2G75A

Crystal structure of anti-sars m396 antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
218
Chain Sequence
VQLQQSGAEVKKPGSSVKVSCKASGGTFSSYTISWVRQAPGQGLEWMGGITPILGIANYAQKFQGRVTITTDESTSTAYMELSSLRSEDTAVYYCARDTVMGGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTSALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of severe acute respiratory syndrome coronavirus receptor-binding domain complexed with neutralizing antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords IGG Heavy Chain
total genus 40
structure length 218
sequence length 218
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2g75A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2g75A01
3LPGA 1NLBL 4O58L 2NY2C 2DD8L 5JW3L 5JO5B 4XBPB 2X4NA 3FOLA 4HC1A 2CKBL 5IMOA 5SX5H 1KPRA 3HNVH 3AS2A 1L7IH 1TJHH 4WGVB 3UZVB 1MCDA 2ADFH 4FFYH 5ESVB 4CMHB 5GS1A 4H88L 3MXVH 5IB3A 3SOBL 4Y5XB 1S5HB 2C1PA 5ERWB 3R4DA 5ADOH 1T2JA 4JJ5A 4RMWA 3NPSB 1REIA 4U6HB 5CINL 5HHNB 3ULVD 3GSNL 4X5WA 4PRPD 4V1DE 2W0LA 4QF1B 5MERA 4XCYA 5B4MC 3HUJA 4OLUH 1AE6H 2ZOLA 4XX1E 4GBXC 4OGAC 4KVCH 4LOUD 5HI3C 4P9HH 5ENWB 2Z92B 1KEML 4R26H 3U6RA 1HSAA 1SEBA 3CX2A 4HKXB 5LCVH 1NBYA 3GEWB 3ARXA 5J89A 3BGMB 4Y16A 1KJ2L 2E6JA 5JDSB 1HHKA 3P0VH 2NNAB 2NY3C 3R1GH 1AQKH 4NKDB 2A83B 1GJIA 4ONFL 3ROLA 3VGAB 4C54A 5I8OL 5CBAB 3QUXB 5H2BA 3DJ9A 4ELME 5K59F 1FHGA 5E6ID 2GT9A 4O51A 1VEOA 4Y4FC 4OZFG 2SEBB 4A6YB 3KHOA 5KSBE 1KCRH 3GIZH 4HPYL 5T5NG 2AK4A 3TNNA 1ZGLB 4U49A 3I75B 4HUUB 5KVGL 2HP4A 5J06A 4FQHA 1FYTD 4NUGH 3P4OA 3FO0H 3WHXA 1BVZA 3D9AL 3GJEA 3UJIL 3KPRA 4Y16C 4GRLA 5JQ6H 5IJVA 3BFOA 5JHLH 4KUCD 2VERN 1G0DA 2HRPL 4N8PA 1AHWC 5ICZA 3GMPA 4MNQA 1NAKL 3HCVA 3VD4A 4P2QE 1MCOL 2VDNH 3LH2L 3BDYH 5FHBL 1CDBA 2D9QB 3GB7A 4PJAB 1KCKA 2X7LA 3IETB 1B90A 3QPQC 4GBXA 4IMLB 3U0PB 1OOAA 1I7ZA 1HI6B 3VI4E 4ZXBD 1IQDB 4U6HA 4RA0C 2A73A 2WINB 1O7VA 1AO7B 4WW1B 3RU8H 4D9RE 3IDJA 2FWOA 4RMUA 4M6AA 4KKCD 2FIKB 4JR9L 3B2VL 2E7LC 2B1HH 4BQ9A 5GS2D 3B9AA 1DVFB 5FEBA 3KWWB 3B43A 2DIJA 2IWGA 1FBIL 4K9EH 1YY9D 5CZVH 1A6WL 1OAUH 2V7NA 4BUGA 3DX6A 3MRKA 1W0VB 1CXIA 3Q5OA 2JK5B 5CIPA 1HINL 2X9XA 4R2GC 4ZXBC 1HXMB 5I73C 2YPVL 3QPQD 2OL3L 3D87B 4ZTOL 2C1OB 4FQXB 4G5ZL 4UDTA 4YK4B 5D1QA 2PYFB 3MXWL 3TT1L 2WZPD 1T0MA 5DRWA 3SJVE 4DKFL 3V6ZB 4RRPA 4MJ2A 4JRWA 3VRLF 1P4LB 2AW2A 4D3CH 1N0XH 2YPLE 4PRPA 5B38A 3QHFH 4I0PA 4GRMA 5JW5B 2BSTB 4HZLB 1JZ5A 1NKOA 1E6JL 5A40E 5EN2A 2XZAH 2NX5D 3D0VB 4DN3L 1TPXB 2OL3B 4PJDA 1QQDA 4PJXA 4XNZB 2DIBA 5J13C 2AS5M 3P4MB 1I9IH 2B1AH 1I9RH 1P4LA 2EYSB 5CUSH 1S7TA 1DQDL 3O9WD 5GGSY 5T33H 3VJ6B 5AWNH 4P9HL 4P4RB 3TBYA 4PJAE 5EOTA 4GQ9H 5GS3A 2DTMH 3MLTA 4XVJH 1N59A 1NGQH 3J7HA 2HN7B 2GK0A 3KJ6H 3FO9B 3RWJB 3VD3A 5CP7B 4HLJA 1CLZL 1GGCL 1J0JA 4LFHG 5FAAA 5DJDB 3X3GL 3VG0H 1JWMA 1CFVL 5I2IB 4LPTA 4GKZA 3PUCA 2VMFA 3D0LA 1KNOB 2R1YA 3PGFL 3MBED 5FM5M 1RHHB 5TDNA 4UIKH 3LDBC 3U2SA 5HI4D 2O5YL 1HHJB 3AY4C 4NQDB 2GCYA 3OG4B 2CRIA 4JFFD 4F57L 4M61A 5E8NA 1Y6KR 3DURB 1CGSL 1MNUH 3RZCD 4D8PA 3GSNB 4DWHA 3QFJE 1E4WL 4OD2B 4HWBH 4JZNA 3WNLA 5KSUA 1HKLH 3SGJC 1Z2KA 3EJYD 3DUSB 1QLFB 5MI0B 1DDHA 1S7VA 1AP2B 3TLRA 3AGVA 4QXWA 2HFGH 1MUJA 3ZDXF 3GMNB 5CP7A 5J11B 4PJHF 5DMKB 3T77A 3KS0H 3LB6D 3NN8B 3ARUA 4KUCF 4YHNA 3S4SG 3U79A 5AYUH 2PXYB 5I1DB 3A6BL 1CGTA 4MJIE 5D96B 2VDOL 5C3LD 2I9LA 5DK0A 4PJXF 1OTSC 5EU7E 2IANA 3QO1A 1SVZA 4ONOA 2E9IA 2EC9T 1A7RL 3VXUA 4WWKD 4LCCB 5HGHA 3LKOA 3SY0A 3HG1E 5EWIH 1EEZB 5HGGS 3EO1A 1XGUB 1AY1H 1ONQB 3KVQA 1Z3GH 2H1PL 2ATKA 3IFOA 4Y1AB 5D7JB 4UQ3A 4LSQH 1ZHLB 1DEDA 5L2KA 2CKBA 4F7PA 1J0KA 1J8HD 1R5WB 1WIOA 4NWTL 4RFOH 1SBSL 2ZJSH 1T21B 3KNBB 5HDOA 5IW3A 4QWWC 3SPVA 3ZE1E 4BH8A 2HAZA 2Y06L 4Y19D 4DOHE 3GM0A 2UWEB 3UBXI 4P2OD 2YN3A 4Z76A 1TZIB 1QSEA 2EYTB 4LASL 5EC2A 1F90H 4LPUA 5LQBH 4EN3D 3QFJB 1HN1A 4UNTA 2DYPD 1OTSD 3U9PL 3HI5H 3BP7B 3T3ME 5J9PB 4JVPA 5E6YA 2AGJL 3ZHDA 3CPLB 3UYRH 1NEZG 1FN4A 2NXYD 1ZK9A 4N1CA 2NTFA 1D9KD 3IAPA 2PYEB 3OGOE 2W0PA 1C12A 1S9YB 3HNSL 3PP4L 5D2LB 3KPNA 2A2QT 1F4XH 3KPRE 3O2DL 5A43C 4I18C 4FTVE 5KVEH 5I1AB 3V6BR 4OLXL 4UV7L 3KJ6L 3U7WH 5D6CA 2Z91B 3TBTB 2ZUQB 3ILQD 3RI5F 2IBGA 3F65A 3WS3A 5DMGD 4M48L 1OARH 4LVHC 4QRRA 4PG2C 2QKIA 3RZCC 4ZMAT 5JW4Q 4KKAC 3U82B 1M7IB 3QCVL 3REVB 3OB0H 5IW1B 1ADQL 1EA9C 3QAZC 2CRYA 5D4QA 3MJ6A 1WGOA 4AIZB 2YK1H 5I8CA 2C3VA 2EDLA 4PYGA 4X4ME 2EE6A 4ELKA 5AAWA 3V2AR 4K23L 5I16B 3D39A 2J6EA 3CDGA 4XNMB 1CGYA 2JTDA 1ZKAA 1X5IA 2OJZL 2DWDA 1YMMB 3DRQA 3MLXH 1C12B 4QHNB 3UTTE 2Q3AA 4LKCA 5IBLD 4M4RA 4XAWL 5ABDE 1I9EA 4QHLB 5HHXL 4HMCA 3TVMC 4QTHB 1CDCA 1AJ7H 4M1DH 3KLDA 3FRPA 4GXUM 1RV6X 3O9WC 3PWNA 4PRHE 4HCRH 1IGIH 3HMXH 3GMOB 1Y6MR 1N26A 1NFIA 4G42B 1L0QA 4NQCE 3W5MA 3RWEA 1J1PL 4JG1H 1BJ8A 3MV01 3STZB 5BQ7B 1T5XB 4HXAH 4LSRL 4N0FA 4LLMB 2XN9A 3TPKA 2PW1A 1KPVA 2UZXB 3UDWC 3SO3C 2PR4H 3RVWD 3F58H 4FQPA 5IIEB 4HKJB 1VPOL 2DOCA 4NDMA 5HY9A 3SE4A 3FCTB 3CFCH 1Q94A 3WJJC 2DWDB 3KYMB 4MJ4A 3QIWA 3IFNL 3PHSA 5I1EH 4BZ2L 2BOCB 4NUGL 1N64L 5EN2B 3GUTA 5FCSH 4B5EA 2HJKA 2E27L 2AJXH 2X89D 5B39B 3KXFD 4PYHA 1L7IL 1TJHL 4NKMB 4UU9B 2X4NB 5I30L 2CXKA 4U1KA 5C7XH 2G60H 2P47B 3HE7C 3NCBB 5F9DC 5HDLA 5LGHL 4PJ8C 1DLFL 4H8WL 5ISZB 4I3SH 2NY0B 3FHAA 2YEZB 3MRQA 3MRMB 5DQJA 3QEUB 5E2UH 5KZCB 3HRPA 4CN1A 4FZ8H 4PJIB 3ARBB 4DEPB 1OTUC 1RUPL 4WO4B 2E6QA 3RGVD 4WEUD 4I9WE 4LCWD 1T1WB 2R0ZL 5IESL 4IMKA 3REWA 5FGCE 1YN7A 3S36L 4L8BB 5DK3A 1A4JA 2NY7H 1FFPB 1IAKA 4EOWH 4TTDD 4U6VL 5INCA 3V0WL 3GUTB 2HFGL 2Z8SA 2VZOA 5C0IA 3HE6B 1LEGB 1XGTA 2QV2A 3FT3B 4POYA 1KJ2H 3T3PF 4ODWA 1MRFL 4RIRA 3O6LH 4ZFZA 4LSPH 1GOGA 3QIWB 1U8KA 5T3XH 3MV8A 3S5LG 4NQCA 4WW1A 5BMFL 2MCG1 4QXTA 2YC1B 5E2WL 4MNGB 3HFML 3BKCH 5JPNB 5I2IA 2NLJA 5FECB 3M17B 3ECBB 3X11B 1FFOB 3B8YA 4YX2H 3IS1X 1EFXA 3O4LA 1XCTA 3TV3L 3FFCA 4HV8B 1KEGL 2O5YH 2OX5A 3KPLB 1YMHB 2IH1A 4WGWB 1MCLA 2O93L 4JY4A 3GHEH 3QEQB 1RK1B 4KY1H 3RTQD 3TC9A 2NY3D 4QXTB 3HE6D 5HHQA 5JXEA 1AY1L 1PAMA 5IB1A 3QBTB 3VXME 4WCYL 4PD4K 1MRDL 2A77L 4LSDA 1D3CA 1J1OL 1AKJD 4MNQD 3K4DA 4TVPE 3I2CL 3B3IB 2AJYH 3HI6L 4FNLH 3BKMH 3CZFA 3U9UA 4QRRE 5T33L 1IAKB 4JPIB 4LLUA 4ZS7H 5FOJA 3O3AB 4NZRH 4DVRH 3BIKA 1NJ9A 1V8HA 5FUOH 2NY0D 4GMSL 4PLKD 3QDAA 1KCLA 2HFEB 3WHE1 4RWYH 3BIAX 4PRBA 4G3YH 3BYTA 4PRAB 4N9OB 1KV3A 3L3JA 1JWUA 1VFMA 1KCSH 2NCMA 4BFIB 3OKLB 4I0KA 4XC1L 3WL9A 3Q1SH 5GIRB 5I1JL 4PY7A 3WKNA 3WV0A 1LO3H 4GAGL 1HXMA 2ICES 5GSVA 3EO9L 3B9DA 3QDGD 4X6BA 4DEPC 1NJ9B 3STLA 4L1DA 4ODHH 5C0BB 5SX5K 4IRZH 3FHQA 4IRJB 4FFWD 1R5VB 4D9LL 1MJ7L 4U7SA 2AV1B 4JM2D 5EBMB 4TYUA 2CUHA 2E27H 1WUNT 3ZE1F 4NNYA 4D94A 2Q76A 5DJZB 2IF7A 1I8MB 2ARJQ 2Y1VA 3S4SB 1QSEE 4RGNB 4B7IA 1PZ5B 4Z5RB 2H2PC 1RHHA 4Y19B 3RY4A 4HQQH 1GC1H 1VKXA 3Q6GL 1VFBA 3CLEH 1I3UA 2E3VA 4E41D 5ACZB 5KS9A 4P4KB 3RFZC 1I7ZB 2HFFA 3MMEB 4X99B 3FMGH 3ARDB 3DGGB 3DWTA 5ALBL 4MD5A 3MSPA 3BX7C 3BP7A 3QWOA 2OZ4A 3MLTB 3CK0L 3GO1H 2DQFA 3CX5J 5B8CC 3VJ6A 5DJYA 4M7ZB 3O6FB 4XMKL 3STLB 3AUVA 4UV4H 3VFVB 1PX3A 4P9ML 5IFHL 3GGWB 2WAHA 3MRBB 2P5WE 2IANE 2OL3A 4Y4HA 5K9KA 3CFBB 3PP3H 4HXBH 3OKLA 1FH5L 4NPYB 2HRPH 3KS0J 5IVXF 4QHMA 2QLVB 1QFWL 2ITCB 1W72A 3VXRE 3J8F7 2AKRA 2OQJA 3UZQA 1AXIB 1EHXA 3GI8H 4ZUTB 3UJTH 2VITB 3KPMA 2LV4A 4LRIA 1H0DB 3QIUB 2DB8A 5DS8B 3GSVA 4EI6B 1S9KC 1NCCH 5IFJB 4YUEH 3QJFA 4K2UL 4Y2DD 2FX8H 3W0WD 2MHAA 4HLZG 1KB9J 4WW2A 4TTGA 1NGXA 1W2KT 5DI8A 1KF9B 2A9NH 3V5DA 1DSFL 1KELH 3D69B 4NJAL 4M9OA 1TCRA 5EPMB 1IAII 3U4AA 1N5YL 4OF5A 4PREA 4NQUA 3S5LA 3WFEH 4M5ZH 2HTKC 4KY1L 4M6NL 4IRJD 2ESVD 5J6GA 4YC2C 3LRSA 3H42H 3FQUA 2VXSL 4OCSH 1JZ8A 3MJ7A 2IPTH 3L3KA 1N64H 3MNWA 2R56L 4X6CB 4HEME 4X9FA 1W0WB 2Y5EA 5MERB 3DETC 4APQC 5HYSA 2KQNA 4KVNH 1Q0YL 2QQNH 2J8OA 4TRPL 1U8MB 5FECA 2M8XA 4M1GH 1CLOL 5IUSA 2AJVH 4JHAL 3PIQB 1E4XH 2EDFA 2W65A 4PJFB 5ERWA 3AU1A 1UQSA 4OF8A 4JG0H 4HWNA 4FXKB 2DQTH 4HGWA 2MMXA 3GNML 4OV6F 1B6DA 3ZT7A 4KRNA 1F11B 3O8XC 4YBLB 3CUPA 1PEWA 4ZUVB 3B6SB 4RFEB 1BVKB 1U95B 4JFXA 3C6LC 2IG2H 2F74A 1VSCA 4XVTL 3VWKD 3TNMA 1S7SA 4K3DL 4XCNB 2VB5A 3DIFB 1MHEA 5H94B 4P0DA 4HUWA 5CBEA 1GPOL 3KLHC 5AUMB 3LD8B 4PJGA 2V5SA 4FQCL 2WWKO 4IRSD 3LN4A 4P23C 5D6DA 3V0AC 4KJWD 4JY6A 1JGEA 2PO6C 4NT6B 3VXRA 1UWXK 4BQ8A 4QNPE 5H35A 2HTLD 4XC3L 5CEYA 1DN0A 2X5PA 4Q9QH 1HSBA 3QZWB 2UV3A 4ODTH 2HT3D 4PV8B 4WNQB 4PLKC 1VFUA 1IAIH 4LSSH 4AENA 1C08B 2EKJA 3NCYS 4NO5B 2Q8AL 1T22B 1KELL 4UINL 3FB5B 4LVHB 4GSDH 5KTEL 4G7YH 4LCCC 5BRZD 1N6VA 3REVA 2NY4D 43CAA 5E08L 2ESVB 5C70A 4FQJL 4MJID 2NW2A 1DR9A 3LN5A 1AGDA 1P1ZA 4PJBF 3TZVD 1X6NA 2ERJB 4PGZA 1MHHA 5EO1B 1A6AB 3RVXC 1FVDA 1WEJL 4H5SB 1YPZB 2DQUH 3Q6FB 2HVKA 4PJGB 4TUJB 1EEYA 2AVGA 5TDPB 3T2OA 3DO7B 3RTQC 3N0PB 2YD7A 1FZKA 5E00B 3B9KA 4HC1L 1XCTB 2L7UA 4MX7A 4X99A 4M1CD 2LU7A 1KT2A 2XOTA 4JPWL 5TE6L 4XBGB 3U46B 5C0RL 2CRZA 3ZYJA 1CFBA 4XPFH 2R0KH 4JZNB 4IOFD 1ETZB 1KTRL 3N85L 3WUWB 5EIIA 5ESVA 5HGDB 1CXKA 1MREH 5K9JL 2Y06H 5GGRA 2XWBA 3NFSH 2OSLB 3MGTA 3OAUH 5IVNA 1F90L 2OYPA 3PWVA 5JTWA 5DK2A 5LQBL 2E6PA 2GW5A 2Z9TA 1FYTB 1MCPL 2FATH 2X44D 2DRUA 1LO3L 5HBBA 3VGAC 3VI4F 3V7AG 1U3HA 4J6RL 1RFDH 1S78C 1WZ1H 3O2WL 4KJYA 1OCWH 1T0NA 5BS0E 1JTTA 1QSFA 1BREA 4U3XA 3WMSA 5JXAL 5I16A 1LO0H 3DO7A 3EZJB 1XAUA 3IJSB 1G6RH 4ZUSA 1OTUD 3VXQA 2NZ9D 1KTKE 3S35X 5GJSL 3T2PA 4XVSL 4FFWC 3MRHB 5IESH 1NGQL 1P1ZB 1QG3A 1Q38A 1UWXH 4JDZA 4WU7B 4OZIE 1FVEA 2BXYA 5C6PB 3BKML 2R4SL 3QEQD 2GSGA 5E95B 5AYUL 2BVOB 1ES0B 1QNZL 2QADC 3F6LA 1OW0C 4WI6A 3PQYA 4AEIL 2BXZA 1OSPH 3MRIA 1BD2A 2C3XA 2R29H 1IGTB 4G6AD 4BQBA 2YRPA 3FB8A 5BZWA 3SDDD 1IM9B 1AC0A 2I07B 1NAMH 2PYEA 4MNHA 4HWEH 3VFNA 2J1KA 1U92B 5IT2H 4KZEL 1KTDB 4IRSA 2W60A 3S37L 3IFNH 2DMCA 5HD8C 4OCLC 3LKNB 3BIBX 1HYSD 3FO2A 3HAEB 4OUUB 5D5MB 5IROA 2MQ3A 5HYQB 2CK2A 1TTGA 3BPOB 2BRQA 3GMRB 4QRPD 5BVPL 5J6HA 2G9HA 2R8SL 3UJJL 3NIGE 4YFLF 4D0DB 2JCCB 4X9IA 5IWLA 1BVKA 1UKTA 4P2RD 4CW1A 2NX5A 2BMKB 4F9LA 4FFZL 5E99H 3EJZC 4RQQA 4L9LC 2I27N 3SO3B 5KZCD 1MQKH 5HGAB 3G08A 5HHNA 4XCCL 3BH8A 4KK6D 5I8EA 3GNMH 1PSKH 1YEHH 4MNHB 3FB8B 5BZWB 3VG0L 4Y5XA 5EO9A 2VLLA 4L8CB 3ULUL 4F37F 5IB3B 1I3RB 1CCZA 4UILH 4XNMA 1DP0A 1JJUA 3V8CA 3PDOA 1UCTA 1JHTB 1T5WA 3BHBB 5K9OA 4YR6A 2YPKB 1T7ZA 4DW2H 4XPHL 1NFKA 3EDJA 5DURD 3ROOB 4WU7A 1EEQA 3H9SA 2YUWA 1RURL 3ZSSA 3ISWA 4TSBH 5E94A 1J7VR 3U36B 4MDIB 1FQ9C 3WL9B 4EKXA 5D2LF 4YR6B 3PJSB 4ZOAA 1WK0A 2DI9A 3GMLB 3CXHK 4F9PA 2AJZB 5DFVD 1JYVA 4G9FD 1DBJL 2VR5A 5DLMH 4OF7A 3SDCC 1SY6A 1FSKB 3HE7D 3NIFE 5CJOH 1I8KA 8CGTA 3MLUL 1TITA 1JYNA 1ZT7A 4J4PD 1Y6NR 3ROLB 1P7QD 4C56E 2HWZL 1A22B 1XF3B 2GIYA 1EGJA 4QCIB 4RISH 3LV3B 3N9GL 4GRLD 3SKUD 2NYYD 1MRCL 4GUPA 2FLRT 4PJCA 1UXWA 4H20H 4AL8L 4ZNCD 3C08H 4I2XA 4X8XA 3MNVB 2MKLC 1T03H 2ZUWA 2VDQL 3KXFB 4U31A 3RBSA 5IHZB 3UX9B 3HMXL 2E5EA 1EBAA 1U3ZA 4YHYC 5EC1B 1DBML 1RUKH 2D03L 4G6MH 1BD2D 3MJ9L 2HJLA 3VFSA 4HGWB 2FIKA 2FX9L 5CD5D 4KI5F 4KI5C 2M26A 3VU2A 4S1DC 4MYWB 1WWBX 3QCTL 4U05A 5CHNB 4OLYL 3ABZA 3T0VA 3NTCL 3RUGE 4CMMA 5HYFA 3TIEA 3SDAB 1KN4H 1I1FA 1Z5LA 1JTOA 5DJZA 5MEND 1AGBA 2VWEE 2K3TA 1I9JL 4OLVH 1NUGA 3V9FA 3WYRA 4GXVH 2VUYA 4OAWB 2HT4D 3BMVA 3K7UA 2CJUL 2GSGB 3VXNB 2RIKA 4HZLA 2YPLB 3GIZL 1FC1A 4TULL 3KPQA 1F97A 5CLTA 1WIUA 5TE4H 3TA3A 3VXUE 4NT6A 5KVGH 4WO4A 4H26A 4FQCH 3IU3A 5E8EA 3CH1B 1UZ8B 5E2TL 1NAMB 2HA1A 4F33A 3NN8A 3OKKA 1RMFH 1JV5B 4R4BA 1I3GL 2BK8A 2VLJA 5JORA 1FLTX 4GH7B 1BJ1J 1YMMD 3QUMH 4H0HB 4X80L 4FQLH 2CK0H 3MV11 4XH2A 1SYVB 3DHMA 5HHOE 1QLEH 3OXSB 3SDDC 3AREA 1U8QB 3QB7C 3BH8B 4ORGA 1BOYA 3GO1L 4CMHC 3EJYC 1UA6L 3EHBC 5EU6B 2D7MA 1A47A 4UT6L 3WXWH 5AZEL 2CIKB 2WNGA 3W9EB 3CFIC 4OLUL 5IFHH 4P9MH 2NX5B 2D0GA 2OS7A 2JCCA 1E4JA 5EBWB 3W0WE 3PL6C 3P9LA 2DYPA 2OI9C 1HILB 3AU1B 1D5BB 5FOBB 3U46A 3MR9B 1IC1A 3BD3A 4NDMB 5HY9B 3RL1B 2A38A 3OZ9L 5GZNC 2XA8H 3QUKB 1YN6B 3CDCA 3HZMB 4U6YB 1AGCA 1U2CA 2I5YL 3O81A 4D9QD 3S7GA 4LFHD 4OIIH 4WY7H 2FYYB 5L2KE 4ZAKC 1BQHA 2ZWLT 4JFFA 4YH6A 3E8UL 4KV5F 5I66B 3QI9B 1JFQL 1UH3A 1QBMH 3WN5C 4OZIF 3SDXB 1CG9B 3VFWA 4H88H 1TJIL 1DSFH 4IOIA 1K8IA 1RVFH 1LO5B 4Q9CA 5GZOC 5C0IB 1RIHL 4AJ0A 2AV1A 3RNKB 3P30H 3IRZA 4L8SA 4OZIB 3QRGL 3IDXL 5D70H 4UTBL 5GXBB 1KLFA 2CLZB 4U3CA 2W59A 3L1OH 3MUZ1 2NY7L 3OGCA 3V6FA 3IDMB 3O3DA 5IVZA 3BH9B 2ZUQC 5JIHA 5E8DH 4JZOA 3S36X 2APBA 4WO4C 3HS0A 2C1OA 3RY6A 2XKNA 3OF6A 5DUML 1CDYA 3RZCB 3X14B 3BXNA 4AY0A 5FUOL 1GZQB 2Y25A 4D3CL 1GGTA 3RIAF 1IFHL 2XNAB 1IBGL 1ZMYA 5T5FH 3NIGF 3DRTA 4JRXD 1J1XL 4QGYA 3ZL4H 4HF5H 2R1XA 1KCVL 1BOGB 2YD8A 4JFZH 3ARFB 1GVIA 1UXSB 2KUTA 4DOHB 3P4LA 3FQNB 2ZOLB 3K2UL 5JMRA 2ZKHL 3BUTA 4PJ5E 4PRIE 3F12B 4PB9L 1BHGA 4MQSB 4UIKL 1JHLL 2ZG1A 2OZ4H 2HFFB 5D8JL 4WHYH 3DX8B 3MRNB 4PJAF 3RL1A 1T89C 2YXMA 3WEXB 3NAAH 5ID1B 4P2OA 5DC4B 4DVBB 3MRPB 4HMDA 5FCUH 1RZKC 3R8BB 1BIHA 3CFEA 4MHHG 1A1MB 4HH8A 4U1SB 4KJWC 1K2DA 1GIGH 2FYYA 2GJJA 4YHPA 2B5IC 1DBKL 3MLZL 1ZT1A 4TNWF 1HH6A 3ULSA 3HNVL 1OP9A 1EFXB 4DGYL 4PP2B 1BZ9A 3SKJH 1W72H 3IXTA 3ZTJG 3RRQA 4X83A 1J0IA 4NZTL 5E2WH 3QFJA 3MUGB 4X0KA 1BAFH 3W82A 4O2CA 3QG7H 4PJDE 4RGOH 4CVZB 3AAZB 5BJTB 4NUJA 3G5YB 4LSRH 4AEHL 1A7PL 3OHXA 3OQ3B 3ARPA 4KJPD 5E1HB 4Z7WA 1E6JH 4PJEF 4P48A 4JQVA 5E9DD 1NANH 5F96H 3VGDA 1I1YA 4OFVA 1KIUA 3S36H 3IU3B 3IKCA 4YBHA 1G1YA 5HJ3A 5HYEA 3STBA 4BELD 1DEEB 1A21A 3SDYH 4GQ9L 3IKKA 4FQ2L 4JDVB 4JREB 2PTTA 1RIVH 2UZIH 2N7BA 1CFQB 3EIFA 5TPWH 5B3JF 3PQYB 1LD9A 2Q6WB 3RPKA 2OL3H 3PJSA 3L7FB 1U58A 1MRDH 3N50A 5C9JA 4Y4KB 3OB0K 1VADA 4XP9L 4OIBA 5EU5B 1ULVA 4IIQA 2V5TA 5IJKA 3OPZH 3MRCA 3G5YA 4DKEL 3GJFA 5SV3A 3E8UH 5I1DA 4M02A 4XZUB 2YZ1A 3LVEA 1VCAA 1M7XA 2IQ9H 1LE5B 1OLLA 1S7RA 3QCTH 1QP1A 1S5IH 3WS3B 4BFEA 3MQIA 1EUUA 3WN5A 2AXHA 5HYJA 5KANI 4U1LB 4PP2A 4UUJB 5GISH 1ZHBB 4F7TA 2CGRH 3V95A 4WHCA 2O5ZL 2KZ1B 2JJWA 2NLJB 4XNQA 1OQOA 1A7QL 4MNGA 1A64A 2C7UA 3WD5H 3BZ4B 2EXYC 3QXAB 2XPGB 2IMMA 1FNSL 2QR0B 3WCYA 1QKZL 1JE6A 4P46C 1FZOB 5F7EL 1EO5A 5EUKB 4S2SA 5TFSL 3GKZA 5IROC 3QUYD 2DN7A 3RA7H 1DFBH 1OAKL 4FP8H 3E2HC 5EC2B 5FA4A 5IOPA 3C6SB 3FQXB 4RZCA 4PTTB 1LGVA 4UTAL 3SDDA 3P4OB 1NFIB 4G42A 3PWUA 4AM0A 1DBJH 5DLML 3SPVB 3G6JF 5EORL 3EYSH 5MEQB 4R4BB 1FPTH 1ZA3A 2VLKB 4U1IB 2MHAB 4TNVF 5BV7B 2YEZA 5EOTB 3PHQB 3S8WA 4TULH 4OCSL 4NFDA 3TA3C 3VFOA 4K23H 2FEDC 2VDPH 2E7HA 3OPZL 1IAOA 5C0CD 4GKSA 3BHBA 5K9OB 3GMMB 2BDNL 2ATPB 4ZOCA 4BK4A 2CDEB 4Y4FD 4M7LT 2DM3A 4NBZB 4YUEL 1KPUA 5DSCB 1S7XB 4B41A 1EH9A 1Q9KB 4NO0B 5FF6B 4KROC 4P3DB 5F3HB 3UJTL 3GKWL 1AH1A 1OWRM 2MNUA 3NABH 1NGZB 1FSKC 5C0GA 1EXUA 3ULUH 1FGNL 1T0NB 1YYML 3HNSH 4IRJC 5EO9B 4HS6B 3HPLA 2FJHA 2ZCKL 4XCNA 1MAJA 2FDBP 4GG8B 4JHWH 3MRKB 3SO5A 4CVXA 3MV8B 3OAYK 2P5EB 4X6CF 2B4CC 3FO2B 3HAEA 4ZFZB 1LMKA 4XWGL 3VXSB 1AD9A 3R06A 1QFHA 1JPFB 3QH3A 4P57A 3BZFB 4YO0B 4OJFH 4OM0L 4DK3A 4YXKL 2QQLH 3P9MA 1SBSH 3SKMA 3SBWA 1Q1JL 1LVEA 3D39D 3DX9B 3HUJE 4IRJA 4M8QB 5E4EC 5C0CE 1NLBH 4GG8A 1IKFH 4QHNA 1OAYH 1PG7L 1EJ6A 5GSRA 5JO5A 2P48B 4PJGF 4V1DA 4V2BA 4HQQL 4OUUA 5D5MA 1K6QH 2IC2A 1V5JA 3PV6A 2BNUB 3RI5K 5C0GB 1A4KA 4HK3N 3OL2A 3BP4A 4ODXB 3VRIB 3WFDH 4F9PC 2J5LB 3K2UH 4PRBB 4LGPB 3QNXB 4LF3B 4U1JB 3B2UC 4X9HA 1JNHA 1AGDB 5F3BB 1J12A 3O3BA 5FB8A 2DWEB 4CBPA 2ZUSA 2GSIA 1NGXB 2QSQA 1NFDF 5CD3A 4OAWA 3TEUA 4ONHB 5D7IA 3Q5TA 2APVA 3H9SE 2BSTA 1TVHB 1MFAH 1H0DA 3QIUA 5T1DL 3KLAA 4P23A 5D6DC 1BX2B 5CGYC 3RVVC 4FQ1H 4HDIA 5IMMA 2F8VA 2BNQB 5JQHC 4FQQB 3QDGA 4LHUG 3D18B 4Q58C 3WNPA 1SJXA 4P5KB 1HXYB 2E9WA 1T83A 5EZJB 4X8JB 3FZUD 4YPJA 4XRCB 1CXFA 5DQDL 4YPGB 1S7VB 3BKCL 4U33A 3PWUB 4AM0B 1MREL 2NY1D 2R69L 4PJBB 1U91A 4KMLB 4JFHE 5GSRB 5K59E 2Y7QA 2DQGL 4DQOH 1TJIH 3EOYG 4NM8H 5KSUB 5I8KL 4UMGA 3NFSL 4G8FB 1I75A 3FJTA 3BSZH 5EBGA 2JKXA 5IT2L 3T0EE 3EGSB 3QXVA 4XRCA 3CFJB 5EIIB 4AIOA 5EH1A 3EOAB 1I8IA 5IHBA 2H2SC 1GGIL 4HIEB 3FONB 5DRZB 4RDQF 4JPVH 1T20A 4NN7B 3RGVA 1AXTH 4ONGH 1C5DB 1IQWL 3KYKH 4U1MA 3DLQR 1DQDH 2ATKB 3IFOB 4BSJA 2EXWD 1ODAA 1QNZH 3C9NB 1A6VH 5CCKH 5KN5A 3QNZA 2G2RB 1TDQA 4BH7B 5CMAA 5CILH 1OPGL 4KHTH 4LBEB 3U36A 4QGTA 1KIRA 3QO1B 4TSAL 4WNQA 3G04A 4QXUH 1PX4A 4U6VH 1WFUA 1C16B 5L88L 4N0UB 2EIZA 3E3QE 2G5RA 1TCRB 2CDGA 2IALB 4NP4L 5F9AC 3MPCA 4RAUA 1HCFX 4U3HA 4N8CL 2YSSA 5JHDE 5T3ZE 4OLWH 1CFQA 2DJSA 4YBQD 1R5IB 1MAML 4PJIF 5GS0C 1OAQH 1IRAY 2EKSA 2Q86B 5GS0H 2GI7A 1SEQH 2R9HC 5HJ3B 1GCFA 1HINH 5ALCL 1G7HA 4JQVC 1W72B 3SKMB 2P44B 3KGRA 4RGND 4JHBA 1YEGH 2F5BL 2FSEB 5F7MC 5A2IH 1JCKA 4ZPTA 3F62A 3BGMA 2P5EA 4M3JA 5J3HC 1F3DJ 1T3FA 2VDKL 4D0BB 1CDIA 2Z93A 4H20L 4AL8H 1V7MH 4KKAD 4XPAL 3SKOB 2BVYA 1JUFA 1ZLUK 4LVNC 5JMOC 3T0AA 2CR6A 4RMVA 5HHXH 4NCC1 4NN6C 4JRYB 1ACZA 2WANA 1A2YB 3WD5L 1T89A 2D03H 2GJ6D 1YQVH 4JGUA 3MRPA 2EXWC 1FVDB 1I9RL 5CUSL 2Z93B 4XVUC 3SKNA 4M4PA 4OV5B 3HRZB 4LSTH 4G8GA 1MLBB 5BO1L 2G75B 3QI9C 5DVOA 1UKQA 2Q20A 4ZFOA 2WBJB 4HHAB 1ZOXA 3VWKA 3CH8A 1NUNB 1YECH 5F9JB 3IRPX 3L95B 4LCCA 5EBMA 1WV7T 4GKSB 1MH5A 3MJ7B 3VGEA 1PKQB 1T1ZB 3MV7E 4XC3H 4LLVB 5F7FA 4DKEH 4DKFH 3O0RL 2CKBH 4JAMB 3VW3H 1IZJA 5JA9A 1BQHG 3RHWF 3D3VE 1NGYB 1EVTC 4RNRA 4KTEH 4GRWB 2YD5A 4ZG1A 3VXRD 2XT1B 2WBJD 5IMLA 2HKHH 4NPYA 2YN5A 3W9DA 2OTPA 4DZ8A 1XR8A 5L2KD 4WHTA 2EEDA 4X7TB 3PNWB 2YHGA 4PTUA 1KULA 3A6CL 4IDLA 4LL9A 1QBLL 4EXKA 5BJTA 4PJGE 4GXUN 3IU4H 4JFEE 2QADB 1A14H 2W92A 1J05A 3GBNH 4UQ2B 1LP9A 1P7KA 3LPFA 4GLRI 4XP4H 1DANU 1F6AA 5DT1H 1ZWIB 3QJHB 5F9JA 4JPKH 4RGNC 4MD5B 1JHKH 5E6ZA 4AEHH 5E9DA 2F54A 4EUPB 1CDGA 4KAQL 2A6KB 4PGCA 4R0LC 4LCUA 5DUPL 4L9LB 3BZ4A 3HRZA 5DEFB 5ICYA 3U0TA 2MCPL 4WI7A 1MFEL 2WIIB 2ICEA 3KYAA 3HC4H 4QRUB 1HSAB 1SEBB 4HS6A 1T4KB 1AI1H 4FMKA 5DJDA 5BXFA 4WFGD 3W0WA 1TQBB 1ZHBA 5TDPA 2IEPA 3DX7A 3CFEB 1YPZA 3MRJA 4TPRH 1H8NA 2B2XL 5T1DH 2ZG3A 5TH2A 2UWEE 4HF5L 4MCZA 1JF1A 2Q7YB 5BZDA 1X5JA 3NA9L 2H8PB 4YHZL 5D72L 5DC0A 1XIWC 4PJDB 1G9NC 4RAVA 5ICXA 3P77A 4Z0XB 4TSCH 4IIQC 3W11C 5DQDH 3MRFB 3BKYH 5DHXB 1B2WL 2ICWI 4NRYB 4IMKC 5D7LE 4DGIH 2JJTA 4KC3B 3RX7A 4XBPA 2XICA 3RKDC 4RWYL 3FAXA 5T1LD 3UYPA 1F2QA 4MB5A 3S98A 1NC4A 5J0BA 1KJMA 3WNKA 3DARA 3UC0L 2JF1A 1P9MA 3BE1H 3TIDA 2A9ML 4W4OC 2J6EL 3GDBA 4F33B 3HE7A 2GSIB 4P49A 4F3FB 3MC0A 2FO1A 5BOZG 15C8H 2ARJB 3DIFA 5F88A 1X5KA 1JNHB 5ACMA 4ZSOB 4UU9A 1IILE 1RK1A 5HHVH 1TETH 3I50L 2EC8A 3QNYB 3BUYA 4WV1B 5B8CA 5GS2H 5KSVA 3MOQA 1F11A 5ITBL 3B5GA 1U6AH 3WJJA 4ZFOB 3M17A 4PJHB 3WE6A 3I3DA 2FECL 4CMMB 1N2RA 1QBML 4GO6B 3FB6B 4YZFF 5KVFL 3EBAA 4DCQB 4YEFA 3FCTA 5GJTL 3TN0D 1L4IA 4M62L 1SVCP 5HXMA 3RBGA 3DV6A 1KFAL 2YS4A 4HGMA 3L3IA 4Y5YB 3OR6B 25C8H 3MFFA 3G6AB 3DROB 4D9LH 1MNUL 1BWWA 1HYRC 1UA6H 4H25B 3WSQL 4EDXB 3LRSB 3D2UA 4L5FL 1IGJA 4YHYB 1GH7A 4XPAH 3EOBB 3SDAD 5DD6B 4MQXC 5DVNA 1T7YA 3MRCB 3SHSA 2D7PA 1HKFA 4P5TD 5SWQB 5EPMA 1OHQA 2JIXD 4QXGH 1NL0L 3LEXA 4YGAB 3HMWH 2A74A 5DI8B 2XKNB 4O9HH 3OKMB 1LQSR 3ULUF 1I3GH 3LS5H 5KSAC 3VFNB 1ZHNB 1NMCB 1KIQB 4IBLT 1MJUH 1EEUA 5F7NC 3RY6C 4J12A 3GKWH 4YFDB 1I1RA 5F7DB 5FM4A 5FYKH 5SV4A 3QUML 4X80H 2VDMH 4OB5L 5SX4H 3WIIL 1QA9B 2H3NB 4WEMB 1RUAH 5D93B 3UROR 3MV7D 4J1UA 4LLUB 3SGDI 1RIHH 1DUYB 5EORH 5LBSL 3ZKNC 3WO4C 5EIQA 4OQTA 4HW6A 8FABB 3C2AL 4MDIA 4ZUWA 1S8DA 4R7NA 3CIQA 2J8UF 1P7QB 5F3BA 3S96A 4CVZA 5K33A 3VA2C 5DMYA 5BS0D 2PXYA 3PHQA 4PRHB 1CGUA 2VXUH 4F8QA 3MRJB 4HIJA 1U3HD 1AXSA 4I18A 4YGVB 1CR9L 2EO9A 3KWWA 1RZIA 4TUKH 1FPTL 4LVOB 4Y5XC 3BOVA 5I71C 5MENE 1UYWH 1E4XL 3D85A 1T4KA 3ZYZA 2IH3A 2X4TB 4LCWB 1CL7L 5F97E 2WINA 2R15A 3BO8B 2O5XL 3WEXA 3T0WA 2VDKH 2A6KA 3KJ4C 4JPKL 1U8JB 4FA8A 3VFUA 1JWSB 4YDJA 5FIEA 4K3HA 5IWLC 3CSGA 4L29A 1UM6H 4JRXE 4MS8D 3HE6A 4X4XB 1PGRB 3O6KH 1QKZH 1KENL 3D9AH 1BJMA 4JRXA 1EZVY 1FNSH 3PWPD 4N5UA 4AG4L 3ZTNL 4AQOA 4PJCB 5C0CB 1MF2L 4L3EE 2YA1A 3LEVL 4OFPA 4L3AA 1LO4H 2BVQB 4OZGE 5CLWA 1OLZA 1I85A 4OLWL 1PG7X 5IMLB 1W0YT 4MQTB 1BD2E 5DRXB 3F7VA 3MNZB 4M6MH 5F3HA 4H5SA 3WIIH 4IJ3B 5IVZB 1JP5A 3S96B 2IQ9L 1H15A 4LLVA 3E0GA 2X40A 4OF3A 1A9BA 1UG9A 1YNTA 1RZ8A 1OARL 2IPKB 5DEGB 5B39A 5CMAB 1JZ3A 3CZFB 1C7TA 4WU5A 1A7PH 1NBZA 5D1XB 2XKUA 1MWAA 4P5TC 1ZA6A 5GGQL 3ZE2E 1IGYA 1K8IB 4M5YL 5T1KD 1BEYH 1JGLH 1CBVL 5CS7A 1DQQB 1U93A 3MBEB 2UWEF 3H0TA 2PF6A 4OD1H 4OCWL 4ZDHA 4KQ3H 5I15L 3HAEH 4MXWH 4DGYH 4PGEA 1WBYB 1MUJB 3O2DH 4PPTA 3AS1A 3RAJL 4K71B 1WQVT 1FO0L 2AQ3A 3ARGB 3OTTA 3KPNB 2MTPA 3LSOB 4HXAL 4KQ4H 3CU7A 1YEHL 3IDYC 2Q7NA 1KOAA 1U6AL 3Q48A 5EBWA 1OTTC 1NCWH 2PN5A 4HUKB 4O2EB 2BVPB 2VUOA 4RIRB 3ZYIA 2DJUA 4GRWH 5FKPA 3I6LD 1BF8A 3PWPE 1B4JL 4M7LL 4N0YL 5SWZB 3MBXH 4XT1C 1CQKA 2EH8L 1FJ1A 2DQGH 1AO7A 1KC5L 1EMTH 4O58H 4R8WH 4HX1A 3TESA 3BN9D 1VENA 1JYWA 3MLVH 4BSVB 3FQTA 4NN6B 3UBXB 2X4UA 2XXMB 3C5JA 3NCEB 4XNUL 2XTJD 1TVHA 1RAMA 4DGVH 4GRWF 5HVFB 4YDKL 2BX5A 2H26A 2ZJSL 5DWUL 3ZKMC 2V5RA 2D4DA 1JNNL 1NGPH 1QBBA 2H41A 4NRZA 4ZDHB 2O61B 5D7LA 4FG6D 5DK0B 1ZVSA 4RNRB 3MBEA 4X6EB 1EGJH 3NACH 1IC5H 3AS0A 4ZPVB 43CAB 4R4FL 2CQVA 2KPNA 1GZQA 2BFVH 4JANB 4MSWA 5FO7A 4MDJA 5HSFA 1J10A 3PXJA 1PKQA 1V3KA 1WTGT 1U58B 4PP1C 4G7YL 3I6GA 2J8UB 5IM7A 3ESVF 4FZEL 5JW5A 1P53A 2VDOH 3UC0H 2GJ6A 4KI1A 1IEBB 5KSAD 4F7EA 1RZKH 4JY6B 2UYLB 5DZNA 1UJ3B 5C9KA 5DK2B 2NPLX 1NCAH 3UAJC 4ODUA 3FONA 4YXKH 4NWUH 4GW5A 3V52L 2ARWA 2C4FT 3CXDL 4A6YL 4X9GA 1JF6A 1LO4L 3OZ9H 3S9DB 1K85A 1E4KA 5IFAH 1R0AL 3CDFA 3U2SB 3RWHB 1IKFL 3I3BA 5D72H 3C6LA 4K3JL 5E9DE 3FT4B 3TNMB 4XPFL 1D6VH 4M62H 5F70A 1JPST 2CDFB 4F8TA 5DJCB 3ARQA 4OM0H 4OJFL 4AQ1B 3WFCH 3PGCB 5EZLB 4OD2A 4XVTH 5GGUA 3S34L 3VDAA 4WWKB 3E2HB 5K9JH 3GHEL 4D8PB 3NZHH 4X9BA 3MFFB 4POZC 5DEZA 3WUWA 2KH2B 4PLNC 4JGJA 1Z0NA 2KQMA 4XMLH 5D9SB 1DQJA 2V9TA 5KJRH 4MXQD 4OD3H 1AIFA 5TDNB 5KOMC 1EO8L 4FQXC 4F7MB 3U0TB 5JOEA 4KQ3L 1IEBA 1BX2A 4G6FD 3MRNA 1KT2B 4FRWA 1D6EA 5FYJH 5BRZE 3UTPE 1I8MA 1OAZH 4UDUB 1E6OH 1Z9SA 5IV2A 1CE1H 2JJSA 4NNYB 4D2NA 1AHWA 3IYLW 3I6GB 4KKBD 3U30B 3JWNC 3AM8A 1OY3B 2FZ3A 4PJ7A 2CD0A 2AEIT 3NACL 1A9BB 2XTLA 3V0WH 4R97C 1EHAA 1G9NH 5CEZL 3OKDB 4JO1L 3N1MC 5DA0B 4DFHA 1GGBH 5JHDD 1QLEL 2CSPA 3G5VA 3TO4C 4IIQB 4WW2C 4U6XB 1NH6A 5MHSE 1UB5A 1RJYA 3K3QA 2EE9A 2HKFH 2VLKA 4U1IA 2AAVA 5GGVL 4MVBD 4X7FC 4Y2DA 3NTCH 3QI9D 3SDDB 4KJQD 1DN0B 2VLKE 1A7OL 2EDOA 5J12C 3IKCB 3QDJD 1KB9K 5D1QB 2ITCA 2RAMA 1FJ1B 4NRYA 4M43L 1TPXC 1CGSH 3P2TA 4FS0A 1FLRL 1RD6A 4CDHA 3FRUB 2AP2A 4L29B 2XWTA 5F21B 5IGXL 1UZ6F 1LK3H 1WBXB 2Z8VC 3ES6A 1YNKL 1WCBA 1T66D 3AY4A 4NQEA 3P11L 1NCNA 1KSRA 4ZOBA 1IGCL 4RGOL 4Z76B 4TUOA 2F5BH 4BH8B 1GOFA 1I1AC 3OKEA 2VSDA 3MJ9H 5HYJB 1HHIA 4HUVB 2X1WL 3C8DA 2NY6B 5F6IC 1N5AA 2YA0A 3ZT6A 2VLME 3FMGL 1JBJA 5DJ2B 1CBVH 2B1AL 3KPRB 5LGKA 3T04D 4TRPH 1V7ML 4MJ6A 5CEZE 4OZHE 4N0CD 4ZS6D 3O6FD 1LEKB 1TNMA 5KVFH 4BQ6A 4K7PL 3LKRA 2XWTB 3D69A 4KK6C 4X4YB 1CDJA 3F12A 5D96C 4I3RH 4PJ5D 4DKAA 3FRUA 3MOBH 2NW3A 1G7JB 1A7NL 1XH3B 2F53B 2FL5B 5DYOA 3NFPA 1SMOA 4JANA 4JQXA 1RK0B 2A6JA 4Y5VA 1OP5K 1SYVA 3VFRA 3QAZB 3O3BB 3RUGF 4PUBH 3VXUD 3WLWC 4X7TA 2E9BA 4PJFF 4HBQA 5KSAB 2FCBA 2F9BT 3ARBA 2QJDA 1ZHNA 2R2BB 1DUZA 1UWGH 4PJ9B 1HYSC 4ZUSB 5DD3H 2FX8L 1GPOH 3OKMA 1G9MH 1V3MA 3S3JA 4GG6E 3MCKA 1ED3A 4OLZL 1J9CT 4H8WC 3UTTB 5I18H 5KW9L 5TF0A 3F5WB 5J4MA 3ARFC 3K8KA 2I60H 4UB0L 1BZ7A 4O2CB 2JB5H 5EOCJ 1WITA 4PJIE 4Z9KB 1WC7A 3VXMA 2VXTH 2H2SD 4DJMA 3U6RB 4K3EL 1CXLA 1U95A 4N68A 1RHFA 2HT2C 3FFDA 5CJ5A 2ZOKB 5ISZE 4DUVA 3MRBA 4Y4HB 5FKPB 1S9VB 1AGBB 4UDUA 3U48A 3GGWA 5JXEC 2VKWA 3O8XA 5LVEA 3X3FH 3SDXA 2IFFH 3S3SA 4OI8A 1KGCD 1F4HA 2R0WH 4U1GC 5C3TA 5DFVC 5ADOL 4ZFFA 1ZGLP 1I8IB 5GRVK 5L7XL 1BPVA 4RRPG 5C6TL 1M7DB 1MJJB 4LU5L 4CW1B 4PB9H 4APQA 3L3KB 4XPTL 3PGCA 5EZLA 3MUHL 4P3CH 4NGHL 1MHCA 2XN9B 1BOGA 5J6HB 5IW6B 5I1IL 2BSED 4ZYKA 3WFCL 3ZL4L 1UH4A 1A6TA 2A9NL 1RIUH 4X98B 4U7MA 2X9WA 1OAQL 5DJ8A 4O00A 5D7SH 2B4CH 3D0VA 5CGTA 1QSFD 1MSPA 3LKSA 4HS3B 1L7TH 4JREC 2HVJA 3QUZB 3P4NB 2X1PA 1CU4H 4IOFC 4O51B 3O3DB 4JFED 1NGWA 2H9GB 1II4E 2GJ6B 5I8OH 4X6BB 2DQIL 2V2WB 1RZFH 5FDWB 1FL3B 4LRIC 1CGWA 5GIRA 5CWSB 5T1KB 5E8DL 3S6CA 2V2TB 1NDMA 4AEIH 4F58H 1E0OB 5TF1H 4J6RH 1KTLA 2BNQD 5D1XD 2V6HA 1K8DB 2H6PA 4HK3J 1A6VL 1FVEB 5CCKL 2DLFL 3UCRA 1OGTA 3BIKB 3VI3E 3T2QA 1RZJH 3O6FA 4QRRB 3QWRA 4ZD3H 4PG9B 1D5MA 4Y8AA 2HYMA 1EJOL 2EDKA 1BZ9B 5L8JB 4DN4L 1UADC 4XCYB 5EOQH 3C60C 4GXVL 1ZLUH 3U4EB 4ZOEA 1YN6A 4PLOB 2I5YH 2RR3A 3C8KB 2HT3C 5L6YL 2XA8L 3LKQB 4Y19A 3CJJA 5DEFA 5ICYB 1MVUB 3D25B 5T3ZH 2ED7A 3IXAA 1J18A 4JRYA 1Q1JH 3UDWA 4HWZB 7FABH 3G6DL 3CD4A 4Y19E 2J4WH 5E5UB 4KUZL 1I7UB 2A6IB 5EC1A 4D9RD 3JWDC 1OQXA 3EFDH 3MLYL 4K7PX 2GEEA 3ARVA 1WIPA 3INUL 1BMGA 2NY1C 4CUCA 3LQAL 1GHFH 1MVFA 3BD4A 2GTWA 4LARH 3TWCH 4KAQH 2D9CA 3QIBD 3TYGL 4BFBD 3LZFL 3UTTA 4XPBH 4WTZA 2FRGP 2R2HB 1LO2L 4QCIA 1T21A 3KNBA 3UP1A 4TUJA 1RZFL 2R2BA 3CMGA 4M3KB 3TFKC 3MOAL 2NY5H 1X4YA 3SEPA 1BFTA 1Q72L 2QSCH 5DTFB 2OTUA 5ANME 3QEGL 1D5ZB 3K80A 1K4CB 1F00I 2F19H 2PO6B 4PJDF 3VA6A 1XEDA 4JPIA 4LKXB 2OJEB 4OTXH 4UAOC 1R3IH 3IT8D 4KK8D 1T2QH 4NC0B 4ALAL 2WP3O 3F7RA 1FCGA 1BF2A 1QRKA 3P40A 1R3JB 4YHZH 4HK0B 5DQJB 2N7AA 1F8TH 3VGFA 2GTZB 2XZAL 1YECL 1YEEL 5C1MB 2E7BA 3SQOL 4XBEL 3JV4A 2J88H 1JPSH 3QUYC 4P3WA 5E8PA 2IG2L 4GS7C 3MV7B 1B6UA 3B4NA 3MUGA 2IAMD 4YHNB 1KC5H 3O4OC 1M6OB 5F89A 2ZP0T 4P46D 1FNGB 3N06B 3ALPA 4J4PA 2MJWA 3QQ4B 1RUMH 4MD4B 4W68A 4YHPB 4L8CA 1UJ3C 3GJFK 4TVPL 1FAIH 5GHWL 2LVEA 4GG6B 2WIIA 2GITA 5E70A 4DCQA 1KLUB 1I1CA 1EVUA 2VH5L 1QACA 1Q9WA 4YWGH 4YQXL 2A0LC 5GS1B 2Y23A 4XCEA 2P7TA 4KDTA 2PKDA 5C0AA 3P11H 3TZVB 5B3JE 1PY9A 1TZHB 4M6NH 1XF5B 4XHJC 4FQLL 2R0ZH 3TJHC 2P24B 3BPNC 4P23D 3I3EA 3GMQB 1C1EL 1TZGH 1D9KB 4YHOL 4IHOB 2MPAH 3LRGA 3BKJH 1EX0A 1N8ZA 1MFDL 1ZANL 4GQPH 3N1FC 3UTOA 2HN7A 3VXTB 5CWSA 4ODSL 4P3DA 2YXFA 5AZ2L 4K94H 3U1SH 1VACB 3DTXB 3DSNA 1YEKL 1P6FA 4S0TD 3RNQB 3BEVA 3OSKA 3P4MA 3C6LD 4R4ND 2LU3A 2NXZD 3U30C 3WUWG 4Z7WE 1X44A 2R23A 1BIIB 1G7MB 2D4FA 2H2PD 3GMMA 5HPOA 3PF2A 4HK0A 1OPGH 1Y0LA 5TQ0H 1VA9A 3TA3D 2Q6WA 3EYOA 3H3KA 4KJPC 4WENB 1A7RH 4JO4L 4HHAA 5EZIH 3VWKB 4NQXB 2Q7YA 1X4XA 3QIBC 4JZJB 3TIEB 1ZVHA 2KL6A 5D2NA 4HBCL 1PEZA 3DSFL 5DRWB 4R6UA 35C8L 2VDML 4OB5H 1OD7A 2Z91A 3TBTA 3VRIA 2DBLH 1DBBH 3O3UN 3TT3H 5D9SA 4YHMH 1KENH 5I71B 5D7KE 1BLNA 1JYXA 3LMJL 5FYJL 1AP2A 1PW3A 4CGTA 1QRNA 1ZLWK 1X4ZA 3K4AA 1UM6L 3CVHH 2VL4A 3EKCA 3FQTB 1TENA 3GMQA 2BC4B 1T03L 1CFSA 4TNVK 4E41A 4JPVL 2W1NA 3UTQA 4K7FA 3UJJH 1FIGH 4JRXB 1NQBA 1QR1A 2BJML 3CX5K 2XI9A 2YKLH 5A2JH 3DROA 4LLYA 4B50A 5HGDA 2FGWH 3MMEA 1PG7W 1ZWIA 3QJHA 1U8PA 2N4IA 3ULUD 4XX1G 1LP9B 1P7KB 3I9GH 3MGAA 4XBGA 2YUZA 4L3EB 5T3ZL 3TVMA 5C09E 5C07D 5DJXA 1QPXA 5I1JH 2F58L 4LHUA 3IDUA 1FL6B 2RB8A 4Y2DB 4NHCH 5D7IB 3MXVL 1NCBH 4LDOB 2ADFL 1JNJA 4Z18A 4TVSa 2VXQL 1MHHB 5EO1A 1QO3B 4YHKL 4LSQL 5D2NB 1U93B 2DTML 4WJ5B 5BCAA 3F6IA 2OMBA 4IRZL 1PDKA 2V2XB 4O5LL 1RI8A 3MRDA 4IDJL 5AD0B 4X7CC 3VFTB 4OBSA 4XPGL 1JGUL 4ZUWB 3DVGA 1NC2D 3EDKA 1QEWB 3FB5A 5GJSH 4YIQA 1AC6A 1MPAH 2H32H 5KAQF 1JNNH 4OZHA 1FRGL 2FEEI 5DUMH 4RX4A 3KPRD 2P5WD 3T8XB 3TFKD 4Y0GA 3VI3F 1MELA 4G8EA 4KRPB 4X5XB 1XR9A 1PKOA 5HYJD 3SKNB 2NTFB 2BY3A 4DVRL 3HUJF 2RFXB 1C5BL 4HIEA 1N3NA 3OB8A 3MGTB 1HHIB 4JM2C 1YNLH 4XPBL 4S1SL 2LTQB 1HQRA 2ZZUT 4IOIB 4JQIL 1MY5A 4F2MA 4YXLL 4YXLH 4E42B 5L0QB 4E9LA 3AMKA 3GMRA 4HWBL 1F4WL 4NOFA 3CLFH 2HG5A 2Z92A 2BSRA 5EUOE 5I74B 2EDEA 4NWUL 4TPRL 1NBVH 1HQ4A 1A6WH 1OAUL 2IJ0C 2J7LA 3C5ZB 5E7BA 2R0KL 1G9MC 2D7TL 2DM2A 5JNYB 4NO3B 4YX2L 1J86A 5F93C 4BQCA 3C60A 1T7VA 1KN2L 1N7ML 3JBG7 5F1SA 3OWEA 4ODWB 4M5YH 5IKCA 5E08H 1SBBA 3GB7B 4Q0XL 4BZ1H 3QPXH 1CD8A 2DBLL 4J8RB 4F58L 1DL7L 2X4PA 1DVFD 5IMOB 3BE1L 5INCB 2R1XB 3ULVF 3GBNL 4XVSH 3KDMA 2V5YA 1SHMA 2J3SA 4LEXL 4ZNEA 1Q0XL 2P45B 3EJJX 3O6ML 5HHOA 1WAAF 4MJ5A 5F1NA 1ZA3B 4Y4FA 1FFNB 3NFNA 2A6DA 1IAIL 1S7UA 3GMNA 4LSSL 3QA3B 4B7LA 2ICWA 3PWLB 1A4KB 3LKPB 5I19L 2HLAA 2YUVA 2JE8A 3DBXA 4KGLA 1DCLA 3TJEL 4W6XB 4RZCB 3OKOB 3C87A 4QRQA 1GZPB 3QUXA 2Y4SA 4ZQKB 3ARRA 4KI5D 3NFPB 5BW7A 4Q9RH 4FQ2H 5FK9A 2AEPH 4R3SB 3EYFB 3G08B 3ILPA 3BKJL 3SGJA 5ADPH 1I1AD 4GW1A 1DZBA 2VQUA 1P84J 2NZIA 4P57B 1B0WA 2P7TB 5LAXA 3MA7B 5FM5O 4NSKB 1KYOK 4I3RL 4DKDC 4NUJB 2PCPA 1JRHI 4TQEH 4H1LB 5BV7L 1A3LL 1SY6H 4WI9A 3EW3B 2W38A 3SCMB 1MIML 3H9ZA 3ZLQC 2YPLD 4E5XA 2OI9B 5FKAA 1U91B 5D1ZC 2W07A 3MCLH 4LCWE 1EXUB 2DDQH 1LNUA 1W72L 3P0YL 3LS4L 5I15H 4N5EC 2YBRB 3LY6A 4HIJB 2VLRE 4PJEB 1GIGL 3MRGB 3TBYB 4TN9A 1F13A 1RPQA 2BVTA 2BNRB 4FTVB 1SM3H 5E7FA 2BRRH 1G7PB 2EH7L 2CGRL 5KTEH 2CK0L 1UKSA 4Y4KA 3DMMB 5IBUB 5EU3B 2HJFB 2BHYA 3GFUA 5JA8B 3TNNB 1QVOA 3ARFA 5K9QI 5I1GH 3B9EA 4WI4A 4MSWB 5FO7B 3PWPB 2LE9A 4XH2B 3DECA 3RNQA 3OJVC 4ODHL 2C26A 4P2YA 1AD0A 3S37X 4WUUE 4PRNB 1JGVL 4WVRA 3U7WL 5HDQL 3GI8L 3F7VB 2VLJB 3QA3A 3EDFA 3W5NA 5ITFA 2Q87A 3QEUA 3PDDA 4I0PD 4XWOC 3BP4B 3OMZA 3JWDL 1RIVL 3WDIA 4QWWD 5JUEH 3RDTD 1RUAL 1AO7E 5D7IE 3HB3C 3OKNB 4JQXC 3BDBA 4OI7A 1MHEB 3AMLA 5DD6A 1ADQH 1I8LA 4C4KO 2QKIB 2HT4C 2MFNA 3QUMB 3IVKB 3D6GA 3P4NA 1TIUA 4Y4KC 4PBVC 1JRHH 2Z35A 4AMKH 1WJ3A 1DVFA 3G6AA 1X5YA 1IE5A 1NDGB 4M7KH 3LZFH 1A6UH 3SGKA 4WWKC 4X6DB 4O2EA 5BZDB 1HHJA 4NQDA 1CE1L 1A7QH 2Y6SD 1F4AA 2A77H 4ODVL 2E7LA 3CK0H 4JJ5B 3QULA 4YAQA 2YUXA 4KVNL 3IDGA 4NO3A 5I1KL 2Y07H 1MEXH 3D48R 2D7QA 3S4SA 2K9UA 2XQBL 5IQ7H 3MLZH 3CFJA 2AJ3B 1RZIB 2DLHA 2X4QB 3IJHB 1KIPA 5JHLL 5DRNA 1WBYA 2BSRB 1GL4B 3SE3A 1D5XB 5L6YH 4LLMA 4G8IA 3UO1H 4N1EA 3IVKA 1Q9KA 4NO0A 1TETL 5FOBA 1U8IB 3ARED 5CKGA 5LG1A 2NX5E 1OP3K 5BQ7A 4WI3A 4PJBE 3KG5A 4GRLC 3T1FA 4ISVB 1KCUL 3C2SA 4NNXB 4YDVB 1EZVX 1UZ6E 1HDMB 4GAGH 2P43B 1YQ2A 4NC1E 4DK6A 3X14A 4X8JA 5BW7C 1EJOH 4G9FE 2R39A 3BPNB 2DM7A 4F7PB 2DQEH 1DBAL 1D9KC 1JK8A 4LLAA 1NAML 4MVBC 1U41A 3PNWA 4NIKB 3WIHL 3ZDZE 1RY7B 2FD6L 4YHLH 1G6RL 4OF6A 5JORB 2AABH 2A9MH 4OZFA 5F71A 5IG7A 1NL0H 1A1NB 4HPOH 2BVQA 3QQNA 3HMXA 4PJ9A 4NCC2 2DQHL 3HC3H 4GAFB 5IW1A 3QDJA 1ZVYA 4BSWB 2VZ3A 4NZRL 1MCSA 1H3UA 3RIFK 4H8WH 1G6RA 3AAZA 4NZTH 3AM8C 4RMTA 1G1CA 3LEYL 3DMMD 4LLDA 4PBXA 3BW9A 4H25A 2JJSC 1SYSA 1BQHB 4OZGF 4XCCH 4P3CL 1P4IL 4XP5L 5ILTL 1P7HL 1MQKL 2XXCB 1ZT1B 1MHPH 2DBJA 1M7DA 3HI1B 5J12B 2V9RA 3OR7B 5GJTH 2N1KA 5FKAB 4MXQC 1OB1A 2EYRB 2L4OA 3HNTL 4ELMF 1QLRB 1WICA 1UWEL 5F7LB 3M1BA 1MCPH 2FATL 4HULB 5DVKA 2XQYK 3FRPG 4I4WA 4HKZA 2VXVH 3O6LL 3B83A 5IVOA 1VHPA 1H3WM 3S37H 3LAFA 4WWKA 4LNRB 5DHYB 1F6AB 2VKXA 4L8DB 5KAQG 4KZEH 4N1HB 4DZBA 1DVFC 2W9EH 3RVXD 1QR1B 2CLVB 1YUHB 3MACH 1QSEB 1K9TA 4P2RE 3RWFB 3S5LB 2PYEE 3BGAA 3OKNA 3DXAA 1I8LC 3BXNB 3MCKB 4DTGL 5E4EB 2V2TA 1MRCH 2FD6H 3NIDF 4ODUB 5DJ0A 3JWOC 3E6HA 1QR4A 2SEBA 4LKCB 3PQYE 3TT3L 1AD0B 1QRND 1F58H 2HWZH 5FO9B 1CK0H 5HYJE 3QXTA 1ZHLA 3IDXH 5D70L 4JDVA 4L4TD 4OD1L 2EE3A 4OZIA 5FV2A 2R2EA 3I2CH 1I9IL 1Y18A 3T09A 2C3WA 2UUDK 5BVJB 1FFNA 5DJAB 4ZFOL 3IDIB 3EOTH 5HI4C 3HZVA 2OK0L 3MOBL 1IKNA 4Z7UA 2R23B 3MBEC 4FG6C 2IBBA 3UXFA 3MRDB 3BWAB 3SE9L 1RJZB 3VRLE 4TSBL 5F7HA 4IS6B 5I1EL 2OR9L 4XNZC 3ZHLA 3GSRA 5F6HJ 4P2QD 2FJGA 3QNXA 4LF3A 1OAYL 1PG7H 4EDXA 4PJ7B 2D7NA 1XF4A 3RIFF 3WNMA 5MHSD 3RVTD 2FECI 3BPLC 5I1AA 3FB7A 1AI1L 1BECA 5J1AB 43C9A 5CEXB 3U0WH 7CGTA 4R8WL 1VEPA 1A5FH 1PYWB 2YRZA 1EMTL 4JLRA 1VFBB 5D1ZA 3C5ZD 3VGBA 1A6UL 2DYPB 5F7WC 1TZHA 3IJYB 4PJHA 3Q3GB 2XWBB 1HQRB 2DTSA 1S9VA 3O6KL 4HS8H 4L4TE 4YDIH 5IGXH 5L0QC 5EU6A 3EYQC 3RAJH 3BUYB 2X4SA 4WV1A 5KSVB 2BNRE 4OCRH 1OM3L 5GRXG 1FFPA 3CDYA 1KNOA 2R1YB 4FXLA 4NJ9L 4X7DC 3IF1B 4BKLB 1KB5A 1AKJA 5E2VH 1J8HB 5CZKA 4I8DA 4IMLA 4LASH 4G6KL 1PFCA 1RMFL 1R5IA 3WFZA 1A9EA 5EZOH 3FO1A 3RX8A 3GMLA 2C3VB 1RJLB 4GBXD 4OGAD 1YA5A 1T6WA 2OBGA 2VDNL 3LH2H 5FHBH 5D2LE 2VL5A 4FQQA 1MCWM 3SGDH 2P8PA 4LP4A 2XZQL 3GSRB 3JV4B 5I1LB 2VQTA 2PW2A 2KZWA 1G7LA 4R7NB 3L3OB 1QFWH 4QYOA 5CIPH 4Y5VB 3V79C 1B9ZA 1UCBH 1EEZA 5D1XA 4OLVL 4XPHH 1KGCE 4EI5B 5HI5C 3S97C 1ZGLA 4XNXL 4MMZC 3LEVH 4MGXA 4NBYB 4R90H 5AAMA 2WBJA 5B38B 1YEKH 2PW2B 3TYFA 1NCCL 2XV6B 5TH2B 1ND0A 4MCYB 3UTTD 5EU4B 1T20B 1ZAGA 1AXTL 1SJVA 2LAAA 4CADA 3Q2CA 1MAKA 4LPWA 4L4VD 1HCVA 1YMHA 2IH1B 4KPHH 4NM4L 5KS9E 3BAEL 2OM5A 4JB9L 4MWFA 5C07B 3E6FA 1KN2H 4O9HL 2ZSWA 2YA2A 4BSVA 3VFPA 3VFMB 4EEEA 4D0DA 5KANG 4L4TA 2DQDL 1PSKL 3CSPA 3L3HB 1IGJB 4XGZA 3STZA 4OFYA 4XMKH 3WNNA 2VR4A 5INDA 3BZFA 2UZYB 3LN9A 4G80A 4YO0A 1X9QA 1WCQA 1E4WH 5I9QB 3D2UD 4U1SA 2ZCLL 3SE8H 1N3NB 3M1BB 3NPSC 1CF8L 4P5MB 2R56H 4UQ2A 4PS4L 2ENYA 3B5TA 5FK9B 2OP4H 4OM1H 5FUCC 4LVNB 1GZPA 3EUUA 3FB6A 2B5IB 5EOCL 1HI6A 4U6TA 2K1MA 3G5XA 2R4RH 4A6YH 1WZKA 1X6LA 4ONHA 4LQ1A 4UBDD 3EYOB 4XP9H 1KYOJ 3WNOA 2CR3A 5EO0A 3L3DB 1ES0A 4GAYA 4NZJA 5FGCB 1JPSL 3FOLB 4N0RA 1RZ7H 2B0SL 5CSZB 5DMIL 2F15A 3NVQA 1LWRA 1UEYA 4U1KB 1TVBA 4HAFA 2NY3B 3SDYL 1BFSA 1C8PA 5J1SC 1BQLH 4Z7VF 1L0XA 3WS6A 1FO0B 3O3EA 1XGQB 1R3JA 1RQ5A 8FABA 1A1NA 3IFLL 2FJFB 4LHJB 4X6FB 4ETYA 5IG7B 3OKYA 1ZSDB 5IKCB 4HAGA 3GSVB 2NQCA 3V5KB 4EI6A 5FDWA 3CC5A 1HSBB 3QZWA 4Z7QF 3QR2A 3V4PH 5IEHB 1FIEA 2PYFA 4GW4B 1CD0A 3QG7L 3CMOL 5IVXE 4QHMB 4FFZH 5E99L 4AZ8A 4WDIB 3VFSB 5C0BE 2ED8A 3Q5YA 5F8QC 3IDNA 4HG4J 2FB4H 4Y16B 1RU9H 2PW1B 5DJCA 2X1OA 2NY5C 1KB5H 5JIIA 4WEBL 2Y7QB 4GKZB 3QEQA 4KK8C 2ZCLH 4O02H 3HNTH 1EAPA 4PGJA 4U4BA 1CFVH 3UZEA 3GSWB 2NXZC 5HTSA 1KIPB 4MX7B 3TN0A 1T2XA 1INDL 2VE6A 3ARBD 4LIQE 3VFUB 1U42A 5DXWA 1U92A 5C0FB 5E8OA 4TTDC 5C0RH 1MJ7H 2ENSA 3BO8A 4JPWH 4CU8A 3O4LE 2W0KA 1EHLH 2XFXA 3GRWH 2EYSA 4PV9A 4ZFGL 6FABH 3U4EA 4X6DA 3T65B 3DYOA 3L5WA 4W4NA 1NSNH 3NCJH 3QDGE 2ZOKA 5IQ9A 2V17H 1F3JB 3E1F1 4I48B 2YSSB 3QQ9C 4KPHL 4OZHB 5E1AB 1JGUH 1FORH 2WBJC 4WU5B 3V4VL 2VWEC 1DLFH 3QDJE 4RAUB 5BVJA 1QEWA 2XIDA 4GRLB 1JRHL 1EGJL 5HI5D 4IOSD 1C16A 1BFVH 2F53E 4WJ5A 1N0XL 4X6EA 5EG6C 4UB0H 5DTFA 1G84A 2A1WH 4GSDL 4HKBB 3NZ8B 4YK4C 4UTBH 1K4DB 3VXSD 2EXYD 1YYLH 3I75A 4HUUA 1RUQH 3VXQB 1LILA 1RUPH 3KYOA 5DQ9A 2CIIB 5A16A 4PRAA 4FNLL 1LK2B 1QYGL 4OI9A 4H26B 4NRXA 3THML 5H94A 3IFPB 3H3BC 5E2VL 3EAKA 1JPGA 4WHYG 3KPOB 4S0SD 5DVMA 5ETUA 1I1YB 1FP5A 4XPTH 4I48A 4G6KH 4Z7WB 4M61B 3PL6B 1KCUH 4OIIL 1Z0MA 4G80B 4UTAH 4Q6IA 1LEKA 1OAKH 1DFBL 1CD1A 5IB1B 1DJSA 4MJ6B 1XGYL 4KKLD 4KDWA 1BP3B 4ZYKB 2JJVA 4S11A 4CDGC 5ESQB 3T0EB 3K8MA 2FO4A 1HE7A 1MIEH 4K9EL 1PYWA 3CFCL 3JTSB 3NH7H 1P4BL 3C5ZC 3HI1A 3RJDA 2XY2A 3VH8G 2AK4D 2F5AL 1A3RH 4HJ0D 3RY5A 5EUOF 2VZUA 5GGSB 4IM8A 3QUKA 2VZVA 4LLDB 2BNQA 2OJZH 1R3LA 1A6AA 4LHUD 2YC1A 5ESQA 4FQJH 4OF0A 3RVTC 3BESR 4HLZH 2CKBB 5CFHA 3H0TB 5JQ6L 1OGTB 3AS3A 3Q6GH 4MZ3A 3ZKXB 1QBLH 4M93C 2XN9E 3QUYA 1AGFB 4YBQC 1QQDB 4PJXB 4U0RB 1J1PH 4EUPG 4NJAH 4GW1B 1CZ8H 2EZ0C 5B8CB 3VXUB 4PR5B 2NTSP 3HPJB 2XACC 5JR1L 4HCRL 2AK4B 1G6VK 2ADGA 4LCYB 4Z0BL 2VQ1B 5L8LB 1R3IL 2XZQH 2AEPL 1H3PL 5SWSA 1K5NB 5CEZD 3C2AH 1HZHL 4NOBA 1BM3L 1NMCC 4PY7B 4DZ8B 5GRWA 5DJ0B 4ETQB 1JWUB 4JKWA 4NO2A 5LBSH 1KCRL 3Q1SL 3AB0B 1JNLL 5IBUG 3CH1A 4N8CH 1JZ4A 3LEXB 2IALA 1BZQK 3ZTJH 4OQTL 5C0CA 4NP4H 4X4MA 2B20A 3QUZD 4YHIA 3QSKB 3GK8L 2VDLL 4KJYB 2GJZB 5D7KD 5T1MB 4FXGA 1KLGB 5FA4B 3ORJA 1CS6A 5GRYA 1XF5A 4KK9C 5LCVL 2VAJA 1I4FB 1QUNA 1JN6A 4PR5A 4LNRA 3L5XH 3WLBB 1UACL 1JVKA 2VH5H 1A1MA 4AT6A 1SM3L 4XVUD 2ZPKH 4LARL 5CZXC 3NCJL 1MLBA 2FWOB 5E4IA 5FYKU 4F7MA 4KRPD 3RVWC 4LVOC 3QFDB 3QEQE 1A2YA 1EIBA 5C92A 1U9KA 5EIVA 1WFNA 3ARSA 1A1OA 2VLJD 3GIVB 5C0NC 2LAGB 3QQ4A 4MD4A 3VFGL 3SJVB 3GSNH 2NY1B 2OMNA 4MNGE 4U6YA 3I85A 1IC4L 3A67H 1JUFB 3ULVL 1SYSB 1XGPB 4Z6AT 5JPNA 2Y72A 2UVEA 4O02L 2BHUA 2APWA 5T1MA 1KPUB 5GZOD 1A7OH 4HMEA 4WTXA 3O6FC 1VGKA 1GRWA 2W60B 2IAMA 4G43B 5IFAL 1R0AH 4GW5B 1MRFH 4P5KA 2R1WB 4Q9RL 3D39E 3KPOA 2YR3A 2HKFL 3A6BH 3PGDA 2DS4A 5T5FL 5DS8A 2VZSA 4LVEA 3NPZB 1NANI 5IHUL 2QHLA 5FM8A 2CLZA 1QFUL 3G5ZA 2VLKD 4WFED 3VFRB 4I77H 2DQIH 1WZLA 2VDRL 2V7HB 4L4VE 5D7LD 1KCSL 2AI0H 5I76B 1DLHB 1IGFL 3LB6C 4QLRA 2WUCL 4KKLC 3FTGB 3RWDA 2EDRA 5FYKD 1DANT 1M05B 4A2LA 3L3OA 1BQLL 1OAZL 2F53D 3I84A 3TBVB 3BD5A 3O4OB 4MA3A 4X0KB 3ROOA 3D5OF 1MHCB 1AE6L 1L9MA 5GRVL 1T1XB 5EFIB 4POUB 1J1OH 1QFPA 1NGPL 2X4QA 3IJHA 2VTFA 3SE3C 1E4XI 1Z9MA 3GSOA 1UENA 1QSFB 4A2MA 2ERJC 4H0GA 5C86A 4ZFFB 2P1YA 1MOEA 3MR9A 2EDNA 1J0HA 3SCMA 3PIQA 3EZ8A 1IAMA 3MUJA 3O9WB 3EO0A 2MCPH 4Z5RA 5ITBH 4Z8FH 1ROWA 3TO4D 1CLZH 3ARGC 4P4KD 2F54B 2D0HA 5LWYH 5IR1B 3RDTA 1NFDE 2VYRE 5AZEH 3X17A 5I1CH 4KROD 3GBLA 1J05B 2YMXH 1E4KC 4JJHA 3UTQB 4L8BA 1I7RB 1I7TA 3O11B 1MCIA 2R69H 3TBVA 4F2MB 4QEGA 1X5ZA 3UTSB 4PJ5A 1Q9OA 4Z95L 3IGAA 4HSQA 1UXWB 3CVIH 3MFGB 2DQDH 1FL5B 4QY8A 3V52H 4GUPB 4F3FA 2Y5TB 4OCXL 5JUEL 1YY8B 4K3EH 1EK3A 4PGEB 3VD9A 5JDJA 2VDRH 3WIHH 5FV1L 1OGAA 3QJFB 5F7UA 2UYLA 5EU4A 1M71B 4NFBA 1OGAE 1FDLL 3ARBC 3OGCB 2Z31C 1G7IB 3ZHKA 5HGBB 3KAAA 2FR4A 1NCDH 3O3AA 2CDEA 4J3WA 3G9VA 5DR5L 3NCYP 2WK2A 1P6AB 2FJFA 4X6FA 2FLBT 1G7JA 4DN3H 4YXHL 3QFJD 5DJ8B 2IANB 1UFUA 3BQUB 5JDSA 2DI7A 2W9DL 2AJSH 2BCKB 4KROB 4W70A 1G7IA 5CEYB 2R0LH 4LAQL 4NGHH 1OSZA 5M7QA 1NEZA 3A67L 5DF0A 3H6JA 2ED9A 2F54D 3HTLX 1BVLA 3NGBC 1DQJB 4WUKL 4JFHD 1I9JH 3ZDXE 4ODSH 2AJUL 4LAJH 3MBXL 3PDOB 5KSBB 3GI9L 3T2NL 4JY5L 2YKLL 3QZWG 4YNYA 2YPVH 2GHWB 1I7TB 3GHBL 3O11A 4JHZA 3IAGC 4M7JH 2XG4A 1F45A 4HUMB 3PGFH 4Y5YC 3P9MB 4KH2A 3HAEG 3FKUS 4YJZL 5L9DL 4JO3L 4KTYA 3P0YH 3X12A 4R7DB 4NSKA 4X4XA 1JMZA 1OP3H 5E8NB 3L9RB 2P42B 4R2GB 2BMKA 2M2DA 5CSBA 2GFBA 2QR0A 4FXKA 1IMHC 1QRNE 2I60L 2M1KA 4LCIL 1XFPA 2Z4QA 5I9QC 1SY6L 3A6CH 2LVCA 1XR9B 2PXYD 3ZKMD 1GXEA 4OQTH 3REWB 4OCWH 1LEIB 3VGGA 3PG2A 4QNPF 3VFPB 2Y6SC 4M03A 3I02B 1DQLH 3VCLB 2ITDB 3ALXA 12E8L 4W6WB 3UBXG 3QRFM 4L4JA 4L3ED 1S5IL 1ZS8A 1HOCB 1XIWB 4WFGE 2VLJE 4OCNC 3BWAA 4XAKD 3TO4A 2ZCHH 1W8NA 2OR9H 2GTZA 3MLSH 2ZUVA 4L8SB 4MHHI 2W9DH 1YEEH 2DQCH 2GYSA 3L95A 5A2FA 2JCCF 2EDQA 4TNWK 4NKQB 4NQSB 2OJEA 2BSSA 3WFHA 2PNDA 4PRPB 4YHOH 4RBPK 1NUDA 4K94L 4QRSB 5ACLA 3MYJA 1I85C 4P2QB 2ZG2A 1MI5A 3K74B 3NIDE 4FQIL 3UTSD 1M1SA 3KPLA 3SGEH 4FQXA 3CSYA 1AR1D 5C71A 1E6OL 3VXMD 2ICCA 2NNAA 3A0OA 4ZFGH 2BNUA 4YLQT 4PJFE 4HS8L 5JLZA 3ULVC 5TE7L 1SJHB 3FQWA 1KPVB 4QXGL 1CTOA 4LSVL 2WLZA 4NQTA 2D7TH 5SWZE 1U8HA 2EYTA 1BGXL 5DHYA 5F7KC 3PABA 4KKCC 3GIVA 3VXSA 2I24N 2HRLA 3T0EC 5CP3A 25C8L 3U7YL 1ORSA 4WEBH 4PJCE 4P2QA 5FA3B 1VKXB 1E27B 5T3XD 1A8JH 4JQIH 4L1HA 1VERA 4QRQB 4MNQE 4TVPD 1RZKL 1B0GB 4XBEH 1S78D 4UUJA 2EE2A 2OZ4L 2ZSVA 4ORZC 2EIBA 3NFNB 5EWIL 1GGYA 3DUHA 3EOTL 2ZCHL 3RUGB 4FFVD 1RJYB 1J5OH 2ZUTA 1YNTB 3MO1B 3SE9H 1OVZA 2EDYA 2J8UE 3MTRA 3MV8D 1EBPA 4O5LH 4QHUA 3MV9B 4FQHB 4U1JA 5BOPA 1S9XA 5CJBA 2YPKA 4Q0XH 4BZ1L 1VEMA 2FBJH 5ESAA 5IK3A 4OT1L 1WWAX 5JPMA 5D93C 4IHOA 2AERT 4I0PB 1DDHB 1D5ZA 1EO8H 2VITA 3KPMB 3OF6D 4HJGB 4JGMA 1F58L 1CGXA 3QHFL 2VXQH 1WZ1L 3JV5A 3H9YA 1KACB 3AFLA 2QQQA 2Z4QB 3TBSA 5DRXA 5ANMB 2EEAA 1LO0L 1CU4L 2KBGA 3HMWL 2HJLB 5JXAH 1L7TL 4K8RC 2X1XR 3DMMA 4G5ZH 3QP3A 3RWGA 4BK5A 5F9WC 4FABL 3LHPH 1CLCA 1X5AA 1DQML 1A6TB 3IJYA 1CE6B 4HGKC 4YBLC 4AK1A 1NBYB 3TH4T 5D1ZB 4CL7A 2XTJB 3GJFH 2BJMH 4PS4H 1YEJH 3WIFA 5JZ7D 3GI9H 2V7NB 5TE6H 2COQA 3LSOA 1MJ8H 1JWMB 2OTWA 4KQ4L 43C9B 1B0RA 3RWGB 1H3XA 4GMTL 3ME0A 4PB0L 1CIUA 3OV6A 2DMKA 2HVKB 2GK0B 2VAAA 2XPGA 1MVUA 1R5WA 5C6TH 2QSVA 3RL2A 2W65B 4PJFA 1MEXL 2XZCL 4ZD3L 5E8PB 5IF0B 1MQ8A 5IEHA 3H2WA 4JO2H 5AWNL 1F3RB 1J8KA 3LPWA 4OGZA 5J1TC 3MA7A 4XCFH 1H8SA 3WLBA 3QIBA 3VRJB 1EFQA 2Z35B 1T22A 5DVLA 5C8JA 1FO0A 3PP3K 3BW9B 4IDJH 2NY2D 1Y18B 1JPGB 5E94B 4MDJB 2CO6B 3OXSA 4M9PA 4ZPVA 2O26U 3DRTB 2Q1EA 3B9VA 3BEVB 2UY7A 3I6KB 4QOKD 4WUUA 3IU4L 4W4OA 5TF1L 1P9MC 2KDGA 4K8RH 1GGUA 4ELMB 4LMQE 2I9TA 4GG6F 4ZS7L 3TT1H 1HIML 1T1YB 3JTTB 1YEFL 2W0FB 3QDHA 4YDLC 1M4KA 5E2UL 4S1RH 2JJTC 4GJTB 1HZHH 3BGFB 1TJGH 2WUBH 1S7SB 5DZLA 4I5BB 2XYCA 1ORSB 3LQMA 4ZNEE 3EYSL 5CD5C 3S88L 1GAFH 4JFXB 4P5TB 2GY5A 2Q8BL 3SDXF 5LWYL 2MPAL 4WRLA 5I1GL 5MEOB 1P5UA 5BS0A 3CUPB 4ZUVA 1F3JA 1WAAE 4W6YB 4N8VB 3PABB 3OHXB 4ODBD 4JHWL 4QRRD 2WSKA 3H9SD 4C56B 1P69B 3F7YA 2A0LD 4LQFL 5BO1H 3X3GH 3HFMH 5JOPE 3JXAA 1CN4A 3JWOL 1FBIH 4YNYB 4U1HA 5E6IA 4OZ4B 5DDHB 5BMFH 1EPFA 4JDTH 4F80A 4KHXL 3T0ED 5IIEA 1MI5E 1UYWL 2XRAL 5H8DA 3TN0B 1B3JA 1S7QB 4JEGB 1ERNA 3ZT5A 3QDMB 1WISA 5ACZA 2O5XH 5KS9B 3PL6D 4Z7VE 1JGDB 4J4PC 1U8OB 4MA3B 5FYLL 4OCYL 5IMKA 1IM9A 2I07A 3LN5B 4NQCB 4NC1C 1XIWD 4OZGB 4RMRA 3OAZK 3WXWL 3MX0A 4C59B 3FO0L 3C08L 3HE7B 1RULL 4MQXD 4OFKA 1MLCA 3MLRH 5MEOA 2VXTL 5HYSG 3JUZA 4R97B 1AGEB 3FL7A 3MA9H 2P5ED 5GRUH 1C7SA 1A14L 3ZMRA 4I5BA 1IM3B 1XCQA 3ETBF 4NQED 1FYHB 3I6LE 1JI1A 3TP4A 1NC2A 4PTUB 1DEEA 4P2CG 3SCMD 4V2CB 1F8TL 1ZSDA 1Q72H 2QSCL 5FYKL 5EZOL 3UMTA 4UZGA 3V4UH 2DLTA 2AV7A 2AK1H 3DVGB 3VCLA 3W2DL 3UYOD 4U6XA 4H1LH 4PUBL 3MJGX 4WFHD 3HLAB 4ISVA 3V6OC 1NC2B 4JN1L 2VISA 4UT9H 4Q2ZB 1KXTB 3DUSA 4WHDA 2CJUH 5C2BH 1LE9B 4ZUUB 3VXNA 5C0AB 4AH2A 1JHTA 1T5WB 1N6QL 3MRLB 3MLYH 3GSNA 3O2VH 4AYFA 5K93A 4XXDB 3PE9A 1CFNB 4Z77A 1NSNL 3K8LA 3IDGB 3H8NA 3HN3A 4P4KC 4JCMA 5FA3A 3MRGA 5EUOA 3ARDC 4P5MA 3HC0A 4HUVA 4TUKL 4NQEE 3BQUD 3TCLB 5JIPA 3L5XL 1DE4A 1DBKH 3FOMA 5FFLA 5I17A 2EIEA 4OFYD 5HVGB 5J56B 4Y2OA 4EN3A 1KFAH 4NNPL 3KR3L 1M6OA 4GMTH 5F89B 1T1XA 5EFIA 4WIQA 4G8FA 4C57C 1IEHA 5IJVB 4HFUH 4KZDH 4OKVB 4Y88A 4JFZL 3ZKXC 4E42A 2VISB 1NMBL 3EFFB 4LCUB 2NYYC 2WUBL 3C09B 2CO7B 2ZSWB 3GHBH 4WFHE 1FYTE 5DFWH 1ITBB 4HFWB 3THMH 5GPRA 1ED3B 4Z7UF 3LV3A 1NDMB 1GAFL 2AV7B 5DJAA 3VWJA 2FIRT 4RCAA 1L0YA 4HDIB 4WUKH 3SDCA