2G72A

Structure of hpnmt with inhibitor 3-fluoromethyl-7-thiomorpholinosulfonamide-thiq and adomet
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
264
structure length
264
Chain Sequence
APGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzyme Adaptation to Inhibitor Binding: A Cryptic Binding Site in Phenylethanolamine N-Methyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 97
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2g72A00
3UJ9A 3CJQA 3EVGA 2JHPA 4HSGA 2C7OA 4RV9A 3FTCA 2EJTA 5FHRA 1EG2A 3O4FA 1G8SA 1L3CA 3VYWA 4U7PB 4YUXA 3TR6A 3LHDA 4CKEA 3CVOA 4HH4A 5G02A 2FK7A 3P2IA 1ORHA 3U81A 4ER6A 4QVKA 2AOUB 3P9CA 4DKJA 2GA9A 1X1DA 4E31A 3FRHA 1NKVA 1SG9A 3PS9A 3SM3A 3E23A 2IPXA 3MCTA 3LL7A 3UFBA 2AN4A 2UYHA 1I4WA 5DX8A 3JWIA 5F2OA 1ZKDA 3TKAA 3CJTA 3V8VA 3ELDA 2AVNA 4PNEA 1VP9A 1Z3CA 5DX0A 4BLWA 3OFKA 5EKUA 4YV1A 5DTQA 3I53A 3KPYA 1R8YA 1XTPA 4M7RA 3KQVA 4PYIA 3FTDA 3LDFA 4R8SA 3SSNA 1Q0SA 4C4AA 4RWZA 3G88A 4RTQA 4RTRA 3QOWA 3ORHA 5HOQA 4BY9E 3BXOA 3IEIA 4RVFA 2AOVA 4PIMA 3SGLA 4B17A 5BW4A 2GPYA 4PYLA 3DMHA 1YFJA 1G6Q1 5DM4A 5E8RA 2OPBA 2EX4A 4R8RA 2ONYA 3DULA 2ZBPA 3FUXA 3LKDA 5EMKA 1G55A 2BR3A 4PYNA 5IH3A 4ER5A 1F3LA 4K6MA 1DCTA 3FTFA 2XVMA 1WS6A 4R6XA 3LDGA 3NTVA 1R74A 3AY0A 5FTWA 3FTEA 1XXLA 2P41A 1JR4A 2NXNA 5E1DA 3A7EA 5EG5A 2PLWA 1N7JA 4DF3A 1PJZA 5CIYA 2P35A 3SXJA 2IDKA 4C08A 1B42A 4RVGA 2IFTA 1YZHA 2PY6A 5ICGA 3G2OA 2ZCJA 3HEMA 1EJ0A 4PCLA 1WY7A 4BLVA 5EMMA 3HCCA 4ER0A 3LCVB 4PYJA 3HP7A 1XVAA 2IH4A 3LDUA 5KS2A 1KP9A 3SR4A 4RTMA 5HIJA 1EAMA 1T43A 5EMJA 2UYCA 5GINE 1MJFA 3KQWA 2JH9A 4RTOA 4P7JA 4QPPA 3A27A 3MTIA 1RI2A 5KQSA 2NXCA 4ZTBA 3UJDA 1NW3A 2ZWVA 4QPNA 4QTUB 3OPNA 1M0EA 5GM2A 1IXKA 3DH0A 2NYUA 2YVLA 3HVIA 2WA2A 3CBGA 5E2AA 5BW5A 2YUIA 5E8JA 1FP1D 1VQ1A 4ISCA 2PXCA 4RVHA 4C04A 2AS0A 5H02A 1I9GA 1ZHFA 2FK8A 2PX8A 3DMGA 1I1NA 3VC1A 2IBTA 2ZLBA 1M6EX 3GJYA 2BR5A 4PGHA 2OKCA 5DM2A 3FZGA 1YFLA 4QQNA 3GRRA 4XCXA 3FPGA 5K0EA 5D1HA 2B78A 3DR5A 4M37A 2OB1A 2OXTA 2C7PA 1XCLA 1VP3A 3TPZA 3KQSA 2CMGA 3OFJA 1AF7A 5EIWA 4Y30A 2C7QA 5EZQA 2IH5A 3O7WA 5HIMA 3WSTA 3AXSA 3M6WA 3ID6C 3LSTA 1KR5A 1HNNA 2VP3A 3GRZA 3LPMA 4LECA 5GWXA 4WVLA 5MHTA 1JQEA 1KPIA 1VBFA 3B3FA 1SQGA 2BM9A 3I58A 4XUCA 2GH1A 3KPWA 2P3OA 2ZIEA 2C7RA 2JH8A 2PSSA 1JG3A 3C6MA 4PGGA 1YB2A 3CC8A 5DLYA 3UJ6A 4RTLA 4HGYA 1NV8A 1NV9A 1P91A 1RI5A 2DPMA 1QAQA 3M6XA 3A4TA 5K0LA 3UA3A 2YR0A 4EMSA 1XDUA 1O9GA 2GAFA 4BLUA 2QY6A 3GDHA 1KYZA 3MQ2A 4EQZA 2BH2A 2ESRA 3F4KA 5FHQA 2G70A 3PT9A 4WXHA 5B1SA 5DXAA 3PFGA 2P7HA 1NW8A 4V0RA 3EMBA 3TFWA 9MHTA 2PJDA 3BGIA 4PYOA 4P7GA 2JHAA 4GUAA 2G8NA 5DXJA 3DTNA 3TRKA 1HMYA 2AOTA 5K01A 1NBHA 1UIRA 2QE6A 4GF5A 4DCGA 4POOA 2PT9A 2ZWAA 3PFHA 4A6DA 1QYRA 2FYTA 2YTZA 4FSDA 2WA1A 5E2BA 5U4XA 2OYRA 2Y1WA 3LCCA 4U7TB 2I6GA 4EKIA 3NMUF 4KWCA 4NECA 5LR6A 1KPGA 2JHCA 3KHKA 5FA8A 3SX0A 3KR0A 4F86A 1RJGA 3CCFA 3GRUA 4FSXA 1EJ6A 1R6AA 3E8SA 4IKPA 5BP7A 2PKWA 3KPJA 3DOUA 2GLUA 2AN5A 1VE3A 3CJRA 5K0JA 4KRGA 3UZUA 4RTKA 2NNWB 2HR1A 3OZSA 3EMDA 1KPHA 5HILA 2E5WA 5CCXA 1VPTA 3REOA 2DULA 4KW7A 5EIFA 4PIPA 2EJUA 5K09A 2B9EA 3P2EA 4MWZA 1SUIA 4E30A 4L7VA 1L3IA 2OO3A 2R3SA 3L8DA 1FPQA 2NXEA 2PT6A 2P3QA 3H2BA 3DLCA 5LSAA 3TKYA 1YUBA 3I9FA 1TPYA 5FWAA 2G72A 5CCBA 3HTXA 3GU3A 3OU2A 5CM2Z 1X1CA 4QDJA 3PLAE 3P8ZA 1JQ3A 4GBED 1ZGJA 5LQUA 4E2WA 4GOOD 3DLIA 3JWJA 3DP7A 3R24A 4FR0A 4BP1A 3BWMA 5EVJA 2PXXA 4IV0A 3JWGA 5EKXA 1P1BA 3SSOA 4C05A 3NDIA 5K0GA 2YXEA 5EC8A 4QQKA 4OA5A 4E70A 2H1RA 4F85A 2V7EA 5HEKA 2B2CA 3DXZA 3QV2A 2P40A 3EVCA 3HA3A 2P1DA 3Q87B 3HVHA 4CKBA 2GS9A 1KXZA 5GP1A 3PX2A 3M6UA 4F84A 2PX5A 4C07A 4YV0A 4Y2HA 4P7KA 1JQDA 3HCBA 5HFJA 1KYWA 2H00A 4E32A 3M70A 2HNKA 3P2KA 5T67A 2A14A 3K6RA 3EGVA 3KQTA 1XDZA 4KDRA 1JTEA 4YUVA 4LG1A 3KPUA 4C06A 4DMGA 2QRVB 4YUWA 1O54A 2ZZMA 3A25A 2AVDA 3GRYA 4FZVA 3BWBA 3ELWA 3S68A 2PGXA 3UJBA 4AZSA 3Q7EA 3BKWA 4GEKA 2O05A 5CVEA 5F2KA 2VDVE 2Z6UA 4PCAA 5EHGA 2PX2A 2QRVA 2F8LA 2ZULA 2I62A 3IHTA 5D1NA 1G8AA 5KYGA 3I64A 3O31A 3LCUA 4QDKA 1F38A 2AOWA 5FULA 4CTKA 4KIFA 1ORIA 2Q41A 5KVAA 1QAMA 4FT4A 3VC2A 4PONA 3C6KA 1D2GA 3G2PA 1JSXA 4GQBA 5CVVA 5E9WA 4HC4A 3MCZA 2G1PA 2O0LA 1BC5A 3NW9A 3NWBA 3GO4A 1AQIA 2PWPA 1NW5A 4YUZA 5DT2A 2VDWA 1FP2A 3G5TA 3R0QA 5EMLA 3KR9A 1SQFA 4EKGA 2PBFA 3KQMA 2PVCA 5LQJA 1EIZA 3G2QA 3QOXA 3DMFA 5FQNA 1D2HA 5DTMA 3G8BA 3EEYA 4X61A 1JG4A 3I5UA 3B3JA 3T0IA 4DZRA 3TM5A 1MHTA 4MHTA 2B25A 3OE4A 4YMGA 5JUWA 5K0NA 3G89A 4KVZA 3C0KA 4FP9A 1JG2A 5EEGA 3AXTA 2AOUA 2H11A 2UZ4A 5EZSA 4GC9A 3OCJA 4RSRA 3B5IA 2JJQA 3BZBA 1L1EA 3CGGA 2EFJA 4YUYA 2AR0A 4P58A 2Z6QA 1NW6A 4RYLA 5FADA 5ICFA 5CVJA 3NVKI 3P9NA 2OB2A 3OU6A 3G2MA 2HTEA 3GNLA 5DRTA 4PYKA 7MHTA 3P9KA 5FQOA 1KIAA 2B3TA 5EPEA 1L9KA 3LX6A 1UWVA 1RI4A 3A7DA 1NW7A 3R3HA 4OBXA 5CVUA 4DQ0A 5K0FA 2CKDA 1PRYA 3TMAA 4PYQA 3UA4A 2CMHA 5ERGB 1R18A 2OY0A 2ZBQA 4HRAA 3T7SA 2FPOA 3LBFA 1JTFA 1O9HA 1SUSA 3FPFA 1X19A 3KQPA 5C9ZA 3LBYA 4ATNA 2IBSA 2ZZKA 4AZTA 3P9IA 3UBTA 3EPPA 2I9KA 5DSXA 1NBIA 2HWKA 1X1AA 3UWPA 5E1BA 2AOTB 4M36A 4XUDA 2GB4A 2ZVJA 3TOSA 3IYLW 3FUUA 4G56A 4MTLA 3TM4A 1U2ZA 10MHA 2QM3A 4MIKA 4V0QA 4Z2YA 5DPMA 2OZVA 3VSEA 2IH2A 3GGDA 3C3YA 5T6BA 2AZTA 3EVFA 4HTFA 4FT2A 3EEOA 3IV6A 2CL5A 3KKZA 2G71A 2HV9A 3THSA 5DRYA 3DUWA 4RX1A 1RJEA 3R6TA 2P7IA 3FYDA 3BWCA 3EVBA 4HG2A 5EQJB 5HIIA 2EG5A 4X1OA 2Z6AA 2JG3A 1INLA 1Q0TA 1NE2A 3EVZA 3NVMB 3SVZA 4RTSA 1N7IA 1L3BA 4PYMA 2ZSUA 2XYQA 3FUWA 1X1BA 4GC5A 4IWNA 4DCMA 1Y8CA 4YV2A 5K0CA 3UJ7A 4OX9Y 5CUQA 4CXMA 3R9XB 5DTRA 2VS1A 3BGDA 3MERA 4OQDA 5GIOE 1IM8A 3HVKA 4CTJA 2ZIGA 4DA4A 3D2LA 4YMHA 5CD1A 1BOOA 3TLJA 3E7PA 4IV8A 4H0NA 5T64A 3PVCA 1KHHA 4JXJA 3UJ8A 3LKZA 4RTPA 3CKKA 3HNRA 4HTFB 5E9QA 2NXJA 3MAGA 2I7CA 4A6EA 2ONZA 2R6ZA 3ANXA 2VDUE 2ZIFA 2KW5A 3ELYA 3M6VA 4KDCA 5DWQA 5K8VA 4QVGA 3M33A 3A26A 3KQYA 3HCAA 3HCEA 4R6WA 3KQOA 1TW3A 3LECA 2HMYB 1ZGAA 4LWOA 3THRA 3HCFA 2IGTA 1RI3A 4HGZA 3BUSA 2AN3A 4AUKA 4FS8A 1G60A 4OBWA 4GOND 4QTTB 3HM2A 4AX8A 1VL5A 3DXXA 3FPJA 1BHJA 3SMQA 1XDSA 3M4XA 1FJXA 3OU7A 4UOEA 3G7UA 3PX3A 1AQJA 3BGVA 1SVUA 3B3GA 4E2YA 3BWYA 1P39A 1R8XA 3C3PA 1UFKA 3B7PA 5LQKA 2CWWA 1WZNA 5LQRA 5KQRA 3NJRA 2ORED 1D2CA 1ZG3A 3DXYA 4ER7A 1DUSA 3B89A 4EVIA 4ER3A 4OQEA 2BZGA 2AOXA 3P71T 5EEHA 3T7RA 3LGAA 2FHPA 2BR4A 2P8JA 1FBNA 3G5LA 3OE5A 3P97A 3ERCA 2N47A 3KU1A 4CKCA 1XCJA 3GCZA 1TW2A 4KIGA 1N2XA 1JSZA 2XBMA 3JWHA 3ER8A 1VLMA 3GXOA 5K03A 5K05A 1XJ5A 2UYQA 5IKMA 3FPHA 4GOMD 2IDJA 3ELUA 1YF3A 5E1OA 5E1MA 3OZRA 1SKMA 3KR2A 2XYRA 2PWYA 4X41A 1QANA 4GOLD 5DM0A 3K0BA 3UJCA 1WG8A 3KPVA 3FUTA 1RJFA 3NDJA 3BKXA 3PB3A 4PINA 3X0DA 4P7FA 5GM1A 2ZZNA 4CWAA 5LQNA 1EQAA 3AWIA 3HCDA 4R05A 2FCAA 3FYCA 1P1CA 4RVDA 3HA7A 5M5BA 3E05A 4EK9A 2PX4A 3G8AA 5K0BA 3PTAA 2OBFA 3RW9A 1WXXA 1QZZA 2BM8A 3UJAA 3HVJA 2V74B 2ZW9A 1R00A 5EHIA 3EVDA 4LWPA 3T7TA 2YX1A 3GIWA 3HA5A 3MB5A 2LD4A 1YZ3A 3NWEA 1QAOA 3ME5A 5DSTA 4DM3A 3BT7A 3MTEA 2NP6A 4RTNA 1IY9A 2NP7A 1WXWA 5F2NA 1V39A 2UYOA 3RIEA 5HZMA 4XUEA 3EVAA 3V97A 5FA5A 1JG1A 3GWZA 2ERCA 2O06A 2YXDA 3AJDA 2ZFUA 3TQSA 4OA8A 2ZBRA 5CVDA 1M6YA 4X60A 4E33A 2ZTHA 1DL5A 3FPEA 2WK1A 5EGSA 2FRXA 3FUVA 8MHTA 4O29A 3SSMA 1ZQ9A 3FRIA 2P3LA 4AZVA 4C03A 4E2ZA 2XVAA 2IP2A 2XYVA 5FWDA 5JR3A 5FUBA 5C0OE 2K4MA 5FCDA 3KR1A 5P8WA 4AZWA 5GOZA 5ICEA 5LQAA 1AV6A 1RI1A 3OZTA 4M38A 1VIDA 2O07A 1RJDA 2PV0A 3GRVA 3KQQA 2IIPA 4RTJA 3MGGA 3EGIA 5BXYA 2YQZA 2ADMA 5E9JA 5ICCA 3EVEA 5DX1A 5LQCA 3EGEA 3ER9A 5EOVA 2YXLA 4MQ4A 2O57A 5DM1A 5HIKA 1H1DA 1G38A 2PXAA 2QYOA 4PWYA 2Y1XA 4X63A 4BP3A 3RODA 1BKYA 5C1IA 4E2XA 5GIPE 1OR8A 4FGZA 2VZ9A 3MHTA 1NT2A
chains in the Genus database with same CATH superfamily
3WDKA 2Z2XA 1QG2A 4GM0A 1TMGE 2BT4A 2E2WA 4MVJE 5T57A 3TF5A 2EJTA 1EG2A 2YMLA 2YZ7A 4IX1A 3RWOA 1OHHD 1SRRA 3ADPA 4IUBS 3ITKA 1LX6A 3A1WA 3DDCA 4J3JA 3GD7A 5JLAA 4O2AB 5G0SA 1IEVA 3VGPA 1OKKD 4LHXA 4C20A 5K6AC 2C2HA 4EX6A 1DJQA 1V26A 4OI2A 5J2UA 2R7LA 2VK8A 1V5GA 1C30A 4TUYA 4WZ6A 3H1FA 3OFNA 3OUTA 5BWCA 2AE1A 3FVTA 4H31A 1HNXB 5FRDA 5ES3A 4B2IA 1R6TA 3TW8A 3GMIA 1G41A 3M8KA 2NU9A 4PU0A 3FPKA 4TZKA 4RWZA 3G88A 4BLOA 5AVWA 3U4QA 1I2CA 2C3OA 3FYUA 4PPQA 4ZPXA 2W9XA 1KAOA 1D7OA 1FXUA 2A1IA 2P8SA 2Y1OA 3GFBA 4IOLA 1KVTA 3KUUA 5CM9C 2E87A 4I9GA 3RS0A 3TGPA 4B79A 1BNCA 3J80A 1ZA1A 4Y3UA 1OWOA 1RBYA 1Z5ZA 1N57A 1XLTC 1Z45A 1WMEA 1ZGCA 5IH3A 3S1AA 4YR9A 1JMVA 5FORA 2GJ4A 3TLGA 3RWBA 3UAXA 3FPLA 3F8SA 2WIJA 3LBAA 4FFBA 1QWOA 1Y8RA 2V1UA 1FVOA 4JT4A 2SCUA 3T5CA 1ZR4A 5I7UA 3JD0A 5L6LB 2R5FA 3KEMA 1SBTA 1E1QA 1GZUA 2HMAA 4HDMA 2QRKA 4URXR 1MPXA 2CJWA 2F59A 5EG5A 3SBXA 3U0VA 4XOUA 1W96A 3AF2A 3NT5A 3ZDAA 1ZI9A 3ZI0A 5LB2A 3MIZA 1WQ3A 2EDCA 2GD1O 3T9BA 4AJOA 2B8WA 3HEMA 4DA6A 5CYPA 4E0BA 3THYB 4FDTA 2GO1A 3UJPA 3FWZA 4LAFA 5G2OA 1KP9A 3V2IA 1EFVB 2D0IA 2GZ1A 1PN3A 5HKKD 4LJ4A 4TKVA 2V6IA 5GINE 4F4UA 1DPGA 4JUBA 4PZUA 3T54A 3DWGA 1FZTA 1P9NA 1LVGA 3PDWA 3LLMA 4RZHA 4PAGA 5CAEA 5KWVA 1C1DA 2WG1A 3AVXA 3I9LA 1M0EA 2GSWA 2WFZA 4HFJA 1ZGZA 2C2GA 4JYBA 1NF3A 3HUDA 3GNQA 4UDXX 4JEHA 2MINB 4JVLA 4EA9A 1YS7A 2PXCA 4KDEA 1P3Y1 3IEMA 5KJCA 5AKLA 5C8DA 1EFHA 4MWGA 3W3AH 1ZHFA 4CKZA 1IIBA 4TS1A 1CFZA 4A8HA 4Y1RA 1LU9A 2YZKA 4X1YB 2NU7B 3GF4A 4UQPA 2ZB3A 2GN2A 3FZGA 6NULA 4F4IA 1H2RS 2Y05A 4LHYA 5K0EA 2B99A 4GG1A 4TLLB 1KDYA 3W1VA 2WWGA 2EEPA 2QOEA 1OWMA 4WY8A 2C2KA 2IUTA 2YXPX 2OV2A 4EBFA 1Z2AA 3HZRA 1NXVA 3ZNQA 3KV3O 2Q27A 3GRZA 4JLOA 1SUDA 4UPDA 1SC6A 5DGXA 4GNRA 1KPIA 1Z4MA 4Q34A 3BXFA 2Q3MA 5A4KA 5KYWA 4OQYA 4X8LA 4F91B 2PSSA 3Q3EA 1P18A 3QMPA 3UJ6A 3ZS9A 2J0SA 5GONF 2FR8A 4TV8F 3EDCA 4HGYA 3QBTA 2G1AA 2A9VA 2C94A 1BXGA 3PNQA 1DRKA 1FUUA 2XMGA 4K05A 3O1LA 2CV0A 3JZDA 1Z6ZA 4OGWA 4F3YA 4ZEMA 3MGKA 3I8SA 2VCEA 3DL0A 3R5HA 4MUJA 4WX2B 3TNDA 4B40A 4DPLA 4E6PA 3TLKA 3DZGA 1T34A 3SKYA 5IXYA 2RBEA 3INTA 1MKYA 3LGSA 4N0EA 4UJ5A 4Y6GB 1DUVG 2X5NA 4O4JF 1K7XB 4RPGA 4W7HA 4RIGA 4C6TA 1GZ4A 1WU7A 3SF8A 3WWCA 4M1ZA 4P3XA 5BSTA 4GGMX 3EFEA 5EIHA 1NBHA 1ISMA 4X1IB 1BHO1 4ZYTA 1QYRA 1ZUD1 5TMBA 4MWOA 2NYVA 3SIWA 1OLUA 3WYEA 4F2WA 1JQJC 4GECA 2JS7A 2Q07A 4AYXA 1NQWA 1Y9ZA 5IKPA 5KTYA 3U61B 4B80A 1MF7A 3BEOA 3KQKA 1L5VA 1JDVA 3QI7A 2PRYA 4IDQA 3U4DA 1S8NA 1XL0A 4FYJA 1QZUA 2ZRPA 1B73A 1E98A 1NYLA 1QVZA 1ADYA 2G09A 2SKCA 3ZXYA 3KPJA 5FTKA 1JDUA 4ITRC 3O9MA 2I66A 1NRIA 2JFXA 2OZKA 3B1FA 2LXNA 1C0PA 3REOA 4FN5A 2H0RA 2FRVA 3S7ZA 3UH0A 4QXOA 2DMRA 5D85A 1W73A 2GPWA 2EJUA 4ZYZA 2OFPA 5I7FA 5L7TA 3TXAA 1BIFA 3VV3A 1BX3A 5I7HA 4KE8A 1LNZA 3RGWS 2EQAA 1FUIA 3B85A 1PDOA 3O26A 4XCQA 1Y6QA 1SVMA 5DYYA 4US2R 4A8JA 2C5FA 2VTKA 3JW8A 4FGKA 1CY4A 2WM3A 4XVQA 1CUHA 2FQWA 2Y92A 3CPHA 5SY6A 1E79D 2NZ2A 2XYPA 3UK0A 5BQXA 5ITWA 1CUIA 3PR2B 4OHUA 4DB2A 4BPBA 3FRJA 3OZGA 4HY3A 1QU3A 3AUUA 2H7VA 1NF2A 1QFMA 3OEHD 2JFUA 1OAOC 2ON6A 1GKIA 4NCXA 1YI1A 4WKBA 3RI3A 4YT4A 4DFDA 1SC3A 2F48A 4IIEA 1O95C 3A6DA 5AHRA 1A7AA 4J49A 4D5GA 1TCCA 4QDXA 5BVGB 1DWOA 3U7QA 3EDQA 1VHDA 3KQUA 5DDIP 4PWZA 4ZAYA 2A5FA 4LZLA 2AMVA 5F7OA 1RP1A 3GELA 3RSHA 3FHLA 3W8NA 1UBMS 1RC8A 2C4TA 3MHPA 1QQBA 3PPWA 3R77A 2GVNA 2AG1A 4WJLA 2PS1A 2QZ9A 1NMEA 4WINA 1CJSA 3BDIA 5K3BA 2SICE 3OI7A 4ZT3A 5LP6A 2NQ2C 3BMQB 5CVEA 1IONA 1KQ3A 4UCFA 2DKOA 3HPRA 1CUFA 1WNFA 1YFLA 4B4WA 4MS4B 1HWYA 4BPRA 4TV9B 4CF5A 5J58A 1H8EA 3H9CA 5KYGA 3COPA 2WOJA 3JQFA 4M54A 2D3WA 3O31A 1OPXA 5C8YA 1T9AA 4IW3B 3B3AA 2AOWA 1ULAA 3HBFA 3PITA 3SM9A 3IUMA 4BIMA 1FLNA 3N9IA 2BDTA 2CNLA 4PHCA 2J07A 3OO1A 1CIPA 1G0OA 1YVDA 3SLGA 13PKA 4RORA 3TUJC 5JCOA 3H5TA 4C22A 1PQ4A 1Z74A 4KNVA 5B64A 3THXB 3MFQA 3ETEA 4CKBB 2PWPA 4QGFA 2X8JB 4J6EA 4DJFC 3GDGA 1QH1B 2JK1A 3CEMA 3DMPA 3OVMA 2JJMA 4KN6A 4UU0A 5EMLA 3NEYA 1XMIA 1V47A 3MJEA 1VKNA 1ZN7A 1A4RA 4JLVA 1S8OA 4EKGA 4WBNB 4E13A 3IKVA 1WCIB 3T95A 4AY6A 3L0ZA 4ZAXA 2EKBA 4A6XA 4YJ2B 2P4UA 3D6AA 3WGMA 1Y9DA 2O59A 1D2HA 3AY6A 4BMDA 3G8BA 1XNQB 1XQXA 3WK8A 4WZZA 2R8PA 4NRDA 1DBQA 2GPAA 2QL7A 2AD5A 3GQBB 3NAMA 3JYNA 3PDCA 4IJ6A 4J07A 3VOAA 4KR3A 2YWEA 4Q03A 1BKDR 2RGWA 4YRNA 3C0KA 1YS2X 2P2NA 4RY8A 5EEGA 1TU0A 5TT0A 4B73A 3HKCB 3RVLA 5T3UA 2W2LA 4OG2A 5HKKA 2GCOA 1WNTA 5B37A 4P58A 4GLJA 1GU0A 1FDOA 1PEKE 1ND5A 2JIOA 5HQ3A 4MH0R 5CGQB 7MHTA 1OX6A 3EC7A 5IX8A 4FZ5A 4FHGA 1Z4IA 1BGWA 3E81A 3JD4A 5KYYA 1RI4A 2WMYA 5BRAA 2GTPA 3OESA 1KZHA 1TK3A 4BFWA 3TMAA 3UA4A 4EVSA 3PHIA 1EB8A 2OILA 5KVCA 4GR5A 1ODTC 2AFIE 2K6GA 3MTGA 4ROTA 2J0QA 3UXMA 2UDPA 3VNAA 1QOQB 5AK3A 5JISA 3E9YA 4AZTA 2Q2OA 1BDIA 3N58A 1E3SA 3GLFE 2VHEA 3T7CA 4M1YA 4YRZA 4MMYB 3UWPA 3N07A 2VQDA 4W4TA 2GB4A 1DELA 1ADCA 5FT9A 2IOFK 3RIMA 1NVKA 2VUHB 4MTLA 1T8SA 4WNAB 2FPIA 5TVKA 3EZ2A 4TMKA 5BWMA 3Q8XB 3M3HA 3C7AA 2VYND 1AMUA 2VHTA 1N6LA 2WICA 2ERXA 5DPMA 5CDFE 3OSUA 3V4OA 2JLXA 4DIKA 1JEEA 3AIIA 4FT2A 2GAOA 3U3DA 3TCXB 2G71A 4HN2A 5IJ0A 2N3ZA 1QORA 3TH5A 1PVDA 4JVOA 4CQNA 3KLNA 4NBNA 4O6VA 5JCOC 1I3OA 5I45A 4KQGA 4MHSA 4URVR 3EEFA 5BNFA 1N3YA 1CB0A 3NHYA 4Q93A 4C43A 2P2DA 4AKGA 1Q0TA 3T7DA 2DHQA 4C3ZA 1DKOA 3WISA 2WD9A 4DV1B 4KPUA 4HQ6A 1L3BA 1YR8A 3L0IB 1BJKA 1OGJA 4BE7B 5BUQA 4MV8A 4OX9Y 4QIHA 2ZBVA 4Y9SA 5F9MA 3RVDA 1OIWA 1O94C 2VS1A 3MERA 4OQDA 3EW7A 3IT1A 4G4SP 1TM3E 2B8JA 2YW9A 4GU5A 4TXJA 3PFWO 5JQWA 1DQNA 1UEIA 3CM0A 1IUNA 1G4UR 4RH1A 4RTPA 4HDNB 2I1VB 3CKKA 2OEPA 2WYHA 2GX6A 2I7CA 3OPYI 4EHJA 2R6ZA 2VXBA 4ZQEA 1I2BA 4HAVA 1O87A 2C29D 2O2GA 3VUFA 1IM2A 1Q22A 3V1MA 3I52A 1PV4A 2JLVA 4MHOA 5J4HA 4G5XA 1FYFA 1GCOA 1CVIA 1CE8A 1QH1A 3KQOA 3WRVA 3U7FB 4X00A 2RARA 3C3DA 4TSFA 1PL0A 1UOQA 3T3EA 3FCOA 3BCSA 4GOND 4LVUA 3ND7A 1Y0BA 4ZHQF 3JR3A 2PUEA 1Z08A 1LLFA 1U3TA 4NCHA 5CT6A 4UOEA 4NMLA 3HJUA 2Z6VA 5I9IA 1JR6A 4F21A 3II6X 3MINA 1K5GA 5J2TA 4EO7A 2PKQO 1FOEB 1W5EA 2YFYA 4NV3A 1DVRA 1BKSB 1I10A 5C8YF 4UBNA 5KNBH 3OTOB 4MRMB 4KOEC 2HLDA 1LZLA 2HUNA 3GP3A 3FROA 5G4KA 3LRXA 1ZIXA 2FEAA 4CG3A 6Q21A 3ADBA 3R8CA 5HJ2A 2DUWA 2R48A 2ZRBA 1TQHA 4G09A 2NVOA 4X20B 2XB8A 4REMA 2I6SA 2WF6A 1HZZC 1YC5A 4PRKA 1MAUA 1R5OA 4XM2A 4LV8B 1TZCA 3BMNB 3ZCVA 2A7XA 4LWQA 2IY9A 2YOHA 3A9RA 3L6DA 5H59A 2FPWA 1U2DC 5MF6A 1XCJA 1TU4A 2G83A 3M7IA 4MKZA 1HGXA 4S0XA 1UPFA 1R6DA 3JWPA 4M89A 5HF5A 5K05A 5F3WB 1RKVA 3DL4A 2RH8A 3P26A 5JSQA 2P90A 2QRPA 5F5LA 1VMIA 5CW2A 2XUOA 3X1YA 1OROA 1BMQA 2NO4A 3G2LA 1E9BA 2CMFA 4GOLD 5H3LA 4CQMA 1I80A 1P33A 3H9EO 2OGUA 4AN1A 2ZSAA 1AHPA 3FUTA 3PB3A 3UT5B 4CGZA 4ZI7B 3LUHA 3BIXA 1AQ6A 4HOYA 2E4WA 3FR8A 3HS3A 4Y1GA 1Z7YA 2AMYA 3C48A 1O94A 2VA8A 3N59A 3HCDA 3OQNA 1D5WA 3FYCA 4GR4A 3C5WP 4F12A 2FPXA 1EHYA 4RVDA 4JKOA 4W9RA 1JKJB 1JHRA 3RW9A 1QTQA 4GBGA 4J1QA 1RBZA 2O4UX 1ONOA 4F45A 2O2HA 1TRKA 4YB8A 1AMNA 5G0UA 4A4DA 1P45A 2BEKA 1J1UA 3WMGA 4INOA 3IPLA 3PV0A 3PEVA 1UWLA 1U63A 2J32A 4DLZA 3BT7A 3H5IA 2JB9A 3AOGA 3BCUA 4JU9A 1UBSB 4CMEA 4B3BA 1V39A 3RIEA 3VSDA 2OAQ1 2WD7A 2AXPA 2P77A 1LPSA 5A05A 1H8ED 3JQAA 2PFGA 3AR2A 4LWZA 4OA8A 4AVYA 1QHFA 4E33A 2Y4OA 5F51A 1QIJA 1DL5A 2W71A 2WK1A 3HH8A 3A9WA 1GGKA 3DOJA 3IQZA 1GPNA 4LCEA 4MV5A 4MRPA 4PLTA 1ZQ9A 5YASA 1I6LA 1RYHA 4RKYA 4AZVA 1Z0SA 2HEGA 3JYLA 4I4LA 3RS9A 1OU4A 1XQWA 4KJXA 3L1JA 3L0SA 4RCZA 3FGOA 4AYWA 4EARA 1HQCA 2NPOA 6CHYA 1T9BA 2IWHA 3OZDA 2IX3A 2FVXA 4JB8A 4IJMA 2QAGC 3R8FA 2FKAA 2GWHA 2YXLA 4J7CA 1YQUA 1K2WA 5ECWA 3OLZA 4FGZA 4N5NA 5BV7A 4N5LA 5DCWA 3LYLA 3K9CA 3FOZA 3KOXA 3SICE 4DMMA 3CZ5A 4LZPA 4YUXA 3ICQB 3BXEA 2F67A 3T1YB 3PF9A 2IDZA 4I3FA 4XB1A 5F5NA 3NH6A 1TTHA 1II0A 1ZXLA 1YRBA 2GA9A 2DFKB 1XZFA 1NFRA 2OBNA 4K6KA 3FRHA 4X54A 4ZI7F 4RVOA 4MCJA 3SM3A 3ZIDA 4DZZA 3GLIB 2FUCA 2Y1EA 3CWCA 3K96A 3QITA 2ZIXB 4PSCA 1OB5A 1WB4A 2NZYA 3GT0A 5FKJA 1RHQA 3T9DA 5HVNA 4F0JA 5EMHA 3U7EB 3ZOZA 1H93A 2I1WA 4DLPA 1M1YE 3WP1B 5K8IA 5IBQA 2DG2A 4YXWD 4CFYA 2D5LA 5EKUA 1QV9A 4IOJA 2X7HA 4MV4A 1VBMA 3WLLA 5I9LA 5EJ9A 2OCGA 1W6RA 3GEBA 4P92A 1GLVA 4BNIA 1BMTA 3HKBA 3WL3A 3ICEA 1E0JA 1BCRB 1K4YA 4DNQA 4EQ6A 2OPBA 3MWLA 4A5OA 1IZ8A 4DRYA 4NEQA 1H4TA 2XMDA 1QCDA 3JALA 4M9RA 3V7NA 2POCA 1ZA2A 3M9XA 1OLSB 3A6ZA 1J5PA 2C9MA 1PTJA 1TM5E 2ROQA 3H9BA 4KK4A 3S8EA 4U2CA 2P9FA 3GPBA 4I2VA 3A4IA 1FXSA 1P0CA 3HUUA 4L74A 3C43A 4QEZA 9ABPA 1U0BB 2WKRA 2WJAA 1BYIA 2ZRFA 4GI5A 2LIPA 1TF7A 4MYCA 4FMCF 1KJ8A 2CFTA 5A5VA 5E6SA 1UJBA 1K9VF 3A9UA 4RJLA 1RR6A 2A8YA 4B48A 4F9EA 3T15A 4ZYLA 5BY2A 1I14A 1CW2B 2OORC 1FQJA 3LCVB 2BGLA 2BEWB 1DB3A 2QNRA 1M8JA 2VH1A 3LDUA 3NPMA 4IXMA 1LF0A 3QEMA 4KYTA 4Q47A 4NIMA 3F7OA 4WECA 3QX8A 4YO8A 3ZU6A 3NVDA 5IKEA 3IIMA 3F9IA 4P7JA 2R6DA 5JCJA 5TIIA 1E5DA 3D7SA 2IC5A 1RI2A 2UUPA 2ST1A 3P0EA 2NXCA 5F1PA 1T1GA 1NW3A 1YE3A 5CG2A 3OEWA 4AUMA 3VVMA 1L1QA 3AF4A 1H85A 2WU0A 2KM1A 5CIQA 1I2AA 3QX3A 1E6LA 3I8OA 4C04A 3IJRA 5REQA 4EMBA 5E7MA 1UQTA 5I7WA 4YI5A 4MUAA 3SXUB 2X7XA 5EXPA 5FLYA 2G36A 4N01A 1LY1A 3EFOA 4ZDKA 2WTNA 1TRHA 4OAQA 4UVHA 4BNNA 4Z51A 1SB9A 5LA6B 5LZ8A 1P4SA 2J4CA 5HXAA 4WLNA 1Y42X 3NONA 1XCLA 3TPZA 3ABIA 1V3QE 2YQ5A 3TFQA 2FCRA 3NRBA 5KYWB 4M1QA 4MW5A 3W90A 2FLWA 1ZQ1A 3PGJA 1CD5A 5DASA 1G7SA 2Y8EA 4KFCA 4OV6B 5AKEA 4C21A 2YINC 1VBFA 2WWXA 4HLDA 2BM9A 1J49A 3JTMA 2FPUA 1LBHA 4NQRA 3OA2A 3E9MA 1L8LA 3IC5A 4RELA 4B4UA 3KETA 5FYDA 2LTAA 4EB6B 3P94A 1NV9A 1LS6A 4Z1MA 4YAFA 3V1UA 3DZJA 1JFVA 1J7KA 2Q3HA 5A5FA 1FVHA 1ARZA 1N4DA 2WFLA 4FQ8A 4Q7LA 5HGJA 1DC3A 3LF1A 1AK2A 1KOGA 1IQ0A 2UXCB 2V9PA 3EQZA 3MWYW 5F4BA 4V0RA 1Y98A 3OTHA 2ZJ2A 1UWCA 4G0OA 1ZONA 2QTNA 4PLFA 3IAXA 1GPH1 3LW8A 1T36B 2ET6A 1A8PA 2JGFA 4LJ7A 1O94D 2FUNB 3S29A 4QM7A 1TPZA 1JVNA 1OH8A 3E9RA 4K40A 4IZIA 5KNDH 4WXRA 3MQ4A 3JAMA 3CLRD 4NMHA 3SQLA 4BGEA 3COSA 3NMUF 4KWCA 2OORA 4R2IA 2PMEA 3R5XA 3IQWA 3HLTA 1KSGA 3SIRA 4DYHA 3SX0A 5HQTA 3X1DA 1CNEA 1XK6A 4RPCA 1G21A 1RJGA 3CCFA 1P4HA 4HX2A 4EO9A 3N2YA 1TO6A 4II3A 4CLRA 2O8CA 3M89A 1XXHB 4REOA 1PGOA 4LOKA 2QG6A 4HN9A 2BDEA 4H6WA 4JVSB 4Q3EA 5EWMA 4NYJQ 5FUYA 4ASUA 2XE7A 3MELA 4Y0VA 1U5BA 3LG2A 1TT5A 5K2MA 5EA2A 3K9LA 1FJGB 1OW3B 1F4PA 2D2XA 3A2NA 4WXMA 1C9JA 4ARZA 2A30A 4AWAA 2FDCA 1Q6YA 1K63A 1MEEA 1XX6A 2GRJA 1DBRA 1CDEA 2P5TB 3DD1A 1DIGA 3GJ5A 2XIQA 4PEVA 4PW0A 4MAAA 5TS3A 4FMDF 1K92A 4IVPA 1JW9B 2UVQA 4ARBA 2II6A 3I2HA 1C3EA 3WTCA 1GU7A 1ZPDA 4JLBA 3SHQA 4YUAA 3W6UA 3E2IA 1GDTA 1MMFB 5I7OA 4JJGA 4EL5A 2I2AA 1W4LA 3MLAA 4MJXA 5AKZA 5C80A 3CISA 2V7UA 2NU9B 3KU4A 3E9ZA 4KO2S 3RFXA 3V33A 3VDQA 4L07A 4PAQA 2JFYA 3BWMA 2PGOA 2PMCA 3HUEA 2WU8A 5AXBA 4B6QA 2Q4DA 5ALGA 3R3VA 2P1RA 4C0BA 3HR8A 1DG1G 1EZ1A 1U5BB 3ORFA 4WQMA 3GIDA 1DRVA 1RABA 3G2KA 5FOSA 4CMEC 4D9GA 5ELLA 1ID8A 2W6ID 3GLTA 4BASA 4S3MA 5BQ3A 4G97A 1PV2A 2W0MA 4BAGA 1P9LA 1QK5A 1R7RA 1XTVA 2DPHA 1VA5A 2CJYA 2KLBA 1E9EA 3PX2A 4RMGA 5AKJA 5DNAA 1YFZA 3I3OA 3D2CA 3L9WA 4LJ6A 2YJNA 1REQA 4O5OA 2GNPA 1BCSA 3TQCA 1IHYA 1C1XB 3KPUA 4LG1A 4C06A 4N7MA 5LN1A 1R0SA 5BUZA 3SG0A 3OZVA 3AR5A 5E7IA 1QTNA 3M4NA 3U9TA 4DY6A 2X4GA 1QRSA 4HAXA 5ALFA 5JYBA 3FCYA 1TK2A 3C24A 4XPZA 3RBVA 2ODQA 2Q8QA 3FWPA 1EHIA 3JVUA 1JVSA 3OZEA 4HAZA 4UNQA 2ZSEA 2JFPA 4KUEA 4FBLA 3O3OB 3EXG2 1QRDA 3KZVA 2P11A 1P3JA 1DAIA 3JQRA 5IAOA 1DCMA 1ND6A 3O2JA 2I4RA 4FT4A 4RQUA 3VC2A 3C6BA 1SM4A 3ZVKA 3U3JA 2OWDA 1O8CA 1QM5A 2CFIA 4HC4A 5FPPA 5F7XA 2I65A 2AC2A 2BFPA 3PDUA 2I8CA 3JQDA 1XMSA 5IN5A 1PG0A 2QMHA 5HQ3B 2YHAA 3MJCA 1KEPA 4OXRA 3CG4A 2R2AA 4ME6A 3UNXA 4PG8A 4XE5A 3R0QA 3ZHYA 5L45A 2ZB7A 3JR7A 1WXEA 1KZ6A 1D3AA 2J3JA 2VNSA 1B8PA 5DM60 5MFPA 5AOBA 1A71A 4QUAA 2ZUDA 1U4SA 2BGKA 1LCIA 1Z6QA 2HJSA 1CR4A 5DK4A 2GFIA 1KDOA 1XD8A 4UOQA 1QF9A 1GEGA 1BDBA 3DR3A 2JA1A 1VKHA 2UZIR 4UAUA 3RJ5A 4DZRA 3AVPA 3ZTYA 1CG6A 2FVYA 1R64A 4RFVA 4FB4A 1YDEA 3QA3E 4JV5B 1MP0A 2WUWE 3W5DA 2CMDA 3JYPA 3QFFA 4NJMB 1SCUA 2CK3D 3E4DA 3VR5D 1L1EA 2JCSA 4OX9B 1T2UA 3WQHA 1QRUA 3QBJA 3EGDA 4IRXA 1GM5A 2OB2A 2PVSA 3G2MA 1YRQA 2L19A 3A04A 3B1YA 3PNKA 4LY9A 3HP4A 4LPSA 3DAGA 4RUKA 3RUIA 3SEFA 5HKAA 2YDXA 1O58A 1EB9A 1GV1A 4HLNA 3H2HA 1RLTA 3SVLA 1W5BA 3O8BA 5ILQA 5ERGB 3SFVA 4HRAA 4AICA 3A1TA 4ZDIA 4C0WA 3AKYA 4H3KB 4AJHA 3G6WA 4ESVA 3N8KA 2GXSA 5CYGA 2EERA 3ADKA 4JMPA 1ENZA 2VT2A 1Z5OA 3OZCA 3P20A 5J2TF 5L53A 4DR2B 4LC1A 1E1MA 1Q77A 4P4TA 3JATB 4LVNA 1J2RA 1HFKA 2Q4OA 3FPAA 3M4JA 4JP3A 4Z9XA 1J8QA 3DEIA 1M6VA 4G56A 2PT7A 3KQHA 5KDLA 5KTTA 4JP1A 2BEJA 2RIPA 3LY8A 5K3DA 1NKTA 3E48A 1FB5A 4MCIA 5KYVA 3HB5X 5EJAA 2MSDB 1YI0A 4GPIB 4BNKA 1FFXA 4C0SA 5IVPA 4A16A 2DSNA 3SEAA 4G67A 1W0KD 3DUWA 1P5RA 3HN2A 4GL4A 3WK5A 2O8EA 3B9PA 1PYDA 4JBXA 3TBHA 1E2IA 4ZOLF 4RD6A 2GK7A 3AV0B 4TN1A 2Z6AA 1Z0UA 2AXEA 1INLA 1KEVA 2QM7A 4G26A 4RD4A 3PXEA 2GILA 2PUVA 2WJVA 4Q82A 3ZKAA 3HV2A 4Y6SA 4CMGA 2PQ6A 2HJVA 3S2FA 4ZCTA 5EKSA 2DT5A 3C6YA 4DYDA 2P0YA 4IDBA 2J3HA 3GZTB 3HVKA 4ZCPA 1Z0FA 2ZIGA 5CD1A 1GIAA 1BOOA 1M66A 1FMCA 4H0NA 5IJAA 3TQFA 4DCPA 5FUQA 1PK9A 3KOWA 1PJBA 3Q2IA 1C1HA 4P7BA 4IGKA 3UQYS 2JFBA 4Y0NA 2VDUE 4YQFA 1Q7CA 4G8BA 1IN4A 1TOAA 3IHWA 4QYMA 2CLLB 2VAMA 3GLHE 1L5WA 2QD3A 3H5AA 2PAFA 1CVLA 1CHDA 1NP6A 4E5SA 3WGLA 1T1EA 3MTQA 3KS9A 3ZD8A 2BJWA 3ZLVA 2ZIWB 3FPJA 3SMVA 5JDIC 1T6NA 1ZH4A 4UZFA 5C1DA 1JWAB 5T3YA 3CYFA 5IJWA 5CR9A 3EC1A 3EGXA 5E3HA 3ZIAA 2PS9A 2CLFB 3WXMA 3JQ6A 1AUVA 3WA6A 1F2TA 2WVHA 4OQPA 2FZKA 1YBMA 5DYNA 1P39A 1F2VA 1JLLA 3ZTWA 3AEUA 5KYNA 2D3TA 1S8FA 5ALOA 4YX9A 5J2TB 1G8GA 3HRHA 4ARIA 5KMGA 4KR6A 2CBGA 2C42A 4JB3A 2BFWA 3DBLB 3R9KA 1D2CA 4OK3A 2JLBA 2EATA 1GITA 1KP2A 3S2EA 2ZYWX 5F2EA 2FMKA 3RNLA 1U11A 4U39A 5KCZA 3VR6H 3PGMA 2ZIVB 2GOYA 2SECE 4ND7A 3NNSA 2FAXA 3VYSB 1GZ5A 1SH7A 4WBSA 1CDDA 1C0IA 1E2BA 1N0UA 1PJSA 2CJXA 2QXYA 1PU2A 1SJ9A 2BFNA 3OLXA 4B9EA 2CHEA 3UN1A 4Q9HA 4B7UA 2D5AA 3I04A 3IVGA 1JSZA 2VTEA 2AWOA 1BS2A 4J0CA 4H4EA 1J70A 3FNEA 5EJFA 2JPDA 1FXWA 3DPSA 5JAHA 4XTRA 1DXYA 2RIRA 1I7NA 3D8NA 3C5CA 1L7BA 3LM8A 2DR0A 3T1NA 1XCOA 4TYNA 2PWYA 3AUYA 1QANA 4NARA 3BTUA 1K2VN 2JLWA 1OV6A 3PFKA 1NDHA 1T8YA 5FTNA 3U1BA 3QVWA 2VLBA 1M54A 4V0SA 1YZGA 3TPFA 3ZDBA 2ZZNA 1JEYA 1J9ZA 2ZUTA 2E4UA 1E60A 1WPGA 2M6SA 2JH3A 3KSMA 5I7RA 4C7VA 2NAPA 3PPVA 3E05A 1BMFA 4WKGA 2PX4A 3G8AA 4G5HA 4XD7D 4EOGA 4BUCA 5K0BA 3C3AA 3NIDB 2QTVB 3R76A 1DC4A 4JGIA 1IUOA 3IPCA 3NCHA 4G1FA 4U2BA 5GGYA 2WT4A 3T7TA 2NVUA 5AW4A 2YRFA 1FCJA 1R4NB 3ESXA 1UPCA 3AFOA 4IG9A 5CK5A 1FYXA 4JI5B 4EHLA 4Q19A 4D0SA 3GWGA 3COZA 1RYFA 2FEOA 1WJGA 3JARB 4MUYA 3QXJA 4W1QA 4ZIRA 2G6TA 3B7WA 2LGJA 3QSYA 3IAFA 2UYOA 5HR5A 5EXTA 2HY7A 2B35A 5H1YA 1FMFA 3Q85A 5HS6A 3IERA 2FSVA 3MLEA 3QXCA 3M5PA 2XXAB 3FF4A 3FUCA 3HYTA 3AP1A 1NAIA 2FFRA 3Q3CA 4P4NA 4L9RA 2FRXA 3NYQA 2X6QA 1CULC 1KU6A 1ZJ5A 2DWUA 4TWJA 2XVAA 5TS2A 2EBUA 3QXHA 3CRW1 2XYVA 2QDKA 1G9SA 1C7RA 2YMQA 4ES6A 1FDUA 1JR2A 2ZKIA 4AY4A 1I24A 4TMYA 1DZIA 1LFDB 1XYGA 3RK4A 4YI3A 1B43A 4WL0A 3AKDA 4JNKA 5EFZA 3RO7A 3GPIA 4B0OA 3C97A 3L7YA 4OHMA 1SOVA 5JEEA 4P84A 1QIGA 3TR0A 2MSEB 2D0PB 2ECPA 3VR2D 2JLUA 1OX4B 2GA8A 5IXJA 2JFZA 4GLLA 4EMTA 5AQEA 2F3PA 1NM5C 4ALNA 2O3UA 5EXSA 3O4JA 3H5VA 4R54A 4IZOA 1NT2A 3T4EA 4INJA 1ZNYA 4V1CI 5JT1A 3BD8A 1RWVA 4ZHQA 5DYIA 4Y1EA 4E5NA 1IATA 3ZIAD 1YJAA 2WHPB 5EP3A 2OZLA 4C5BA 3EJ6A 3DTVD 3E3LA 1SKBA 3HADA 4U3JA 5DNEA 5G02A 3ETDA 3U81A 3WY9A 1Y7HA 4MI9A 3B9BA 5FEUA 1ZWLA 5AO9A 4BATA 1RZ3A 2XZOA 4DKJA 2OYCA 2XXAA 3I32A 1NKVA 1BAPA 1X8KA 4KFRA 5AJZA 4FE7A 2F9MA 1N7GA 1P75A 2R1UA 4F3KA 1O0BA 5GVSA 1HE1C 1IFXA 4QOHA 1EVYA 1RT9A 1B2LA 3VH1A 2Z83A 1LDBA 1TTPB 2P9JA 1ZVQA 2F9FA 2OP1A 3K1JA 3MAJA 2ZM6B 4M8KA 3OPYA 3U4HA 3VO1A 3MTBA 5BN5A 4ZV9A 2AEMA 3A4LA 1G19A 4IDCA 1SXJA 4LV6A 1QP4A 3FTDA 1M76A 2O7VA 4QGSA 2EGUA 1H9BA 3DCJA 2VK2A 3LOPA 3RJTA 5CCEA 3QOWA 4OJNA 5ADWA 4E2FA 4I55A 1RWBA 2GO7A 3BXOA 3EG5A 3C85A 2B4AA 3I37X 4GM4A 4OJYA 3F4BA 1G6Q1 4ON9A 5CU7A 3N2NA 2Q1YA 3DE6X 3JVVA 2PMBA 3S0JA 4TS4A 1YB4A 3PUXA 4B6SA 5JFOA 2IXAA 4DA0A 5CEEA 4Q4AB 2WIKA 3E9DA 3WNQA 2HCTA 5GV8A 4Q1FA 2A9PA 4QUIA 2QRNA 1K8RA 1QZTA 5IHXA 3OBIA 3NHKA 2C1ZA 3IMEA 4GD3Q 1R3UA 1UJ4A 2PMDA 1HE3A 3L7OA 1ZRMA 2YNMC 1OVMA 5B2FA 2IDKA 4E5YA 1AGRA 1Q91A 3H5RA 1P19A 2TSYB 2OM2A 3ICWA 4J75A 3V4LA 5DNYB 1Q19A 1TYDE 1DX4A 2IZ0A 1ZH2A 1OXXK 3G2OA 3IAS1 4GEGA 5D3MB 4D0GA 2Y0CA 1XTUA 4UDYX 1WY7A 3DPUA 4QA9A 3KVRA 4WCFA 3WNBA 2OAGA 1FMTA 3FWNA 2EBHX 4Z4HA 3SR4A 4BGDA 3DT9A 1QPGA 3Q0EA 4MVXA 1XA0A 1PX2A 4EUSA 1KS2A 2CUNA 1E2JA 3NEPX 3R1IA 2VXOA 3DDUA 3EH2A 4LC0A 3IIKA 4MPDA 4MV9A 4RS4A 3CO5A 4IIJA 5A4JA 1FU7A 2PDAA 3IXQA 4HH1A 4S1PA 3UWKA 3O9VA 1OLOA 2H2FA 1Q3TA 2X1HA 2WJYA 4PC6A 1SIBE 3A2MA 2IYQA 4C7XA 3ZI7A 4S1OA 3S44A 4A2PA 1BVUA 1CJBA 1VM6A 3TNYA 4JI4B 4ZO6A 4YECA 3GJYA 3JPWA 3OZIA 4KRXA 3L79A 1VYTA 2ZT6A 4B45A 1ABBA 1D1PA 1T26A 5FUWA 3RV3A 5CA1A 1E4EA 4BNXA 4N0MA 1L8OA 4RADA 4M76B 1Y37A 2D74A 3JZIA 4NBSA 3S2UA 2L17A 3T3PB 5AW8A 4YRLA 3SR0A 4JUIA 2WIDA 1JQEA 3GFTA 5JMWA 2P9QA 2VQFB 2ZE5A 4XIJA 4FI3C 2P3OA 2OUIA 4HDCA 2C7RA 3H86A 2IPLA 3QZUA 1Z26A 1R37A 2RHCA 3CC8A 3MJTA 4PGGA 4Z86A 2FPGB 3HXTA 4ETMA 5I7VA 3U60B 1C7FA 3KAQA 4UHCA 3R0VA 1GG9A 2REQA 3K20A 3K70C 2GDZA 3CNLA 4PLVA 3QWFA 4L5IA 1Q74A 4BQEA 5DHRA 5KTNA 1D0VA 4L72A 1ECBA 3HG7A 2B8TA 2GHQA 4R84A 1W0CA 2X4LA 1JGTA 1LRKA 1H9CA 3X43A 2PTHA 3T12A 3EXG1 4LTDA 3UVEA 5FO0A 1I4EB 2FW9A 1YOVB 3FNHA 3GARA 4NP6A 4C0KA 1M5UA 4DLAA 4EG3A 5JTTA 5A3SA 2X8JA 1HMYA 1E1NA 5AIBA 1SRQA 4DCGA 4IGFA 5ALTA 3TLCA 4QZVA 4HO1X 1P7YA 2ID4A 1FS5A 4KO1S 1HFWA 4M1KA 1UKCA 4Q1DA 3I28A 5DGDA 3UMVA 1GNLA 1HBJA 3N2IA 4FNOA 4UHEA 2QTMA 3VTAA 1RYEA 1E4YA 4Q3NA 4WCFC 3UG6A 3VH2A 1V25A 1CZKA 1LDYA 1XKTA 3B20A 4X97A 2V8OA 1HEUA 3UFXA 3VOTA 2DECA 4ZV4A 2X0DA 2FF7A 1IG3A 3MT8A 1R6AA 4G2TA 2HSZA 4IQ8A 5SZJA 4YMUA 1MC4A 3EZXA 3G23A 1DEOA 3DAFA 2ZQ5A 4N1AA 4BNTA 2DFNA 3LC2O 4GX0A 1LZKA 2XZLA 2OD9A 1C2YA 1NVDA 4AKTA 2WT8A 1BG6A 2E5WA 2NZUG 2OXFA 4QULA 5HTKA 4F38A 2FWJA 4GKJB 1MVLA 2C84A 2WYWA 2ZIAA 1ZM9A 4NR0A 3L7AA 5BQ5A 2JK0A 5DHFA 2V4MA 1H2ZA 2OR3A 1SUIA 2RJ3A 4BNDB 1HE5A 2H51A 3EF3A 3BJZA 4XB6B 2PT5A 5AK4A 2R3SA 4ZZ0A 5JH7F 3AY7A 3H8VA 2XZPA 2ZR9A 3OOSA 1L4YA 3CO0S 3H1EA 3TKYA 2L69A 4CEIA 2X77A 4CQMD 3MSCA 4LVCA 4YRJA 3HTXA 3NBQA 1NJ5A 3WO1A 4DLBA 3LBIA 4V2IA 3VOBA 1ZI8A 3WAGA 2Y3IA 1EM8A 3O94A 1WLYA 4B1FA 4E2WA 3K0CC 5AP9A 3ZXXA 1KIFA 2WYVA 3MS7A 5KCMA 2H17A 1NW4A 2VSXA 3BFXA 3MTAA 3E7XA 4O0LA 3DCYA 3FOWA 4XOIA 5DWVA 3J81k 3CA8A 1C7JA 1WE2A 2JF0A 3ICOA 1QP8A 1BE8A 3CINA 2R1TB 3KLBA 5F12A 4BGVA 5CEJA 4TMWA 1E2QA 4P1ZA 4PM4A 1ESMA 5A6SA 5GOTA 1KXZA 3M6UA 3HDYA 4GI7A 4JYCA 2HH9A 3ZGYA 3DL2A 1U98A 2MMCA 3C4VA 4P83A 1ZINA 1JVBA 4R8VA 4ZO8A 3ZVLA 4WBNA 1PZHA 2C3UA 3K6RA 4HNGA 3ZBPA 4CU2A 5ADUS 2Q28A 4YP7A 4D9CA 1D04A 1I4DD 1L7XA 1OMOA 2X3YA 3BM5A 3PDIB 3QP9A 4D80A 3T3HA 3OCVA 4OKIA 3S68A 2VH2A 2ZDHA 6ADHA 5CCDA 1SCDA 4YY3B 4GEKA 3AR4A 5DBFA 5SV2A 4GWLA 1R8QA 1IWBB 5LUAA 3CPEA 3VM6A 3OTQA 5L95A 4I7EA 3I64A 4Z0PA 4DA8A 4CMJA 2ZE8A 1FYDA 3HB9A 1PUXA 2WM2A 2ZS9A 3C98A 3HJHA 2HN9A 1MHPA 1QAMA 3P9SA 1BEUB 1R16A 3P5SA 4FKBA 1K98A 1LQTA 1T2CA 3IR7A 4WT7A 5FAXA 7AT1A 4X66B 4LJRA 3O83A 1A9PA 4XARA 4EF4A 1NDQA 2PH5A 2PL9A 4IJ5A 3SQMA 4HQRA 2DHCA 3I04M 3NBUA 2CDAA 1U1EA 3VBCA 1UXHA 2WD8A 4K6CA 3VMMA 3Q3IA 4CR6A 2HSEA 2IYZA 4DY4A 4HX9A 4PVDA 4QFBA 3U40A 2Q2NA 2PVCA 4AS3A 5LQJA 3WWZA 1HYBA 4HDRA 2DBRA 4O4JA 2HLDD 3JWEA 4R2MA 4TRRA 1N9GB 1ZD5A 3BE6A 2GRAA 1WUIS 5ECYA 1IOWA 4XVHA 1JQBA 3L4BC 1E1KA 5JD5A 2B25A 1NVAA 2P4EA 2RHWA 5HK8A 4MKIA 4ND6A 5CLIA 5LZ9A 1B3BA 1NVUQ 4IIFA 5ED4A 1VJTA 1A4IA 3IAS6 4BWYA 1E1RA 1MC5A 1NMXA 2QJOA 4X85A 4YUYA 2GJ8A 2AR0A 4DR6B 3EXHB 3OAAD 4LJ9A 5CVJA 4KAAA 4JX8A 4FONA 2WBLC 4G07A 2DTEA 4H18A 3DFIA 2RB4A 3U9LA 1U31A 4CMAA 2XJ9A 3JVIA 4WN3A 4ADSG 1M5TA 3WA7A 2JASA 3AVOA 1JLRA 4R98A 5JO0A 4C2UA 3NRCA 4PGFA 3GN1A 5F5XA 3R3YA 1BW9A 2ZBQA 4HPWA 3NHLA 3U4AA 4JL8A 5L6MB 1RBQA 3QFHA 2BF4A 3VHXB 2FETA 2PLFA 2JGEA 4BNZA 1RTTA 1CQJB 4JK3A 4MO9A 2WB2A 3JATA 3MTJA 4DCUA 3EBLA 3ZE1B 2GF2A 3WBBA 5E0OA 1YC2A 1FDVA 1XQ9A 5JATA 5I3ZA 1GPYA 4BVEA 2YVAA 4ND5A 4OI4A 4V3CA 3ZW9A 2XCTB 1MUUA 4XTCS 5EYPA 1FDRA 1A0OA 2ZYAA 3WIBA 3MBIA 3CRNA 1M1NA 1LQUA 3JQ8A 4V3BA 1Y80A 3IEVA 4TTAA 3RF7A 4ARSA 5K6AA 3EQ8A 3DWIA 2ZVPX 2W6ZA 5LMZA 3N2ZB 2OBLA 1E2LA 3L0BA 1WM1A 3BWCA 1K9SA 1KZYC 1M1UA 2FN8A 3GEMA 2F3SA 3Q11A 4R01A 5KAMA 3RLIA 4W5TA 1SG6A 3JX9A 4JGBA 3VR1A 1OBVA 3MLBA 3UH1A 1Z9BA 3HBAA 3AU8A 1PWEA 5CB4A 1V1MB 4DLRA 1QQTA 1HYEA 3C4JA 5AM0A 4PR0A 4B4VA 5AI4A 4Q9JA 4BKQA 1DKRA 5B57C 4J0GA 3VU3A 4J94A 3MJDA 3DOOA 5HOQA 3AZQA 4HWSA 4ZAZA 3UC5A 4J1NA 3KZNA 4YCBA 1Q1NA 1NVGA 5D86A 3T1QA 3AR9A 4K81B 1COWD 4LGMA 3LKZA 1MNAA 4BC1A 1P2BA 1YQWA 4HTFB 5KB3A 4DV7B 1YJ5A 3R4CA 3T35A 1WHTB 2CVFA 4WACA 1FQWA 1EK5A 1T10A 3OC6A 1WHSB 3FYUB 3M33A 1A8UA 1EDBA 1UFVA 2VSFA 4DLSA 5JTUA 4KV7A 3D4BA 3HWWA 1TW3A 3LU1A 1MW8X 2MJLA 3CCBA 3ND9A 4MJ3A 4OXKA 3B9QA 1EFUA 2AF4C 3L5KA 5BVHB 3FYHA 4OHFA 3IPXA 4GKKB 2C5BA 2X14A 5JEDA 1X80B 2Q5CA 4F93B 4NBKA 3JAWA 3PIDA 4GP9A 1ZCZA 1GRCA 3VJRA 2BD0A 2GZHA 2Z08A 4YH1A 4OM8A 4CEJA 1T9KA 1SCKA 3LA8A 1H4QA 3KJZA 1S02A 5DGCA 4AG6A 2UU9B 1EAYA 3C3PA 1UFKA 4OXNA 4MVJM 1M75A 1DV2A 1WCV1 4ENVA 2HMTA 3RV4A 2E0IA 4L85A 1M2KA 2R4UA 4GKBA 5HFNA 1CUYA 2BFAA 2Q1WA 4CL0A 5JCPA 4UHJA 3B8EA 4OQEA 4NZ9A 1ECPA 2OHIA 2QX7A 1KE2A 4AM8A 4C2BA 3ROTA 4BB9A 5JCJD 4L8WB 5G3ZA 5KIAA 1L5FA 1ZOSA 1EFLA 2ZUVA 3SZUA 2XRFA 1SKQA 3OP4A 3ZGOA 4Q00A 3AJEA 5IT5A 1C9NA 1E2GA 3AVQA 3QVVA 3L0OA 4YGYA 4NATA 3WIEA 4KDFA 2DRIA 3VNQA 2GXUA 3RSOA 3P9QA 1RQ2A 3EYWA 3JWHA 3ZK7A 2XBMA 4RK0A 4G8JA 4EUEA 2XCSB 3TJZA 4D43A 1GTSA 1CS4C 5CHYA 4RF4A 1EA5A 1SQ0A 3M82A 3B6JA 1MR3F 5E1OA 4RDCA 3UKOA 2YY5A 2XD9A 3ACCA 3ULKA 5EWJA 3OFVA 1Y34E 5DTIA 5HWSA 1G8PA 1S2NA 3TRIA 5JJCA 5G1OA 3EXAA 1FIUA 2PZMA 1BRMA 3PRHA 1OH5A 2M98A 2NQTA 4R3NA 4MEJA 5BYKA 3D31A 1HZJA 2J9FA 2D1YA 3NALA 4DSAA 2PO7A 4GI2A 3WYGA 4OIMA 1L4GA 3L7NA 1C8BA 4UEKA 1XF9A 3ZJYA 1ZJWA 1CUWA 2BMFA 4GPAA 3GFSA 3JD2A 4KZKA 3SYLA 2Z04A 4IDDA 5EHIA 2XTJA 1O5TA 3ANSA 3KB2A 1WB9A 2LD4A 1P7VA 4TTIA 4S2UA 3D3NA 2EJBA 3JZAA 3PI7A 2G1UA 4A0QA 3ZWYA 1WXQA 2BJHA 3H5OA 3MTEA 3Q7SA 3VSCA 1S01A 1G291 4C89A 1WXWA 1CZLA 1VYVA 3ODPA 4RV4A 1J24A 4GLFA 1ML3A 4RE5A 4JI6B 3AJDA 4IFIA 1A76A 4JQOA 5SZIA 1U2PA 4KXFB 2ZTHA 1XZDA 2G5TA 4B4OA 3H0EA 1X13A 4LNUA 4QJIA 5DHTA 3PLNA 2OO5A 3X1ZA 1Q0UA 5A1JA 3DEKA 3HABA 1GSOA 2HV8A 1FSGA 3CB4A 4JYZA 3B6IA 1YDFA 1ZZGA 4TN5A 3IOEA 2RHTA 3WMXA 3K1TA 3S1SA 2GK3A 4PG6A 3F46A 3PTZA 1Y63A 5ENDA 5D5PA 5EWMB 5C0OE 1WD5A 2OFFA 4FFSA 3RAEC 4MKRA 2GZRA 4FHFA 4I1VA 1SQ5A 3B38A 4EB8A 3QJ5A 1PNQA 2XMCA 5I47A 1OFUX 4QT4A 2LBPA 3A4MA 1A8IA 2XUHA 1VPDA 4F46A 3ABSB 4CTOA 5HIKA 3IVRA 3ONDA 2C54A 3UK6A 1F1BA 1VSVA 2WKSA 2X22A 3ZZ1A 3ZHSA 1R0KA 2I6QA 4F2HA 2VZ9A 4NC9A 3RIYA 4DCNA 1SOAA 2C7GA 2GVZC 4C3OB 1YIDA 1RQXA 2QUAA 2VTVA 3O4FA 4XJTA 1QIIA 1U3DA 1MX1A 1E92A 2BUCA 3P2IA 1REQB 4PGMA 1NXWA 3LF2A 5JS7A 1EK6A 1U7DA 2VTBA 1HG1A 1YQ9A 3PS9A 1PJ4A 3WWEA 4NCNA 3UT0A 4EI7A 3H13A 4M3NA 4G5RA 2UYHA 4DV0B 4Q1VA 1CRZA 1GKUB 4V02A 5DX8A 3R7NA 5KUTA 1A27A 1EG7A 3PFFA 3CVVA 1L7DA 1XAIA 1NM5A 4Q7JB 2V4UA 4QBKA 3DOIA 3GT4A 4L9AA 3CLTC 4CZ2A 1PBNA 1KL7A 4OAPA 4JXZA 2QR3A 3UB4A 1UBOS 1UDAA 3LDFA 4IINA 1B76A 4R8SA 4UMDA 3KXKA 1FU8A 3A6LA 4AJLA 4EG8A 2JGDA 1N2OA 1PNOA 1UK8A 3T0GA 3VU8A 3NTQA 4C88A 4RVFA 2AOVA 1E5XA 4EZIA 4B17A 4DDWA 1JA9A 1PL8A 2XNCA 4TGLA 1K5PA 4Y2GA 1JALA 1KYIA 4TXMA 2RHDA 2BLLA 5EZYA 1JWLA 1SZDA 3HU1A 5AUOB 4JFRA 1ZCBA 2ONYA 1YJCA 5EJ5A 3L04A 5EMKA 5AM5A 4Q02A 1E66A 2BR3A 1NN1A 4BJ5A 1F3LA 1L4HA 2H29A 2IPMA 1XD2A 3N7TA 3LYUA 1ZD9A 2P9TA 4K6MA 1ZRNA 4UTOA 1PFUA 1PS0A 4QU8A 1QX3A 1LSOA 5J1TB 4A5SA 2Y66A 1FQKA 1XPJA 2XZDA 4HQNA 4D99A 5HRUA 3K8QA 2OUKA 4GE3A 1N7JA 1P1IA 3FCAA 4FNMA 5H4HA 4GQAA 1W4CA 5AT1A 3WYFA 1PQWA 1T6BY 2VEOA 3LX4A 3RTGA 1T0BA 1RLMA 1A2OA 3AB7A 1UKBA 3IKJA 3NTLA 3N87A 1RWQA 3FGNA 4F1WA 3U7HB 3PJRA 1N2IA 4F4CA 2DCUA 3QLJA 1LJLA 4DQUA 4B7CA 5ENZA 4E03A 5FBWB 2HI0A 2YJ4A 4UM8B 3LO5A 3QEAZ 3L40A 4Y98A 1A8HA 4QPNA 4N18A 2ACEA 4DXHA 3L5OA 4KQ6A 4EHDA 3TFOA 2IL1A 5GM2A 5C4MA 1W75A 3HVIA 3HKBB 3JQBC 4M99A 1P2DA 4AF8A 2HNBA 3GT7A 5E8JA 1IZ9A 3LUFA 4QJ4A 4UE6A 2O8BA 2I3ZA 1VE1A 3V4SA 2ZVQX 4FGLA 2NTYC 3AF0A 3TQHA 2WSYB 4KWTA 1ZO8A 5JSZA 4PGHA 1OKKA 2CXRA 1G42A 1LSUA 1JHQA 2C92A 2J9ZB 1E0SA 3AL3A 4M0KA 4QQNA 4YAGA 4LGYA 2XDAA 5EERA 3UUGA 4G8DA 4TV8A 2OXTA 1JAXA 1ZIOA 4WEQA 1OQAA 2O2IA 3LE8A 3IUQA 1CP3A 1JDBB 1N9GA 1NNI1 2ZSIA 2CDRA 4FGJA 4FYWA 4OVKA 4WNIA 4CIDA 1JIQA 3KXDA 2HMUA 1GT6A 1NXTA 3LPMA 4I55F 4LECA 1KY3A 4B46A 4X6UA 4WVLA 5MHTA 3WQBA 2BMWA 5A0VA 3SJ7A 3A3OA 3I58A 1Y5RA 2Z5FA 3EGCA 4L9WA 3UJNA 4BRUA 1BD3A 2FZLA 3NGLA 1ZL0A 1NV8A 2HZ7A 1QAQA 3KEFA 2PSJA 1W44A 2LDXA 2ZROA 3KKKA 5EZ6B 1E0DA 3EFOB 1UMDB 3VHLB 4MV3A 2B20A 2P30A 1U5AA 3RYCB 2G70A 4YAEA 2OV1A 1ZITA 2F1JA 4G1EB 1SCIA 3MXTA 3PNSA 4H1HA 4R9VA 5D5HA 5TF0A 2RBKA 2V8BA 2E4VA 1MJNA 1TMKA 1C3VA 1ODFA 1XQVA 2P7HA 3IDAA 3PFGA 4JA2A 4N0DA 4JLKA 4JSYA 2G76A 4NL4H 3STHA 4UDOA 4EI8A 5ABPA 3AUJB 4RPIA 3KSUA 4DWJA 1VHWA 5IMSA 1VE9A 4Q18A 2A5LA 1BVYF 2V6BA 4G1CA 5DXJA 2FZVA 4B6FA 5C8ZA 2ERYA 1S9HA 2AG0A 3V1LA 2QE6A 5JAQA 3UK1A 2ZWAA 4YASA 4A6DA 5LMUB 1W2HA 2CSUA 4Q24A 3A1FA 5DWDA 2I2CA 3L4BA 1JR3A 3N8IA 4OY3A 1AK9A 3ZWOA 1TAGA 4C7BA 3B70A 5KYUB 2HD4A 2Q5JA 3D8UA 1NJ1A 2OOSA 4A9AA 1G2QA 1SCUB 2YKGA 1MOQA 1IQRA 4H0FA 1IBLB 4FOSA 2JJ1A 1AUOA 2D8AA 3I9V1 4IKPA 5BP7A 3EZGA 3LUDA 4KOAA 1D6JA 1NVMB 4RKFA 4C6SA 5BN3B 4HI0E 5KKCA 4JJEA 4PX5A 1E6MA 4WDRA 3CJRA 3U4GA 5KSYA 3THWB 2WE8A 2DERA 3W8FA 4Q3KA 3FMVA 4GRDA 2FPKA 3C6QA 2ACWA 4WGGA 1AA9A 2AW5A 2PJZA 3CFYA 4N7BA 4DREA 2RHMA 3CMMA 3M2TA 4LSZA 2AHOA 2JLCA 2VN8A 2X86A 2OP0A 4MWZA 3SBOA 5JALA 1MB2A 3ZBUA 1PFVA 2FR1A 2OO3A 3BPSA 3GEGA 4AJKA 4QTXA 1FPQA 5HIAA 5J4LA 4UKDA 1UBEA 2PT6A 3SHOA 4HAIA 2OQVA 4LYJA 1NJ6A 3ELBA 3H2YA 4B5LA 2NGRA 2CC2A 3AKEA 2CDBA 4M6WB 3QWBA 4I55B 2HYDA 1ZGJA 2Y0DA 3QYAA 5B58T 1FX0B 2I6FA 2ZRKA 3BHMA 1Z2DA 3VSBA 2ZXUA 3DAPA 2WLSA 4H35A 5EKXA 5C5DA 3UTDA 2M9MA 4PZYA 1KF0A 4EHFA 3AJ9A 5I8WA 4FR2A 1N6IA 3QLEA 3W4IA 1VHQA 3T94A 3I09A 3Q9UA 2H1WA 3O3CA 5ALJA 3E0XA 3MVEA 3W2EA 2X19A 1ZAKA 1N92A 1NF8A 1ZX1A 1YRWA 2V7QD 4UBMA 4Y2TA 3UM9A 5B6IA 3J7TA 3RC9A 2ACVA 4P4SA 3TW6A 1OBHA 1UT5A 3TLZA 1GPAA 4JYAB 3E35A 1Y3DE 1W30A 3KFLA 1YDWA 3PCRB 4GZMA 4B34A 4KIWA 2PZJA 3WB0A 4MGKR 3HY3A 2AVDA 3GRYA 3ZD6A 1H0SA 5LP6B 4MRNA 2Y2VA 4R5HA 3K9HA 4QASA 2B7BA 2PX2A 1OXMA 1OFTA 1L5SA 3NC4A 4WIAA 4DZTA 3L1VA 3NO4A 4LFCB 5KDOA 2BKUA 3MCAA 1JKMA 4DLVA 1HK7A 5EJ2A 2Z57A 3LCUA 4HR7A 3VV2A 3BMNA 4G86A 2H8GA 2Q41A 5A3RA 3OOEA 1GAJA 3QVJA 1NBMD 2XMQA 2PCJA 5E9WA 3H87A 2G1PA 1I0LA 2XT9A 2DBYA 4QYWA 5EP1A 4A1FA 2V3CC 1KEKA 3GGCA 3NBZC 5D8DA 3WLHA 4IGIA 2B6HA 5DNUA 4KODA 1UOEA 2JGMA 3E1GA 2NSYA 1K7EB 3GJ0A 4R9NA 1YJBA 4RJ2A 4CKWB 2O1XA 3EDMA 3OHPA 3J7AC 2C2YA 1Q0HA 2G8LA 1Y8AA 3WK9A 4H59A 3PVSA 1RXCA 3G0CA 2HBYA 3RTDA 4BNYA 4BYMA 2Q8PA 4H1UA 2XMBA 3OF5A 1YQXA 1KOFA 1BHSA 1OZAA 4X61A 3S2ZA 1TKAA 1UEJA 5EXEA 2I80A 3B3JA 3LVFO 3T0IA 3AEYA 3HP1A 4FNAA 4FOPA 1GG2A 1SVIA 1EP1B 5CPFA 2ZJZA 5K8TA 1V0JA 3SNHA 5FWNA 1CJCA 1SHJA 2BKLA 1OZ0A 3BFVA 3OCJA 2V98A 2QVXX 2JJQA 1NBOA 3BZBA 3WMEA 3THWA 2YIMA 4EEXA 2JLYA 3CF2A 4PG5A 1M3SA 1XG5A 2I7DA 1U3CA 3BL5A 5DRTA 4HT3B 4OBBA 1QVRA 3KNZA 5B2ZA 3QHAA 3LX6A 4MWSA 5ITVA 1CRQA 3A7DA 2D1FA 2K87A 4B4DA 4HATA 3LY7A 1H2FA 1NI4B 1R18A 2CMHA 2GF0A 4HTAA 4DPKA 2FPOA 5JZSA 1PJAA 1T4BA 3VAZA 4ZODA 3GNSA 2JI9A 4UAVA 2CZQA 4WCFB 3UOWA 3WB1A 4ATNA 2ZYTX 5JVDA 3W3AD 3W78A 1UZLA 4ZOLA 4EITA 1JHVA 1RXYA 3KSRA 4TV9F 3KKOA 2I9KA 3CUKA 1ZC3A 3EH1A 5H82A 2BHRA 3IOYA 2YN2A 2J9YB 2XEDA 2GFHA 2V7BA 1R9JA 2ZREA 4GYYA 2UZ0A 1W4BA 1E9AA 1MRNA 2QTAA 3LA6A 4AAYA 4DQVA 4EGJA 2QP3A 3MOIA 1L5MA 4Z2YA 2ZBGA 1AKNA 2IH2A 2HX1A 4KL8S 5D7BA 5ERXA 2I78A 4I5EA 1KZGB 3CU5A 5DIFA 2FI1A 3RR2A 4EW6A 4J9VA 1E94E 5L4LA 3VTKA 4TMVA 5DRYA 1KKMA 1YGYA 4QXAA 1QDEA 3K0HA 1CJMA 2VOJA 3OM8A 3M5WA 4BO6A 1MZPA 2VNKA 3IX7A 3BXHA 5FBVB 1U2SA 1Q12A 2G80A 2JKVA 4ZOLB 2SHKA 3HL4A 4LJYA 5IK2A 1KRHA 3BEDA 1RWMA 1A8SA 1PWXA 1N7IA 5ELXA 4A0RA 3EWSA 3G0OA 4NEGA 1CUZA 3DE0X 1NJ8A 3Q6IA 3TIIA 1EUDB 2AUNA 2Z2JA 4F6LA 3P7MA 1UBLS 5IF9A 4HQKA 4UD6A 2G5CA 2XOEA 4M7PA 4KSYA 2HPVA 3W5BA 1JE0A 4BYGA 4E3ZA 1EFCA 1FFDA 1F6BA 5CB4B 5KU7A 4ARZB 2P67A 4D8UA 4DLKA 2KI5A 2KW5A 3L07A 1JE1A 4LDRA 4TPKA 5DTJA 1DG9A 1DOHA 3NORA 4U8HA 3UHPA 4KH0A 1FFGA 3K2EA 3G17A 4B6JA 4D02A 4EW1A 4FQ5A 4R6WA 3PHLA 1SC1A 2JLQA 2CUKA 4FZ3A 1FXWF 2BYTA 2ZUEA 1JJFA 2H2AA 3NFYA 5IAGA 2EBWA 3THRA 2YYAA 4BMCA 3I62A 2ZI5A 3Q9SA 3F3KA 5HM6A 1C1DB 4Q1AA 2EKQA 3VGJA 4OQXA 3RIGA 1THZA 4NESA 5EIOA 1LDMA 3T9CA 4JI8B 4QOSA 5DP2A 1R0ZA 3VKGA 1XZIA 4MB0A 1NT4A 5FO1A 2QGZA 1EFVA 3OA0A 4FXOA 2HL6A 4Q01A 4BNMA 4ENSA 3A2LA 5LDGA 2XRYA 1WO8A 3WGZA 4MGIR 5ILOA 2VPXA 4Q1BA 2PNFA 4QDTA 2WHPA 1RWNA 4G63A 4OFZA 4PQFA 1XC7A 4Z3DA 4DS3A 5KQRA 5FYQA 3CT6A 1A77A 4HZGA 3W05A 3UEOA 1DUSA 5AM2A 4FQ7A 3KXIA 2B5VA 2FMIA 3V32A 5TRTA 3SKXA 4A0SA 2WFAA 2AX3A 2PA0A 5UKDA 4BEVA 1XJQA 1DCFA 2NG1A 1IAVA 1HXHA 3HL0A 4GPBA 4MCAA 5EHZA 4DNOA 5I7AA 1NTRA 3CTMA 3V2HA 1OTXA 4UNNA 3RSFA 5HKOA 1E1RD 4BEBA 1GARA 4CCYA 1AQUA 4IXNA 2RGUA 4MKFA 1M1ZA 3UMYA 1VRVA 3NFRA 1BE0A 1LPOA 2DR3A 2H3EA 1AS0A 3FDFA 5K03A 4S04A 3CLRC 1XTTA 3TW8B 5IKMA 3VUEA 2BFEB 8ADHA 1RWWA 1CETA 1NSYA 4A3SA 3F8WA 1TNDA 3TLMA 4X41A 3GI1A 4OHKA 2VNJA 1PGNA 3BRSA 4GPTA 1M2NA 3K0BA 4JBIA 1KI9A 2PKRA 2R7MA 4ACAA 1W1IA 1PT6A 4MVYA 3WIUA 3N8HA 3A4VA 1LBIA 4M0CA 5KWSA 1I8TA 3HUFA 3VU1A 4W5OA 1KK1A 1MENA 2QV7A 1QYWA 3B36A 5IDYA 1ISGA 1M0TA 5IEBA 2W00A 4X93A 4C5AA 5HZGA 4BBPA 3VZDA 4DMCA 1G59A 4IX9A 3R9XB 5FXMA 2QQFA 4D97A 5BSFA 1GSIA 3RARA 3MWDA 4BAUA 1IPFA 4EF5A 4N41A 4F8JA 2QBYA 4DR7B 1JH8A 2X4IA 2XVYA 1IBCA 1PW5A 2RGAA 2O48X 1KOLA 3C7TA 3BMCA 3JASA 3U2QA 4FOTA 3WK6A 3PNPA 1N0VC 1X7YB 5C8XA 4F4JA 4X5OA 2NZVG 1JAIA 4LZNA 3REFA 5JRJA 5L4NA 1Y1SA 2PS0A 1M6YA 1U1FA 1WKVA 3AOEC 1M67A 3PG5A 4IUYA 4PO9A 1Y9EA 4URWR 3ZHOA 5F7ZA 4GSKA 3QBDA 1Y33E 1E2PA 1MEOA 1U7TA 2BZSA 2E4XA 2MR5A 4P53A 1AURA 2RGGA 1SXJD 1DC5A 2GZMA 1LLDA 2KSQA 1WTAA 3EZ9A 3GJQA 3TZQA 5KBYA 3LOQA 2AJBA 4AZWA 1I6MA 2R7NA 2LUOA 3WNCA 4A91A 4LYGA 2XUIA 1TEXA 4CV2A 1KGDA 3AI3A 3KKEA 3MGGA 2BEUA 4L5CA 4HNAA 2IOHA 3TOZA 2Q0SA 1ULBA 1HOTA 2AC7A 4I08A 3DZBA 2O57A 4BWGA 3HXKA 3O8LA 5IC4A 2W2LD 3WGGA 1BKYA 2VWHA 3EFHA 4IHKA 5I7EA 4IH1A 2IYSA 1PQUA 3MN1A 3KHTA 1I0IA 1E2EA 2R60A 4XIYA 3UJ9A 3VAAA 1JIVA 1PWHA 1QUEA 3H2IA 1I33A 2B21A 2OCYC 4RVCA 4OKNA 4BNGA 3QY0A 4NCIA 5C81A 5AK6A 1BN6A 3MYRA 3JRWA 3AF3A 2EOAA 4CKWA 2VH5R 1VMKA 2C4WA 3P9CA 4Y2XA 2WSBA 1JLLB 1SBQA 1O6ZA 4K2AA 4MQFA 4GOXA 4DANA 3BQNB 2XCUA 1GYRA 1JKFA 2VJLA 4DRZA 1GNVA 1CQIA 3OUZA 4KKXB 3I9NA 2IWRA 3OZAA 3GA7A 3PXAA 3R5SA 2PMKA 4TKZA 1OX4A 3IKLA 1FJ2A 1RFLA 2O20A 5EAIA 1U0GA 1TEVA 5DTQA 3MWGA 4YJDA 4D3SA 3KQVA 4M9UA 4PO1A 5M3BA 3CUUA 4BMVA 4RTQA 4DUPA 2WQ6A 5CNKA 4KNWA 1OWPA 2MINA 3OIGA 2OBYA 2FLVA 2QJWA 2Q5HA 2QT1A 1FDIA 2PXHA 5A5GA 3D4LA 4CHTA 3BIFA 1EVZA 4CDMA 3MCUA 5TGDA 2HIGA 2C98A 5BWLA 1FK8A 4O4HF 2ZT7A 2PKEA 5CAEB 3D6FA 2V6GA 1J8YF 2QVCA 3TLEA 2X5KO 2R11A 4F3TA 5CDYA 4TYYA 5ETJA 1DCTA 1HEIA 3MINB 4UFOA 3SZGA 3WMRA 1VI6A 1FFBA 2AK2A 1RYBA 3ZQUA 2YNMA 3AY0A 2B36A 2I4IA 2VKTA 2L82A 1RYDA 3AESB 1FS6A 1Z2OX 2CD9A 3GRKA 3KT6A 3QK7A 3OKAA 4WK0B 2ZK7A 3WTBA 1W7AA 1I2DA 3BRQA 1MIHA 2JAUA 4RLFA 3FFTA 3FWHA 4MK4A 3ZY5A 4W7IA 1NR5A 1TIPA 1YNOA 3AKZA 3GFGA 3BSYA 4KMOA 4LSWA 3OMLA 4C0QC 4EJSC 4EP1A 1JT9A 4IKEA 4ZOQI 3I1FA 1RW4A 4NV0A 3JQGB 3U19A 1EAMA 1V6AA 1TZ2A 2OG1A 3ZX5A 4J4HA 2FPGA 4QPPA 1V3UA 1N5JA 1X7YA 3FHCB 1KJIA 2B1JA 3PQDA 2PD4A 2VHWA 3NOOA 5ALXA 4P5DA 2PQ2A 1N1GA 5BO5A 4TKMA 2QIPA 1W1UA 4XDHA 5KHLB 5G4LA 1J1IA 1RFGE 4XW2A 5AHXA 5BSGA 4BNLA 2YCLA 3DHNA 1J2EA 4B33A 2BE9A 4XYMA 3RTEA 2ZLBA 3T7IA 3K35A 5T8KC 3V1KA 4Z4CA 2LZ0A 1P80A 1Q0QA 4L3OA 4M9XA 3OPVA 4GOJA 4X94A 1KYYA 1NWCA 1QH8A 5D1HA 5DMHA 3RU2A 1DG3A 2ISQA 4RK1A 5A0FA 3WL4A 5DULA 3E9QA 4IDPA 3S40A 1SUCA 4KQEA 4PTYA 4TLMB 5G41A 4EATA 1NTOA 3B78A 4R31A 1D4FA 4KX3A 3ONFA 2I6UA 2R4QA 3IEXA 4HLQB 4JGGA 4Y6LA 3W8DA 3N86A 4FFLA 2EFGA 1ORVA 1XSEA 4CIVA 2C5LA 1QIHA 4U6NA 4I4NA 1JYEA 1P91A 4OFWA 1O97D 1JIKA 3A4TA 2D7JA 1EVKA 4TMXA 4UZSA 4X1YA 1KQFA 4Q7QA 1KYZA 1SCQA 2FPPB 2I3DA 2YRWA 3KZXA 4OFXA 2IW1A 1RMQA 2ZR7A 1TQDA 3BZWA 4HXEB 2CYCA 1OU0A 1Z5NA 2HBZA 4Y6PA 4D8TA 3KWMA 5HJ7A 9MHTA 3EY4A 1VPLA 1OV4A 2PZAA 4PXSA 4R9SA 3T38A 3VPXA 3PKJA 3RD5A 4JBYA 4BJHB 4BN5A 1N5DA 1QIMA 4P7GA 2C07A 4GUAA 2B1QA 2YZ2A 4WKNA 4B5KA 1MEJA 4MS3B 1G9XA 3C16C 5FOWA 1KAGA 1JHOA 4R0MA 5DHSA 3Q2OA 4DIUA 5K0TA 4C6RA 1SU4A 2OV4A 1CR2A 1QHYA 1W52X 2DQZA 3PD1A 4GMDA 2I34A 3FF1A 4NECA 4OLFA 1Y7IA 5FTMA 1AGXA 5I7SA 3OJOA 5FA8A 1XEWY 3QLUA 2VHXA 3GLIE 5JADA 2O52A 5LQMA 4G9GA 2H1SA 4F86A 3C4QA 1A4XA 3GRUA 3HJCA 4U7JA 2DLNA 2ZJYA 2ZBUA 3WBKA 2XCRB 1WSDA 1UT8A 2O7SA 2WAYA 3FNGA 3L7CA 3ZHTA 1V9CA 4B71A 4INAA 2OT3B 2ORIA 3JQ7B 3FJYA 1HE8B 2V7GA 1BWSA 2NO6A 2RJNA 1JDSA 1V1RA 2C3MA 2FB9A 4J0HA 4JLWA 4B3IA 4E4TA 3P9YA 1J8FA 4U0KA 3SQDA 1AUQA 5K09A 2WNHA 3HBJA 3OIDA 4TROA 3DV9A 3QTLA 4QUDA 2O8VA 3V4FA 4E30A 1Y4SA 4ESOA 4L7VA 3HBLA