2G6FX

Crystal structure of the sh3 domain of betapix in complex with a high affinity peptide from pak2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
GPLGSVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 7
total genus 11
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2g6fX00
4J9DA 4JJDA 1NLOC 2ED0A 4LE9A 3CQTA 2CREA 1BU1A 3EG1A 1YNZA 2YUQA 2EYWA 2RQWA 1W6XA 4CC4B 2KYBA 1IO6A 2ESWA 2YUPA 1NG2A 4HVUA 5EC7A 2A28A 4OMMA 1PHTA 1OEBA 2RPNA 1KJWA 2DL4A 3I5SA 2M51A 3I5RA 1B07A 2RF0A 2EVRA 2K9GA 2DL7A 1K1ZA 2O9SA 1M27C 1YWOA 1VYUA 1B3QA 1UE9A 1KSWA 2YUNA 1UG1A 2EKHA 2H8HA 2C0OA 2FRWA 3M0QA 1UFFA 4HXJA 1E6HA 4LUDA 2EPDA 1CKAA 2X3XD 1I0CA 5I11A 2BZ8A 2KNBB 4J9GA 4D8DA 3ULRB 2PNIA 1YCSB 2I0NA 2KRNA 4GBQA 1SEMA 2AKLA 2J05A 3UF4A 2EW3A 4OMNA 2K3BA 2HCKA 1AWXA 2KGTA 2DL3A 1UECA 3C0CA 1M3BA 1QWFA 1YWPA 2DM1A 2P4RA 3M0UA 4RTZA 4RTVA 1RLQC 2KBTA 1Y0MA 3FJ5A 1WLPB 1NYGA 3LH5A 2JW4A 1X43A 1K9AA 2KXDA 3H0IA 3M0SA 2A37A 4GLMA 2RQUA 2FPFA 1YP5A 1JQQA 1PRMC 1PNJA 3A98A 2YSQA 3VS1A 2VKNA 4IIMA 3REBB 3VRYA 2RNAA 1Z9QA 2D8JA 2LP5A 5GJWB 1WXTA 2PTKA 2KXCA 1UGVA 4AFUC 1Y57A 1BBZA 4Z89A 4J9BA 1X6GA 1X2KA 2X3WD 3O5ZA 2GBQA 3ZL7C 1AEYA 4R0KA 3QWYA 3PVLA 1GBRA 4IIOA 1H92A 2DBMA 1YN8A 3SEMA 2K2MA 5IHIA 1QLYA 2DL5A 2O88A 4HVVA 2EYZA 2DL8A 3IQLA 4KRTA 1GFCA 1NYFA 4Z88A 4FSSA 1QCFA 2LJ0A 1PWTA 2CDTA 4EIKA 5FWBA 3I9QA 1WFWA 4D8KA 4RTTA 1PKSA 2SRCA 2FRYA 1KIKA 3NHNA 4F16A 2D1XA 2L3PA 1NM7A 3QWXX 2ROLA 2L2PA 2W0ZA 3M0TA 4F17A 1U5SA 3REAB 2EGCA 4F14A 3GBQA 4HVWA 1OPLA 1FYNA 2D8HA 1AD5A 2DJQA 3I35A 2W10A 1RUWA 1WIEA 1JXOA 2ABLA 4HCKA 3U23A 1X27A 2V1QA 2LQNA 1WX6A 2EQIA 2LMJA 4AFQC 1JEGA 1GCQC 4M4ZA 4JPBW 1X2QA 4OMLA 3VS6A 1VYTA 1GFDA 4QT7A 1K0XA 2KT8A 1EFNA 3EG0A 4RTWA 2FG0A 2A36A 4LN2A 2LZ6B 2DNUA 2B86A 2EBPA 1J3TA 5IH2A 3VS5A 1ZSGA 1I1JA 1GCPA 3VRZA 1QWEA 2JM8A 2DYBA 4LNPA 2LJ3A 1Z9ZA 5FW9A 4J9CA 2DRKA 2DE0X 2GQIA 1K4US 1M3CA 1K0SA 1FMKA 1WYXA 4OMPA 2DBKA 2JMAA 2LCSA 2OJ2A 2KT1A 2F2XA 1UJ0A 2DX1A 3PE0A 3VS7A 4Z8AA 1MUZA 1UHCA 2C0TA 2L0AA 2KYMA 1CSKA 1I07A 1LCKA 3JV3A 1GRIA 2YT6A 3PVQA 2CSQA 1OV3A 4RUGA 4RTUA 1ABQA 2EYXA 4RTXA 1BK2A 2JXBA 1SSHA 3M0PA 2JT4A 1N5ZA 2DLPA 1HD3A 1NEGA 3NPFA 5FWCA 2DA9A 1G2BA 1WDXA 2CT4A 4AG1C 5I22A 1UHFA 2FPEA 2KR3A 1AZGB 2HDAA 1SHGA 1WXBA 2F2WA 2FO0A 3SHWA 1M8MA 1TUCA 2JM9A 3EHRA 1ARKA 1QKXA 3NMZC 2ENMA 5IHNA 1H3HA 2O31A 1AWWA 2LX7A 4DEYA 2EGEA 4CC2A 1T0JA 1U3OA 1T3LA 1AVZC 2J6FA 3KFVA 2MCNA 1UUEA 2CH4W 1AOJA 4JZ3A 1XOVA 5L23A 2DF6A 2K6DA 1SRLA 4J9HA 2JS0A 1TG0A 3EG3A 2J6OA 2HSPA 1GL5A 1GCQA 2O9VA 4OMQA 2F2VA 5GJVB 3VS0A 4Y92A 4X1VA 1JU5C 2DILA 1E6GA 4J9IA 1ZUKA 4ESRA 2JMCA 2YDLA 4JJCA 4K11A 2OAWA 2NUZA 2BZXA 2CH4A 1HSQA 1T3SA 1SRMA 5IXBA 5IXFA 3RBBB 2QDLA 3THKA 1MV3A 1U06A 2RQTA 2MIOA 1V1CA 2CUDA 2E5KA 2OI3A 3H0FA 4AG2C 4CC3A 2ECZA 2BZYA 2DVJA 1SPKA 2KROA 2RQRA 2HBWA 2ROTA 3EG2A 3VS3A 1X6BA 2L3SA 2PZ1A 4JZ4A 1RI9A 3VS2A 2AZSA 1W1FA 2C0IA 2KRSA 2J06A 1CKBA 2KE9A 1AWOA 1ZX6A 1ZLMA 1JXMA 2KEAA 1ABOA 2K79A 2KRMA 2A08A 2EYYA 4DEXA 2SEMA 4ZNXA 1QKWA 2NWMA 2RN8A 1AZEA 4ORZA 3VS4A 4CC7A 2O2OA 4E6RA 3UA7A 2D0NA 1G83A 1NEBA 2RQVA 1ZBJA 2FEIA 2YUOA 1MV0B 1UJYA 2VWFA 1ZUUA 2LJ1A 4AFZC 2CSIA 2L3QA 4J9EA 4OMOA 3H0HA 3UATA 2JS2A 4JJBA 3RNJA 1T0HA 5IHKA 3EGUA 2EGAA 2G6FX 1KFZA 2VVKA 2XMFA 2J7IA 1HJDA 3NGPA 5ECAA 3TSWA 1X69A 3R6NA 1UDLA 1OPKA 2GGRA 1PRLC 1RLPC 1JO8A 1OOTA 4RTYA 2JTEA 1K76A 2AK5A 1M3AA 1ZUYA 2BTTA 3EHQA 3TVTA 4J9FA 1H8KA 1SHFA 2LNHB 2DMOA 1UTIA 2GTOA 3UA6A 2LQWA 2FPDA 1W70A 1PKTA 2RMOA 2CUBA 2M0YA 2GNCA 1AWJA 2IIMA 2CT3A 1VYVA 2HEQA 1BB9A 4WCIA 1GBQA 1WXUA 1VA7A 5HCKA 2K7AA 4A63B 1E7OA 2ED1A 4LUEA 1WI7A 3H41A 4AFSC 2GTJA 1A0NB 1NLPC 2DRMA 1TUDA 2AZVA 2MOXA 1WA7A 2AKKA 3TSZA 1M30A 1S1NA 2V1RA 2J6KA 3M0RA
chains in the Genus database with same CATH superfamily
2HAXA 1NLOC 3CQTA 4LDYA 2AIRB 4F7UA 3FB9A 3CCJQ 2JN0A 4R56A 4C92D 4M7AD 4PJNA 3CCJT 1MNDA 3HPWA 3GOXA 2RQWA 4ATOA 3META 4EMKA 5EC7A 4GY5A 1UEBA 1IGUA 3CCST 2EWNA 2RPNA 4GLKA 5DY9A 3T9NA 2CYZB 2DL4A 2YRCA 3G71T 2RF0A 4XU1A 2EVRA 2K9GA 2O9SA 4KT0E 4FM4B 1B3QA 1KQ1A 3CEYA 1M2OA 2XG8D 1YHQA 1LOJA 4J7IA 1UFFA 1R0CB 4HXJA 1E6HA 2RO0A 4M77G 1VQKT 1N8RR 4M77C 5KYXA 2BZ8A 2A0FB 4D8DA 3NTIA 2E1HA 5GAN2 3ULRB 4GBQA 1KQSS 2XK0A 1SEMA 5FROA 2J05A 2EW3A 1NJIR 3CBPA 2HCKA 1AWXA 2KGTA 1YJWA 2EQMA 1UECA 1DJ7B 3C0CA 1YWPA 3M0UA 2P4RA 3CCUA 3S3NA 2C06A 1VQ6Q 2XIDA 5HKCA 2QEXT 2H3JA 3FJ5A 2MYSA 4LXCA 1K9AA 2KXDA 1IRXA 2L89A 4LD6A 3HRUA 1YP5A 4F7UE 1PNJA 3A98A 3JSCA 3REBB 3X28B 4FW2A 3QSUA 3E19A 4XTXA 5A0LA 2KXCA 3I56T 2LNVA 1VQ9T 3WVDB 4Z89A 4J9BA 1BKBA 2QA4T 3O5ZA 5FU7C 3NFCA 3EGDA 1MMNA 4PLIA 5CCAA 4RCCA 2K2MA 3CMEQ 5IHIA 1M8VA 2EYZA 2RHZA 1GFCA 4Z88A 1QCFA 2LJ0A 2RD1A 4EIKA 5CR2A 4JJNK 2SRCA 3OQ5A 2FRYA 1RI0A 4KUIA 4C0DB 3QWXX 4C5GA 2L2PA 2EGCA 4OB0B 3OBYA 1ZSZC 1G3YA 2JTMA 4HCKA 3QUIA 1X75C 1X27A 2OTLT 1ZA2B 4M7AC 3SD4A 1YIJA 2DAQA 5GANj 4C8QD 1GCQC 4M4ZA 4JPBW 4X9CA 1TOVA 2DO3A 2JVVA 5KYXB 1EFNA 4RTWA 3OYDA 4PJOF 1U1SA 4Y91A 4DBRA 4C92F 3RKYA 1ZSGA 2CZ6B 1KD1C 2I2LA 3VRZA 3L2ZA 2M9UA 2EYQA 1M5Q1 2CZ1B 4BY6B 4C92G 2JM8A 3RKXA 3SFMA 1VQ8T 1HYOA 2X4WA 3URGA 3LLRA 4BE2A 1Z9ZA 3TQ7P 3L2QA 4KBMB 4J6WA 3SWNB 3LWIA 1M3CA 3QJ6A 5GANg 1WYXA 1NPPA 2DBKA 2NUTB 3OYFA 1BIBA 1TU0B 5GAMj 4JDSA 2VASA 2OJ2A 3CMEA 2KT1A 2F2XA 4M77F 1UJ0A 4Z8AA 4BDYA 1MUZA 2NUTA 1XNIA 2HL3A 3EFOA 5KH6A 5GAN5 4ZGJB 1S72T 3FEOA 3H6ZA 2ZPGB 3MP1A 2HQEA 1ABQA 4EMKC 4OMFB 1VQNT 1Y07A 3OA6A 1HD3A 4DA4A 3V7SA 2DA9A 1G2BA 3HKSA 3CCEA 3R6OA 2FPEA 2HDAA 3JCMf 3OYAA 1YIJQ 1SKUB 3L2UA 1YITT 2E5QA 2Y4YA 1QKXA 1WHKA 4KUDK 1WHGA 4JRKA 5IHNA 1TSFA 2O31A 2KY9A 4OVAA 1VQ7T 1AWWA 2ZGWA 4QKUA 4DEYA 4EMHA 4CC2A 2EQUA 1T0JA 4FYWB 3SDZA 1QCOA 4LDUA 2VGMA 4M78D 1UUEA 2X51A 1VQLQ 2NUPB 3ASKA 3L2WA 2GFUA 2RHXA 4J9HA 1TXQA 3EG3A 2J6OA 3LWHA 1GCQA 2O9VA 4OMQA 1VQOA 4PJJA 1M1GA 5FU7B 1E6GA 1ZUKA 5KYNA 4K11A 3G6EQ 2NUZA 2OAWA 1HSQA 2F5KA 4C8QE 4QQDA 2E3IA 2RQTA 1V1CA 3JB9F 2E5KA 3ZFJA 2HNIA 1IREB 2LC4A 2LT4A 3D7SB 3EG2A 1Q86U 3VS3A 5DLOA 5GAN4 1VQ5Q 2AZSA 2KRSA 1EZZB 1NJIU 1CKBA 3CCRA 1YJNA 2FL7A 1BIAA 3CC7T 1ABOA 5D6WA 2A08A 4DEXA 2KI7A 3M56A 2FHDA 1Q82C 1RAEB 2E10A 3CC7A 3JB9H 4XTWA 3CPFA 3M4GA 1C6VX 3C12A 4PJOD 1G83A 1NEBA 2LX9A 1ZBJA 2RQVA 3L42A 1MV0B 4N0AC 4X9DA 2DETA 2QQ9A 3P8BB 4J6XA 1WGSA 2LJ1A 4AFZC 2QQBA 2QQSA 2L3QA 2GFAA 4IUTA 3JCMh 2DEQA 1FXXA 1NJIC 3O8VA 1K73R 5GAN7 2PVOB 2XDDA 3RNJA 1B34A 3ZBDA 4PL6A 4KH1B 1LPLA 3CD6A 3CCUT 1Q82U 2EGAA 3Q1JA 5KYUA 5A0GA 2OX7A 3OYEA 4M77B 3E2UA 1D1CA 1OPKA 1MMDA 2GGRA 4MZTA 3JCMP 2LQ8A 2QXFA 1M1KU 4RTYA 3CC4Q 2JTEA 5LJ5f 5GAOq 1M3AA 3EHQA 6AT1B 4J9FA 2WSEE 3OY9A 4C8QC 3E9FA 4FSXA 1WHJA 2GTOA 3HFNA 3UA6A 3CC4T 2K3YA 2GNCA 2DIGA 4JRIA 4E7HA 2IIMA 4A4HA 4EMKB 1VYVA 4XU2A 1UGSB 4FCYA 1BB9A 3QZ5B 4C5HA 3M4YA 3MEAA 1VA7A 1Y7XA 3E1SA 3JB9G 2RJFA 5LJ3e 4LUEA 2E64A 3OW2P 4ELZC 2GTJA 1A0NB 5GAMh 1NLPC 2DRMA 2AZVA 4HKEA 3CCLT 1M30A 2V1RA 2J6KA 4ANJA 3CCJA 1GFDA 3M0RA 4JJDA 3WXMB 1RAAB 5I2SA 5GMKi 4M7DC 1N9RA 4M78F 2ZAEA 1RABB 3FJPA 1YNZA 5GMKm 2AHJB 3RIRA 3OS2A 2HQXA 3QZ9B 2KYBA 1IO6A 2ESWA 2YUPA 4HVUA 3CXCA 3JCMe 1Q82R 3OYNA 7AT1B 1OEBA 4OGCA 3I5RA 2DL7A 1JJ2S 4RG8A 1VQMA 2BE9B 3X20B 3J7AF 1KSWA 3AHUA 3OYMA 2EKHA 2DKGA 2H8HA 3JB9D 5IT9E 3CPWS 2EKOA 3CCMQ 2M0OA 2EQKA 1OX9A 1X01A 3L1AA 4NL3A 3QO3A 5KYUB 3MO8A 2X3XD 2KNBB 1KHCA 2Y4XA 2I0NA 2AKLA 2LQKA 5GANd 2JTFA 3I55A 2ATCB 2K3BA 2DL3A 1M3BA 3OS0A 5CIUA 2KBTA 4BE0A 1WLPB 1M1FA 3CPWP 3M0SA 1M1KC 4BI8B 3CC2A 1I5OB 3OYBA 3BW1A 3A8OB 3VS1A 2VKNA 1WQ7A 4DOVA 1Z9QA 2D8JA 4ZTFA 1QW1A 4M7DE 2PTKA 4PJOB 1UGVA 3JCMJ 1BBZA 1YCYA 2D6FA 3M57A 3QWYA 1GBRA 3G4SQ 2JOYA 1P92A 3SEMA 2FB7A 2M16A 2O88A 4IUVA 2DL8A 3IQLA 4KRTA 1D3BB 1GXIE 2X35A 1PWTA 5FWBA 3CCSQ 1ZQ1A 4PFOA 2V8JA 3EH1A 1S72Q 2QAZA 3CCLA 4B9WA 4MMKA 3GNGA 4HVWA 3QYGB 1G3WA 2D8HA 1NPRA 5IN1A 1U1TA 1BCOA 5GMKj 1RUWA 1MNEA 1Q86R 1RAFB 1V76A 3M59A 2PVGB 2NUPA 2V1QA 1BI3A 2IG0A 1K9MC 3EFSA 2EQIA 2DD4A 4PJOE 3CCVA 4M75E 3MEUA 2LVMA 1K8AU 3VS6A 1X2QA 4OMLA 1VQ8Q 5GANh 2DEUA 2KT8A 4RCBA 2B86A 2EBPA 2G3RA 1ZHIA 1J3TA 3J81E 3S3MA 3VS5A 2MWPA 3QDFA 4B9XA 1GCPA 1D1BA 4KH0B 2E65A 1VQ5T 2DE0X 1YFNA 3VU3C 1QVGS 2RH2A 2HBPA 4OMPA 5LJ3f 5FU6B 2GQVA 2JJ9A 1QVGP 4LDWA 1Y71A 2LCSA 5LJ3g 3PE0A 9ATCB 1VQ9Q 2XDPA 3NTKA 5EG2A 3TEEA 1CSKA 3GIBA 1PSFA 4L5GA 2RI5A 2CSQA 3KUFA 4C0FA 1OV3A 3S3OA 1EX4A 3A8MB 3MCAB 1SSFA 4BE1A 2ZPFB 2EYXA 3I56A 1BK2A 3LYIA 5CKFA 2MPXC 4KGZB 3NPFA 2CT4A 5I22A 3CD6T 1N8RC 2DTIA 3V7CA 1SHGA 2K5LA 4C5EA 4PJOA 1KC8C 2F2WA 5A2QE 2O4XA 3SHWA 4M75A 3TCJA 1VQLT 3V8KA 5KE2A 1WPYA 1Q95G 4O6JA 4Q5WA 1VQLA 3LGFA 1ARKA 3KBGA 3NMZC 4XQ3A 5KCHA 3V8LA 4WTOB 5GAN3 3PIOA 1OU8A 2EGEA 3HP9A 1U3OA 3E9GA 3G4ST 2MCNA 1AVZC 2J6FA 1HXDA 3EGXB 3P8DA 1YBYA 2DZ9A 5M9OA 2JS0A 3CCVQ 3CCQA 4C8QB 4NL2A 4M78C 2F2VA 2HKQB 2HD0A 2RB6A 1G5VA 2EQJA 2JMCA 2YDLA 2YRDA 3QHSA 2BZXA 1K8AC 4M7DG 1SG5A 2L3RA 3M54A 3OS5A 5IXBA 4BDZA 4PLLA 3THKA 1UGRB 1QQJA 3H0FA 2V8IA 4A4EA 4AG2C 2ECZA 3DB3A 2PVDB 1KD1U 1RAIB 2RQRA 2HBWA 2ROTA 2VB6A 4HCCA 3JCMX 1X6BA 4M7DB 2ZPEB 3QDRB 3JCMg 1WJRA 4ZGDB 1AWOA 3INZA 2R5AA 1ZX6A 1JXMA 1VQPT 1H3ZA 2SEMA 4J6YA 4M77D 2MAMA 3CCRQ 1YJNQ 2Z0WA 4C92A 3UA7A 2CP2A 5CKEA 2YUOA 2FEIA 3UT1A 1OI1A 3JCMW 4OF1A 1ZUUA 1OU9A 4HCBA 4F7UF 2CP3A 2QG9B 4YTLA 1VQPQ 3A5ZB 4V2SA 3JAME 3VUZA 3UATA 1UGPB 5FRNA 2JS2A 5IHKA 2VC8A 1OQKA 3L2RA 3CCET 4JUVA 2RJEA 1I4K1 3NGPA 1RL2A 1X69A 3R6NA 1RLPC 1OOTA 1K73C 1S72A 2HKNA 2K5IA 3RERA 1OZ3A 3FDRA 2BTTA 5D7UA 2RI2A 3C95A 5GAN6 1SHFA 1UTIA 3RESA 2BKDN 2ZZDA 3CMET 2QK0A 4XTZA 4BB7A 1W70A 1VQ4T 2MWOA 2COWA 1YIJT 2FZKB 2E3HA 3RKWA 4M78A 2MMPA 4F7UG 5DLQE 2CKKA 2MI6A 2OTLA 2MF2A 2X9HA 5HCKA 1WXUA 4A63B 2FZCB 2ED1A 3OW2S 4BI4A 2YHTA 3H41A 4AFSC 1O9SA 2YLBA 1KG1A 4X34A 2EIFA 2AKKA 2LCCA 1ZSZB 3EG9A 1K8AR 4R55A 2H3EB 4J9DA 2ED0A 3LX7A 2ZPHB 2ZPBB 4MDWA 4M7AB 2CREA 1BU1A 2XI9A 3OBWA 3EG1A 4XAXB 4BI3A 1TS9A 3CBMA 1W6XA 2DERA 2RI3A 3FIFA 4M75C 3HHTB 1NG2A 2A28A 1PHTA 2XICA 3GLXA 4XTVA 1C1AA 3RMQA 4BY6C 1YWOA 2JNGA 2RM4A 1BCMA 4M77A 3CXCS 1PM3A 4E7KA 3ME9A 2COYA 2FRWA 3JB9I 4LD9K 1CKAA 5LJ5j 2CS7A 1I0CA 4M78E 2PNIA 2KRNA 1MMAA 1IZ6A 1TUGB 3CBOA 4M7AE 3UF4A 2OTLQ 2ZCFB 2VYTA 2DM1A 4RTZA 1JJ2P 2A7YA 5DM7R 1TTHB 3LH5A 1QP2A 3OYHA 1K73U 2QI2A 2QTVA 2XD0A 3A1PA 3I56Q 1JQQA 1PRMC 2YRVA 4M75G 5GAMf 4PJMA 4JS5A 1FMVA 2YWWA 3N5BB 2CZ0B 3CMAQ 3CC4A 1VQKQ 3CC2Q 5KYWA 2K4YA 5GJWB 2LP5A 1QVGA 4JLGA 2BUDA 1N6AA 3MEWA 2NYSA 1VQ4A 4AFUC 1KQSA 2CP5A 2O01E 5LL6S 2K2VA 4EMGA 2X3WD 2GBQA 5CQXA 3UWNA 1KQ2A 3ZL7C 4C92C 2KQWA 3PVLA 1PD1A 4IIOA 4Y28E 1VQ6T 2DBMA 2YXYA 2DL5A 4HVVA 5GMKh 2Y90A 2RHYA 1Q7YU 1NYFA 4F04B 4HT9A 4B6MA 1KHIA 3V8JA 1YI2Q 4D8KA 1G3SA 4L6V5 4RTTA 2VXFA 4FIBA 1KIKA 3HRSA 3NHNA 1VQ7A 2D1XA 1KC8R 1QP3A 2ROLA 1RADB 2W0ZA 1KD1R 3HL8A 4F17A 3REAB 3GBQA 1FYNA 1FMWA 4XTYA 3VUBA 4M7AA 1YITA 3MHXA 3A8GB 2W10A 1O75A 2ABLA 3EGXA 5I21A 1Q81C 2M1HA 1Q7YC 3OYCA 2LDMA 3M55A 1RAGB 1WX6A 1HK9A 3H8ZA 4J83A 1ZSZA 4FW1A 1JEGA 3EAEA 4J8OA 4QT7A 4EDUA 1G3TA 3FLGA 3CCMT 4QQ6A 3MKDA 3EG0A 4KGXB 4M78B 4F7UB 2X4YA 4OP0A 2DJZA 4BUGA 2DNUA 2LZ6B 1YI2A 2V8KA 1WJSA 4QVDA 1OZ2A 1VOMA 3OYLA 3C4SA 1I1JA 4OB3B 1QWEA 2MK5A 3RR6A 2QTXA 4BD3A 1G8XA 1I5LA 4J9CA 2DRKA 2GQIA 1K4US 5CKBA 2DXBA 4IUQA 3PFSA 4O5VA 3GNFB 3RMSA 3UPUA 3C94A 5LJ3d 3OYJA 1D09B 1N8RU 3JCMc 2P0PA 5CQYA 1UHCA 2C0TA 4XU3A 5D6XA 4E47A 1NE8A 2KYMA 1LCKA 2E6NA 3JV3A 1FX7A 2P0QA 3QJYA 2YT6A 2HMAA 5LJ5d 3BY7A 1YI2T 4JLIA 5KYYB 1W2BS 2ZPIB 2RHUA 4VUBA 3AT1B 4N4HA 1M1KR 1XJWB 1SSHA 3M0PA 4JS4A 1N5ZA 5LJ3h 1YITQ 1NZ9A 3MP8A 1UHFA 4IURA 2DIQA 2LRQA 2P0KA 1I8FA 1MHNA 2OTJA 3I55Q 2CP7A 4DBQA 3OYIA 3EHRA 2PUKB 2DXCA 4M78G 1M90R 2EAYA 1AHJB 2K5FA 2KVQG 1H3HA 2JZ2A 3OB9A 4A4GA 1D0YA 1AOJA 4JZ3A 1XOVA 4XTUA 4ME7A 4FT2A 2DF6A 4HT8A 3CXCP 3FRNA 5J39A 1PD0A 5HK3A 1OX8A 3OYKA 3CCEQ 3CCQT 2HSPA 1GL5A 4IUPA 5GANe 1K9MU 3VS0A 5GJVB 3VYHB 4Y92A 3G6ET 4ESRA 3JB9J 4JJCA 4C0DC 4HA8A 4HCZA 5KYWB 1VQMT 2FZGB 3G4SA 5IAYA 1C0MA 1SRMA 3ZEHA 1QVFA 3RBBB 4XK8E 1MV3A 1U06A 2EJFA 3EGDB 1IB8A 2BIVA 2CUDA 1UGQB 2OI3A 4RKUE 4C0ZA 1TH7A 2BZYA 3JCMQ 2KROA 3TU4K 2L8DA 4ZN1A 5LJ5e 1YJWQ 1Q81R 1I81A 3M58A 2L3SA 1VQ6A 3VS2A 4E7SA 1VQOQ 2KEAA 4M7DD 2K79A 2HQHA 4N0AA 5GAOp 4N4GA 1YJ9A 2P4TA 3TREA 4ZNXA 1QKWA 4M75B 5FLXE 2NWMA 4PFPA 2CP6A 1YJ9T 1AZEA 3DLLA 4ORZA 4CC7A 2CP0A 2O2OA 1R8OB 3CCRT 1YJNT 2D0NA 1UJYA 4ZN3A 3SWNC 2QQAA 3BE3A 5AT1B 2YLCA 5A0DA 1PC0A 1Q7YR 5HY6A 3MJXA 2F5TX 2DYIA 3EGUA 3SB2A 2JUFA 2G6FX 1KFZA 1QVPA 2LCLA 2PUOB 3P8HA 1KC8U 3JCMb 2QQRA 5ECAA 1HJDA 3TSWA 1AT1B 1UDLA 3QYHB 1B34B 1JO8A 4C8QA 4QVZA 8AT1B 1VQ7Q 1K76A 3WVEB 5CKDA 4J5YA 1VQ9A 1PG5B 1WJQA 2LQWA 2R58A 1QVFP 2FPDA 1VIFA 2RMOA 2CUBA 3HSBA 4E7JA 2M0YA 1AWJA 2V26A 4RG2A 2HEQA 5I2MA 4DBHA 4WCIA 3CD6Q 2K7AA 4OB1B 1E7OA 1VQ5A 3LGLA 2F1LA 2E70A 3OW2A 1M90C 3CC2T 3VV0A 3V7RA 2MOXA 3UDCA 4AMCA 5J3BA 5GAMe 1YJWT 3M5AA 4FYVB 4C92B 4IKFA 5KYYA 4LE9A 3GPLA 1VUBA 3G1JA 1W2BA 1QMCA 3EFOB 4NS5A 2KSSA 1RAHB 2YUQA 4FT4A 3F70A 4DQ2A 4A4FA 2EYWA 4ZGEB 1M90U 2D9TA 4M7DA 4CC4B 3PTAA 1IHVA 1UB4A 2BE7D 4OMMA 2QGGA 2KK4A 4A4KA 1KJWA 1M2VA 1PCXA 3I5SA 2M51A 1B07A 2DVEA 1K1ZA 1XQHA 4C8QF 1M27C 3SWNA 1VYUA 4II1A 5LJ5g 1UE9A 2YUNA 1UG1A 4OGEA 3CCSA 2EJGA 3MPUB 3MEVA 2C0OA 4PJOG 1D1AA 4FYYB 3M0QA 4ELYC 5FU6C 3A8HB 4LUDA 4MDXA 3PGGA 2DFUA 2EPDA 3PIPA 1BI0A 5I11A 4J9GA 5AYFA 1YCSB 2GF7A 4AT1B 3QPHA 3BDUA 3OMCA 1F1BB 4OMNA 5GANf 1VQPA 2FYKA 1QWFA 4M7DF 3PT9A 3DB4A 4RTVA 3VYGA 1RLQC 1Y0MA 3CMAA 4LDXA 3RUXA 2IPOB 2WSFE 1NYGA 2JW4A 3JCMd 5GAOl 1X43A 3H0IA 2A37A 5CVIA 4GLMA 2RQUA 2FPFA 5GAN8 3CPWA 5GAMd 4PFZA 2YSQA 4IIMA 3BDLA 1ZA1B 2LT1A 3VRYA 1JJ2A 2RNAA 2WACA 1WXTA 4CRIA 2E12A 4PKCC 1Y57A 2QA4Q 1D3BA 1X6GA 1X2KA 3GF5A 5LJ5h 4M75D 5KCOA 2B8AA 1AEYA 4R0KA 2RK2A 2L5QA 1H92A 3PNWC 1YN8A 1K9MR 4BACA 4A54A 2PQWA 1H641 4DOWA 1QLYA 2KDSA 5GMKl 3G71Q 2X4JA 1Q81U 1VQMQ 4FSSA 1BYMA 3DKMA 4M77E 2F69A 2CDTA 2VUBA 3I9QA 2DTOA 2QGFB 1WFWA 1PKSA 3X26B 4F16A 2L3PA 1IXDA 1NM7A 2XKOC 2FVUA 5C6SA 4E2FB 4Z02A 3M0TA 1U5SA 4C8QG 4F14A 1OPLA 3OS1A 1AD5A 2DJQA 3I35A 4DBFA 1N9SA 1WIEA 1JXOA 3QIIA 3EG9B 4UC4A 3U23A 3QG1A 3HFOA 3VKIA 2LQNA 2VGNA 2LMJA 3BFMA 4AFQC 1KQSP 4RMOA 1BI2A 3M53A 1K0XA 1PSEA 1VYTA 3GP8A 4EPCA 2EJ9A 2FG0A 1EIFA 3KXTA 2A36A 4LN2A 3QXEB 1IHWA 5IH2A 1MGQA 3QKJA 3HTRA 1ZBXA 1SF9A 2K57A 1FWZA 5L8RE 2DYBA 1Q86C 4LNPA 1D0XA 2LJ3A 5FW9A 4LDVA 3OSVA 1YHQT 1M2VB 1K0SA 1FMKA 4JRPA 3OMGA 1N27A 2JMAA 2KMTA 2DX1A 3VS7A 2XHCA 3G71A 3QBYA 4QW2A 2L0AA 4NOYA 1I07A 1M4ZA 2RA2A 1GRIA 2DXUA 3MP6A 3PVQA 1VQOT 2AT1B 5GAMg 3VJPA 4RUGA 4RTUA 3L2VA 3PMTA 4RTXA 2JXBA 4N4IA 2E41A 2JT4A 2DLPA 3CCVT 4PK4A 1NEGA 2QYZA 4TVRA 5FWCA 1B7TA 1WQWA 2RJDA 1WDXA 4AG1C 2IVWA 2KR3A 1AZGB 4KGVB 1JRIA 1WXBA 2R5MA 2DK3A 2FO0A 3G7ZA 1M8MA 1TUCA 2XDBA 1M9SA 3ER0A 2JM9A 2DZCA 3CCLQ 1WHLA 2RHIA 4PJOC 2KAFA 2ENMA 2R57A 2QEXA 1D0ZA 2OTJT 1NBEB 5GMKe 2M02A 1WZOA 2LX7A 1W2BP 2O4XB 1X6OA 4J7FA 1KK7A 1T3LA 2DXTA 3KFVA 3OYGA 5FRMA 2CH4W 4M7AF 2LTOA 5L23A 4QVCA 3G6EA 2K6DA 1SRLA 2HZYA 1VQKA 1TG0A 4M75F 3PMIA 3HRTA 3JCMV 5KE3A 4X1VA 1JU5C 1R77A 1BI1A 2DILA 2X4XA 4J9IA 1QCNA 1QVFS 2CH4A 4D6WA 2OAUA 2QASA 4FL6A 1T3SA 5CAIA 1JB0E 5IXFA 2QDLA 2MIOA 2PU9B 4CC3A 2DPPB 2QDYB 4C0GA 2DVJA 1SPKA 1YJ9Q 2XU8A 4E7IA 4QQGA 1WHMA 5LJ3j 1Y96A 3NTHA 4MMLA 3S6WA 1LVKA 4C5IA 1MMGA 2PZ1A 4JZ4A 1RI9A 3X25B 1OULA 1W1FA 2C0IA 2J06A 3OSSC 2KE9A 3M9QA 4E7ZA 1ZLMA 2KRMA 2EYYA 3OYYA 3CCMA 2RN8A 3VS4A 4E6RA 1WNLA 1LNXA 4PNOA 4L59A 1Y96B 5CKHA 2VWFA 3CC7Q 1IGQA 2COZA 4FU6A 4FYXB 2CSIA 4J9EA 3RDVA 2VV5A 4OMOA 3H0HA 2VXEA 5GAOn 4JJBA 2HSEB 1T0HA 2CZ7B 2DTHA 1ACMB 2E6ZA 2HL5C 2GCXA 2WSCE 3CCQQ 5D6YA 1RACB 4A53A 2P84A 4CI0C 2VVKA 2XMFA 1R0BG 1JBMA 3I55T 2J7IA 2QEXQ 4IUUA 5CO7A 3DLMA 5CK9A 3X24B 1VQNA 1U8RA 4M7AG 1PRLC 3J80E 2K3XA 4MZPA 3H9NA 2RJCA 3CCUQ 1OYXA 1YHQQ 2AK5A 2RK1A 1ZUYA 2E4HA 2OTJQ 2CGHA 4E7LA 3TVTA 8ATCB 1TWBA 4KULA 1H8KA 3A8LB 1XTDA 2LNHB 2NLUA 5GAOm 2QA4A 2EFIA 2DMOA 3EFRA 2D0QB 4ZTJA 4P5NA 4JRQA 1LJOA 1PKTA 3EH2A 2CT3A 4WF2A 5J26A 5HK0A 3FC3A 1GBQA 3LW5E 2A3LA 4PJLA 3JRZA 4OB2B 1V29B 2DD5A 1WI7A 1VQ8A 5C0MA 1VQ4Q 1TUDA 1VQNQ 4XU0A 3CMAT 1WA7A 5GAOr 4C92E 1W4SA 3TSZA 3LH0A 1VIEA 1WHHA 1S1NA 4MZMA
chains in the Genus database with same CATH topology
4J9DA 4JJDA 1NLOC 2ED0A 4LE9A 3CQTA 2CREA 1BU1A 3EG1A 1YNZA 2YUQA 2EYWA 2RQWA 1W6XA 4CC4B 2KYBA 1IO6A 2ESWA 2YUPA 1NG2A 4HVUA 5EC7A 2A28A 4OMMA 1PHTA 1OEBA 2RPNA 1KJWA 2DL4A 3I5SA 2M51A 3I5RA 1B07A 2RF0A 2EVRA 2K9GA 2DL7A 1K1ZA 2O9SA 1M27C 1YWOA 1VYUA 1B3QA 1UE9A 1KSWA 2YUNA 1UG1A 2EKHA 2H8HA 2C0OA 2FRWA 3M0QA 1UFFA 4HXJA 1E6HA 4LUDA 2EPDA 1CKAA 2X3XD 1I0CA 5I11A 2BZ8A 2KNBB 4J9GA 4D8DA 3ULRB 2PNIA 1YCSB 2I0NA 2KRNA 4GBQA 1SEMA 2AKLA 2J05A 3UF4A 2EW3A 4OMNA 2K3BA 2HCKA 1AWXA 2KGTA 2DL3A 1UECA 3C0CA 1M3BA 1QWFA 1YWPA 2DM1A 2P4RA 3M0UA 4RTZA 4RTVA 1RLQC 2KBTA 1Y0MA 3FJ5A 1WLPB 1NYGA 3LH5A 2JW4A 1X43A 1K9AA 2KXDA 3H0IA 3M0SA 2A37A 4GLMA 2RQUA 2FPFA 1YP5A 1JQQA 1PRMC 1PNJA 3A98A 2YSQA 3VS1A 2VKNA 4IIMA 3REBB 3VRYA 2RNAA 1Z9QA 2D8JA 2LP5A 5GJWB 1WXTA 2PTKA 2KXCA 1UGVA 4AFUC 1Y57A 1BBZA 4Z89A 4J9BA 1X6GA 1X2KA 2X3WD 3O5ZA 2GBQA 3ZL7C 1AEYA 4R0KA 3QWYA 3PVLA 1GBRA 4IIOA 1H92A 2DBMA 1YN8A 3SEMA 2K2MA 5IHIA 1QLYA 2DL5A 2O88A 4HVVA 2EYZA 2DL8A 3IQLA 4KRTA 1GFCA 1NYFA 4Z88A 4FSSA 1QCFA 2LJ0A 1PWTA 2CDTA 4EIKA 5FWBA 3I9QA 1WFWA 4D8KA 4RTTA 1PKSA 2SRCA 2FRYA 1KIKA 3NHNA 4F16A 2D1XA 2L3PA 1NM7A 3QWXX 2ROLA 2L2PA 2W0ZA 3M0TA 4F17A 1U5SA 3REAB 2EGCA 4F14A 3GBQA 4HVWA 1OPLA 1FYNA 2D8HA 1AD5A 2DJQA 3I35A 2W10A 1RUWA 1WIEA 1JXOA 2ABLA 4HCKA 3U23A 1X27A 2V1QA 2LQNA 1WX6A 2EQIA 2LMJA 4AFQC 1JEGA 1GCQC 4M4ZA 4JPBW 1X2QA 4OMLA 3VS6A 1VYTA 1GFDA 4QT7A 1K0XA 2KT8A 1EFNA 3EG0A 4RTWA 2FG0A 2A36A 4LN2A 2LZ6B 2DNUA 2B86A 2EBPA 1J3TA 5IH2A 3VS5A 1ZSGA 1I1JA 1GCPA 3VRZA 1QWEA 2JM8A 2DYBA 4LNPA 2LJ3A 1Z9ZA 5FW9A 4J9CA 2DRKA 2DE0X 2GQIA 1K4US 1M3CA 1K0SA 1FMKA 1WYXA 4OMPA 2DBKA 2JMAA 2LCSA 2OJ2A 2KT1A 2F2XA 1UJ0A 2DX1A 3PE0A 3VS7A 4Z8AA 1MUZA 1UHCA 2C0TA 2L0AA 2KYMA 1CSKA 1I07A 1LCKA 3JV3A 1GRIA 2YT6A 3PVQA 2CSQA 1OV3A 4RUGA 4RTUA 1ABQA 2EYXA 4RTXA 1BK2A 2JXBA 1SSHA 3M0PA 2JT4A 1N5ZA 2DLPA 1HD3A 1NEGA 3NPFA 5FWCA 2DA9A 1G2BA 1WDXA 2CT4A 4AG1C 5I22A 1UHFA 2FPEA 2KR3A 1AZGB 2HDAA 1SHGA 1WXBA 2F2WA 2FO0A 3SHWA 1M8MA 1TUCA 2JM9A 3EHRA 1ARKA 1QKXA 3NMZC 2ENMA 5IHNA 1H3HA 2O31A 1AWWA 2LX7A 4DEYA 2EGEA 4CC2A 1T0JA 1U3OA 1T3LA 1AVZC 2J6FA 3KFVA 2MCNA 1UUEA 2CH4W 1AOJA 4JZ3A 1XOVA 5L23A 2DF6A 2K6DA 1SRLA 4J9HA 2JS0A 1TG0A 3EG3A 2J6OA 2HSPA 1GL5A 1GCQA 2O9VA 4OMQA 2F2VA 5GJVB 3VS0A 4Y92A 4X1VA 1JU5C 2DILA 1E6GA 4J9IA 1ZUKA 4ESRA 2JMCA 2YDLA 4JJCA 4K11A 2OAWA 2NUZA 2BZXA 2CH4A 1HSQA 1T3SA 1SRMA 5IXBA 5IXFA 3RBBB 2QDLA 3THKA 1MV3A 1U06A 2RQTA 2MIOA 1V1CA 2CUDA 2E5KA 2OI3A 3H0FA 4AG2C 4CC3A 2ECZA 2BZYA 2DVJA 1SPKA 2KROA 2RQRA 2HBWA 2ROTA 3EG2A 3VS3A 1X6BA 2L3SA 2PZ1A 4JZ4A 1RI9A 3VS2A 2AZSA 1W1FA 2C0IA 2KRSA 2J06A 1CKBA 2KE9A 1AWOA 1ZX6A 1ZLMA 1JXMA 2KEAA 1ABOA 2K79A 2KRMA 2A08A 2EYYA 4DEXA 2SEMA 4ZNXA 1QKWA 2NWMA 2RN8A 1AZEA 4ORZA 3VS4A 4CC7A 2O2OA 4E6RA 3UA7A 2D0NA 1G83A 1NEBA 2RQVA 1ZBJA 2FEIA 2YUOA 1MV0B 1UJYA 2VWFA 1ZUUA 2LJ1A 4AFZC 2CSIA 2L3QA 4J9EA 4OMOA 3H0HA 3UATA 2JS2A 4JJBA 3RNJA 1T0HA 5IHKA 3EGUA 2EGAA 2G6FX 1KFZA 2VVKA 2XMFA 2J7IA 1HJDA 3NGPA 5ECAA 3TSWA 1X69A 3R6NA 1UDLA 1OPKA 2GGRA 1PRLC 1RLPC 1JO8A 1OOTA 4RTYA 2JTEA 1K76A 2AK5A 1M3AA 1ZUYA 2BTTA 3EHQA 3TVTA 4J9FA 1H8KA 1SHFA 2LNHB 2DMOA 1UTIA 2GTOA 3UA6A 2LQWA 2FPDA 1W70A 1PKTA 2RMOA 2CUBA 2M0YA 2GNCA 1AWJA 2IIMA 2CT3A 1VYVA 2HEQA 1BB9A 4WCIA 1GBQA 1WXUA 1VA7A 5HCKA 2K7AA 4A63B 1E7OA 2ED1A 4LUEA 1WI7A 3H41A 4AFSC 2GTJA 1A0NB 1NLPC 2DRMA 1TUDA 2AZVA 2MOXA 1WA7A 2AKKA 3TSZA 1M30A 1S1NA 2V1RA 2J6KA 3M0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9D A;  4JJD A;  1NLO C;  2ED0 A;  4LE9 A;  3CQT A;  2CRE A;  1BU1 A;  3EG1 A;  1YNZ A;  2YUQ A;  2EYW A;  2RQW A;  1W6X A;  4CC4 B;  2KYB A;  1IO6 A;  2ESW A;  2YUP A;  1NG2 A;  4HVU A;  5EC7 A;  2A28 A;  4OMM A;  1PHT A;  1OEB A;  2RPN A;  1KJW A;  2DL4 A;  3I5S A;  2M51 A;  3I5R A;  1B07 A;  2RF0 A;  2EVR A;  2K9G A;  2DL7 A;  1K1Z A;  2O9S A;  1M27 C;  1YWO A;  1VYU A;  1B3Q A;  1UE9 A;  1KSW A;  2YUN A;  1UG1 A;  2EKH A;  2H8H A;  2C0O A;  2FRW A;  3M0Q A;  1UFF A;  4HXJ A;  1E6H A;  4LUD A;  2EPD A;  1CKA A;  2X3X D;  1I0C A;  5I11 A;  2BZ8 A;  2KNB B;  4J9G A;  4D8D A;  3ULR B;  2PNI A;  1YCS B;  2I0N A;  2KRN A;  4GBQ A;  1SEM A;  2AKL A;  2J05 A;  3UF4 A;  2EW3 A;  4OMN A;  2K3B A;  2HCK A;  1AWX A;  2KGT A;  2DL3 A;  1UEC A;  3C0C A;  1M3B A;  1QWF A;  1YWP A;  2DM1 A;  2P4R A;  3M0U A;  4RTZ A;  4RTV A;  1RLQ C;  2KBT A;  1Y0M A;  3FJ5 A;  1WLP B;  1NYG A;  3LH5 A;  2JW4 A;  1X43 A;  1K9A A;  2KXD A;  3H0I A;  3M0S A;  2A37 A;  4GLM A;  2RQU A;  2FPF A;  1YP5 A;  1JQQ A;  1PRM C;  1PNJ A;  3A98 A;  2YSQ A;  3VS1 A;  2VKN A;  4IIM A;  3REB B;  3VRY A;  2RNA A;  1Z9Q A;  2D8J A;  2LP5 A;  5GJW B;  1WXT A;  2PTK A;  2KXC A;  1UGV A;  4AFU C;  1Y57 A;  1BBZ A;  4Z89 A;  4J9B A;  1X6G A;  1X2K A;  2X3W D;  3O5Z A;  2GBQ A;  3ZL7 C;  1AEY A;  4R0K A;  3QWY A;  3PVL A;  1GBR A;  4IIO A;  1H92 A;  2DBM A;  1YN8 A;  3SEM A;  2K2M A;  5IHI A;  1QLY A;  2DL5 A;  2O88 A;  4HVV A;  2EYZ A;  2DL8 A;  3IQL A;  4KRT A;  1GFC A;  1NYF A;  4Z88 A;  4FSS A;  1QCF A;  2LJ0 A;  1PWT A;  2CDT A;  4EIK A;  5FWB A;  3I9Q A;  1WFW A;  4D8K A;  4RTT A;  1PKS A;  2SRC A;  2FRY A;  1KIK A;  3NHN A;  4F16 A;  2D1X A;  2L3P A;  1NM7 A;  3QWX X;  2ROL A;  2L2P A;  2W0Z A;  3M0T A;  4F17 A;  1U5S A;  3REA B;  2EGC A;  4F14 A;  3GBQ A;  4HVW A;  1OPL A;  1FYN A;  2D8H A;  1AD5 A;  2DJQ A;  3I35 A;  2W10 A;  1RUW A;  1WIE A;  1JXO A;  2ABL A;  4HCK A;  3U23 A;  1X27 A;  2V1Q A;  2LQN A;  1WX6 A;  2EQI A;  2LMJ A;  4AFQ C;  1JEG A;  1GCQ C;  4M4Z A;  4JPB W;  1X2Q A;  4OML A;  3VS6 A;  1VYT A;  1GFD A;  4QT7 A;  1K0X A;  2KT8 A;  1EFN A;  3EG0 A;  4RTW A;  2FG0 A;  2A36 A;  4LN2 A;  2LZ6 B;  2DNU A;  2B86 A;  2EBP A;  1J3T A;  5IH2 A;  3VS5 A;  1ZSG A;  1I1J A;  1GCP A;  3VRZ A;  1QWE A;  2JM8 A;  2DYB A;  4LNP A;  2LJ3 A;  1Z9Z A;  5FW9 A;  4J9C A;  2DRK A;  2DE0 X;  2GQI A;  1K4U S;  1M3C A;  1K0S A;  1FMK A;  1WYX A;  4OMP A;  2DBK A;  2JMA A;  2LCS A;  2OJ2 A;  2KT1 A;  2F2X A;  1UJ0 A;  2DX1 A;  3PE0 A;  3VS7 A;  4Z8A A;  1MUZ A;  1UHC A;  2C0T A;  2L0A A;  2KYM A;  1CSK A;  1I07 A;  1LCK A;  3JV3 A;  1GRI A;  2YT6 A;  3PVQ A;  2CSQ A;  1OV3 A;  4RUG A;  4RTU A;  1ABQ A;  2EYX A;  4RTX A;  1BK2 A;  2JXB A;  1SSH A;  3M0P A;  2JT4 A;  1N5Z A;  2DLP A;  1HD3 A;  1NEG A;  3NPF A;  5FWC A;  2DA9 A;  1G2B A;  1WDX A;  2CT4 A;  4AG1 C;  5I22 A;  1UHF A;  2FPE A;  2KR3 A;  1AZG B;  2HDA A;  1SHG A;  1WXB A;  2F2W A;  2FO0 A;  3SHW A;  1M8M A;  1TUC A;  2JM9 A;  3EHR A;  1ARK A;  1QKX A;  3NMZ C;  2ENM A;  5IHN A;  1H3H A;  2O31 A;  1AWW A;  2LX7 A;  4DEY A;  2EGE A;  4CC2 A;  1T0J A;  1U3O A;  1T3L A;  1AVZ C;  2J6F A;  3KFV A;  2MCN A;  1UUE A;  2CH4 W;  1AOJ A;  4JZ3 A;  1XOV A;  5L23 A;  2DF6 A;  2K6D A;  1SRL A;  4J9H A;  2JS0 A;  1TG0 A;  3EG3 A;  2J6O A;  2HSP A;  1GL5 A;  1GCQ A;  2O9V A;  4OMQ A;  2F2V A;  5GJV B;  3VS0 A;  4Y92 A;  4X1V A;  1JU5 C;  2DIL A;  1E6G A;  4J9I A;  1ZUK A;  4ESR A;  2JMC A;  2YDL A;  4JJC A;  4K11 A;  2OAW A;  2NUZ A;  2BZX A;  2CH4 A;  1HSQ A;  1T3S A;  1SRM A;  5IXB A;  5IXF A;  3RBB B;  2QDL A;  3THK A;  1MV3 A;  1U06 A;  2RQT A;  2MIO A;  1V1C A;  2CUD A;  2E5K A;  2OI3 A;  3H0F A;  4AG2 C;  4CC3 A;  2ECZ A;  2BZY A;  2DVJ A;  1SPK A;  2KRO A;  2RQR A;  2HBW A;  2ROT A;  3EG2 A;  3VS3 A;  1X6B A;  2L3S A;  2PZ1 A;  4JZ4 A;  1RI9 A;  3VS2 A;  2AZS A;  1W1F A;  2C0I A;  2KRS A;  2J06 A;  1CKB A;  2KE9 A;  1AWO A;  1ZX6 A;  1ZLM A;  1JXM A;  2KEA A;  1ABO A;  2K79 A;  2KRM A;  2A08 A;  2EYY A;  4DEX A;  2SEM A;  4ZNX A;  1QKW A;  2NWM A;  2RN8 A;  1AZE A;  4ORZ A;  3VS4 A;  4CC7 A;  2O2O A;  4E6R A;  3UA7 A;  2D0N A;  1G83 A;  1NEB A;  2RQV A;  1ZBJ A;  2FEI A;  2YUO A;  1MV0 B;  1UJY A;  2VWF A;  1ZUU A;  2LJ1 A;  4AFZ C;  2CSI A;  2L3Q A;  4J9E A;  4OMO A;  3H0H A;  3UAT A;  2JS2 A;  4JJB A;  3RNJ A;  1T0H A;  5IHK A;  3EGU A;  2EGA A;  2G6F X;  1KFZ A;  2VVK A;  2XMF A;  2J7I A;  1HJD A;  3NGP A;  5ECA A;  3TSW A;  1X69 A;  3R6N A;  1UDL A;  1OPK A;  2GGR A;  1PRL C;  1RLP C;  1JO8 A;  1OOT A;  4RTY A;  2JTE A;  1K76 A;  2AK5 A;  1M3A A;  1ZUY A;  2BTT A;  3EHQ A;  3TVT A;  4J9F A;  1H8K A;  1SHF A;  2LNH B;  2DMO A;  1UTI A;  2GTO A;  3UA6 A;  2LQW A;  2FPD A;  1W70 A;  1PKT A;  2RMO A;  2CUB A;  2M0Y A;  2GNC A;  1AWJ A;  2IIM A;  2CT3 A;  1VYV A;  2HEQ A;  1BB9 A;  4WCI A;  1GBQ A;  1WXU A;  1VA7 A;  5HCK A;  2K7A A;  4A63 B;  1E7O A;  2ED1 A;  4LUE A;  1WI7 A;  3H41 A;  4AFS C;  2GTJ A;  1A0N B;  1NLP C;  2DRM A;  1TUD A;  2AZV A;  2MOX A;  1WA7 A;  2AKK A;  3TSZ A;  1M30 A;  1S1N A;  2V1R A;  2J6K A;  3M0R A; 
#chains in the Genus database with same CATH topology
 2HAX A;  1NLO C;  3CQT A;  4LDY A;  2AIR B;  4F7U A;  3FB9 A;  3CCJ Q;  2JN0 A;  4R56 A;  4C92 D;  4M7A D;  4PJN A;  3CCJ T;  1MND A;  3HPW A;  3GOX A;  2RQW A;  4ATO A;  3MET A;  4EMK A;  5EC7 A;  4GY5 A;  1UEB A;  1IGU A;  3CCS T;  2EWN A;  2RPN A;  4GLK A;  5DY9 A;  3T9N A;  2CYZ B;  2DL4 A;  2YRC A;  3G71 T;  2RF0 A;  4XU1 A;  2EVR A;  2K9G A;  2O9S A;  4KT0 E;  4FM4 B;  1B3Q A;  1KQ1 A;  3CEY A;  1M2O A;  2XG8 D;  1YHQ A;  1LOJ A;  4J7I A;  1UFF A;  1R0C B;  4HXJ A;  1E6H A;  2RO0 A;  4M77 G;  1VQK T;  1N8R R;  4M77 C;  5KYX A;  2BZ8 A;  2A0F B;  4D8D A;  3NTI A;  2E1H A;  5GAN 2;  3ULR B;  4GBQ A;  1KQS S;  2XK0 A;  1SEM A;  5FRO A;  2J05 A;  2EW3 A;  1NJI R;  3CBP A;  2HCK A;  1AWX A;  2KGT A;  1YJW A;  2EQM A;  1UEC A;  1DJ7 B;  3C0C A;  1YWP A;  3M0U A;  2P4R A;  3CCU A;  3S3N A;  2C06 A;  1VQ6 Q;  2XID A;  5HKC A;  2QEX T;  2H3J A;  3FJ5 A;  2MYS A;  4LXC A;  1K9A A;  2KXD A;  1IRX A;  2L89 A;  4LD6 A;  3HRU A;  1YP5 A;  4F7U E;  1PNJ A;  3A98 A;  3JSC A;  3REB B;  3X28 B;  4FW2 A;  3QSU A;  3E19 A;  4XTX A;  5A0L A;  2KXC A;  3I56 T;  2LNV A;  1VQ9 T;  3WVD B;  4Z89 A;  4J9B A;  1BKB A;  2QA4 T;  3O5Z A;  5FU7 C;  3NFC A;  3EGD A;  1MMN A;  4PLI A;  5CCA A;  4RCC A;  2K2M A;  3CME Q;  5IHI A;  1M8V A;  2EYZ A;  2RHZ A;  1GFC A;  4Z88 A;  1QCF A;  2LJ0 A;  2RD1 A;  4EIK A;  5CR2 A;  4JJN K;  2SRC A;  3OQ5 A;  2FRY A;  1RI0 A;  4KUI A;  4C0D B;  3QWX X;  4C5G A;  2L2P A;  2EGC A;  4OB0 B;  3OBY A;  1ZSZ C;  1G3Y A;  2JTM A;  4HCK A;  3QUI A;  1X75 C;  1X27 A;  2OTL T;  1ZA2 B;  4M7A C;  3SD4 A;  1YIJ A;  2DAQ A;  5GAN j;  4C8Q D;  1GCQ C;  4M4Z A;  4JPB W;  4X9C A;  1TOV A;  2DO3 A;  2JVV A;  5KYX B;  1EFN A;  4RTW A;  3OYD A;  4PJO F;  1U1S A;  4Y91 A;  4DBR A;  4C92 F;  3RKY A;  1ZSG A;  2CZ6 B;  1KD1 C;  2I2L A;  3VRZ A;  3L2Z A;  2M9U A;  2EYQ A;  1M5Q 1;  2CZ1 B;  4BY6 B;  4C92 G;  2JM8 A;  3RKX A;  3SFM A;  1VQ8 T;  1HYO A;  2X4W A;  3URG A;  3LLR A;  4BE2 A;  1Z9Z A;  3TQ7 P;  3L2Q A;  4KBM B;  4J6W A;  3SWN B;  3LWI A;  1M3C A;  3QJ6 A;  5GAN g;  1WYX A;  1NPP A;  2DBK A;  2NUT B;  3OYF A;  1BIB A;  1TU0 B;  5GAM j;  4JDS A;  2VAS A;  2OJ2 A;  3CME A;  2KT1 A;  2F2X A;  4M77 F;  1UJ0 A;  4Z8A A;  4BDY A;  1MUZ A;  2NUT A;  1XNI A;  2HL3 A;  3EFO A;  5KH6 A;  5GAN 5;  4ZGJ B;  1S72 T;  3FEO A;  3H6Z A;  2ZPG B;  3MP1 A;  2HQE A;  1ABQ A;  4EMK C;  4OMF B;  1VQN T;  1Y07 A;  3OA6 A;  1HD3 A;  4DA4 A;  3V7S A;  2DA9 A;  1G2B A;  3HKS A;  3CCE A;  3R6O A;  2FPE A;  2HDA A;  3JCM f;  3OYA A;  1YIJ Q;  1SKU B;  3L2U A;  1YIT T;  2E5Q A;  2Y4Y A;  1QKX A;  1WHK A;  4KUD K;  1WHG A;  4JRK A;  5IHN A;  1TSF A;  2O31 A;  2KY9 A;  4OVA A;  1VQ7 T;  1AWW A;  2ZGW A;  4QKU A;  4DEY A;  4EMH A;  4CC2 A;  2EQU A;  1T0J A;  4FYW B;  3SDZ A;  1QCO A;  4LDU A;  2VGM A;  4M78 D;  1UUE A;  2X51 A;  1VQL Q;  2NUP B;  3ASK A;  3L2W A;  2GFU A;  2RHX A;  4J9H A;  1TXQ A;  3EG3 A;  2J6O A;  3LWH A;  1GCQ A;  2O9V A;  4OMQ A;  1VQO A;  4PJJ A;  1M1G A;  5FU7 B;  1E6G A;  1ZUK A;  5KYN A;  4K11 A;  3G6E Q;  2NUZ A;  2OAW A;  1HSQ A;  2F5K A;  4C8Q E;  4QQD A;  2E3I A;  2RQT A;  1V1C A;  3JB9 F;  2E5K A;  3ZFJ A;  2HNI A;  1IRE B;  2LC4 A;  2LT4 A;  3D7S B;  3EG2 A;  1Q86 U;  3VS3 A;  5DLO A;  5GAN 4;  1VQ5 Q;  2AZS A;  2KRS A;  1EZZ B;  1NJI U;  1CKB A;  3CCR A;  1YJN A;  2FL7 A;  1BIA A;  3CC7 T;  1ABO A;  5D6W A;  2A08 A;  4DEX A;  2KI7 A;  3M56 A;  2FHD A;  1Q82 C;  1RAE B;  2E10 A;  3CC7 A;  3JB9 H;  4XTW A;  3CPF A;  3M4G A;  1C6V X;  3C12 A;  4PJO D;  1G83 A;  1NEB A;  2LX9 A;  1ZBJ A;  2RQV A;  3L42 A;  1MV0 B;  4N0A C;  4X9D A;  2DET A;  2QQ9 A;  3P8B B;  4J6X A;  1WGS A;  2LJ1 A;  4AFZ C;  2QQB A;  2QQS A;  2L3Q A;  2GFA A;  4IUT A;  3JCM h;  2DEQ A;  1FXX A;  1NJI C;  3O8V A;  1K73 R;  5GAN 7;  2PVO B;  2XDD A;  3RNJ A;  1B34 A;  3ZBD A;  4PL6 A;  4KH1 B;  1LPL A;  3CD6 A;  3CCU T;  1Q82 U;  2EGA A;  3Q1J A;  5KYU A;  5A0G A;  2OX7 A;  3OYE A;  4M77 B;  3E2U A;  1D1C A;  1OPK A;  1MMD A;  2GGR A;  4MZT A;  3JCM P;  2LQ8 A;  2QXF A;  1M1K U;  4RTY A;  3CC4 Q;  2JTE A;  5LJ5 f;  5GAO q;  1M3A A;  3EHQ A;  6AT1 B;  4J9F A;  2WSE E;  3OY9 A;  4C8Q C;  3E9F A;  4FSX A;  1WHJ A;  2GTO A;  3HFN A;  3UA6 A;  3CC4 T;  2K3Y A;  2GNC A;  2DIG A;  4JRI A;  4E7H A;  2IIM A;  4A4H A;  4EMK B;  1VYV A;  4XU2 A;  1UGS B;  4FCY A;  1BB9 A;  3QZ5 B;  4C5H A;  3M4Y A;  3MEA A;  1VA7 A;  1Y7X A;  3E1S A;  3JB9 G;  2RJF A;  5LJ3 e;  4LUE A;  2E64 A;  3OW2 P;  4ELZ C;  2GTJ A;  1A0N B;  5GAM h;  1NLP C;  2DRM A;  2AZV A;  4HKE A;  3CCL T;  1M30 A;  2V1R A;  2J6K A;  4ANJ A;  3CCJ A;  1GFD A;  3M0R A;  4JJD A;  3WXM B;  1RAA B;  5I2S A;  5GMK i;  4M7D C;  1N9R A;  4M78 F;  2ZAE A;  1RAB B;  3FJP A;  1YNZ A;  5GMK m;  2AHJ B;  3RIR A;  3OS2 A;  2HQX A;  3QZ9 B;  2KYB A;  1IO6 A;  2ESW A;  2YUP A;  4HVU A;  3CXC A;  3JCM e;  1Q82 R;  3OYN A;  7AT1 B;  1OEB A;  4OGC A;  3I5R A;  2DL7 A;  1JJ2 S;  4RG8 A;  1VQM A;  2BE9 B;  3X20 B;  3J7A F;  1KSW A;  3AHU A;  3OYM A;  2EKH A;  2DKG A;  2H8H A;  3JB9 D;  5IT9 E;  3CPW S;  2EKO A;  3CCM Q;  2M0O A;  2EQK A;  1OX9 A;  1X01 A;  3L1A A;  4NL3 A;  3QO3 A;  5KYU B;  3MO8 A;  2X3X D;  2KNB B;  1KHC A;  2Y4X A;  2I0N A;  2AKL A;  2LQK A;  5GAN d;  2JTF A;  3I55 A;  2ATC B;  2K3B A;  2DL3 A;  1M3B A;  3OS0 A;  5CIU A;  2KBT A;  4BE0 A;  1WLP B;  1M1F A;  3CPW P;  3M0S A;  1M1K C;  4BI8 B;  3CC2 A;  1I5O B;  3OYB A;  3BW1 A;  3A8O B;  3VS1 A;  2VKN A;  1WQ7 A;  4DOV A;  1Z9Q A;  2D8J A;  4ZTF A;  1QW1 A;  4M7D E;  2PTK A;  4PJO B;  1UGV A;  3JCM J;  1BBZ A;  1YCY A;  2D6F A;  3M57 A;  3QWY A;  1GBR A;  3G4S Q;  2JOY A;  1P92 A;  3SEM A;  2FB7 A;  2M16 A;  2O88 A;  4IUV A;  2DL8 A;  3IQL A;  4KRT A;  1D3B B;  1GXI E;  2X35 A;  1PWT A;  5FWB A;  3CCS Q;  1ZQ1 A;  4PFO A;  2V8J A;  3EH1 A;  1S72 Q;  2QAZ A;  3CCL A;  4B9W A;  4MMK A;  3GNG A;  4HVW A;  3QYG B;  1G3W A;  2D8H A;  1NPR A;  5IN1 A;  1U1T A;  1BCO A;  5GMK j;  1RUW A;  1MNE A;  1Q86 R;  1RAF B;  1V76 A;  3M59 A;  2PVG B;  2NUP A;  2V1Q A;  1BI3 A;  2IG0 A;  1K9M C;  3EFS A;  2EQI A;  2DD4 A;  4PJO E;  3CCV A;  4M75 E;  3MEU A;  2LVM A;  1K8A U;  3VS6 A;  1X2Q A;  4OML A;  1VQ8 Q;  5GAN h;  2DEU A;  2KT8 A;  4RCB A;  2B86 A;  2EBP A;  2G3R A;  1ZHI A;  1J3T A;  3J81 E;  3S3M A;  3VS5 A;  2MWP A;  3QDF A;  4B9X A;  1GCP A;  1D1B A;  4KH0 B;  2E65 A;  1VQ5 T;  2DE0 X;  1YFN A;  3VU3 C;  1QVG S;  2RH2 A;  2HBP A;  4OMP A;  5LJ3 f;  5FU6 B;  2GQV A;  2JJ9 A;  1QVG P;  4LDW A;  1Y71 A;  2LCS A;  5LJ3 g;  3PE0 A;  9ATC B;  1VQ9 Q;  2XDP A;  3NTK A;  5EG2 A;  3TEE A;  1CSK A;  3GIB A;  1PSF A;  4L5G A;  2RI5 A;  2CSQ A;  3KUF A;  4C0F A;  1OV3 A;  3S3O A;  1EX4 A;  3A8M B;  3MCA B;  1SSF A;  4BE1 A;  2ZPF B;  2EYX A;  3I56 A;  1BK2 A;  3LYI A;  5CKF A;  2MPX C;  4KGZ B;  3NPF A;  2CT4 A;  5I22 A;  3CD6 T;  1N8R C;  2DTI A;  3V7C A;  1SHG A;  2K5L A;  4C5E A;  4PJO A;  1KC8 C;  2F2W A;  5A2Q E;  2O4X A;  3SHW A;  4M75 A;  3TCJ A;  1VQL T;  3V8K A;  5KE2 A;  1WPY A;  1Q95 G;  4O6J A;  4Q5W A;  1VQL A;  3LGF A;  1ARK A;  3KBG A;  3NMZ C;  4XQ3 A;  5KCH A;  3V8L A;  4WTO B;  5GAN 3;  3PIO A;  1OU8 A;  2EGE A;  3HP9 A;  1U3O A;  3E9G A;  3G4S T;  2MCN A;  1AVZ C;  2J6F A;  1HXD A;  3EGX B;  3P8D A;  1YBY A;  2DZ9 A;  5M9O A;  2JS0 A;  3CCV Q;  3CCQ A;  4C8Q B;  4NL2 A;  4M78 C;  2F2V A;  2HKQ B;  2HD0 A;  2RB6 A;  1G5V A;  2EQJ A;  2JMC A;  2YDL A;  2YRD A;  3QHS A;  2BZX A;  1K8A C;  4M7D G;  1SG5 A;  2L3R A;  3M54 A;  3OS5 A;  5IXB A;  4BDZ A;  4PLL A;  3THK A;  1UGR B;  1QQJ A;  3H0F A;  2V8I A;  4A4E A;  4AG2 C;  2ECZ A;  3DB3 A;  2PVD B;  1KD1 U;  1RAI B;  2RQR A;  2HBW A;  2ROT A;  2VB6 A;  4HCC A;  3JCM X;  1X6B A;  4M7D B;  2ZPE B;  3QDR B;  3JCM g;  1WJR A;  4ZGD B;  1AWO A;  3INZ A;  2R5A A;  1ZX6 A;  1JXM A;  1VQP T;  1H3Z A;  2SEM A;  4J6Y A;  4M77 D;  2MAM A;  3CCR Q;  1YJN Q;  2Z0W A;  4C92 A;  3UA7 A;  2CP2 A;  5CKE A;  2YUO A;  2FEI A;  3UT1 A;  1OI1 A;  3JCM W;  4OF1 A;  1ZUU A;  1OU9 A;  4HCB A;  4F7U F;  2CP3 A;  2QG9 B;  4YTL A;  1VQP Q;  3A5Z B;  4V2S A;  3JAM E;  3VUZ A;  3UAT A;  1UGP B;  5FRN A;  2JS2 A;  5IHK A;  2VC8 A;  1OQK A;  3L2R A;  3CCE T;  4JUV A;  2RJE A;  1I4K 1;  3NGP A;  1RL2 A;  1X69 A;  3R6N A;  1RLP C;  1OOT A;  1K73 C;  1S72 A;  2HKN A;  2K5I A;  3RER A;  1OZ3 A;  3FDR A;  2BTT A;  5D7U A;  2RI2 A;  3C95 A;  5GAN 6;  1SHF A;  1UTI A;  3RES A;  2BKD N;  2ZZD A;  3CME T;  2QK0 A;  4XTZ A;  4BB7 A;  1W70 A;  1VQ4 T;  2MWO A;  2COW A;  1YIJ T;  2FZK B;  2E3H A;  3RKW A;  4M78 A;  2MMP A;  4F7U G;  5DLQ E;  2CKK A;  2MI6 A;  2OTL A;  2MF2 A;  2X9H A;  5HCK A;  1WXU A;  4A63 B;  2FZC B;  2ED1 A;  3OW2 S;  4BI4 A;  2YHT A;  3H41 A;  4AFS C;  1O9S A;  2YLB A;  1KG1 A;  4X34 A;  2EIF A;  2AKK A;  2LCC A;  1ZSZ B;  3EG9 A;  1K8A R;  4R55 A;  2H3E B;  4J9D A;  2ED0 A;  3LX7 A;  2ZPH B;  2ZPB B;  4MDW A;  4M7A B;  2CRE A;  1BU1 A;  2XI9 A;  3OBW A;  3EG1 A;  4XAX B;  4BI3 A;  1TS9 A;  3CBM A;  1W6X A;  2DER A;  2RI3 A;  3FIF A;  4M75 C;  3HHT B;  1NG2 A;  2A28 A;  1PHT A;  2XIC A;  3GLX A;  4XTV A;  1C1A A;  3RMQ A;  4BY6 C;  1YWO A;  2JNG A;  2RM4 A;  1BCM A;  4M77 A;  3CXC S;  1PM3 A;  4E7K A;  3ME9 A;  2COY A;  2FRW A;  3JB9 I;  4LD9 K;  1CKA A;  5LJ5 j;  2CS7 A;  1I0C A;  4M78 E;  2PNI A;  2KRN A;  1MMA A;  1IZ6 A;  1TUG B;  3CBO A;  4M7A E;  3UF4 A;  2OTL Q;  2ZCF B;  2VYT A;  2DM1 A;  4RTZ A;  1JJ2 P;  2A7Y A;  5DM7 R;  1TTH B;  3LH5 A;  1QP2 A;  3OYH A;  1K73 U;  2QI2 A;  2QTV A;  2XD0 A;  3A1P A;  3I56 Q;  1JQQ A;  1PRM C;  2YRV A;  4M75 G;  5GAM f;  4PJM A;  4JS5 A;  1FMV A;  2YWW A;  3N5B B;  2CZ0 B;  3CMA Q;  3CC4 A;  1VQK Q;  3CC2 Q;  5KYW A;  2K4Y A;  5GJW B;  2LP5 A;  1QVG A;  4JLG A;  2BUD A;  1N6A A;  3MEW A;  2NYS A;  1VQ4 A;  4AFU C;  1KQS A;  2CP5 A;  2O01 E;  5LL6 S;  2K2V A;  4EMG A;  2X3W D;  2GBQ A;  5CQX A;  3UWN A;  1KQ2 A;  3ZL7 C;  4C92 C;  2KQW A;  3PVL A;  1PD1 A;  4IIO A;  4Y28 E;  1VQ6 T;  2DBM A;  2YXY A;  2DL5 A;  4HVV A;  5GMK h;  2Y90 A;  2RHY A;  1Q7Y U;  1NYF A;  4F04 B;  4HT9 A;  4B6M A;  1KHI A;  3V8J A;  1YI2 Q;  4D8K A;  1G3S A;  4L6V 5;  4RTT A;  2VXF A;  4FIB A;  1KIK A;  3HRS A;  3NHN A;  1VQ7 A;  2D1X A;  1KC8 R;  1QP3 A;  2ROL A;  1RAD B;  2W0Z A;  1KD1 R;  3HL8 A;  4F17 A;  3REA B;  3GBQ A;  1FYN A;  1FMW A;  4XTY A;  3VUB A;  4M7A A;  1YIT A;  3MHX A;  3A8G B;  2W10 A;  1O75 A;  2ABL A;  3EGX A;  5I21 A;  1Q81 C;  2M1H A;  1Q7Y C;  3OYC A;  2LDM A;  3M55 A;  1RAG B;  1WX6 A;  1HK9 A;  3H8Z A;  4J83 A;  1ZSZ A;  4FW1 A;  1JEG A;  3EAE A;  4J8O A;  4QT7 A;  4EDU A;  1G3T A;  3FLG A;  3CCM T;  4QQ6 A;  3MKD A;  3EG0 A;  4KGX B;  4M78 B;  4F7U B;  2X4Y A;  4OP0 A;  2DJZ A;  4BUG A;  2DNU A;  2LZ6 B;  1YI2 A;  2V8K A;  1WJS A;  4QVD A;  1OZ2 A;  1VOM A;  3OYL A;  3C4S A;  1I1J A;  4OB3 B;  1QWE A;  2MK5 A;  3RR6 A;  2QTX A;  4BD3 A;  1G8X A;  1I5L A;  4J9C A;  2DRK A;  2GQI A;  1K4U S;  5CKB A;  2DXB A;  4IUQ A;  3PFS A;  4O5V A;  3GNF B;  3RMS A;  3UPU A;  3C94 A;  5LJ3 d;  3OYJ A;  1D09 B;  1N8R U;  3JCM c;  2P0P A;  5CQY A;  1UHC A;  2C0T A;  4XU3 A;  5D6X A;  4E47 A;  1NE8 A;  2KYM A;  1LCK A;  2E6N A;  3JV3 A;  1FX7 A;  2P0Q A;  3QJY A;  2YT6 A;  2HMA A;  5LJ5 d;  3BY7 A;  1YI2 T;  4JLI A;  5KYY B;  1W2B S;  2ZPI B;  2RHU A;  4VUB A;  3AT1 B;  4N4H A;  1M1K R;  1XJW B;  1SSH A;  3M0P A;  4JS4 A;  1N5Z A;  5LJ3 h;  1YIT Q;  1NZ9 A;  3MP8 A;  1UHF A;  4IUR A;  2DIQ A;  2LRQ A;  2P0K A;  1I8F A;  1MHN A;  2OTJ A;  3I55 Q;  2CP7 A;  4DBQ A;  3OYI A;  3EHR A;  2PUK B;  2DXC A;  4M78 G;  1M90 R;  2EAY A;  1AHJ B;  2K5F A;  2KVQ G;  1H3H A;  2JZ2 A;  3OB9 A;  4A4G A;  1D0Y A;  1AOJ A;  4JZ3 A;  1XOV A;  4XTU A;  4ME7 A;  4FT2 A;  2DF6 A;  4HT8 A;  3CXC P;  3FRN A;  5J39 A;  1PD0 A;  5HK3 A;  1OX8 A;  3OYK A;  3CCE Q;  3CCQ T;  2HSP A;  1GL5 A;  4IUP A;  5GAN e;  1K9M U;  3VS0 A;  5GJV B;  3VYH B;  4Y92 A;  3G6E T;  4ESR A;  3JB9 J;  4JJC A;  4C0D C;  4HA8 A;  4HCZ A;  5KYW B;  1VQM T;  2FZG B;  3G4S A;  5IAY A;  1C0M A;  1SRM A;  3ZEH A;  1QVF A;  3RBB B;  4XK8 E;  1MV3 A;  1U06 A;  2EJF A;  3EGD B;  1IB8 A;  2BIV A;  2CUD A;  1UGQ B;  2OI3 A;  4RKU E;  4C0Z A;  1TH7 A;  2BZY A;  3JCM Q;  2KRO A;  3TU4 K;  2L8D A;  4ZN1 A;  5LJ5 e;  1YJW Q;  1Q81 R;  1I81 A;  3M58 A;  2L3S A;  1VQ6 A;  3VS2 A;  4E7S A;  1VQO Q;  2KEA A;  4M7D D;  2K79 A;  2HQH A;  4N0A A;  5GAO p;  4N4G A;  1YJ9 A;  2P4T A;  3TRE A;  4ZNX A;  1QKW A;  4M75 B;  5FLX E;  2NWM A;  4PFP A;  2CP6 A;  1YJ9 T;  1AZE A;  3DLL A;  4ORZ A;  4CC7 A;  2CP0 A;  2O2O A;  1R8O B;  3CCR T;  1YJN T;  2D0N A;  1UJY A;  4ZN3 A;  3SWN C;  2QQA A;  3BE3 A;  5AT1 B;  2YLC A;  5A0D A;  1PC0 A;  1Q7Y R;  5HY6 A;  3MJX A;  2F5T X;  2DYI A;  3EGU A;  3SB2 A;  2JUF A;  2G6F X;  1KFZ A;  1QVP A;  2LCL A;  2PUO B;  3P8H A;  1KC8 U;  3JCM b;  2QQR A;  5ECA A;  1HJD A;  3TSW A;  1AT1 B;  1UDL A;  3QYH B;  1B34 B;  1JO8 A;  4C8Q A;  4QVZ A;  8AT1 B;  1VQ7 Q;  1K76 A;  3WVE B;  5CKD A;  4J5Y A;  1VQ9 A;  1PG5 B;  1WJQ A;  2LQW A;  2R58 A;  1QVF P;  2FPD A;  1VIF A;  2RMO A;  2CUB A;  3HSB A;  4E7J A;  2M0Y A;  1AWJ A;  2V26 A;  4RG2 A;  2HEQ A;  5I2M A;  4DBH A;  4WCI A;  3CD6 Q;  2K7A A;  4OB1 B;  1E7O A;  1VQ5 A;  3LGL A;  2F1L A;  2E70 A;  3OW2 A;  1M90 C;  3CC2 T;  3VV0 A;  3V7R A;  2MOX A;  3UDC A;  4AMC A;  5J3B A;  5GAM e;  1YJW T;  3M5A A;  4FYV B;  4C92 B;  4IKF A;  5KYY A;  4LE9 A;  3GPL A;  1VUB A;  3G1J A;  1W2B A;  1QMC A;  3EFO B;  4NS5 A;  2KSS A;  1RAH B;  2YUQ A;  4FT4 A;  3F70 A;  4DQ2 A;  4A4F A;  2EYW A;  4ZGE B;  1M90 U;  2D9T A;  4M7D A;  4CC4 B;  3PTA A;  1IHV A;  1UB4 A;  2BE7 D;  4OMM A;  2QGG A;  2KK4 A;  4A4K A;  1KJW A;  1M2V A;  1PCX A;  3I5S A;  2M51 A;  1B07 A;  2DVE A;  1K1Z A;  1XQH A;  4C8Q F;  1M27 C;  3SWN A;  1VYU A;  4II1 A;  5LJ5 g;  1UE9 A;  2YUN A;  1UG1 A;  4OGE A;  3CCS A;  2EJG A;  3MPU B;  3MEV A;  2C0O A;  4PJO G;  1D1A A;  4FYY B;  3M0Q A;  4ELY C;  5FU6 C;  3A8H B;  4LUD A;  4MDX A;  3PGG A;  2DFU A;  2EPD A;  3PIP A;  1BI0 A;  5I11 A;  4J9G A;  5AYF A;  1YCS B;  2GF7 A;  4AT1 B;  3QPH A;  3BDU A;  3OMC A;  1F1B B;  4OMN A;  5GAN f;  1VQP A;  2FYK A;  1QWF A;  4M7D F;  3PT9 A;  3DB4 A;  4RTV A;  3VYG A;  1RLQ C;  1Y0M A;  3CMA A;  4LDX A;  3RUX A;  2IPO B;  2WSF E;  1NYG A;  2JW4 A;  3JCM d;  5GAO l;  1X43 A;  3H0I A;  2A37 A;  5CVI A;  4GLM A;  2RQU A;  2FPF A;  5GAN 8;  3CPW A;  5GAM d;  4PFZ A;  2YSQ A;  4IIM A;  3BDL A;  1ZA1 B;  2LT1 A;  3VRY A;  1JJ2 A;  2RNA A;  2WAC A;  1WXT A;  4CRI A;  2E12 A;  4PKC C;  1Y57 A;  2QA4 Q;  1D3B A;  1X6G A;  1X2K A;  3GF5 A;  5LJ5 h;  4M75 D;  5KCO A;  2B8A A;  1AEY A;  4R0K A;  2RK2 A;  2L5Q A;  1H92 A;  3PNW C;  1YN8 A;  1K9M R;  4BAC A;  4A54 A;  2PQW A;  1H64 1;  4DOW A;  1QLY A;  2KDS A;  5GMK l;  3G71 Q;  2X4J A;  1Q81 U;  1VQM Q;  4FSS A;  1BYM A;  3DKM A;  4M77 E;  2F69 A;  2CDT A;  2VUB A;  3I9Q A;  2DTO A;  2QGF B;  1WFW A;  1PKS A;  3X26 B;  4F16 A;  2L3P A;  1IXD A;  1NM7 A;  2XKO C;  2FVU A;  5C6S A;  4E2F B;  4Z02 A;  3M0T A;  1U5S A;  4C8Q G;  4F14 A;  1OPL A;  3OS1 A;  1AD5 A;  2DJQ A;  3I35 A;  4DBF A;  1N9S A;  1WIE A;  1JXO A;  3QII A;  3EG9 B;  4UC4 A;  3U23 A;  3QG1 A;  3HFO A;  3VKI A;  2LQN A;  2VGN A;  2LMJ A;  3BFM A;  4AFQ C;  1KQS P;  4RMO A;  1BI2 A;  3M53 A;  1K0X A;  1PSE A;  1VYT A;  3GP8 A;  4EPC A;  2EJ9 A;  2FG0 A;  1EIF A;  3KXT A;  2A36 A;  4LN2 A;  3QXE B;  1IHW A;  5IH2 A;  1MGQ A;  3QKJ A;  3HTR A;  1ZBX A;  1SF9 A;  2K57 A;  1FWZ A;  5L8R E;  2DYB A;  1Q86 C;  4LNP A;  1D0X A;  2LJ3 A;  5FW9 A;  4LDV A;  3OSV A;  1YHQ T;  1M2V B;  1K0S A;  1FMK A;  4JRP A;  3OMG A;  1N27 A;  2JMA A;  2KMT A;  2DX1 A;  3VS7 A;  2XHC A;  3G71 A;  3QBY A;  4QW2 A;  2L0A A;  4NOY A;  1I07 A;  1M4Z A;  2RA2 A;  1GRI A;  2DXU A;  3MP6 A;  3PVQ A;  1VQO T;  2AT1 B;  5GAM g;  3VJP A;  4RUG A;  4RTU A;  3L2V A;  3PMT A;  4RTX A;  2JXB A;  4N4I A;  2E41 A;  2JT4 A;  2DLP A;  3CCV T;  4PK4 A;  1NEG A;  2QYZ A;  4TVR A;  5FWC A;  1B7T A;  1WQW A;  2RJD A;  1WDX A;  4AG1 C;  2IVW A;  2KR3 A;  1AZG B;  4KGV B;  1JRI A;  1WXB A;  2R5M A;  2DK3 A;  2FO0 A;  3G7Z A;  1M8M A;  1TUC A;  2XDB A;  1M9S A;  3ER0 A;  2JM9 A;  2DZC A;  3CCL Q;  1WHL A;  2RHI A;  4PJO C;  2KAF A;  2ENM A;  2R57 A;  2QEX A;  1D0Z A;  2OTJ T;  1NBE B;  5GMK e;  2M02 A;  1WZO A;  2LX7 A;  1W2B P;  2O4X B;  1X6O A;  4J7F A;  1KK7 A;  1T3L A;  2DXT A;  3KFV A;  3OYG A;  5FRM A;  2CH4 W;  4M7A F;  2LTO A;  5L23 A;  4QVC A;  3G6E A;  2K6D A;  1SRL A;  2HZY A;  1VQK A;  1TG0 A;  4M75 F;  3PMI A;  3HRT A;  3JCM V;  5KE3 A;  4X1V A;  1JU5 C;  1R77 A;  1BI1 A;  2DIL A;  2X4X A;  4J9I A;  1QCN A;  1QVF S;  2CH4 A;  4D6W A;  2OAU A;  2QAS A;  4FL6 A;  1T3S A;  5CAI A;  1JB0 E;  5IXF A;  2QDL A;  2MIO A;  2PU9 B;  4CC3 A;  2DPP B;  2QDY B;  4C0G A;  2DVJ A;  1SPK A;  1YJ9 Q;  2XU8 A;  4E7I A;  4QQG A;  1WHM A;  5LJ3 j;  1Y96 A;  3NTH A;  4MML A;  3S6W A;  1LVK A;  4C5I A;  1MMG A;  2PZ1 A;  4JZ4 A;  1RI9 A;  3X25 B;  1OUL A;  1W1F A;  2C0I A;  2J06 A;  3OSS C;  2KE9 A;  3M9Q A;  4E7Z A;  1ZLM A;  2KRM A;  2EYY A;  3OYY A;  3CCM A;  2RN8 A;  3VS4 A;  4E6R A;  1WNL A;  1LNX A;  4PNO A;  4L59 A;  1Y96 B;  5CKH A;  2VWF A;  3CC7 Q;  1IGQ A;  2COZ A;  4FU6 A;  4FYX B;  2CSI A;  4J9E A;  3RDV A;  2VV5 A;  4OMO A;  3H0H A;  2VXE A;  5GAO n;  4JJB A;  2HSE B;  1T0H A;  2CZ7 B;  2DTH A;  1ACM B;  2E6Z A;  2HL5 C;  2GCX A;  2WSC E;  3CCQ Q;  5D6Y A;  1RAC B;  4A53 A;  2P84 A;  4CI0 C;  2VVK A;  2XMF A;  1R0B G;  1JBM A;  3I55 T;  2J7I A;  2QEX Q;  4IUU A;  5CO7 A;  3DLM A;  5CK9 A;  3X24 B;  1VQN A;  1U8R A;  4M7A G;  1PRL C;  3J80 E;  2K3X A;  4MZP A;  3H9N A;  2RJC A;  3CCU Q;  1OYX A;  1YHQ Q;  2AK5 A;  2RK1 A;  1ZUY A;  2E4H A;  2OTJ Q;  2CGH A;  4E7L A;  3TVT A;  8ATC B;  1TWB A;  4KUL A;  1H8K A;  3A8L B;  1XTD A;  2LNH B;  2NLU A;  5GAO m;  2QA4 A;  2EFI A;  2DMO A;  3EFR A;  2D0Q B;  4ZTJ A;  4P5N A;  4JRQ A;  1LJO A;  1PKT A;  3EH2 A;  2CT3 A;  4WF2 A;  5J26 A;  5HK0 A;  3FC3 A;  1GBQ A;  3LW5 E;  2A3L A;  4PJL A;  3JRZ A;  4OB2 B;  1V29 B;  2DD5 A;  1WI7 A;  1VQ8 A;  5C0M A;  1VQ4 Q;  1TUD A;  1VQN Q;  4XU0 A;  3CMA T;  1WA7 A;  5GAO r;  4C92 E;  1W4S A;  3TSZ A;  3LH0 A;  1VIE A;  1WHH A;  1S1N A;  4MZM A; 
#chains in the Genus database with same CATH homology
 4J9D A;  4JJD A;  1NLO C;  2ED0 A;  4LE9 A;  3CQT A;  2CRE A;  1BU1 A;  3EG1 A;  1YNZ A;  2YUQ A;  2EYW A;  2RQW A;  1W6X A;  4CC4 B;  2KYB A;  1IO6 A;  2ESW A;  2YUP A;  1NG2 A;  4HVU A;  5EC7 A;  2A28 A;  4OMM A;  1PHT A;  1OEB A;  2RPN A;  1KJW A;  2DL4 A;  3I5S A;  2M51 A;  3I5R A;  1B07 A;  2RF0 A;  2EVR A;  2K9G A;  2DL7 A;  1K1Z A;  2O9S A;  1M27 C;  1YWO A;  1VYU A;  1B3Q A;  1UE9 A;  1KSW A;  2YUN A;  1UG1 A;  2EKH A;  2H8H A;  2C0O A;  2FRW A;  3M0Q A;  1UFF A;  4HXJ A;  1E6H A;  4LUD A;  2EPD A;  1CKA A;  2X3X D;  1I0C A;  5I11 A;  2BZ8 A;  2KNB B;  4J9G A;  4D8D A;  3ULR B;  2PNI A;  1YCS B;  2I0N A;  2KRN A;  4GBQ A;  1SEM A;  2AKL A;  2J05 A;  3UF4 A;  2EW3 A;  4OMN A;  2K3B A;  2HCK A;  1AWX A;  2KGT A;  2DL3 A;  1UEC A;  3C0C A;  1M3B A;  1QWF A;  1YWP A;  2DM1 A;  2P4R A;  3M0U A;  4RTZ A;  4RTV A;  1RLQ C;  2KBT A;  1Y0M A;  3FJ5 A;  1WLP B;  1NYG A;  3LH5 A;  2JW4 A;  1X43 A;  1K9A A;  2KXD A;  3H0I A;  3M0S A;  2A37 A;  4GLM A;  2RQU A;  2FPF A;  1YP5 A;  1JQQ A;  1PRM C;  1PNJ A;  3A98 A;  2YSQ A;  3VS1 A;  2VKN A;  4IIM A;  3REB B;  3VRY A;  2RNA A;  1Z9Q A;  2D8J A;  2LP5 A;  5GJW B;  1WXT A;  2PTK A;  2KXC A;  1UGV A;  4AFU C;  1Y57 A;  1BBZ A;  4Z89 A;  4J9B A;  1X6G A;  1X2K A;  2X3W D;  3O5Z A;  2GBQ A;  3ZL7 C;  1AEY A;  4R0K A;  3QWY A;  3PVL A;  1GBR A;  4IIO A;  1H92 A;  2DBM A;  1YN8 A;  3SEM A;  2K2M A;  5IHI A;  1QLY A;  2DL5 A;  2O88 A;  4HVV A;  2EYZ A;  2DL8 A;  3IQL A;  4KRT A;  1GFC A;  1NYF A;  4Z88 A;  4FSS A;  1QCF A;  2LJ0 A;  1PWT A;  2CDT A;  4EIK A;  5FWB A;  3I9Q A;  1WFW A;  4D8K A;  4RTT A;  1PKS A;  2SRC A;  2FRY A;  1KIK A;  3NHN A;  4F16 A;  2D1X A;  2L3P A;  1NM7 A;  3QWX X;  2ROL A;  2L2P A;  2W0Z A;  3M0T A;  4F17 A;  1U5S A;  3REA B;  2EGC A;  4F14 A;  3GBQ A;  4HVW A;  1OPL A;  1FYN A;  2D8H A;  1AD5 A;  2DJQ A;  3I35 A;  2W10 A;  1RUW A;  1WIE A;  1JXO A;  2ABL A;  4HCK A;  3U23 A;  1X27 A;  2V1Q A;  2LQN A;  1WX6 A;  2EQI A;  2LMJ A;  4AFQ C;  1JEG A;  1GCQ C;  4M4Z A;  4JPB W;  1X2Q A;  4OML A;  3VS6 A;  1VYT A;  1GFD A;  4QT7 A;  1K0X A;  2KT8 A;  1EFN A;  3EG0 A;  4RTW A;  2FG0 A;  2A36 A;  4LN2 A;  2LZ6 B;  2DNU A;  2B86 A;  2EBP A;  1J3T A;  5IH2 A;  3VS5 A;  1ZSG A;  1I1J A;  1GCP A;  3VRZ A;  1QWE A;  2JM8 A;  2DYB A;  4LNP A;  2LJ3 A;  1Z9Z A;  5FW9 A;  4J9C A;  2DRK A;  2DE0 X;  2GQI A;  1K4U S;  1M3C A;  1K0S A;  1FMK A;  1WYX A;  4OMP A;  2DBK A;  2JMA A;  2LCS A;  2OJ2 A;  2KT1 A;  2F2X A;  1UJ0 A;  2DX1 A;  3PE0 A;  3VS7 A;  4Z8A A;  1MUZ A;  1UHC A;  2C0T A;  2L0A A;  2KYM A;  1CSK A;  1I07 A;  1LCK A;  3JV3 A;  1GRI A;  2YT6 A;  3PVQ A;  2CSQ A;  1OV3 A;  4RUG A;  4RTU A;  1ABQ A;  2EYX A;  4RTX A;  1BK2 A;  2JXB A;  1SSH A;  3M0P A;  2JT4 A;  1N5Z A;  2DLP A;  1HD3 A;  1NEG A;  3NPF A;  5FWC A;  2DA9 A;  1G2B A;  1WDX A;  2CT4 A;  4AG1 C;  5I22 A;  1UHF A;  2FPE A;  2KR3 A;  1AZG B;  2HDA A;  1SHG A;  1WXB A;  2F2W A;  2FO0 A;  3SHW A;  1M8M A;  1TUC A;  2JM9 A;  3EHR A;  1ARK A;  1QKX A;  3NMZ C;  2ENM A;  5IHN A;  1H3H A;  2O31 A;  1AWW A;  2LX7 A;  4DEY A;  2EGE A;  4CC2 A;  1T0J A;  1U3O A;  1T3L A;  1AVZ C;  2J6F A;  3KFV A;  2MCN A;  1UUE A;  2CH4 W;  1AOJ A;  4JZ3 A;  1XOV A;  5L23 A;  2DF6 A;  2K6D A;  1SRL A;  4J9H A;  2JS0 A;  1TG0 A;  3EG3 A;  2J6O A;  2HSP A;  1GL5 A;  1GCQ A;  2O9V A;  4OMQ A;  2F2V A;  5GJV B;  3VS0 A;  4Y92 A;  4X1V A;  1JU5 C;  2DIL A;  1E6G A;  4J9I A;  1ZUK A;  4ESR A;  2JMC A;  2YDL A;  4JJC A;  4K11 A;  2OAW A;  2NUZ A;  2BZX A;  2CH4 A;  1HSQ A;  1T3S A;  1SRM A;  5IXB A;  5IXF A;  3RBB B;  2QDL A;  3THK A;  1MV3 A;  1U06 A;  2RQT A;  2MIO A;  1V1C A;  2CUD A;  2E5K A;  2OI3 A;  3H0F A;  4AG2 C;  4CC3 A;  2ECZ A;  2BZY A;  2DVJ A;  1SPK A;  2KRO A;  2RQR A;  2HBW A;  2ROT A;  3EG2 A;  3VS3 A;  1X6B A;  2L3S A;  2PZ1 A;  4JZ4 A;  1RI9 A;  3VS2 A;  2AZS A;  1W1F A;  2C0I A;  2KRS A;  2J06 A;  1CKB A;  2KE9 A;  1AWO A;  1ZX6 A;  1ZLM A;  1JXM A;  2KEA A;  1ABO A;  2K79 A;  2KRM A;  2A08 A;  2EYY A;  4DEX A;  2SEM A;  4ZNX A;  1QKW A;  2NWM A;  2RN8 A;  1AZE A;  4ORZ A;  3VS4 A;  4CC7 A;  2O2O A;  4E6R A;  3UA7 A;  2D0N A;  1G83 A;  1NEB A;  2RQV A;  1ZBJ A;  2FEI A;  2YUO A;  1MV0 B;  1UJY A;  2VWF A;  1ZUU A;  2LJ1 A;  4AFZ C;  2CSI A;  2L3Q A;  4J9E A;  4OMO A;  3H0H A;  3UAT A;  2JS2 A;  4JJB A;  3RNJ A;  1T0H A;  5IHK A;  3EGU A;  2EGA A;  2G6F X;  1KFZ A;  2VVK A;  2XMF A;  2J7I A;  1HJD A;  3NGP A;  5ECA A;  3TSW A;  1X69 A;  3R6N A;  1UDL A;  1OPK A;  2GGR A;  1PRL C;  1RLP C;  1JO8 A;  1OOT A;  4RTY A;  2JTE A;  1K76 A;  2AK5 A;  1M3A A;  1ZUY A;  2BTT A;  3EHQ A;  3TVT A;  4J9F A;  1H8K A;  1SHF A;  2LNH B;  2DMO A;  1UTI A;  2GTO A;  3UA6 A;  2LQW A;  2FPD A;  1W70 A;  1PKT A;  2RMO A;  2CUB A;  2M0Y A;  2GNC A;  1AWJ A;  2IIM A;  2CT3 A;  1VYV A;  2HEQ A;  1BB9 A;  4WCI A;  1GBQ A;  1WXU A;  1VA7 A;  5HCK A;  2K7A A;  4A63 B;  1E7O A;  2ED1 A;  4LUE A;  1WI7 A;  3H41 A;  4AFS C;  2GTJ A;  1A0N B;  1NLP C;  2DRM A;  1TUD A;  2AZV A;  2MOX A;  1WA7 A;  2AKK A;  3TSZ A;  1M30 A;  1S1N A;  2V1R A;  2J6K A;  3M0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...