y C;  2CSQ A;  1QKW A;  3CC2 T;  2XG8 D;  4OB1 B;  4M7D G;  3KUF A;  3O5Z A;  1H64 1;  1QVF S;  1D1A A;  4KUD K;  3EGD B;  1OQK A;  3M0S A;  4RTY A;  1EZZ B;  3EGX A;  1G8X A;  5LJ3 j;  3I55 A;  4JRP A;  3FB9 A;  3E9F A;  2EWN A;  4C8Q E;  2NUZ A;  1G3S A;  2QEX Q;  4Z88 A;  5GAO l;  4D6W A;  2DVJ A;  2NUP A;  2DL5 A;  1I8F A;  1M90 C;  2LMJ A;  4X9C A;  1Y07 A;  5KYY B;  3CC4 T;  1M1K U;  1QCF A;  4PFP A;  5GAM f;  2VB6 A;  3M0R A;  2KSS A;  5FU7 C;  4KGV B;  3RUX A;  4A63 B;  3J80 E;  3H0H A;  4C92 G;  2MI6 A;  2R5A A;  3AT1 B;  4GLM A;  2DFU A;  4PJO D;  1HYO A;  2M0O A;  3TSZ A;  4LDY A;  4F7U B;  1FMK A;  4LDU A;  3OYA A;  4BD3 A;  3GIB A;  2F2X A;  3HPW A;  2OTJ T;  2QYZ A;  1WXU A;  2LNV A;  2LCC A;  2O01 E;  3OS5 A;  3C12 A;  2QEX A;  2EQI A;  4AT1 B;  1QWF A;  1IZ6 A;  2M0Y A;  5HY6 A;  2OAW A;  1PKS A;  4C5H A;  1TS9 A;  1YJW T;  2KGT A;  1Q86 U;  3CPW S;  1M1K C;  2DXB A;  4C8Q F;  3QDR B;  4RTX A;  2XHC A;  3G4S T;  4WCI A;  1QW1 A;  3E2U A;  4QVC A;  2IVW A;  1G83 A;  3DB3 A;  1I07 A;  1UGS B;  3L2W A;  5C0M A;  3JRZ A;  1K73 U;  2DF6 A;  1VQ8 T;  1TU0 B;  1VIE A;  2DRM A;  3JCM f;  3CEY A;  4IUU A;  4PKC C;  2F69 A;  4XTX A;  3QJ6 A;  1MNE A;  1FWZ A;  1T3L A;  3UPU A;  3SWN B;  2AKL A;  4RTV A;  4LN2 A;  1VQN T;  4OMF B;  4IUV A;  1NBE B;  5EC7 A;  2XIC A;  1M5Q 1;  1VUB A;  4M78 B;  2DJZ A;  5GAN 7;  3A98 A;  3OMC A;  2LP5 A;  1UHF A;  2X35 A;  3L2Q A;  2YHT A;  1Q86 C;  1VOM A;  4E47 A;  3OYB A;  1Y71 A;  2AZV A;  5KYX B;  1BCM A;  4C0F A;  2K3Y A;  2KK4 A;  3A8L B;  3GBQ A;  4FM4 B;  4E6R A;  4M75 B;  4LD9 K;  5ECA A;  3GOX A;  3FJ5 A;  1K73 C;  2EKO A;  1YJ9 T;  2QK0 A;  1BU1 A;  1VYU A;  5FU6 B;  3BDU A;  3UWN A;  4VUB A;  4J9B A;  3VS2 A;  2DMO A;  3BW1 A;  1BI3 A;  5LJ5 f;  2K6D A;  3RKY A;  3CCQ Q;  1K9M R;  3OSS C;  4OMQ A;  3CCS T;  5GAO p;  2J6F A;  1UJY A;  4E7Z A;  3H0F A;  2RHZ A;  3JCM W;  4KRT A;  3RBB B;  2XMF A;  2HCK A;  1QVF A;  1AD5 A;  2I2L A;  2BE7 D;  3NGP A;  3MET A;  3S3O A;  2FYK A;  4ELY C;  2KQW A;  2XID A;  2DIL A;  1MV3 A;  3HRU A;  4QVZ A;  1UDL A;  3M58 A;  1XTD A;  2RHX A;  2X9H A;  4OMN A;  3QWY A;  3M4Y A;  2HKQ B;  3JB9 J;  3EH1 A;  4MZT A;  2LT1 A;  2RMO A;  2DBK A;  5GAN 2;  1WNL A;  4LDV A;  5IT9 E;  4DOV A;  4C0G A;  5KYU B;  1Y96 B;  1X01 A;  2GF7 A;  3KXT A;  3CCE Q;  2NUT A;  4M78 D;  1XJW B;  2JW4 A;  4BAC A;  2YUN A;  5IAY A;  3MEW A;  2CUD A;  1U5S A;  2GCX A;  2XDP A;  1OX9 A;  3TU4 K;  2B86 A;  3O8V A;  3CCM Q;  3NHN A;  5GMK j;  3DLL A;  1WX6 A;  2E3I A;  4M75 D;  3HL8 A;  2CP6 A;  3VYH B;  3PNW C;  1MMN A;  3L2Z A;  1M3A A;  2EW3 A;  2D0N A;  2EAY A;  2A3L A;  1PRM C;  4OB2 B;  2XU8 A;  3SHW A;  1OX8 A;  4M77 F;  3KBG A;  2M1H A;  5LJ3 f;  1RAG B;  2L3Q A;  1M9S A;  2YRC A;  5IXF A;  5CVI A;  2KRS A;  1KFZ A;  1VQM A;  1SSH A;  4M7A C;  1VA7 A;  2KXC A;  2KAF A;  2HDA A;  3VRZ A;  1E6H A;  4C0D C;  4M77 C;  2JOY A;  2RPN A;  2VGM A;  2R57 A;  3CCE A;  2YDL A;  1UGV A;  3X28 B;  3HRT A;  3CPW A;  4E7S A;  3CPF A;  1JBM A;  4XTU A;  2KNB B;  1RL2 A;  4PJO G;  3C94 A;  3CPW P;  2LQK A;  3P8B B;  5GAO q;  2HAX A;  4MZP A;  1ZLM A;  2O88 A;  3JB9 D;  2VKN A;  3CCM A;  3ZBD A;  3OS1 A;  4PJN A;  3OYG A;  4XK8 E;  5KYW B;  1BCO A;  1MMD A;  5GAM g;  3I56 Q;  1ARK A;  3CCL Q;  2FHD A;  3RR6 A;  2COY A;  2XDD A;  4XTZ A;  1M2V B;  4JPB W;  3TCJ A;  4R56 A;  1N8R U;  2YLB A;  5GJV B;  1R77 A;  1YFN A;  1KJW A;  4C5G A;  4C92 B;  5CIU A;  1IRX A;  4R55 A;  2OI3 A;  4KBM B;  1X6O A;  4DOW A;  4QW2 A;  1CKB A;  2YWW A;  1R0C B;  1WA7 A;  2QGF B;  2V26 A;  2DLP A;  4L6V 5;  4EMG A;  4C8Q A;  4KT0 E;  1YI2 A;  3BE3 A;  1PCX A;  1K8A C;  3QSU A;  1SHG A;  1VQK T;  3I56 A;  3CMA Q;  4LDX A;  4CC4 B;  3CME T;  3CCL A;  4RCC A;  1PC0 A;  1OU8 A;  2JNG A;  4C5E A;  4PJL A;  2CP5 A;  2BZY A;  2M02 A;  5CKH A;  4M7D D;  2DPP B;  1BI1 A;  3CBO A;  3QUI A;  2DTH A;  5GAM h;  1N8R C;  2YLC A;  3H9N A;  1PD0 A;  1B34 A;  1U3O A;  2FG0 A;  1X2K A;  3PVQ A;  1X69 A;  4RTW A;  4GLK A;  1BB9 A;  1WHM A;  2DL7 A;  4N4H A;  2V8K A;  4E7I A;  1G3T A;  1FXX A;  3MP6 A;  1VQ7 T;  3VS3 A;  3UA6 A;  2VYT A;  1AWJ A;  1BI2 A;  4RTZ A;  1NM7 A;  3JCM V;  4RTU A;  3SEM A;  2JS0 A;  2LNH B;  4HT8 A;  2DYI A;  2D1X A;  2E41 A;  2QDY B;  3FIF A;  8ATC B;  1I81 A;  2CP0 A;  5CKE A;  4C92 D;  4XTW A;  5GMK l;  2EQM A;  4ATO A;  1EIF A;  2BZ8 A;  2O31 A;  4OMO A;  1BIA A;  3A8G B;  2DTO A;  3G71 Q;  2ATC B;  5IHN A;  2DTI A;  3EG1 A;  2JTM A;  1I1J A;  1ZUK A;  2D9T A;  1JO8 A;  2C0O A;  1VQO Q;  3BY7 A;  2DD4 A;  3M53 A;  1AWX A;  1Q82 R;  3CCU A;  4ZTF A;  2LQN A;  4BDZ A;  1AWO A;  1S72 Q;  5DM7 R;  4KGX B;  2X4X A;  3JCM h;  4RG8 A;  1Z9Z A;  2E6N A;  3CC7 Q;  4LUD A;  4K11 A;  1UGR B;  2DXU A;  3P8D A;  3ZFJ A;  3E1S A;  4Y28 E;  5IH2 A;  4M78 G;  4WTO B;  2AT1 B;  1QMC A;  3SFM A;  3NFC A;  3OY9 A;  2RNA A;  1IHV A;  4A4K A;  1YIJ T;  2CUB A;  3EG2 A;  4F7U E;  6AT1 B;  1X6B A;  3VU3 C;  1N9S A;  2BTT A;  3QG1 A;  3QXE B;  4KUL A;  3LGL A;  2NYS A;  4BDY A;  3MEU A;  4M75 G;  2X51 A;  4RCB A;  4OGC A;  3G71 A;  1RI9 A;  4HCK A;  4J83 A;  1BI0 A;  2A08 A;  4DBH A;  5LJ5 d;  3EHQ A;  2DXC A;  3OSV A;  3LWH A;  1YP5 A;  1ZSZ B;  1VYV A;  1VQ5 Q;  4N0A C;  3C0C A;  1MMG A;  3OYI A;  1S72 A;  2VXE A;  3DB4 A;  1HD3 A;  3EGX B;  2RO0 A;  5FRO A;  2M16 A;  4FT4 A;  2JS2 A;  3OYY A;  3CC7 A;  4ZGJ B;  4LDW A;  2ZPB B;  3M9Q A;  3GLX A;  2JVV A;  2AHJ B;  2A0F B;  2LRQ A;  3RER A;  1YNZ A;  3EGU A;  1VQM T;  3OA6 A;  3DLM A;  3JB9 G;  2H3E B;  1MGQ A;  2DBM A;  2DA9 A;  2PNI A;  1R0B G;  3JCM J;  5LJ5 j;  3M59 A;  5LJ3 g;  1AHJ B;  2KYM A;  4MML A;  4CC7 A;  1GBR A;  1IXD A;  2KEA A;  5A0G A;  2E6Z A;  4JRI A;  1SF9 A;  4B9X A;  5GAN 4;  4XU0 A;  1Y57 A;  3VUZ A;  1NPR A;  1EFN A;  4A4H A;  4A4F A;  4BY6 C;  3G6E Q;  1VQ5 A;  1MHN A;  1WGS A;  1RAI B;  1VQ4 A;  4O5V A;  4F7U F;  1T0J A;  3VS1 A;  2DEU A;  1VIF A;  2LJ0 A;  3LH5 A;  1LNX A;  2L3P A;  1B7T A;  1WQW A;  1QVP A;  3L2U A;  2DJQ A;  1NPP A;  3C4S A;  2P4R A;  2GGR A;  1BIB A;  2OJ2 A;  2EGC A;  2XKO C;  5GAN e;  2MWO A;  3NTI A;  1QVG P;  1X75 C;  3QYH B;  3VS6 A;  4N4I A;  1QP2 A;  3QDF A;  5GAO n;  4QVD A;  1JQQ A;  2X3W D;  2JMA A;  2GFU A;  3VRY A;  4JJN K;  5HKC A;  1ZA1 B;  4EMK C;  3M0U A;  2VUB A;  1YI2 T;  4HCB A;  3JCM Q;  1KHC A;  1SKU B;  5LJ3 h;  1KC8 R;  1OU9 A;  2KVQ G;  1OPL A;  1WHJ A;  1A0N B;  2E1H A;  3GP8 A;  3BFM A;  2EKH A;  3RMQ A;  2RQV A;  1LVK A;  4OP0 A;  1VQ6 Q;  1M27 C;  2YT6 A;  3EHR A;  1ZBJ A;  3I5S A;  2V8I A;  3I9Q A;  2O4X B;  2OTL Q;  3WVE B;  3C95 A;  2KMT A;  5GAO m;  1TUC A;  2ZPE B;  1B07 A;  2Y4Y A;  3VYG A;  1WPY A;  1KQ1 A;  2QI2 A;  3FRN A;  4JJD A;  1D3B B;  4PNO A;  1Q7Y R;  3VUB A;  2CH4 W;  4D8K A;  2QA4 Q;  3TQ7 P;  4PK4 A;  1Y7X A;  5IN1 A;  1VQL T;  3JB9 H;  3H8Z A;  1WZO A;  4HVV A;  3MJX A;  1YWO A;  2C0I A;  3OBW A;  2LX7 A;  2RI5 A;  3JCM P;  1XOV A;  3M55 A;  2FRY A;  3G1J A;  1VQ6 A;  4IUQ A;  1E6G A;  1OI1 A;  1X6G A;  1KQS P;  2GTJ A;  1M90 R;  4PFZ A;  2OTL A;  1PSF A;  1W1F A;  1D0Y A;  1W2B S;  2E10 A;  3OS2 A;  2K57 A;  2COZ A;  1KG1 A;  2BZX A;  2DO3 A;  2EQU A;  2HQH A;  3RMS A;  5GAN 6;  4M7D E;  3JB9 F;  1YIT Q;  4OB3 B;  5GAO r;  3LGF A;  4AMC A;  3CCU T;  1ZSG A;  3M57 A;  1PHT A;  1K9M U;  3HP9 A;  3EH2 A;  2L3R A;  3EG9 A;  1NJI U;  4PL6 A;  4Z8A A;  3JCM b;  2HL3 A;  1KD1 U;  4RTT A;  2PVG B;  4OML A;  3RIR A;  4C8Q C;  1LOJ A;  2GTO A;  3A1P A;  3UT1 A;  2XDB A;  2P84 A;  3REA B;  3OYL A;  1JJ2 A;  4M7A G;  3LW5 E;  4OF1 A;  2WSC E;  1KIK A;  3EFO A;  4J9D A;  1JJ2 P;  4OMM A;  2JMC A;  5I2M A;  4N0A A;  1K1Z A;  4C92 E;  3FJP A;  2EJ9 A;  1HJD A;  4JJB A;  4QKU A;  1MV0 B;  1UB4 A;  3CCR Q;  2QQB A;  1YIT A;  2MK5 A;  2X4J A;  2ENM A;  2RJD A;  3EGD A;  3HFN A;  1W4S A;  4J9I A;  2YUP A;  3JCM X;  1GL5 A;  2GQV A;  5GAN d;  3M5A A;  1YHQ Q;  2KRM A;  1AZG B;  4RUG A;  3G7Z A;  5KCH A;  1SEM A;  3FC3 A;  1K9M C;  3OMG A;  2HMA A;  2VV5 A;  3UF4 A;  3N5B B;  1M1G A;  4M7D F;  1NJI C;  4E7L A;  1KD1 C;  5FU7 B;  4ESR A;  1VQ9 T;  2EIF A;  2BIV A;  4FYX B;  5KYY A;  3ZEH A;  3CXC P;  1M8M A;  4F17 A;  4ORZ A;  3J7A F;  4JUV A;  4M7D C;  4J9H A;  1DJ7 B;  2F2V A;  4HT9 A;  1FMW A;  5EG2 A;  2DM1 A;  3LYI A;  1WJS A;  1D0X A;  3JSC A;  3CCR A;  5GAN j;  1WHK A;  1PKT A;  1Q86 R;  1VQ4 T;  1B3Q A;  3MP8 A;  4F7U A;  3NTH A;  4ME7 A;  1ABQ A;  4A4G A;  5L23 A;  4PJJ A;  1YHQ A;  1AEY A;  1GCQ C;  2HSP A;  1K76 A;  1BK2 A;  1TG0 A;  4C92 F;  3M56 A;  4AG2 C;  2JM9 A;  3KFV A;  5IXB A;  4AFQ C;  1M1F A;  2ESW A;  4KH0 B;  2G3R A;  4J7F A;  3WVD B;  4EMK A;  4HA8 A;  3CCQ A;  2VAS A;  2CZ0 B;  5GMK h;  3JV3 A;  3QPH A;  3QYG B;  5HK0 A;  2HNI A;  2RHY A;  2VC8 A;  2VXF A;  3ER0 A;  1SSF A;  2QTX A;  3OS0 A;  4AFZ C;  4BE0 A;  2ZPG B;  4RG2 A;  4GBQ A;  2DX1 A;  3CCJ Q;  4EIK A;  2PU9 B;  1ACM B;  4J6X A;  1NZ9 A;  2FRW A;  1YBY A;  1D0Z A;  4JS5 A;  1M3C A;  4CC3 A;  1RAH B;  2KYB A;  3SWN A;  1T0H A;  4NOY A;  2VWF A;  3I55 T;  2DZC A;  4LUE A;  1W2B A;  1NLO C;  2GBQ A;  1M4Z A;  3CCV Q;  1B34 B;  1W2B P;  1JEG A;  1AOJ A;  3A5Z B;  1AZE A;  3EG3 A;  4E2F B;  4QQ6 A;  1K8A U;  1WJQ A;  1YJN Q;  2WSE E;  2DL8 A;  3URG A;  4DBR A;  3V8J A;  2L0A A;  4C5I A;  3CCJ A;  1Y0M A;  4C0Z A;  3TRE A;  3CD6 Q;  2RN8 A;  2RD1 A;  2ZGW A;  2CP2 A;  1TTH B;  3QKJ A;  2CZ1 B;  1I5L A;  2G6F X;  2K2M A;  1VQP Q;  3HTR A;  4CRI A;  3CC2 Q;  1M30 A;  1ZUY A;  4ANJ A;  3OYE A;  2E12 A;  1NYF A;  2FZC B;  3CCV A;  1HSQ A;  2QEX T;  2NLU A;  2LDM A;  1H3Z A;  1MUZ A;  3FEO A;  2EFI A;  2QQS A;  1WHG A;  3LX7 A;  4KUI A;  4X1V A;  5AT1 B;  1PNJ A;  2AK5 A;  5D6W A;  1QCO A;  1G3W A;  4AFS C;  3OW2 A;  3EG0 A;  2J6K A;  3OW2 P;  2V1Q A;  1G3Y A;  4BUG A;  3A8M B;  1SG5 A;  3CD6 A;  3CC4 Q;  2JN0 A;  1IO6 A;  5GMK i;  2K79 A;  5KYU A;  2CS7 A;  1VQP A;  2RJC A;  4J7I A;  2K4Y A;  4LXC A;  3CC2 A;  2A36 A;  4PJO E;  4J9G A;  4BE1 A;  1U1T A;  2FPE A;  1M2O A;  1QVG S;  4N4G A;  3JCM g;  4RMO A;  2SEM A;  3S3N A;  4IUR A;  1NEB A;  2FEI A;  2DVE A;  2OTJ Q;  1W70 A;  2LVM A;  4XAX B;  4QT7 A;  1Q81 U;  3OYJ A;  4M7A B;  4X34 A;  1AWW A;  4ZTJ A;  4C0D B;  4M77 B;  3CQT A;  5A0D A;  1K0S A;  3EFR A;  3CMA A;  3CC4 A;  1UE9 A;  2ED1 A;  1YJW Q;  2EYZ A;  2X3X D;  4LD6 A;  4M7D A;  4UC4 A;  5GMK m;  3QII A;  1N8R R;  3G4S Q;  4ZNX A;  2ZAE A;  3TVT A;  5FRN A;  4QQG A;  1GCP A;  2DNU A;  5GAN 3;  2IPO B;  2CP3 A;  3X20 B;  3AHU A;  1OZ2 A;  1WJR A;  1GCQ A;  3UA7 A;  3MEA A;  2P0Q A;  1RAA B;  3Q1J A;  3DKM A;  4CC2 A;  5GAN f;  4HKE A;  5LJ5 g;  1V1C A;  2IIM A;  2RK1 A;  4PLL A;  2L2P A;  4PJO F;  2FPF A;  1VQN Q;  1M2V A;  1Q81 C;  3X24 B;  3OYM A;  3VV0 A;  1U8R A;  2E70 A;  3F70 A;  4C92 A;  4RKU E;  2DL4 A;  1RAC B;  4NS5 A;  4PJO C;  2K3B A;  2RQT A;  3MO8 A;  1SRL A;  2CZ6 B;  3NPF A;  3G4S A;  4II1 A;  3LH0 A;  2BUD A;  2EPD A;  3H41 A;  1I4K 1;  1PWT A;  1KQS S;  3IQL A;  1RLQ C;  3CCQ T;  1BKB A;  1QWE A;  2MMP A;  4M7A D;  3RES A;  3QZ9 B;  5CCA A;  1VQO A;  1YJ9 Q;  1CKA A;  2LQ8 A;  4M77 D;  5DY9 A;  3P8H A;  2D8H A;  4J6Y A;  2ROL A;  1ZQ1 A;  5CQX A;  1D09 B;  4F04 B;  2MYS A;  1VQN A;  2EYX A;  2CH4 A;  4KGZ B;  3CCS Q;  1G5V A;  2FL7 A;  2QQ9 A;  3GNF B;  5FLX E;  1N6A A;  4OB0 B;  1X43 A;  3E9G A;  2NUP B;  2DRK A;  5LJ5 h;  2YRV A;  2D0Q B;  3MKD A;  3ME9 A;  2PZ1 A;  2MPX C;  1RAE B;  4R0K A;  2O9V A;  2CDT A;  3CCE T;  1RI0 A;  1WHH A;  1JJ2 S;  2PQW A;  1JB0 E;  2RB6 A;  5CQY A;  4MDX A;  2X4Y A;  4L59 A;  4IKF A;  4A53 A;  4GY5 A;  1Q95 G;  2EQK A;  1YJ9 A;  2YUO A;  4J9C A;  1WDX A;  1KK7 A;  4J6W A;  2P4T A;  4BI3 A;  2F1L A;  3CCM T;  4M78 E;  1HXD A;  1X27 A;  2FVU A;  3V8L A;  3QO3 A;  4JZ3 A;  1O9S A;  1TWB A;  5CKD A;  3NMZ C;  5KE3 A;  4M75 E;  1QVG A;  4PFO A;  2J7I A;  3MCA B;  4FSX A;  1QKX A;  4E7J A;  5D7U A;  5J26 A;  4EMH A;  4J9F A;  2ZZD A;  2RK2 A;  3CXC S;  2HKN A;  3GF5 A;  4E7K A;  1J3T A;  2LCL A;  2QGG A;  5I21 A;  3WXM B;  2DET A;  2CSI A;  1H8K A;  2KXD A;  3A8O B;  2QAS A;  1IHW A;  2EBP A;  2KI7 A;  1RAF B;  2F2W A;  2EJF A;  3RKW A;  3OYH A;  3G6E A;  3OBY A;  1AT1 B;  2KY9 A;  2W0Z A;  2JZ2 A;  3RKX A;  3I56 T;  3EFO B;  4DA4 A;  3PE0 A;  3NTK A;  3CCL T;  3QHS A;  2EGE A;  2E65 A;  3M0P A;  4BI4 A;  1V29 B;  2DD5 A;  3I5R A;  4M78 F;  1TXQ A;  1UEC A;  3SWN C;  3VJP A;  3V7S A;  1ZSZ A;  2WAC A;  4D8D A;  3CBM A;  2D6F A;  3PFS A;  2QG9 B;  3FDR A;  4MMK A;  3OYD A;  2HBP A;  4FSS A;  2KT1 A;  4M78 C;  2W10 A;  2XD0 A;  4M75 F;  1UGP B;  1C0M A;  2JJ9 A;  2O9S A;  4OMP A;  2DZ9 A;  5GMK e;  4AFU C;  1IRE B;  3QZ5 B;  1H3H A;  2CKK A;  3EAE A;  5FWC A;  1OUL A;  4M75 C;  3CMA T;  2DKG A;  1U1S A;  4XU3 A;  2RJF A;  2F5K A;  3UAT A;  2RH2 A;  2GFA A;  4BY6 B;  1R8O B;  3M4G A;  1GBQ A;  5DLQ E;  1KQS A;  2HL5 C;  4J9E A;  3FLG A;  1WHL A;  1OV3 A;  4FW1 A;  5FU6 C;  1LPL A;  3REB B;  1VQK Q;  2RM4 A;  3GPL A;  4JLI A;  2JXB A;  2YRD A;  3CME Q;  4E7H A;  4PLI A;  1UTI A;  3PGG A;  2E4H A;  3X26 B;  2MF2 A;  5I22 A;  4IUT A;  2GQI A;  2QXF A;  4XQ3 A;  2GNC A;  4PJM A;  4FIB A;  5KYN A;  4M4Z A;  3R6N A;  2QA4 A;  4FL6 A;  4WF2 A;  1OPK A;  1SRM A;  5IHI A;  4PJO A;  4B6M A;  2HSE B;  2K7A A;  5GAN g;  2EQJ A;  1C1A A;  1PG5 B;  4OGE A;  1F1B B;  2NUT B;  3MPU B;  1VQ7 Q;  1LJO A;  1WYX A;  2JT4 A;  1WXT A;  2FB7 A;  4EMK B;  1WQ7 A;  3OQ5 A;  4M77 G;  2Z0W A;  2KDS A;  2EVR A;  3JAM E;  1VQK A;  2EYY A;  1OEB A;  1KSW A;  4JRK A;  3CBP A;  1ZUU A;  3G71 T;  3CME A;  9ATC B;  2K2V A;  4IIM A;  4ZN1 A;  3HSB A;  1M1K R;  1OZ3 A;  4DEX A;  2L8D A;  1VQO T;  2M9U A;  5FRM A;  5HCK A;  3RNJ A;  4ELZ C;  1TH7 A;  3PT9 A;  4XTY A;  5FW9 A;  1RUW A;  1S72 T;  2RJE A;  1MMA A;  3JB9 I;  5KH6 A;  2ZCF B;  4L5G A;  3CC7 T;  2QQA A;  4NL3 A;  3L2V A;  5GAN 8;  2OX7 A;  4Y91 A;  3OW2 S;  3PIP A;  2LQW A;  3L42 A;  4B9W A;  2SRC A;  1IGQ A;  2O4X A;  4JZ4 A;  2A37 A;  2CRE A;  3CXC A;  1O75 A;  5LL6 S;  1VQ7 A;  1I5O B;  4FCY A;  1NE8 A;  4ZGE B;  1VYT A;  1D3B A;  1JXO A;  1YWP A;  2COW A;  2YUQ A;  2ED0 A;  3HRS A;  2HD0 A;  4FU6 A;  4A54 A;  5GAN h;  1HK9 A;  2KR3 A;  2C0T A;  1NYG A;  4ZN3 A;  2RQW A;  1YIJ Q;  1BYM A;  1SPK A;  5GAM e;  2E5Q A;  1G2B A;  2K5F A;  1VQ5 T;  3M0Q A;  3QBY A;  4DQ2 A;  1GFC A;  1TSF A;  1UEB A;  2I0N A;  4M7A E;  1C6V X;  1FX7 A;  1NJI R;  4M77 E;  1K73 R;  4J5Y A;  1KD1 R;  4X9D A;  4YTL A;  3PMI A;  3S3M A;  2HEQ A;  4HXJ A;  2FZK B;  1K0X A;  3MHX A;  3JCM c;  1QVF P;  4MDW A;  2Y90 A;  4C92 C;  2JM8 A;  2DER A;  2K5L A;  4MZM A;  5HK3 A;  1H92 A;  4C8Q B;  5L8R E;  1QCN A;  2EYQ A;  1YCY A;  2YXY A;  4LE9 A;  2BKD N;  1YIJ A;  1LCK A;  2A7Y A;  2V8J A;  1VQM Q;  3M54 A;  3G6E T;  2CT3 A;  2VGN A;  3OYN A;  3HFO A;  3PMT A;  2KE9 A;  4BI8 B;  5CK9 A;  2QDL A;  3U23 A;  1N27 A;  2ABL A;  3JCM e;  4F16 A;  2QTV A;  5CR2 A;  4XTV A;  2H3J A;  4M78 A;  3UDC A;  2E5K A;  4QQD A;  1OOT A;  4M7A F;  1M8V A;  2D8J A;  2RQU A;  1UJ0 A;  5J3B A;  5KYX A;  5CKB A;  4M75 A;  1WFW A;  2ROT A;  1JRI A;  4TVR A;  4FYY B;  2LTO A;  4O6J A;  3VKI A;  3J81 E;  2B8A A;  4M7D B;  3ASK A;  4JS4 A;  1QP3 A;  4BB7 A;  2A28 A;  1NLP C;  1I0C A;  2AIR B;  2PUO B;  2CP7 A;  1GRI A;  1V76 A;  1VQ6 T;  2HZY A;  4Q5W A;  1YI2 Q;  2NWM A;  1OYX A;  2J06 A;  4C8Q D;  3VS7 A;  2PUK B;  2OTL T;  1FMV A;  3VS4 A;  5LJ5 e;  1NG2 A;  2LX9 A;  2RQR A;  2FO0 A;  2ZPF B;  4FYW B;  4Z89 A;  1T3S A;  2QA4 T;  1PRL C;  1YJN A;  2DYB A;  4J8O A;  3S6W A;  1K4U S;  1ZHI A;  1ZX6 A;  2DEQ A;  3H6Z A;  2DAQ A;  2Y4X A;  2CZ7 B;  3I35 A;  1Q82 U;  1Y96 A;  2HQE A;  5GAM d;  4HCC A;  2L5Q A;  1VQL Q;  4HVU A;  2L3S A;  3H0I A;  2ZPH B;  1FYN A;  4JLG A;  4CI0 C;  5D6X A;  4NL2 A;  4V2S A;  1NEG A;  2L89 A;  3V8K A;  2E64 A;  1EX4 A;  2E3H A;  4DBF A;  1SHF A;  3QJY A;  3HKS A;  3ULR B;  1YIT T;  3D7S B;  3OB9 A;  1RAD B;  1UG1 A;  4FW2 A;  1K8A R;  1ZSZ C;  3VS5 A;  2RHI A;  2JUF A;  2CT4 A;  2AZS A;  1MND A;  3ZL7 C;  1M3B A;  3V7R A;  4F7U G;  1KHI A;  1BBZ A;  3SB2 A;  4DBQ A;  1E7O A;  5GAM j;  4FT2 A;  2P0K A;  4OVA A;  2LJ1 A;  5LJ3 e;  3CCU Q;  2BE9 B;  5GAN 5;  4FYV B;  1Q82 C;  1VQL A;  3L2R A;  3GNG A;  3E19 A;  3MEV A;  3OYF A;  2LT4 A;  2QQR A;  2XK0 A;  4DEY A;  1KQ2 A;  1U06 A;  1UFF A;  1VQ8 Q;  2KT8 A;  2O2O A;  3BDL A;  2X4W A;  1QQJ A;  5KYW A;  3L1A A;  5FWB A;  2RI3 A;  3PTA A;  2OTJ A;  1ZA2 B;  4XU1 A;  1UHC A;  3V7C A;  3CCR T;  1TUG B;  5A0L A;  3JCM d;  1XNI A;  2MAM A;  2FPD A;  5AYF A;  1YHQ T;  2ZPI B;  3VS0 A;  2LC4 A;  1PM3 A;  2PTK A;  8AT1 B;  1YJW A;  3TSW A;  2DL3 A;  2CYZ B;  3LWI A;  2MOX A;  2M51 A;  3PIO A;  2V1R A;  2WSF E;  4IIO A;  4HVW A;  3RDV A;  2LZ6 B;  2QAZ A;  3THK A;  1TUD A;  1VQ8 A;  5CO7 A;  2EGA A;  5C6S A;  1VQ9 Q;  3OYK A;  1CSK A;  1S1N A;  3M0T A;  2KBT A;  2LJ3 A;  3QWX X;  3OYC A;  1Z9Q A;  1Q81 R;  3R6O A;  3X25 B;  1GFD A;  5A2Q E;  2K5I A;  5KE2 A;  2K9G A;  5IHK A;  3SD4 A;  1ABO A;  2EJG A;  4IUP A;  2DIQ A;  2R58 A;  2EYW A;  3PVL A;  2OAU A;  1VQ4 Q;  1GXI E;  1JU5 C;  2F5T X;  1KC8 U;  4KH1 B;  2HQX A;  5D6Y A;  1K9A A;  4Z02 A;  2HBW A;  3MP1 A;  2DIG A;  1D1C A;  5M9O A;  5DLO A;  4M7A A;  1N9R A;  4BE2 A;  2R5M A;  5J39 A;  2IG0 A;  1RAB B;  2J05 A;  2PVO B;  2C06 A;  4A4E A;  4P5N A;  4M77 A;  2RF0 A;  1VQ9 A;  2KRN A;  3T9N A;  2LCS A;  2J6O A;  1D1B A; 
#chains in the Genus database with same CATH homology
 3R6N A;  5GJW B;  3JV3 A;  2DE0 X;  2FG0 A;  1U3O A;  3PVQ A;  1X2K A;  1X69 A;  1OPK A;  4RTW A;  4AFZ C;  1BB9 A;  2YSQ A;  1SRM A;  2DL7 A;  5IHI A;  1N5Z A;  4GBQ A;  2DX1 A;  4EIK A;  3VS3 A;  1AVZ C;  2K7A A;  3UA6 A;  4AG1 C;  1AWJ A;  1YCS B;  4RTZ A;  2FRW A;  1NM7 A;  2H8H A;  4RTU A;  1M3C A;  3SEM A;  2JS0 A;  4CC3 A;  2LNH B;  2KYB A;  1RLP C;  1T0H A;  1WI7 A;  1WYX A;  1WXT A;  2JT4 A;  2D1X A;  2VWF A;  4JJC A;  1W6X A;  4LUE A;  1NLO C;  2EVR A;  2GBQ A;  2ECZ A;  2EYY A;  2MIO A;  1OEB A;  4F14 A;  1KSW A;  1WLP B;  1ZUU A;  4Y92 A;  5I11 A;  1JEG A;  2VVK A;  1X2Q A;  4IIM A;  1AOJ A;  2BZ8 A;  2O31 A;  4OMO A;  4LNP A;  4DEX A;  1AZE A;  5HCK A;  3RNJ A;  3EG3 A;  2KRO A;  5IHN A;  1JXM A;  3EG1 A;  5FW9 A;  1I1J A;  1RUW A;  1ZUK A;  1JO8 A;  1WXB A;  2C0O A;  2DL8 A;  2JTE A;  1YN8 A;  2L0A A;  1AWX A;  1Y0M A;  2AKK A;  1QLY A;  2LQN A;  1AWO A;  2LQW A;  2MCN A;  1WIE A;  2RN8 A;  2SRC A;  1UUE A;  2CSQ A;  1QKW A;  4JZ4 A;  2A37 A;  1Z9Z A;  2CRE A;  2G6F X;  4LUD A;  4K11 A;  2K2M A;  5IH2 A;  3O5Z A;  1VYT A;  1JXO A;  1M30 A;  1ZUY A;  1YWP A;  2RNA A;  2YUQ A;  2CUB A;  2ED0 A;  1NYF A;  3M0S A;  4RTY A;  1HSQ A;  3EG2 A;  2KR3 A;  2C0T A;  1NYG A;  1X6B A;  2RQW A;  2BTT A;  1SPK A;  2NUZ A;  1MUZ A;  4Z88 A;  4X1V A;  1G2B A;  1RI9 A;  1PNJ A;  4HCK A;  2AK5 A;  2DVJ A;  3M0Q A;  2A08 A;  2DL5 A;  2LMJ A;  4AFS C;  1GFC A;  3EHQ A;  1YP5 A;  1VYV A;  1QCF A;  2I0N A;  3EG0 A;  3C0C A;  2J6K A;  2V1Q A;  3M0R A;  1HD3 A;  4A63 B;  3H0H A;  1IO6 A;  2HEQ A;  2JS2 A;  2K79 A;  4HXJ A;  1K0X A;  4GLM A;  3TSZ A;  2JM8 A;  2A36 A;  1FMK A;  4J9G A;  1YNZ A;  3EGU A;  1H92 A;  2F2X A;  2FPE A;  4LE9 A;  1WXU A;  2DA9 A;  2DBM A;  2SEM A;  2PNI A;  1LCK A;  1NEB A;  2EQI A;  2FEI A;  1QWF A;  2KYM A;  2M0Y A;  1W70 A;  4CC7 A;  1GBR A;  2CT3 A;  2KEA A;  4QT7 A;  2KE9 A;  2OAW A;  1Y57 A;  1AWW A;  1EFN A;  1PKS A;  2QDL A;  3U23 A;  3CQT A;  1T0J A;  2KGT A;  3VS1 A;  1K0S A;  2ABL A;  2LJ0 A;  3LH5 A;  2L3P A;  4RTX A;  1UE9 A;  2ED1 A;  4WCI A;  4F16 A;  1G83 A;  2EYZ A;  2X3X D;  1I07 A;  2DJQ A;  2DF6 A;  2P4R A;  2E5K A;  2GGR A;  4ZNX A;  1OOT A;  3TVT A;  2OJ2 A;  2EGC A;  2DRM A;  1GCP A;  2D8J A;  2DNU A;  2RQU A;  1UJ0 A;  3VS6 A;  1T3L A;  2AKL A;  1WFW A;  2ROT A;  4LN2 A;  1JQQ A;  4RTV A;  1GCQ A;  3UA7 A;  2X3W D;  2JMA A;  4CC2 A;  5EC7 A;  3VRY A;  1V1C A;  2IIM A;  2L2P A;  2FPF A;  3M0U A;  3A98 A;  2LP5 A;  2A28 A;  1NLP C;  1UHF A;  1I0C A;  1GRI A;  2DL4 A;  2NWM A;  2AZV A;  1OPL A;  3GBQ A;  2K3B A;  2J06 A;  2RQT A;  4E6R A;  1A0N B;  2EKH A;  3VS7 A;  1SRL A;  2RQV A;  3NPF A;  1M27 C;  2YT6 A;  3VS4 A;  3EHR A;  5ECA A;  1ZBJ A;  1NG2 A;  3FJ5 A;  3I5S A;  2EPD A;  3H41 A;  2RQR A;  1PWT A;  3I9Q A;  2FO0 A;  3IQL A;  1RLQ C;  1BU1 A;  1VYU A;  1TUC A;  4Z89 A;  1B07 A;  1QWE A;  1T3S A;  4J9B A;  1PRL C;  2DYB A;  3VS2 A;  2DMO A;  1CKA A;  4JJD A;  1K4U S;  2K6D A;  1ZX6 A;  2D8H A;  4OMQ A;  2ROL A;  2CH4 W;  4D8K A;  2J6F A;  1UJY A;  3H0F A;  4KRT A;  3I35 A;  3RBB B;  2EYX A;  2XMF A;  2CH4 A;  2HCK A;  1AD5 A;  4HVV A;  3NGP A;  1YWO A;  2C0I A;  2LX7 A;  1X43 A;  1XOV A;  2L3S A;  4HVU A;  2DRK A;  3H0I A;  1FYN A;  2DIL A;  1MV3 A;  1UDL A;  2FRY A;  1NEG A;  4OMN A;  2PZ1 A;  4R0K A;  2O9V A;  3QWY A;  2CDT A;  1SHF A;  1E6G A;  1X6G A;  2RMO A;  2DBK A;  2GTJ A;  3ULR B;  1W1F A;  1UG1 A;  3VS5 A;  2BZX A;  2YUO A;  4J9C A;  1WDX A;  2JW4 A;  2YUN A;  2CT4 A;  2AZS A;  2CUD A;  1U5S A;  3ZL7 C;  1X27 A;  1M3B A;  1BBZ A;  2B86 A;  4JZ3 A;  1ZSG A;  1E7O A;  1PHT A;  3NHN A;  1WX6 A;  2LJ1 A;  4Z8A A;  4RTT A;  3NMZ C;  1M3A A;  2EW3 A;  2D0N A;  4OML A;  1PRM C;  2GTO A;  2J7I A;  1QKX A;  3SHW A;  3REA B;  4DEY A;  1U06 A;  1UFF A;  1KIK A;  2KT8 A;  2O2O A;  4J9F A;  2L3Q A;  5IXF A;  4J9D A;  2KRS A;  5FWB A;  4OMM A;  1KFZ A;  1SSH A;  2JMC A;  1J3T A;  1UHC A;  2CSI A;  1K1Z A;  1H8K A;  1VA7 A;  2KXC A;  2KXD A;  2HDA A;  3VRZ A;  1E6H A;  2RPN A;  2EBP A;  2FPD A;  2YDL A;  1UGV A;  2F2W A;  1HJD A;  4JJB A;  1MV0 B;  2KNB B;  2ENM A;  2W0Z A;  3VS0 A;  1ZLM A;  4J9I A;  2YUP A;  1GL5 A;  2O88 A;  2PTK A;  2VKN A;  2KRM A;  3TSW A;  1AZG B;  4RUG A;  2DL3 A;  3PE0 A;  1SEM A;  2MOX A;  2M51 A;  2V1R A;  2EGE A;  4IIO A;  3M0P A;  3UF4 A;  1ARK A;  4HVW A;  3I5R A;  2LZ6 B;  3THK A;  4ESR A;  1UEC A;  4JPB W;  1TUD A;  1M8M A;  5GJV B;  4D8D A;  4ORZ A;  4F17 A;  2EGA A;  1KJW A;  1CSK A;  1S1N A;  4J9H A;  2F2V A;  4FSS A;  3M0T A;  2KT1 A;  2OI3 A;  2KBT A;  2LJ3 A;  2W10 A;  2DM1 A;  3QWX X;  1Z9Q A;  1CKB A;  1GFD A;  2O9S A;  4OMP A;  1WA7 A;  4AFU C;  2K9G A;  1PKT A;  5IHK A;  1B3Q A;  2DLP A;  1H3H A;  1ABO A;  1ABQ A;  5L23 A;  5FWC A;  2EYW A;  1AEY A;  1GCQ C;  2HSP A;  1K76 A;  1BK2 A;  1TG0 A;  3PVL A;  3UAT A;  1JU5 C;  1SHG A;  1GBQ A;  1K9A A;  4AG2 C;  4CC4 B;  4J9E A;  2JM9 A;  1OV3 A;  2HBW A;  3KFV A;  5IXB A;  4AFQ C;  3REB B;  2BZY A;  2J05 A;  2ESW A;  2JXB A;  5I22 A;  1UTI A;  2GQI A;  2RF0 A;  2GNC A;  2KRN A;  2LCS A;  2J6O A;  4M4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...