2G75A

Crystal structure of anti-sars m396 antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
218
Chain Sequence
VQLQQSGAEVKKPGSSVKVSCKASGGTFSSYTISWVRQAPGQGLEWMGGITPILGIANYAQKFQGRVTITTDESTSTAYMELSSLRSEDTAVYYCARDTVMGGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTSALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IGG Heavy Chain
publication title Structure of severe acute respiratory syndrome coronavirus receptor-binding domain complexed with neutralizing antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 218
sequence length 218
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2g75A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2g75A01
3GSXA 4GKNA 4GJTB 5DGRA 4Q6IC 2V9RA 1NUGA 4NQEE 5JLZA 3IS1X 5E9DE 3R0NA 5AZEH 1UKSA 1TZHB 4UIKL 4S1RH 5IFJA 4PJXA 4EDXB 2BRQA 4BSWB 2VITB 4LOUC 4GG6A 2NNAB 1Z2KA 3PG2A 5HDOA 4LGSB 4NO2A 1H3XA 2EYSB 5IHBA 2OM5A 1A2YB 2WIMA 4OZIF 3TYFB 1I4FA 3MRIA 1DL7H 2JCCF 2F74B 4NFDA 3KPMA 5C0BB 3ULSB 2VOTA 2P5WE 4P4RB 3CFJA 3LQAC 2PN5A 2HYMA 4GS7C 4WVRA 1UZ6E 1X4ZA 3RHWF 1I3VA 4YXHH 5E2WH 3BH8B 2RGSA 4KVNH 4BFGA 5DMGC 2HLAA 3VE0A 1JRHI 5C0CB 2VDQH 4YIQA 1J0ZA 3O8XA 3PP3H 3ZE0F 5IMOB 1AP2A 4ZMAT 1MREL 1QRNE 3PL6C 3VFNB 3I2CH 1IZKA 1DFBH 4ZPTB 3I6KA 3QHFL 1F4HA 4ALAH 1FORL 5IV2B 3T0AA 2AS5M 4HUUA 1FDLL 4KFZC 2EDFA 3RL2B 2DJUA 2G9HB 3DMMD 5GRVK 3ZDXE 3FFCA 4ZS6C 1GPOH 4P4KD 4R2GB 4G6FD 1BOGB 3VG0L 4IIQB 5CEYA 3TT1L 1G0XA 4TVPH 5CP3H 4TPRH 5JPNA 1LD9B 1FV1A 5A2JH 2F53D 3MLVL 3KPNB 4JRXA 4ZUVA 4X6DE 5DA0B 2D7TH 4JFFB 3RU8H 3DLQR 2NXYD 4PJXF 5HHPB 4OLYL 4GG6F 1VADA 4LLAA 1YMHA 1FYTA 5FYKH 5D1QC 2VDNL 3ILQC 4FXKA 1JHKH 1BQHG 1C16B 2C5DC 2D9CA 1EXUB 1I8LC 1YEDB 4JO3L 5DS8B 4R6UA 1T2XA 2CUHA 4PBXA 2DKSA 4Y1AE 4IMKA 4MXQC 2ICWB 1QSFB 4FQ2L 4HX1B 3EHBD 4I3SL 4E41D 2FH6A 3QFDA 2DLIA 1QHOA 4X5XA 3AU1A 3BZ4B 3DGGB 3GM0A 5GGSY 2BMKA 2OZ4L 3HCVB 4MJ6B 4RMSA 3KYMB 4BQ9A 5K59F 2DLTA 2YXFA 4MHHG 2L7JA 4IRSB 2IMMA 1QBBA 1JIBA 1PX3A 5DUBB 4Q9BA 4O4YL 2DBLH 4LPVA 1WIOA 5A1AA 3LKPA 1E0OB 4HZLA 1NFIB 2H41A 3EYOA 5EBGA 5CJXA 2CKBH 1QVOB 2R29H 5GGTL 4HBCL 3ABZA 3TBVB 4NGHL 4XPBH 5GIRA 3L5WA 2XZZA 5MI0B 3UTSE 2N7AA 3O4OC 1AGCA 4HS6B 4NZTH 5FM4A 3P77B 1P84K 1LNUB 1YDPA 1DVFD 2EDTA 4KZEH 3RBSA 5I75B 1CFBA 2J5LC 4TVPE 2EYRA 4OZIB 2OI9C 5TDNA 3IVKB 2VJXA 2JCCB 12E8H 3AUVA 3QEQB 2L0DA 1OTTD 1KG0B 2WLYA 5FO9A 1MJ8L 4NO3B 3G08A 4NNPH 3WLBB 5BVJB 4GW4B 2ZCKH 2ZOKB 4YNYA 1C08A 4H1LB 1LO3H 4NHUA 4QTHA 4Z7WB 4YXLH 1VPOL 4PJ5D 2V17L 4FA8A 5FYKE 5I19H 4RAVA 3HS0B 2WUCH 1EGJL 4YAQB 3CDYA 4XXDB 4YFLF 3PWUA 4M93B 5J9PA 5T3XE 5ESVA 1VERA 4U1IB 4IMLA 2F53A 1TZGL 4KVCH 1MVUA 5C0EA 4KHTH 2V2XA 1OW0C 4JG0L 3VXSB 4PJBE 1HIMH 3ARBC 4HV8A 1YA5A 3PDOB 3ESUF 4JM4L 4GAGH 2AXHA 3PWJB 4OZHA 1MJUH 2H2SD 2EDEA 4AK1A 3U36A 1PKQE 2FD6H 5I71C 4X9GA 1HWGB 1CBVL 4X8JB 5D96C 4NNYA 1FFNB 5EO0B 2Q7YB 1SQ2N 1ES0A 4CW1A 3WLWD 1HHJB 2OR7A 2ZSVA 5ICXA 4PRHD 1Y18A 4M03A 5C0DB 5K33A 3TBWB 1HQ4A 2KBGA 2IALB 1S7WB 5D2NC 4HWBL 4E41A 3VFMB 3OAYH 4PJ7A 2WSKA 4GW5B 1T03H 1OF2A 4ZSOE 1YJDL 3S37L 3QRFM 3U7WL 3K46A 4MNGB 4Z95L 3RAJL 5FGCE 1FL3B 5BW7A 1EZVX 2ZG1A 2NXZB 1T1ZA 3TH4T 5DGQA 3X14A 2AGJH 2GJ6E 3LS5H 3HRZB 4WHYH 1N64H 3VG9B 3VFUA 5IWLC 2GKIA 1S9XB 3RZCC 1F97A 1I9RL 3QDGE 5AYQA 4XNYH 5A2KH 4XNQA 1ZS8A 1TTGA 4FQXC 1W2KT 4Z7OF 3FQRB 5IW6B 1DBBH 5F9WC 4JO2H 3WFDL 1DVFA 3K2UL 1N26A 2J88L 4ZYKA 1KN2H 1Z5LB 3I3BA 3QO1B 4G7VH 1R24A 2A74A 1G6RA 4KKBD 3RWEB 3RVTD 3LN5B 4NM8L 3P11H 1L0YA 1YPZF 4XVUD 1G7MA 2FGWL 2HT2D 3QJHB 5TE6L 3KLAB 2D7PA 4HUUB 4OZHF 4GT7A 2PW1A 1S7XB 3EFFA 1R3JB 5EC2B 4PRNB 3MRBA 1T7YA 4JDTH 4M7KH 3LS4H 1XF5B 2R4SH 1NCDL 4Z7VB 4KQ3L 3MMEB 3AS1A 3U7YL 2YS4A 3BRFA 1HQRA 3ME0A 1DLHA 5GZND 1DQDL 2RR3A 5FYLL 5I0DA 3MRLB 4FABH 3HMWL 5IEHB 1Q9OA 4CMHC 4PJ7F 5GGRY 2ADFH 1R5WB 2M1KA 3SKNA 4UB0L 5MP6L 1YY8B 5AWNH 1HZHL 5D6CB 3VXRD 2UY7A 4L8BA 1QLEH 5E95B 2EEAA 2FX8L 5K93A 2DQTH 1HILA 1J88A 5DDHB 4APQC 1VEPA 2IQ9L 3C5JB 4FXKB 4LASL 5F7MC 3M1BA 4PRDB 3JWOC 1OGAB 1QA9B 2BC4A 2Y5TB 4HAGA 4RA0C 3SY0A 2G75A 2O5XL 1LVEA 4KK6C 3HPLB 1RFDL 1N6UA 3UYOD 5DJ0A 1KGCD 4KRLB 3CC5B 4O9HL 1UZ8B 1IGCH 1YQVH 3MLUH 3QFDB 1FO0L 3VMPA 1NBVH 1A3LL 3H3BC 2G2RA 5ESAB 5H94B 3PWPD 5D1ZA 1A6AB 5I8EA 1R6VA 1YNLL 2UZYB 5HHXL 2IQAB 5HVWA 1JWUB 1T0PB 1A47A 1DBAH 1MRDL 2P42B 3GHEH 3IJSB 4JZJB 4XTRC 3RDTD 3RKPA 3FO2B 4RWYH 4AT6A 3OF6D 3MCLH 4L9LA 4Y4KC 2E9BA 3HNVH 5CD5D 3AM8A 4NFCA 2C4FT 5DJ8B 2G5BA 2XTJD 4LCCB 3NCCB 5DVOA 4NSKB 1XF4B 3CMOL 3JV0A 4OLZL 3WXVH 4YHOL 3ZHDA 4CVXB 1CVRA 4YXKH 5C08E 1V7MH 3FB6A 2DQCL 2IBZY 1SBSL 3VXUE 4LRNH 2V5RA 4K71B 5EC1A 4GAJH 3AC0A 5EU5A 1EEYB 2HA1A 4WHYG 4HK0B 4JPKL 4X6EA 5T1KB 4UDTA 1ZWIA 4JRYD 1HK6A 1QPPA 2R2EB 4UTAL 5AEAA 5EPMA 3GMMA 1HHHA 3DMMB 2X05A 5CZKA 3NIDF 4P4KB 3TV3H 5BJTA 4GFTB 2OZ4A 3VFRA 1JNHA 2PW2A 2GSGB 2VZOA 3QNXB 43CAB 4AMKL 3TYGL 1P1ZB 2CLZB 3O3BA 3O3EA 2FZ3B 4IMLB 2F53B 1U92A 3W0WB 2NY4C 3SE4A 1XR8A 5D7SL 4LLQB 3MZTA 3KYNA 1YPZB 4HV8B 1BFVL 2HT3D 2R0WL 4OCWH 3GI9H 4F7TB 1F3JA 4MLIA 4PJHE 3AGVA 5IJKA 3ULUH 4BFBD 5FK9A 5CBAA 5ILTL 4EQ2A 3NFNB 4PJCA 2EDHA 2IH3B 2IFFH 2W0PA 4HH9B 1CGVA 3GEWB 4Y2OA 3BPOB 3MOQA 4O2CA 1Y18B 5DFWH 5BXFA 3TJEL 1TJGH 5GS1C 4L4TE 2XKNA 3D18A 3AS0A 3DV6B 2EXWC 2J1KA 1PKOA 1LWRA 4PJEE 3SDAB 2BNQE 1GOFA 2WAHA 3G5YA 3F58L 1I1AC 1WFNA 3PWPA 5D2LA 2AV1A 5IVXB 1FNGB 3M8OH 3VMNA 3MLTB 4BZ2H 3DX8B 4J4PD 1KELH 1RZFL 2JK5B 4N0UA 3RDTA 2AI0L 5CJ8A 3BIAX 3ZYZA 1RULH 2X1QA 5F3HA 3OF6A 4M4RA 5FYLD 3I6GB 4KK9C 4I4WB 4GKZB 2A0LD 2HTKC 2FRGP 1Y6KR 2VWEE 4L8DA 4XAKE 3CXDH 3QUZC 2YC1B 3UYPA 1F3RB 2UY6A 3HHRB 1J0KA 1DVFB 4MNQE 5BVPL 1ZA3B 4PS4L 5C2BL 2MPAH 3FQXA 1H8SA 3QAZB 2HVKA 2E7LC 3DXAD 1URLA 3IJYB 4XZUA 4DGIL 5F9OL 3V0VB 2VO5A 4OAWA 3MOAL 4LHQB 4GRWH 1BEYH 4LVOB 5A43C 2LAGB 1T21B 1S7UA 1EFXD 2V2TB 3RTQC 1A7NH 4PJ5B 3WUWG 4EI6A 4PV8A 5I1DA 1KIPB 3OKEB 1TZIB 5JW4Q 3S6CA 3MROA 1UFUA 4XMPH 1MCLA 5CJOH 3CGTA 4I3RH 5IMLB 3NCBB 2H2PD 2NX5D 4YHIA 3PL6D 2YKLL 4MXWL 2IGFL 4HQQH 3UTPD 4BSVB 1FCGA 3EYUL 1CE1L 1FL6B 2NY5H 4MAUH 4JN1L 4Y2DA 4OCRH 4HS8H 1TVDA 1I7TB 1S9VA 5IB4B 1ZHBB 4LCYA 4M7ZC 5D71L 3P2TA 1KEML 4YO0B 3UPAA 3BQUA 3LN4A 2YUVA 4XBEL 4M5YL 5D2LF 4KMTH 2BSRA 2GJJA 5IB2B 4PJFA 3STBA 2AV7A 4NQDE 5SWZB 2L4OA 5LWYL 2VDRH 3REWA 1HWHB 4PRHB 4YHNA 3BEWB 2XYCA 1AGDA 1KPUA 3ZKMD 3O4LD 3SY0B 4QF1B 3VXMA 3MRDB 4N0FB 2DMKA 3ZE2E 1JNNH 2X4UB 2ZP0T 2ZOLA 1IQWH 1Y6MR 3GB7A 5IG7A 4Y5VC 1PJ9A 3Q3GA 1LMKA 4FTVD 1WV7T 1ZHLA 2R0KL 3QXDA 4TULH 1RJZB 2YA1A 3S5LB 5JW4N 4QT5B 1SJEB 4R97B 4DQOL 5MENE 1L6XA 3GRWA 2X7LA 4G8GE 1N0XL 1AKJB 4NUGH 5DLML 1S9YB 5FGBC 4MSWB 5C6WH 1E4JA 3MV8D 2FJFB 1U41A 3L3HA 3WD5L 4GRWE 1ZLUH 3RA7L 3QCVL 5GSRB 4RMRA 4BK4A 2AABH 3MRMA 4U1NA 5E5MB 5FM8A 3B3IB 1JZ4A 3OB0H 3ULVC 2FHBA 4WV1C 3DXAA 5MERA 2P24B 5DQJA 4FQLL 2DLFL 1IC7H 3WKNA 3MJ9A 2AK4E 2HVJA 4GW1B 3CSYA 4KY1L 1EFXA 1S8DB 2VDML 1KB5H 1PG7X 4NHCH 3NAAL 2VZUA 3E3QC 4HIEB 3BPCB 4DVRL 3R1GL 3DGCR 2Y1VA 2DTMH 4PB0H 3E8UL 5H37G 5IVOA 3W9EA 2EXYC 3B83A 2HT4C 2H26B 2YRLA 1SHMA 3MRNB 5B3NA 1UKTA 3A6CL 2G60L 2FWOA 5K9JH 4DKFL 3QZWA 5FIEA 4NP4H 3LB6C 5HI3D 5L2JB 1QKZL 1MFBH 1I7ZA 4EI5C 5CS7A 4KI5C 5A3ID 1K4DB 1OQXA 4TUJA 3KAAA 4XB8A 2NW3B 1Y0LA 2HTLC 3HPJB 4HWUA 3GSVA 3VXRB 4RMWA 4U1JA 4BJLA 4U1LB 3L3OB 1AXSA 5JIHA 5DMKB 1EFQA 2HJFB 5I1LB 1JWSB 4LDOB 3BSZH 1NAKL 3QEUA 1N59A 1QR4A 3U0TA 4HMCA 4TSBL 3WO4B 3O4LA 1A9EA 1B2WH 5I1AB 1J0IA 1SEQL 3MRPB 4JFOA 5KG9B 4N90D 2IPTL 1CL7H 4P3CH 1G9NH 2BNRE 3U9UA 3WHE0 4GMTH 2A6KA 4EEEA 2QHRH 1VESA 4FTVA 4QGYA 5C07E 3PWVA 3HZKA 4WHDA 4Z0XB 5TPWL 5L0QB 1JPST 3QIBA 3WFEL 1PG7H 3VWJD 1TQBC 4NRXA 4ZFFA 4P5TD 3RDTB 2IADB 4Z0BH 3CX5J 4M1CC 4YC2B 1HINL 4JM2A 2BVUA 1UXWB 4XP1L 2B0SL 4HH8A 1J8HE 1TVBA 1SY6H 2DQGL 2VDKL 2XTJB 2J6EH 2KL6A 5GZOC 2FBJH 5DQDH 3X3FL 4V1DD 4XMKL 4DEPC 5HVFB 4JR9L 3KLHC 1TENA 2AKRA 3KXFD 1JNLH 5EO1B 5I2IB 4DTGH 5DJXB 2YMXH 4HKXB 4HUWB 1F8TH 3NGBB 3BP4A 1P2CB 2QSCL 5CGYD 1LE9A 3QSKB 4JRYB 1XT5A 5J13B 3O3AB 1EEQA 4FQXD 3L6FA 1VGKA 3DUUA 4UNTA 3QFJD 3SCMA 4BH8B 1FL5A 4Z8FL 3H9SE 4WUUA 1NPUA 3L3GB 4ZOEA 1K8DB 3ARED 4XPFL 1HHKA 4MB4A 1FJ1A 1G0YR 2UWEA 2VABA 5DEZA 1HI6B 2D31A 3OR7A 4ONGL 3OHXA 1GXEA 4PGCB 4G80A 4ONOA 3HFML 1LO5A 3RWCB 3MXVL 3KPLB 3MRHA 3TCLB 3LMJH 2ZCHH 5C0JA 5F6HI 4Y5XA 5C0AD 1NC2D 1Q9LA 3BAEL 5KN5A 1IM3B 1RUPL 1E4XH 5EZLB 3EKCA 4MYWB 2XICA 4PLKC 4YR6A 5J7CC 1K6QL 5E1AA 3P9LA 4KJPC 5DUPL 5JZ7C 4WO4D 4Y4HC 1A64A 3REWB 3RX8A 1JZ2A 3SE9H 1YN7A 3ARQA 3IFNH 5B39B 1U8OB 2VLJE 4NN7C 4BM7A 2Q8AH 4K8RH 4ZNEE 3PGDA 3Q6FA 4F33A 2VR5A 2YUZA 1XF3A 4PJAA 4PV9B 2X4PB 4WU7A 2C3VA 4PRIB 3LQZA 4P5TA 3EDKA 5GS0L 5T1DL 3LV3B 1CICC 4NZRH 5HI5D 4PJ9C 1AHWA 1QYGL 2M26A 3CSGA 4Q6IB 1FNHA 2BOBA 3BUYB 4WNQA 4IOIA 2FO4A 2A9ML 1IAOA 3IAPA 1JK8A 1KPVB 5C0IB 1G7HB 3VGHA 1TIUA 1IL1B 3IETB 4MS8C 3BHBA 3MA9H 4H8WC 4YGVB 1AQKH 2R1XB 5HPOA 3RVXD 3KXFA 1A4KB 3I85A 1SYSA 2UWEF 1AD9B 3REVB 1A1OB 3DXAB 4HJGB 5IBUG 5MERB 5DQJB 4LHUB 3ZL4H 1LEGA 1MELA 3FOLA 4ISVA 1BAFH 4JFEE 4KMQA 1AJ7H 1J86A 5HHOE 1TXKA 3BPNB 1HXYA 4GS7B 3GJEB 1A6UL 4Y4KD 1K3ZA 3C5ZC 3FT2B 3TIEB 1UWGL 2XI9A 3QFJA 3DX6A 3U46A 1MI5A 3HE6D 1FO0B 3B9KC 3AREA 4JHAL 4LGPB 2VKWA 5E2VL 4KAQL 5EIQA 2B1AL 1I8IA 2MCPL 1YEJH 3PHQB 4OCXL 2NX5B 3PL6B 4LLVB 2YPKA 2XQBL 1NJ9A 3GGWB 3ARZA 4HSQA 2HJLB 3QZWB 4MQSB 1J10A 4ORGA 5HBBA 3AS2A 4L29B 4QRSB 2DQUL 3VD5A 1MLCA 2NY3D 4Z76A 4ONFL 1NC2A 3I02B 5E99L 2P44B 1FBIH 4WI4A 1FN4B 3GSNL 4PJAF 1CXIA 4Y4FC 2VDPH 1GC1L 2AK1H 4O02H 1SVZA 2V7HA 4YH6A 4WO4A 5I9QB 5GGSB 3T2OA 3RPKA 5L6YH 1S7RB 3O0RL 3ZYOA 1RZKH 1JPSL 1KJVA 5HHME 3QQ9D 2JJSC 3O2DH 2NY4D 2LE9A 5IW1B 1KUMA 4LFHD 2D4DA 5KAQG 4XWOD 3IDMA 2FYYA 1ND0A 4X9FA 5DO2D 3MV11 4GAYB 1WEJL 5DI8B 5D1QB 3ULVL 1OAKH 1TETL 4RMTA 4XP6H 4M5ZH 2JB6B 3TCXA 4C56D 4PJXE 4RA3A 4X4XA 4GG6E 4XGZA 2APVA 1A1NA 4F7PA 4BZ1H 1CL7I 3P4NA 4JQXC 3X3GL 1V05A 4UBDD 3MV8B 2AJYH 3MGOA 1JYWA 1E27A 1KPRA 4X6CA 1IGIH 3G6JB 3QUMB 3PWLB 5GJTL 5ACZB 1EAJA 5IFAL 3SEPA 1HE7A 4EN3C 3SKOA 5F70A 1KCSL 1LEKB 1WBYB 4IS6A 5E6IA 1A7RH 1F90H 5CSZA 2HRPH 3DO7A 3ZKND 5DJ6B 4HZAA 4PTTB 4MX7A 2FEEL 4KHXH 3T1FB 5HHNA 3LRSB 4CMMA 2ICWI 2MNUA 3OL2A 4YDVA 4G9FD 4L8SC 4KK9D 1TVHB 1JCKA 4U6XA 4HIIA 1SVCP 4Z78B 3DSNA 4NQSB 3HE6A 3CDGB 4WY7H 1OD7A 3K2MC 1U6AL 1KEGH 5D1XA 5I1KH 4I48A 4HPOL 2Q86B 4X80H 2CKNA 4WJ5B 3RWDA 3U0WL 1EHLH 4LU5L 3FFCE 3I3DA 3PUCA 2J5LB 3O2VH 2OI9B 3OXRB 5GS0D 1WFOA 1C7TA 2C4FU 5F88B 3CUPB 3V0WH 3QPQC 4O2FA 1BQSA 2ZJSL 1R3KB 2R69L 4UOJA 5H35A 5I1HL 2CJUL 4X9BA 3WSQH 5EBWA 3OR6B 4JRXE 2CDEA 3HA0A 1I3GH 1XGQA 3CFCH 5I1JH 3BKYH 2ADJB 2F19H 4MA7H 1G7LB 1FYTE 2XQYG 1WT5C 1BX2B 5D7JD 1MAKA 4WI6A 5JXEA 5DSCA 1JWMA 5LVEA 1S3KL 2QQQA 2VH5L 1ZEAL 1L7IL 4X6CF 4I2XA 4LSPL 3ARBB 5CBEA 3ZLQC 4DKDC 2PXYA 4RMQA 4RMUA 3I6LD 2B7DT 1T83C 3L3DB 1CIDA 3LZFL 5C09D 1CE6B 3RIAF 1CGYA 5F44A 3VWJB 4ZAKD 4P5TB 2WZPD 5FFLA 1TTUA 4OLUL 3QUKB 4YHZL 3IFPB 1S7QB 5D2NB 4IOIB 1MUJA 2W0FA 5BZWA 4GXVH 1UXSA 3HAEA 4JB9L 4Z5RA 4V1DB 3GSOB 1UWEH 4DFIA 5EH1A 3NCJH 1ITCA 1DE4A 3KXFB 3WIHA 4XPAL 2KQNA 5HVHC 1B90A 2HKFH 5EUKA 3KJ6H 5I1CL 4BK5A 3U83A 3C09C 4G9FA 3OKDB 3KPPB 3FOLB 2FX9L 3FO9A 3O45A 4LLUB 3RZCB 1QACA 4J2XA 1T7XA 1HH6A 1XGRA 3LAFA 4JRWA 2CIKA 1UM4L 1FFPA 2FHCA 4FQXB 4PJDB 3S88H 5KSBF 3GO1L 3EO1A 2M8XA 5F9WB 3W2DL 3WNMA 4TSCH 3LEYH 1NGPH 1JL8A 1ORQA 1EK3A 2WWKT 4OD1H 1V8HA 5GGRB 1AD0A 4JGJA 4Z7OE 4DAGH 4D9LL 2YPKB 1OP9A 1RVFH 2VDLH 1IQDA 2Q76B 1JF6A 5FCUH 5D5MA 25C8L 4OLVH 3NFSL 4YUEL 2OK0L 4JDVB 2F53E 2V7NA 4OD3H 4Z76B 3LVEA 5C0AB 3EYQC 3IJHB 2X9WA 4ENEC 5F96L 3L3KA 2B2XH 2FJGB 1ZTXH 2W9DH 4OZHE 2HT4D 3GUTB 5IB3B 3LKRB 1KJ3L 5DHYA 4NKDA 1MAML 4UT9H 3Q6GH 4RRPG 2AXFB 2V9QA 3SKJH 3VFSA 2VB5A 3T8XB 1G6VK 1WBXA 4CMHB 1ZLWK 1XGPA 5GS3A 4LLDA 2AJZA 2Z4QA 4KI5D 3GFUA 1KXQE 4H8WL 3VGAC 4IRJA 4QXUL 1EO7A 1N4XH 5GRJH 4P23D 5C09A 4E41E 3MX0A 4WHTA 1UH3A 1OT2A 4PJ7E 1ZV5A 4APQB 3QI9C 4ELME 4ZAKA 4OI9A 2FSEA 3H9HB 5F1NA 3WS3B 1YEEL 3WUZA 3TF7C 4H0HB 1MCBA 2ARJB 4X4XB 5D7KD 3AXLA 4MJ5B 1PW3A 3MR9B 3EOBB 4F7PB 3VI3F 3EOAA 3UZVB 2D9QB 4X0KA 4IOFD 2Y23A 1GGIL 3MLZH 3VXOA 5DRWB 5IQ7L 2FJHB 4NRZA 3U82B 4X6CB 2GYSA 5LGHL 1A14H 4G8FA 1BQLH 2CRYA 4OFDA 3BVNA 5EUOF 1I9JL 2HFTA 5DRZB 4JFXB 4MCZA 4ZPVB 4YFLI 2FIKB 3RNQB 1QBLH 1A9BB 5D5MF 1IGYA 2DI9A 4R90H 1C1EH 2FNBA 4Y4KB 1D5ZA 4QHKJ 1G7PA 2CGRL 2VN7A 1LQSR 5SX5K 4Z7UB 3LIZL 1BGXH 1A7QL 4YJZL 5IHUH 2KUTA 3KLHD 4MJIB 3B9AA 3LH2L 4LQFL 2O5ZL 4ZFOL 1NDGB 4TTDC 4WWKC 2NY1D 4LEOA 1ZXQA 4NOFA 2X4OB 2CRMA 3VWKC 2HJKB 4BUHA 4U1MA 4ODHH 1VGEH 4H26B 1CS6A 2ATPA 4AYFA 3D69A 2WBJA 4I0PA 4Z77A 2NR6D 4QWWD 5JHDD 5KSBB 5FB8B 2IPUK 4BKLB 4S2SB 4KGJA 3MACL 2JJTA 3O9WC 3N1FC 5J1AB 4UTBH 1HH9B 3NIDE 3QG7L 2H6PA 2NY4B 4S1SL 4RGMC 5EU6B 3EDDA 1K4CA 3QNZA 4D2NA 3PV6A 2C1PB 4YQXL 3PXHA 3S36X 1WJ3A 1FRGH 4XVTH 3LSOA 2BOCB 3B2VL 3NCFB 2I9LA 3T09A 2QR0A 4FQJH 4XNZC 2EKSB 2GT9A 4HLZG 2R56H 1YQ2A 4J3XA 4C56B 4F9PA 1EVUA 4URTB 1PEZA 2DM4A 3HC3H 4TQEH 2DQFA 1NFDA 3IKCA 1AGEB 1J05A 1MCOL 3B6SA 3QRGH 1FAIH 5BRZD 5D7IA 5IESL 5T3ZL 5GS1B 3F7YA 4JFYB 4R4FH 3MRQA 1H3VA 2X4RB 2N7BA 4F7CA 1FZKB 2DQHL 2E5EA 1T80A 3EOYG 4XAWL 5I15H 2F5BH 5IKCA 5F21B 4HKZA 1FG2A 1WICA 4PY7B 5DRXA 4GUPA 2ESVD 4HPYH 4BQ8A 1KCRL 1T20B 2WQ8A 5EUKB 1OB1A 3BWUC 1JRHL 4PJ9D 3ZHLA 5FA3B 3WEXA 3FT3B 4FFWC 4WW2A 3NZ8A 2FATL 4IDJL 4X99B 1ZHNA 2LVEA 1AC6A 1P4LB 1LO2L 4FHBD 4OQTL 3U30C 1ZT4B 4OQ1A 2ZCLL 1FVDB 3ARDC 1MJJA 2DB8A 5KVEL 5DRNA 1QZ1A 3THMH 1VKXB 2F54B 3MODH 4KGLA 4S1DC 4X7EC 5E94B 2BX5A 4J7RA 4M8VA 1V3KA 1UEYA 3W9DB 4M1GH 4YHMH 3S36H 5EUOB 4A6YL 5D70L 3FO1B 3QG6A 3UJTL 4GQ9L 2HFFA 3SQOL 3O6FD 3FOMA 3P73B 4GKSB 5SWQA 3SDXF 4L8CA 3F7RA 3OAZK 3G5XA 3ARGC 4JKLA 5D6DA 5MEQA 4OT1H 4O5LL 5DT1L 2FEDD 3MGTA 2OP4L 3RTQB 4JKPL 3HI6L 1D5MA 3PQYA 4F3FB 3BPLC 3EGSA 2HN7B 4LLWA 3HMXL 4N1CA 2AJUH 3OTTA 5IBTH 3MZGB 3KPOB 3TO2A 4F7MA 3UTQB 3GMOB 3I9GL 1II4E 1IEHA 3RGHA 4DK3A 5D7JB 2P49B 3RWHA 4UV4L 9CGTA 4BELD 4TUKH 1AH1A 5D7IF 4PJCE 4HIHB 2BVOA 5FHAH 1PEWA 2APXA 4IHOB 2B4CL 1X5ZA 3DHJA 4O58L 4UT6L 4EUPB 1I85A 4HUNB 1KGCE 4HGWB 2EC9T 4Y4FD 5INDA 5DJDB 2VNCA 4RIRA 4WHTB 4KXZI 3C60A 1WVZA 4Y16D 3RVVD 5ID1A 2MTPA 5DD5L 3P40A 1JHLL 4L3EB 5KSUA 1N7ML 3STLB 1JF1A 3L1OL 3PWPE 5D2LE 3PJSB 2WINB 5J3HD 4WW2F 2AJSH 4LPUA 2NY6D 1T1XA 3IRZA 3MRRA 4QOKD 5BV7L 4R3SB 5DR5H 3KDMB 4Q2ZA 4N0UE 1D5IL 2E7CA 2AJXH 2W65A 4G43A 4NC2B 3S34L 1JGLH 2L7UA 3EFDL 4CNIB 4XBPB 4X4YB 3UJIH 2D2OA 2PO6C 3PGCA 4XH2A 1FYHB 4XP9L 4Y5VB 4D3CL 5KVDL 3GSNB 3U0PA 4Z18A 3GBML 2ESVA 3T0WA 4ETQA 1U8MB 1HSAB 1G9MC 1XR9A 4LNVA 5IIEB 5IF0B 4OUUB 4ZDHA 4OI7A 1MFEH 1OAZL 2DI8A 4EBQL 5GSVA 4HIXH 3GKZA 2R2HA 2Z93B 3BKCL 3GRWH 3TBTA 3MNVB 2VLKD 4JLRA 5SV3A 1BBDH 3RPIA 3PWNA 1D6EA 2OTUB 2KZWA 3ARFA 4YE4L 4AEFA 1RZGB 4WV1B 1C5BH 4FG6D 4DKEL 5C0GB 1TCMA 4KPHH 4K9EC 4N8CL 3G04B 2UVEA 5FDWB 3QNYB 4WFHD 1YECL 4MMXC 3BGMB 3HE7C 1Q8MA 3ZKQD 5KTEH 1MF2L 2Z92A 4UINL 3GBNH 5HYIA 5T3ZD 3DVGA 4NC0B 3X13A 3MJ9H 4V2CB 1A7PL 2MJWA 3TLRA 4YX2L 5E8NA 3LKNB 1BVKA 4KJQD 1AO7B 1ORSB 3FMGL 1U3HC 5IM7A 4JJ5B 4KUZH 1IGFL 3UMTA 1CK0L 1WCBB 4O2EB 1H3WM 3BKMH 5I17A 5TDPB 2ATKB 3L7EB 2IJ0C 1WWBX 3F12A 4PJFE 5BQ7A 6CGTA 3EYSH 2XPGA 4DW2H 4YHPB 4R96A 5DJYB 1HKFA 3SDXB 3CZJA 4TUOA 4CVWA 1U8KA 1T1YB 1I7UB 5FOBA 2R1YB 2YPLD 1EJOH 1EPFA 1CFNA 2GAZA 3OWEA 4P23B 5FA4A 4X6BB 3VXME 3WHE1 4Y16A 3FO0H 3IDNA 5LXGL 1JN6A 2XACC 1ZLVH 3DBXA 5EB9A 5K9KB 4W6YB 1RK0B 3QUXA 3T4YB 1FNSH 2CDGB 5DJ2B 4HFUL 4QOKA 1RV6X 5IMMA 3GJFB 1U93A 1RIUH 1PZ5A 5DVNA 3VGGA 5FYLE 4NKOA 4Y88A 2W9EH 4NJ9H 5AZEL 1FH5H 2Q3ZA 2YD4A 4OZFA 5FECA 1OAUH 1BIHA 1OPGH 4PTUA 3LEXA 3C6SA 3BDBA 4XVSH 1BPVA 1OSZB 5CGMA 4N9GB 1T0NB 1YEIL 1WZ1H 1DL7L 5EU3B 5F9JA 3WKMH 1E28A 1H3TA 1KTLB 1YUHB 2VLKA 5I1GH 4XNXH 4AENA 1AGBA 2XZCH 1ZLSH 4YXHL 3ES6B 5E2WL 2DTSA 4KVNL 4DEPB 4JY4A 1D9KC 1FGNL 3UBXG 1G1YA 1MEXH 5IEKB 2VDQL 2H32A 2E7HA 3G5VB 3IAQA 1NGYB 3TFKD 1SJXA 2CK0H 1C5DB 4XRCB 3JZ7A 5I66A 3NN8A 2EO1A 3U6RA 2O93L 1U3ZA 1REIA 3I2CL 4OFVA 1MQKH 3UTPE 1BM3H 3PF2A 4JREC 4ALAL 3MLRH 1CT8B 5ICZB 5E1HB 4DN3L 1BQUA 3VFPB 5J6HA 3SGJA 1U8JB 3C08H 4U3CA 3H3KA 3MLWL 5EWIH 5JHDB 5C6TH 5E8EA 1P7KB 4MDJA 5CLWA 1OGTB 2NQCA 1GPOL 3WJJA 5DD1H 3WJLC 2NY2D 3OKYA 3S35X 4NKIH 4HXAH 3STZA 4ZUUB 3DTXB 4TVPL 4TPRL 3QUYC 3HN3A 5CSBA 3VRJB 3MA7B 4JFHE 4BQCA 3R06B 4LRIC 1DUZA 3H42H 3TESA 4NQED 4OQTA 3QDJD 2YPLA 3O4LE 4WW1A 2D7TL 2XTLA 3RU8L 3RFZC 2VWEC 5HGHA 1NC4D 3BD3A 4OD2A 4XX1G 4E0RA 4WTZA 1H0DB 1CF8H 4KJYA 5FYKL 3UDWC 5C9KA 1BHGA 3CFKB 1O7SA 4FTVE 5CZXD 2ZWLT 2VISB 2EEDA 5J56B 3ARXA 1JHKL 4LCWD 4PGBA 3GIVA 2A83A 1QSEB 5TDOB 3MO1A 4NWUH 2E8YA 4L3AA 1H8OA 3O6KL 5BRZB 2VZ3A 2P5WD 3L3JB 2VQ1B 2YBRB 2VC2H 1FLRH 4NN7B 3QO0B 4H5SB 1TCRA 1Z0MA 3T0EA 4J1UB 4JY6B 1F13A 4J3OC 1R3LA 4NQVB 5DHVB 3QI9D 5EN2A 1TNNA 4ZXBC 4YWGL 4MD5B 1LE5B 1CICB 4FFYH 4NNXB 3WFCH 4PJ9B 2DQIH 4YK4B 2DBLL 4B5EA 5I16A 3ROOA 4S11A 2CKBL 2R29L 3VI4F 1AI1H 1MCEA 1CFTA 3S35H 4KZDH 2BCKB 4XPBL 2IPKB 4EDWH 1SMOA 1FP5A 2XT1B 2EIZA 4LL9A 2XWTA 4NZTL 5LCVH 2C9AA 1OP3K 5FKPB 2R9HC 4K55A 4UQ3B 4KZEL 3MSPA 4WUUE 2JJVA 3OPZH 1XH3A 4JQIH 1T89C 2DOCA 5INCA 2N4IA 4G3YH 3O6FB 4K2UH 2UWEE 4E42B 1MAJA 1M1SA 2LU4A 3EYVB 4PD4J 1TPXC 3C5ZB 2Y6SD 1MLBA 3U4EA 4K94C 2ZCKL 4JFPA 3RWGB 1CXHA 2VE6B 3B9KB 1I7RA 1ACYH 1LO3L 2PYFA 1JMZA 2NMSA 4GMSH 4YXLL 4IJ3C 3FQTA 5CEZH 3IDGA 4N0RA 1TTFA 4ODXB 5I19L 4FRWA 2WUCL 4WWKD 4TNWF 3WIFB 2XZAH 3CFBB 4TNWK 3QH3B 1INQB 1QBMH 1U8PA 3F12B 4KVCL 4ZUTA 1UVQA 3QDJA 4PGDA 3VFWA 4Y1AD 4KHTL 4PRPA 3VDCA 1HIML 4HUVA 1NC4A 4N90E 2EDYA 4FQCH 1R0AL 4GAGL 4Y4FB 1MJUL 2KPNA 1U8NB 4G8EA 5DVMA 2FD6L 1G9ML 2EDXA 4PJIA 1D5BA 4LCWA 4KWUA 2AW2A 5ISZB 5DQ9B 4ZFOB 4PJAE 1XCQA 5FV1L 1CLOH 2QSVA 4HHAB 1N0LA 3KS0H 1RK1A 5C92A 4GXUN 1T4KB 4C83A 3O41B 1T03L 5J1TC 2X2YA 1QR1B 2JIXA 3C8HA 5FF6A 2R23B 1P7QD 5E8OB 5IMKB 1CXLA 1OAQH 3KXFE 2AGJL 1NGWA 3NIFE 3UEZA 1A4JA 3LS5L 4TVPD 4ZUWA 3SDCC 5F9JB 4KDWA 4BFIB 2EE6A 4D9QE 1NEUA 1IKNA 1N64L 2NYYC 3FT4A 3TBYA 1A1MB 2VLKB 3CCHB 5KZCD 8FABA 1L4IA 5EIIB 4XNYL 4UT7H 1OP5K 5CIPB 4YHKH 5EU7E 4AM0B 1E4WH 4XCFH 5CMAB 2A2QT 1NBZA 1DBBL 4EN3B 3DX7A 4JO2L 3QFJE 3OX8A 3S5LG 4LKXB 3RVWC 1FVCB 1LEIB 1MI5E 3JV4B 4YDJA 5E00B 5FYKD 4HCRA 3OKKB 5GGVH 4G7VL 4FFWD 4ODWB 5F3BB 1T7VA 3IGAA 2ADGB 1QFWH 2ZKHH 1HHIB 3P11L 2MCG1 3M07A 3ARVA 1JHTA 4WU5B 2C26A 1TQCB 1U42A 2CLVB 3JTSA 3G9AB 3U4BH 3GMPA 4DJMA 1OM3H 4RQQA 5GRUH 4P57A 3S4SB 1XF2A 4JDTL 4M7KL 1PYWA 3LS4L 3LKSB 2R4SL 4NJAH 3SE3C 3BZDA 5HY9B 4UDUA 2DWEB 1BFTA 3IU3B 4H1LH 3A0OA 5C0ND 2CIIA 1F6AB 3BMWA 4P5KA 1KCUH 3DUHA 4AEEA 1B0GA 4FABL 1DUZB 5L7XH 2DL2A 3DO3A 1MHPH 3OKMB 2J8HA 4N0YH 4OI8A 4W68A 5FV2A 4POUB 3UC0H 2ADFL 2H9GA 1OW0A 5FXCH 4U33A 2ADIA 1VACB 3MV9D 5JQ6L 5I6XB 3JUZA 3OJDB 3ORJA 5E6YA 5AWNL 1QLEL 1FGVH 2DQTL 2W91A 4NCDA 4A6YB 4CDHA 3VXNA 4I18A 4R7NA 1PQZA 4XCNA 4QXGH 1RZIB 1MY7A 3HC0B 5IK3B 5JMRA 4MAYA 4R26L 1KTKE 2QBWA 1YQVL 2IH1A 3MLUL 3R8QA 2EH8L 2C7UB 4BH7A 5E08H 1NBVL 1P7QA 4X6CE 2P8LB 3DROA 3WHXA 2COQA 2NPLX 5TE4H 4CDGC 1FFOB 3D2UD 3PNWA 3FRUB 2FCBA 2P5ED 3DIFA 1KIQA 3D85A 3RL1A 1DBAL 4HC1A 3GHEL 4LPCA 4X6DF 4QHLB 5FHBH 4RWYL 3ROOB 5BS0D 5E4EC 4NFBA 3HNVL 4FQQB 4UNVA 5ESQA 4LVEA 2DWDB 1CFTB 2DQDH 2V2WB 2EE3A 1A6TA 2NZ9D 4KDVA 3WXVL 1C5CH 3P4OB 3R8BB 5HVHB 1V7ML 1AIFA 1IAKB 3KWWA 4MGXA 1J5OH 2J2ZA 1GHFH 2OSLA 4K7FB 2ITDA 2VR9A 1BECA 3JV6A 1NUFA 2P8PB 1CDYA 5TF1H 4GAJL 4PD4K 4IM8A 3O3DA 1Q38A 1RUQH 1QRKA 1ZA6A 2JELH 1MCFA 3NACH 5DA4A 3T65B 3K7UA 4OFIA 3IAGC 4OB5H 1CG9A 1L0XA 2PYFB 3CFIC 2NY2B 1IC1A 2GI7A 4ZO9A 3PP3K 1FHGA 3RJDA 1KV3A 4Z7QE 1I3RB 4EOWH 1DBJH 4KDTA 2OJEB 2DYPA 3FQWA 3TBSB 3UP1A 3D0LB 4MCYA 3HE7D 3MC0A 3GMRB 4NQEB 1S5IH 3QDJB 4NYLB 4POZC 5E9DB 2Y72A 4F37K 4QCIB 3MV9A 2OCFD 5GISH 4MA3A 4XB7A 4OCWL 3GI9L 4I2XE 2Y5EA 2H8PB 3BD4A 5T1MA 4ZUSB 3MRGA 1DLFH 3ULUL 1DN2A 1AQDB 1D5BB 5IB5B 2Q6WA 3ROLA 4M6NH 2BJMH 3ELAT 4DGVH 4HD9A 3B9DA 3D3VD 4JZNB 3P0GB 2P5WB 5I18H 1V3LA 3V5DA 1HYSD 5I75C 4H1LG 3D6GA 5KVFH 1ZHKB 1LDPH 4KRPC 4ODSH 1ONQA 1FZMA 4JE4B 1TJGL 4ZOBA 4U6HA 3VGAB 4FXGB 1UCBH 3IFLH 2A6DB 2ED9A 4R8WH 1RJYA 4PUBL 2EDRA 5CP7A 2QADD 3QI9B 5C08D 3D2UA 1BQHB 2GUOB 4XP4H 1F4XH 2P5EA 3M8OL 4HWNA 1G1CA 4I5BB 4BZ2L 1QRNB 3VXUD 2O61B 1KELL 3Q5OA 3SDDD 5F89A 1N3NB 1RULL 1KENH 5BS0A 4H88H 4QXTA 1XZ0B 4UUJA 2ZUQC 3TBYB 4CADA 1IFHL 4G9FE 5B8CB 2I07B 1NMBL 4K94L 2EC9U 1RZJH 2HP4A 1T04B 1Q94B 2Z8RA 1X7QB 3JWDH 5ITBH 2YA0A 3CXDL 3B8YA 4G6AC 3GSQB 3RIFF 3U48A 3QIUC 3L9RB 3DX7B 5ENWB 4K3DH 5E7BA 3UJJH 3TVMD 1HOCA 4WDIB 1R3HB 3UAJC 5L8LB 2MPAL 2P43B 1UEMA 4HF5H 3RUGA 1M7IB 4AIZA 4NQXB 4LNRA 4GRMA 5FYKU 5C9JB 2FL5B 3VFOB 1DUYA 4X6DB 1MHHB 1BEYL 5ADPH 1ZVSB 4PG9A 4U0QB 1EUUA 5JXAH 5D5ME 3L5IA 1A7NL 2X4SB 4IDLA 4OLWH 2BY3A 5EIVA 4QGTA 4MDIB 2BVQB 3SGKA 3LHPH 4NO5A 4XMPL 4WWKB 3FB7A 5CJOL 2BZDA 5CHNB 1EHNA 2NXZC 4PBWD 3U9PH 2VAAB 4NQCD 1YN6A 5T5NG 4HQQL 3ILPA 3OKNA 4FQ1H 5JORB 4Y1AB 3D0VB 4JVWA 5DK0A 1QG3A 1ADQA 4F15C 2NY5L 4MAUL 4OCRL 4HS8L 4ESKA 1H8NA 3FL7A 3OKOA 5KW9H 1K2DB 4I0CC 3W5NA 2CRZA 1X9QA 2ADIB 2HFGH 3VFTB 5GRZA 3DRTA 3O9WB 2ED7A 4KMTL 4N8VA 4YBLC 3TPUB 3LKOB 2P48B 1IAIM 5C09E 4DWHA 2YEZB 3WNOA 3D3VA 4DZ8B 2VDRL 5DJAA 2LABA 3O8XC 2A77H 5JIIA 2X1XR 3G6AB 1DEEB 3VD4A 2GFBA 4PP2A 1JNNL 3IYLW 4XNZB 1ZK9A 2YD2A 4XAKD 5JDSB 1IQWL 4MJ4A 3MV7A 1I1AA 3T0DA 4PG2A 4YEFA 4MNQD 1M7DB 1BLNA 3GMNA 3S3SA 3SDDA 1CD1B 3BZFA 3FTGB 3RUGF 3DUSB 4XC1H 5ALCH 2MFNA 5B4MD 1ZGLA 1U2HA 3E0GA 4NUGL 4RCAA 2CRIA 3LPFA 4NCC1 5KZCB 2AAVA 2R0ZH 2FB4H 3PIQA 5K9QG 1I9IL 4KK8C 3SN6N 3DETC 5DFTA 4JANA 4RGND 4K3EH 4O51A 4L4VD 2X5PA 2IBBA 2AABL 4CVZB 2OYPA 3QUZA 4EQ3A 5CJBA 3PGFH 1BJ1H 2YSSB 5DTFB 3ULUD 3QPXH 3S7GA 1M4KA 4OSUH 4QY8B 5HYQA 3WS6C 1JV5A 2IC2A 5TQ0H 2DMCA 1IC7L 1F4WH 3U30B 1HDMA 3C2AH 3BT2H 2AXJA 3T4AB 4Y8DC 4PJBB 3N1PC 3SGDH 3ARDB 1YNKH 2PTTB 4PRBA 4YDLC 1DQJA 1KB5L 4NHCL 4NPYA 2WUBH 1ETZA 5TE7H 3H7BB 3SOBH 1PKQB 1XGYH 2DTML 4P5MB 4QHMB 4PB0L 5BO1H 5ERWB 1WAAA 5ID0B 4LDLB 1FZOB 1HCFX 5T1LD 2HKHH 4M62H 4YPJA 3V5KB 2ERJB 4P9HC 4R4BB 5HTSA 1QFUL 4NQCA 4LAJH 1U58B 5CGTA 2DLEA 5K9JL 2R1WA 4CL7A 4EXPX 2RHEA 4NP4L 5DURD 1FNEA 3ARGB 4RX4D 5EZOH 2AXGA 1MFBL 2CKBB 3ARPA 3BPLB 4ORZC 4ZSOB 3WUWA 1FVEB 2ARJQ 5I74C 5I8OH 3PABB 4WFEE 4PYHA 4QYOA 3T0VA 3C5SB 5FGCB 1GZQB 4OLXH 2XA3A 2X89A 2GJ6B 1MFDH 5MEND 1BWMA 3BSZL 5KVGH 3D9AH 3IU4L 1YNTA 3C9NB 4G8GD 1FIEA 3L3IA 1B2WL 5D7KE 1NFDE 4K71C 1IGJB 1DDHB 3QDGB 5ACLA 5K9OB 1CL7L 4P3CL 2W07A 1G9NL 2EH7H 2WQRA 5TJWK 5D7IE 4P46D 4GMTL 3H3PH 2QHRL 4PLOB 1UA6H 3KVQA 3PHOA 5JMOC 3DMMC 2QSTA 3L5XH 3RQ3A 2GTZA 3VXPB 4P2RA 1PG7L 4X6FA 4DN4H 4Z0BL 5L9DH 3O11B 5DFVD 2YUXA 5A2IH 3TA3D 1T5XA 1DR9A 1MH5B 5E2JA 1SY6L 4PJHF 1OLZA 2PO6B 3BIKA 4L4VA 2J6EL 4OZGA 1IAII 2FBJL 5DQDL 4M8QA 2GSIB 1WAAF 2NXYC 2VLLB 2IF7A 4MWFA 1JNLL 4ZOCA 2VAJA 4DTGL 5DD6B 1UB5B 2YMXL 2OR9L 2YD6A 1X44A 2Z9TA 2PCPA 1OAYH 4OIIH 2A73A 4LEXH 1F8TL 1T22B 2IAND 4AIZB 4YPGB 3O6LH 4OZ4A 3W39A 1MVFA 1YEGH 1FFRA 4HGKC 4HUXA 3BEVA 2GCYA 4HKBA 1NGZA 2NLJB 3PQYE 4G6MH 4I3SH 2DAVA 2XXMB 3ZDZF 4F7EA 1I8KB 3CH1A 4Y89A 5BW7C 3HE7B 5CEXB 4QRPA 2VL5A 3KHOA 3DV4B 2HLFD 4RX4A 4R9HA 4HWZA 3VDBA 4OKDA 1CWVA 1HNFA 5MEPB 3LMJL 1SM3H 5EFIA 2ZCHL 5FKAB 1QEWB 1Q9KB 4JG1L 1G7QB 2EDDA 4EI5A 5F7DB 5IR1B 2OXHA 5BZDB 1S5HA 3DRTB 1A02N 2PTUA 1E4XL 4HBCH 1R3IH 4QLRA 1DVFC 3CLEH 4WI8A 3TEUA 3JVGA 5ADOH 3QAZC 2AJ3B 5IVZA 32C2B 3IFNL 1MHCA 2UYLB 3CH8A 2BK8A 1ZOXA 2YHGA 4OZGF 4P46A 5SWSA 3AFLA 1OTTC 2Q8AL 3UTTA 5DYOB 4OCLC 5CWSA 3ULUF 5C08B 4GLRH 3ZSSA 4X5WA 1EMTL 1DEDA 1XF1A 1IBGH 4RGOH 1ZT1A 5GRVL 2IEPA 5HYEA 3VXUB 3GMNB 1OSPH 4PREA 3T77B 5E56A 2ESVE 4NZRL 1CI5A 1CGUA 4JY5H 5E2UH 5HGBB 3TA3A 2MHAA 2HG5A 3IXTB 4JPIA 4NDMB 3U2SB 2A1WH 4F80A 1IC5H 3MA9L 4LDEB 2DN7A 1TZGH 3H9SD 4M43L 1X5XA 3V7AE 1MCJA 1PY9A 43C9A 1AQKL 3VCLB 2XFXB 3TVMB 3INUH 3ZKSD 4OZFH 2V6HA 4LBEA 3MLYL 3QQ3A 4G42A 2C1OB 1PZUB 1DQQB 2IANA 3RWIB 3ZL4L 2KZ1B 1BAFL 3ZE2F 1HDMB 4KK5C 5TGBA 2VZVA 4ELKB 1D9KB 1RQ5A 4PJHB 1BZQK 2A6IA 1RD6A 3MOBL 3GMLB 3AY4A 5JOEA 1RUAH 5I1EH 2H32H 3HZVA 1YEJL 1ZT7B 5HI4D 1UQSA 4G6JL 2Y7QA 5EU4B 5HHVL 1G84A 1KJMA 1OTUD 4GRWF 4JREB 5E5RB 4HMEA 4D8PA 1BZ7A 5AG8A 4L4TB 2VLJD 3JTTB 2XN9D 4WFFD 2DI7A 4PJEB 4LF3B 1QLFB 2B39A 3JWNC 1N2RA 5HGAA 1OWRM 1FBIL 4B7LA 4MJ2A 1K8IB 4XC3H 3V7AG 5F7HA 1A7BA 1JTPA 2AK1L 4O02L 4E5XA 5HD8C 4HUKB 4G6KH 1OP3H 3FONA 2QKIB 3QUYB 4KV5F 5L6YL 4QHKI 2MMXA 3TGXA 3GM8A 1RZKL 2JB5L 2RFXB 3OV6A 3HR6A 3O2DL 3L3IB 1CDHA 2Z91A 3BH9B 4Y4HA 1GAFH 2X6MA 3BWAB 3CFDB 2VQUA 4UV7H 2IAMD 2ITCA 4QOKE 3RVTC 4ZFZB 1C12B 1OHQA 3MUHL 1KB5A 1T6VN 1HYRC 5ITFB 2BXZA 3MJ8B 4XVUC 4PGEA 1WBZA 2HT2C 5C0FB 3H6JA 3I50H 1F5WA 4MNQB 4XP6L 4M5ZL 3MRCB 3WFBH 4U6VH 1RJLB 3FAXA 3W82A 2BSTA 1CIUA 4OF6A 1KLGA 3M17B 5GZNC 1FIGH 4NBYB 2AJYL 3GSWB 5HHOD 1KLUA 3BZEA 1T5XB 3IDUA 1BF2A 1NAMA 3ZKXC 4EVNB 2G5RA 1WK0A 3DJ9A 4MD0A 4S1QH 1IGIL 1MJ7H 2V9TA 4JDZB 5IB1A 1CFQA 1S7VA 5D7LA 1RHHA 3CFEA 3C8KB 5ANMA 4ZXBB 1SJHB 2GJZB 1RAMA 3OJ2C 3MBXH 1F42A 1HKLH 3OGCA 1A7RL 1F90L 4RISH 2HRPL 5IJKC 4KHXL 4NT6A 3B8SA 1UJTA 3LD8B 1U8IA 4JFQB 1S7TA 4K7PX 1LHZA 2C4XA 3DX9B 1OQOA 4U2YA 1IM9A 1F11B 5H2BA 4M61B 4QRTB 3DVIA 4WY7L 4K8RD 4G6AD 1LO4H 3LQAH 1KEGL 3VI4E 3MFFB 2K9UA 2BXYA 3CLFH 5DEFA 3HLAA 3OB0K 3VU2A 5T1LB 5E0QA 3O3UN 4RFEA 5D9SA 3UAJD 1BFSA 4NQDB 3V52H 1EHLL 4KKLC 3VA2C 5M95B 3O2VL 4OZFG 3HUJA 5I8CB 5DURB 3KPQB 5DHXB 5HHMD 3U79A 4HT1H 3V0WL 3SKMA 3UPRA 2XN9A 3RDTC 4KTDH 4XCYB 2FH8A 1J18A 1YNLH 2YD3A 2J6EA 6FABH 3MUJA 5CD5C 1WZMA 3WSQL 4G8IA 2YPLE 4IJ3B 2XTJC 2D3VA 4XMLH 1T0MA 3X11A 1I3GL 4GOSA 3NA4A 3CFCL 4U49A 5AD0A 1MCKA 5I1JL 4RSVA 3P4LA 2EYTB 2F19L 4MA7L 3RWJA 4JZOA 5MENB 4G8GB 1XIWD 5C86A 5J57B 4KQ4H 4LHJB 5IVZB 4GRWB 1SEBB 4H25B 1D6VH 1IEAA 1R5IB 3NGBC 1MWAB 4IOSD 1QLRA 1KTDB 2OR8A 1W0WB 1P4IH 4K7PH 3T0EE 5EO9A 1T3FB 2NW2A 2Z31A 1N5AA 4A2MA 2DKUA 4JFDD 2DQEH 5HYSB 2AK4B 3GSRB 3BD5A 2CLRB 1CFSB 1HHGB 1DN0A 2VXQH 2GK0A 3MFGB 4GXVL 4GLRI 3D39D 1M05A 1R5VB 1T2QH 4QRQB 3SGEI 4Y2DC 3DNKA 4AH2B 4ONHA 3L7FB 2HT3C 3NCJL 1NDMB 43C9B 5ACMA 4FZEH 2P8MB 1QBAA 5FO8B 2HKFL 3D5OF 3VRIA 3BQUC 1RUKH 1BFVH 3HUJF 3QUMH 2HFEB 3HR5A 3KJ6L 3SDCB 1JPFA 3MRKA 3AAZB 2VXVL 3MNZB 4OJFL 4PJGA 3K3QA 3X17A 2CK2A 1KT2A 4C57C 3EOTH 3RZWA 2D0GA 4L8SA 5EOTA 4BQBA 5LAXB 1S9WB 3DETD 4XT1C 3WO3B 3S88L 3FCTA 4HJJH 3RJQB 4TSCL 4JRXD 3LEYL 1NGPL 3BN9C 3EBAA 4OD1L 3TJEH 4OGYH 3DRQB 1UM6H 4YLQT 4DAGL 3HZYB 1E6JH 2I26N 4GO6B 4KU1A 5HGGS 2OLDA 4HCRH 3E6FA 3MCG1 2DM3A 2ARWA 4QO1A 1WC7B 1RVFL 5FM5M 2VDLL 3DOSA 5ICYA 5IGXH 1BOYA 4RDQG 5FCUL 2BNRB 3E6HA 4OLVL 2XNAA 4NO0B 3QDJE 4OD3L 2A0LC 4XI5C 5C07B 2Q8BH 3QJFB 4LHUG 4PRPE 3MCKA 3WL9A 2B2XL 3EYFB 2CUIA 1SYVA 1ZTXL 2W9DL 2I5YH 4N1EA 4RZCB 4LSQH 3KPRA 4ZOAA 1WITA 5EULV 5FEBA 1XIWA 3J8F7 4UT9L 3Q6GL 3WNKA 5KAQF 1W0VA 4PJIE 5GGUB 4LCWE 4XNMA 3FFDB 5JPMA 3SKJL 5B21A 1A3RH 5CINH 1BJMA 1WT5A 3IKKA 1HEZA 1J8HB 3FB8A 1IVLA 2BHUA 5C2BH 1EEZB 1WWAX 3BXNB 2RQ8A 1KB5B 3BPNC 2VQTA 1JYNA 1N4XL 5GRJL 3VFVA 2A9NH 2BSSB 4OCSH 1VB9A 3ARYA 4JFDA 1S7SA 4OFPA 3MJGX 2WP3O 1TNMA 1X5LA 4XBGA 4PJGF 1M6OB 5BOZG 4LCUA 2H2PC 1CR9H 5IQ9B 1B0RA 3VJ6A 3V4VL 5JA9A 3MLZL 1LO0H 4HIJB 4UQ2B 2X9XA 3D39A 3QEHB 3OKLA 3BDYH 2WLZA 1PY4A 5MHSD 2K7PA 3K80A 5GRXG 1A14L 3H9SB 4U1HA 1BQLL 1AGFA 3V0AC 4JN1H 1BBJA 3WDHA 2I27N 1MRCH 4LARL 4XCEB 4NKQB 1GRWA 5F7EH 1WSST 4ODUA 1QBLL 3O2DA 5I9QC 2BNUB 4BSJA 5E4EB 4R90L 1C1EL 4JN2B 3VD9A 4HC1H 5DMIH 2HH0L 3ZKMC 4CKVX 1H5BB 4AL8H 4PP1C 1BGXL 1IEBA 5IHUL 5EBLA 4WEBH 1FLTX 2MKLC 4MNHB 1KB9J 1RIVH 5HPMA 1U95B 1NANI 1U8HA 2GEEA 5HGDB 4OF8A 3QQ4A 4HWEL 1L7TH 2IBZX 1J0YA 5HHQA 5E8PB 1V7NH 2AP2A 5KSVB 5L8JB 3QWOB 2Z35A 2VLJB 3KNBA 1JZ6A 1PG7W 3D25B 3BO8A 2NTFA 1G7IB 4ODHL 2B20A 1VGEL 5EZJB 1JUFB 1FFQA 4I77H 3V6ZA 1B88A 2OS7A 3X11B 2XQYK 3MJ7A 4UTBL 2GIYA 5IROC 2BVPB 3NFPB 4F58H 4BA8A 3UYRH 3BP6A 4OKVB 1Q72H 2IAMB 3SJVA 4KTYA 4CGTA 1FRGL 1T5WB 4XVTL 5IOPB 1VFOA 3RGVD 3RWFB 1JGUH 1IGMH 2D0HA 4PGJA 1Q1JH 2R56L 5JNYB 1PSKH 4XHJD 3SCMC 2VDMH 3HC3L 4RRPA 4GG8A 3UTZB 4LLYA 2D4FA 3MREB 1I1FB 1V3JA 4JFEB 2PYEA 3QRGL 4KRPB 5HHOB 1FAIL 4J3UA 2BHZA 4R4FL 3O6MH 1AE6L 3DI3B 4U1SB 5HI3C 1Q0YH 3JWOH 2VLRA 5JUEH 2WW8A 2GK0B 3ZTJG 4D0BB 3A6CH 3HI1A 2F5BL 3PP4L 4DKFH 3QXUA 5FUOH 4ZFGH 5A3IC 4X7SH 4KTEH 5J6GA 4TYUA 4DZBB 1LGVA 2WIIB 4ONHB 1WF5A 3DVNA 3MUGA 2OTWA 4Y5XC 4HPYL 4WEUD 1BZ9A 2XRAH 3LKQA 2VSDA 5F1OB 2Q1EA 3V6OA 1JGDB 2YRPA 5EBMB 1K5NB 1NQBA 3TO4A 2ZUQB 2EDKA 3IB4A 3OAUH 4U1KA 3IDJB 5JTWA 1J12A 1AXTH 5J0BA 3F62A 3THML 2X70A 3CD4A 1F6LL 3QIUB 3MODL 1VHPA 3BW9A 4FFVD 5LG1A 4DOHE 5I76A 4UU9B 1A6ZA 5I1IH 2Q20A 4M1GL 4YHML 5ETUB 3HG1D 5HHMB 4OCNC 3CK0H 5IHZA 1YMMD 3VH8B 3VWJC 4P5TC 2FX7H 1PBYA 4KK5D 3GSXB 4GKNB 4MD4A 3DECA 5CJ5A 4L3CA 4Z7NF 4ZQKA 1MQ8A 5JLZB 4MHHI 2A6JA 1U91A 5HVGB 4ELMA 3HNSH 2AJUL 4UZGA 5IBTL 3MV9E 5IFJB 2XY1A 2B0SH 4TSAL 2VDKH 3GIZL 4LIQH 4PJXB 1TJIH 3ZTNH 1T6WA 4GG6B 3ZYJA 1QQDA 1XIWB 4NO2B 3MLXL 4TUKL 5TQ2H 4F15B 1I4FB 1UCTA 5D1ZD 3MRIB 1GZPA 2PF6A 2R2BA 3CPLA 5FHAL 2VYRE 3KPMB 3RGVA 1ADQH 3C6LD 5CGYC 1OWWA 1UJ3A 3CFJB 5EU7C 3LQMA 2X4NA 1U8QA 3KJ4B 5IBLC 4YBLB 4PIRF 4J3TA 4J8RA 4M7JH 5HD8D 1NCCH 4W4NA 5IVNA 2HLAB 1NGQL 3VE0B 3AREC 4GRLD 4YIQB 1X6LA 4Z8FH 2E7BA 3O8XB 5E70A 1AP2B 2P5EE 5DR5L 2AJXL 1CD8A 5HYJA 1JGLL 1M71A 2GITA 4WENB 3HI5H 3I6KB 3UJIL 5BS0E 3QIWA 4WTWA 4PBVC 4D0DA 1HSBA 1QUNA 3MNWA 3P9MA 2RCSH 3FFCB 3JXAA 4YHLH 1E6OH 4ZS7H 1TJHH 1MFEL 5CEYB 4WO4C 5JPNB 1IRAY 4HIXL 3CZFA 3GRWL 3VXTA 2ZNXA 1BBDL 3E1F1 3RUGE 1UACH 1FV1B 1NMAH 2R15A 1KB9K 4JRXB 4ZUVB 4ELMF 3B43A 3JUYA 4CN1A 1VADB 2SEBA 4KKAD 1YMHB 1FYTB 4KPHL 3HG1A 1YMMA 3HB3C 2BHYA 3SPVA 4Y19A 4P2QD 1OCWL 3T2NL 5HI5C 3GBNL 5DK2A 4FQHA 2XXCB 4YDLB 4KJWD 3MJ9L 1Z3GH 1BD2D 4KUZL 4X5XB 3AU1B 2AQ1A 1MNUL 2H3NA 2BMKB 3RVXC 2ICEA 4KKLD 2X4TA 3BKML 2B1HH 4FZ8H 1JPGA 5I73C 5AAWA 4HBQA 3F5WA 5E6IC 3EYSL 4DW2L 2EIEA 3VFGH 4QRUA 2EC8A 4M00A 3D3VE 4YDKH 3C6LA 3LKPB 3BKJH 4HZLB 3EYOB 3MRFA 1IGTA 5I74B 1VFBA 1EJOL 5E8DH 3I75A 5GIRB 2QLVB 3FO0L 3N0PB 1KIRA 3HE6C 3L5WB 4GRLA 1AGCB 2XWJA 5D1XC 3O2WL 3VGFA 1RI8A 3MV7E 1FNSL 4GG8B 5JR1H 1YDPB 1IAMA 3TZVD 3MYJA 2DDQH 2CUMA 4C4KO 5LGJA 1MSPA 4NCC2 1FZJA 1UB6A 5E2VH 1RIUL 2EYRB 5TDNB 1ZGLM 3ZT7A 2EDNA 1ERNA 2VXTH 2W9EL 4NJ9L 3BJ91 1FH5L 1UENA 3DYPA 5FO9B 2AEWA 3OXSA 5JW3H 4GKOA 3G08B 2NY3C 1X5JA 3SBWA 4NWTH 1OAUL 5GGVY 3SDYH 1OPGL 4KH2A 1C08B 4YNYB 2F8XC 4NHUB 4QTHB 4XVSL 4G6FB 1WIUA 1UT9A 2W38A 1I1RA 1I1YA 1WZ1L 4RAVB 4N8VG 4XXCA 4YFDB 3WKML 4KKCD 1RSFA 3PWUB 4LKCA 3IDXL 5I1GL 5J9PB 5ESVB 4XNXL 3QQ9C 2XZCL 1ZLSL 1MVUB 2FIRT 5JXEC 5C0EB 1NMCC 2V2XB 4XWOC 4Y2DD 5F7FA 2J8OA 2NXYB 1W72A 2X70B 2UUDH 5DO2C 3Q5TA 4WI7A 4H0GA 3N06B 2DQJH 4OZHB 3U36B 3GSUA 3BQUD 3HZMA 2CK0L 3P0YH 4P2QA 4U3HA 1QO3A 1WAAE 4NNYB 1JPTH 3CVIH 5DMJB 1ES0B 4FQIH 1IMHC 4NQCE 4CW1B 1MQKL 2NY0D 3MBED 1BM3L 3MLRL 3K74B 2ZSVB 3ALWA 5ICXB 4UBDC 1BD2A 3C08L 1HQ4B 1N6VA 5EWIL 3ALPA 3VXMD 4E41B 5C6TL 2EIDA 4H0IA 3BN9D 3KLSA 4PJ7B 4PB9H 1OF2B 4ELMB 5DD1L 3EJYD 3TIDA 1U3HA 3Q5YA 4LCIH 4YZFE 4NKIL 4HXAL 4X4MA 5DJZA 2HAZA 5D8JH 1NGXA 1I3UA 3KGRA 4A2LA 5IP4A 4YEEA 1T1ZB 4S0SD 3ZKNC 3X14B 3H42L 4KROD 3QA3A 2EDWA 4RFNB 5KS9A 3ZDZE 3VFUB 5JQHC 1OAXH 4JFZL 4K23H 1AC0A 4GBXA 4UNUA 4J3SA 4XI5D 2DF3A 4XNQB 3DHMA 1ZS8B 4R0LA 3IDIA 1IKFL 2ILLA 5CFHA 4OCYH 5H37H 1CF8L 5IT2H 4MQ7A 5L2KD 3TZVA 4ZYKB 4NWUL 3FB5A 3OZ9H 3BDXA 1UH4A 4WFGD 1WTLA 4P2RE 4OFYD 5GS0C 1R24B 1SMAA 4JPVH 2VC2L 2A74B 1FLRL 1G6RB 1EUTA 5F1KC 1U8LA 2FR4A 4K3GA 4V2BA 3WFZA 1G7MB 1HSBB 5I30H 3LCYA 4RGNE 3DVFA 4L4VE 1JZ3A 4OZGE 2PW1B 3TNNA 1CDJA 2EE2A 4HDIA 3EFFB 4LPYA 4Q0XH 5EORH 3DURA 3MRBB 1HN1A 5B38A 2CJUH 4PJCF 3WFCL 4FFYL 3DYMA 1NEZG 3ULUE 1MIEL 2DQIL 2X4QA 2DD8H 1HQRB 1DLHB 5D7JC 5KSAD 2ZUUA 1EERB 3QULA 3QT2A 1AI1L 1GGYA 4KZDL 3S35L 15C8H 1N5YH 1H3UA 1Q9OB 4EDWL 3FQUA 1T1WA 5AUMA 3WE6A 1MCNA 4WCYH 1A7OH 4POYA 3SKNB 5LCVL 3QXAA 3WFHA 3N9GH 1RURH 5F7UA 1B0WA 4QRRD 3E3QE 3OPZL 4L8BB 4M7LH 2RJMA 1QFHA 4JQIL 4U6YA 1HILB 4G3YL 4K2UL 4J3WA 4ZAKC 2VN4A 4JFHD 3MBEA 1KBGH 4QHNA 3M1BB 4I0KA 4QRPE 4HFWA 2BC4B 4Q9RH 2G75B 3UBXA 4PP1D 3JWDC 2O5YH 3TJHD 5DJ0B 1ACYL 4GMSL 3OBAA 5CEZL 1ED3A 4Y5YA 3ZO0A 2CO7B 3GNML 2G2RB 4D0CA 4JAMA 2BY2A 1GC1C 4AJ0A 3EJJX 4AEHH 2XZAL 5D1ZB 5I8EB 3QIBD 4PRAA 3TN0D 2DM2A 3K4AA 4AT6B 4JM2D 4L9LB 3V5HA 4X8XA 3BP5A 4FQCL 2NY7H 1JJUA 4HG4J 1N6QH 2V5YA 2YN3A 5SWSE 1JZ7A 2G5BB 5HJ3A 3TPKA 1JP5A 4QHUA 3UTTE 5L2KA 4RNRA 4DK6A 1I8MA 3FB6B 4FNLH 4OGAD 1CLOL 4OFYA 4MXVF 1A8JH 4NUJA 5EC1B 2WNGA 2N56A 5EU5B 4KV5E 1C8PA 1WZLA 4X6EB 4UDTB 1ZWIB 2MQCA 3X12A 1CDCA 1EAPA 3EUUA 5EPMB 3GMMB 1BFOA 1HHHB 1JTOA 4OGXH 1C7SA 4I0PC 3RY6C 2CO6B 3GK8H 3H9YA 3SCMD 1OAQL 5BJTB 4WUUD 4PJFF 3VFRB 3S96A 1JNHB 2JJTC 2PW2B 5AAMA 5F96H 2RBLA 1CD0A 3IXAA 5KSAA 4X7TA 4UOW1 3O3BB 3O3EB 4OBRA 2IANE 3ZKXB 1U92B 3CX2A 4UT7L 1VFAA 1YEKH 1LK2A 1X5IA 4YHKL 1E4WL 4XCFL 1XR8B 1NAMH 4ETYA 3MLSH 1ACZA 3KYNB 4PPTA 1F3JB 4P23C 4QRRA 3CVHA 5L8KB 1XGUA 3EO9H 4XP5H 5FK9B 5CBAB 5GGVL 4F9PC 4QTIH 4PJCB 3WN5A 5C7XH 1XGTA 3MJ6A 1T89A 1QFWL 2ZKHL 4P9MH 3ARUA 4IOFC 1BMGA 4O2CB 2I9TA 4PR5A 3U4BL 5BXFB 3V6FA 1OM3L 2R2CA 5GRUL 2XKNB 3D18B 2YD1A 1YYMH 5DEGA 5L88L 1T2JA 3P9WB 4H20H 3L5JA 2OQJA 3G5YB 1KFAL 4NJAL 2GTWA 2FHFA 1ZANH 5JIPA 3MRJA 4JVUA 1JF5A 5CKAA 3PWPB 2XV6B 5D2LB 2AV1B 2N1KA 5TH2A 1I9EA 3KPSA 4LSUH 1NBQA 4N0UB 3TN0A 1MHPL 4N0YL 5F1IA 5F3HB 4WW2C 4HEPG 1G7JA 3HC4H 1GL4B 4L8DB 3GI8H 5BCAA 1BJ8A 2XZQH 1FGVL 3H0TA 1GH7A 2QQKH 1JGEA 5FO7A 5JW5A 3D48R 3TZVB 4LP5A 2XG5A 1GCFA 4XPGH 1BVLA 3FQXB 4QXGL 4D9QD 1X6NA 2HVKB 4JCLA 5A2FA 2NY1C 1OD9A 3P4MA 1H15A 4XZUB 1UM5H 4OAWB 4MB3A 4UIMA 3QDMA 2CDFA 4N0CD 3VW3H 5D6DC 4G9DA 2E6JA 1KXVC 1S7UB 5IBLD 5E08L 2WWMC 4ODTH 4G5ZH 2NR6C 1CTOA 4QWWC 5TE4L 5KJRH 1MI5D 1ZLVK 5CEZD 5D7LE 4EI6B 4F2MA 2XWBA 1ZSDA 1A6VH 4PV8B 4XVJH 5I1DB 5ANME 3PXJA 5BOPA 5MEOA 3TNMA 3MROB 3BISA 5A2LH 5EG6C 3N1QC 5JO5A 1HXMA 5FHBL 3BP7A 4R2GD 4YHIB 1MHEA 5JHLH 3G5ZA 5F1SA 3KS0J 2DQDL 4Y2DB 3AB0B 5F8QC 1S9VB 3FQUB 3ECBA 3PDDA 4LCYB 1OY3B 4YBQD 1C5CL 1I85C 3EO0A 1DQMH 1J5OL 3BQUB 3LN4B 4JFFD 1QFOA 2BSRB 3WIHL 1NCTA 4PJFB 5EOCH 5TF1L 1VCAA 2AV7B 4W6WB 5DJCA 1WCQA 1RUQL 3QCUH 1KF9B 4W70A 4JM2F 3HUJE 4YHNB 2JELL 1AGDB 1KPUB 3NACL 5AG9A 4GAFB 4PJ8A 2XKSA 3VXMB 2XN9E 4WFFE 4OB5L 3S5LA 1K3IA 5FOJA 3KYAA 1MCPH 2ZOLB 1F2QA 3GB7B 1QSFD 5IG7B 3Q3GB 2X09A 1ZHLB 1TZHA 3QXDB 4BZYA 4EOWL 1DBJL 1GVIA 3HB3D 1P5UA 3UX9B 1SBBA 1ZE3C 4EDXA 4BSWA 2VITA 2NNAA 4KROB 2CMRH 3S97C 3IS0X 2EYSA 2X7LB 4YK4C 1A2YA 4HG4K 3I3EA 3TYFA 4I13B 1EV2E 3MTRA 4IRSD 3L3HB 5GISL 5C0BA 3ULSA 4OM1H 3JSSA 2QEJA 4P4RA 1DLFL 1OOAA 1PVHA 3ZHKA 2MOVA 1X3DA 4JQVC 3MRMB 4U1NB 2ZPKH 3ARFC 3BH8A 3QB7C 4KRMB 4R7DA 3Q1SH 5KVEH 4M6NL 4DGVL 1ZVYA 4LPXA 5I18L 5E6ID 5C0CA 5TF0A 1JMXA 5KVFL 4ODSL 1LDPL 3O6FC 4D94A 5LGKA 1OARL 1UCBL 2HVJB 4R8WL 1DQLH 2APWA 3CSYB 3VFNA 4RBPH 2FEDC 1EFXB 4ZPTA 3QYCA 3MXWH 1BFOB 3QEQD 4KUCD 1DJSA 1IAIL 5J11C 5IV2A 4XP4L 1F4XL 2YA2A 5D1XD 3BRGC 3LY6A 2G9HA 3W9EB 1YYLH 3SKUD 1YY9D 1KENL 1BOGA 2FWOB 4H88L 3WXWH 4IIQA 1LD9A 3JWDL 4PJGE 2Y9RT 2BRRH 1YEHH 5ITBL 1I7ZB 2DS4A 2H1PH 4J3VA 4TUJB 1J9CT 1Y0LB 3KPNA 4K3DL 1BP3B 4XPTH 3GSVB 4JFFA 1PLGH 4U1JB 1DBKH 1AXSB 4Y16C 3RVVC 3N85H 5HHPA 1VA9A 2PTVA 2GY7B 2VL4A 4HF5L 2XKUA 5J12C 3RY4A 1JYVA 3QEUB 3QUXC 1N59B 5J3HC 5F7LB 3U0TB 2DIBA 2NY6C 3FZUD 1A9EB 3O4LB 1C16A 5ADPL 4JFOB 5JXED 1YEDA 5DS8A 5FGRA 3U9UB 4OLWL 2PXYD 3GDBA 2A6KB 1QSFA 2EECA 4FTVB 3EFDH 2D03H 3NIFF 2CR6A 4L5FH 3PWVB 3HZKB 3LHPL 1K85A 3DGGA 4D3CH 3U9PL 3QIBB 3KPRE 4FQ1L 3HCVA 4MJ6A 4NRXB 4ZFFB 3KYMA 3PDGA 2JJUA 4IRSA 5DUBA 2IBGA 4JM2B 5KW9L 5SV4A 1TVBB 2HFGL 1NFIA 3BKCH 1QVOA 5DZOA 4NC1E 2B5IC 1JFQH 3DWTA 2AKRB 4FG6C 5FO7B 4HS6A 3U1SH 3P77A 2CXKA 1LNUA 4JFDE 1NL0H 2A77L 3BP4B 3FKUS 3A6BH 1LE9B 4OZIA 1YECH 3IVKA 4XNUH 1Z9LA 4ZTPL 2JCCA 3D39E 5FCSH 3L6FB 4G9DB 1TQCC 1VGKB 3QEQA 3DUUB 5FYJH 3SGJC 1KG0A 1I75A 5IUSA 4NO3A 3SCMB 1FL5B 4KJQC 4WUUB 3WLBA 5BVJA 4GW4A 4LPWA 2ZOKA 3K81A 1HHKB 1ODAA 4XC1L 1FJ1B 4H1LA 5ALCL 4Z7WA 2UWEB 2OMBA 2VABB 2D31B 3OR7B 3HS0A 1MFCH 2R0ZL 4YAQA 3OHXB 4XXDA 4G80B 2FB4L 3MUZ1 1LO5B 4IRZH 2Q87A 4U1IA 3MRHB 4K3EL 5GQBA 4YHYB 2IG2H 5E2TH 5C0JB 3VXSA 4Y5XB 4DGYH 1Q9LB 5I6XC 5KN5B 3QPXL 3PDOA 2Y06H 4LSVH 3QCTH 1X5YA 3PWJA 4B53A 4JO4L 5EZIH 4YR6B 5TQ0L 5E1AB 3P9LB 1F4WL 4UILH 4X8JA 1FFNA 3BT2L 3C2AL 2Q7YA 5EO0A 1YN7B 3PE9A 4HJ0D 1HHJA 2WUBL 5TE7L 5C0DA 3SOBL 1E4XI 3BE1H 5DUMH 3TBWA 1XGYL 2IALA 5BO1L 1S7WA 4IRJD 4HW6A 3B2UD 3PGDB 3Q6FB 4LLMA 3VFMA 1DBMH 2HKHL 1GGBH 4M62L 3T0EC 4F33B 1KC5H 4GW5A 1XF3B 4PJAB 4WU7B 1CU4H 2C3VB 2OX5A 4MNGA 3LQZB 1DZBA 1FL3A 5E4IA 1F3DH 1AHWB 4Y0GA 4C59B 5EZOL 4TRPH 2BOBB 1YEIH 4K3JH 4WNQB 2R8SL 2FO4B 3HRZA 1FCCA 3SJVE 1IAOB 1MCQA 1JK8B 2B4CC 4KUCF 5I8OL 1J1OL 1S9XA 3BHBB 2JE8A 1JI1A 5FYJE 1MOEA 4Z7NE 4OLXL 5CUSH 5DVKA 3RHWK 4R7DB 1KACB 4Z7WF 1SYSB 3FQRA 5IW6A 1FE8H 1MFDL 3TFKC 5KVGL 3D9AL 1FGNH 1NSNL 1G0DA 4FN0A 1LEGB 4ISVB 4B7IA 2PYEE 2EH7L 1Z5LA 2QTEA 3QO1A 5BV7C 3SO5A 1HXYB 3S3JA 3H3PL 3RWEA 3LN5A 5MHSE 2VLRE 1UA6L 3QFJB 3DX6B 1JVKA 3U46B 4Z7QF 1X5FA 1MI5B 1UKQA 4DN3H 5T1KD 3L5XL 3AREB 3QJHA 1RJCA 3KLAA 3MLWH 2NY2C 1S7XA 1R3JA 5EC2A 4DN4L 4PRNA 1I8IB 2EDJA 1XF5A 5L9DL 3V6OE 4N68A 4Z7VA 3MMEA 3K8LA 1NJ9B 2JLLA 2X41A 5BMFH 4ORGB 5AYUH 3U4AA 3MRLA 1MLCB 5IEHA 4HLZH 3W0WD 3A67H 1NC2B 1YEFH 2WBJD 4I0PD 3OMZA 1R5WA 3K8MA 5CZXC 3QQNA 1YY8A 1OAYL 2J7LA 2V7HB 4OIIL 2IMNA 4LEXL 4WO4B 5D6CA 1CCZA 5EOQH 4LSDA 3WS6A 1XEDA 3O6LL 4OM0H 2VRAA 3ARWA 5DDHA 1KJVB 3C5JA 1YEGL 3QHZH 4PRDA 5T3XH 1OGAA 4ZTOH 1QA9A 3EJZD 3O6KH 3IDMB 2FYYB 2Y5TA 3IDYC 3F7QA 3Q0HA 1ND0B 1KIUA 2CSPA 4WFED 4WGWB 3HPLA 4G6ML 5T5NF 2J3SA 4MVBD 5D72H 3CC5A 1UZ8A 3EZJB 1BJ1J 4UMGA 3F6IA 4P48A 5GHWH 3SDAD 2C3XA 4I9WD 5IHLB 3T04D 5J06A 4XGZB 5ESAA 1A1NB 5H94A 4YWGH 3P4NB 2HMID 1A6AA 1RIHH 3MGOB 1IKNC 1CZ8H 1SM3L 1LDSA 1E27B 1W8OA 2IQAA 1JWUA 4K7PY 5KBNC 3IJSA 5B8CC 4JZJA 3WNPA 1KPRB 3FO2A 2E27H 3RKDD 2YPVH 2VUYA 3K0WA 3RNKA 3SE8H 3LPWA 3KPTA 1R3IL 5DJ8A 4NN5C 4LCCA 3SKOB 2PUQT 4NSKA 2QL1A 5I73B 1XF4A 3CLEL 4IS6B 5E6IB 1NCBH 3T3MF 1P4BH 5CSZB 4CVXA 1NCWL 1A6PA 1JI2A 4NBXB 4Z7VF 3TT3H 5ADOL 3DO7B 3UPCA 1M7XA 4MX7B 1KTRL 5HHNB 4CMMB 1KJ2H 1RUMH 3NIGE 4YDVB 4NQTA 2I24N 3C2SA 4U6XB 4HIIB 1WISA 2Y6SC 4P49A 4LAQH 3NCEB 3B9VA 5HYJE 3T2QA 1EEYA 4HK0A 1NCNA 3LEVH 3HE6B 5T1KA 2UZXB 1IBGL 4RGOL 5D1XB 2R2EA 1F4YH 4I48B 3BGFC 1OSPL 5B3JF 3DMMA 2Y36H 4P4KA 2P46B 2X9YA 3RWDB 1CLCA 1CQYA 3H9ZA 2ZNWA 4JY5L 1A5FH 1U36A 5DVLA 2WBWB 5E2UL 2GSGA 3QNXA 43CAA 1P1ZA 2A1WL 2CLZA 4O2FB 2FZ3A 1IC5L 2NY3B 3W0WA 2M2DA 5H35B 2WWMD 3UO1H 1KYOJ 2P7TA 3PQYD 4RMVA 3INUL 5EBWB 1FG9C 2CDEB 4LLQA 1MFNA 1XGQB 1YPZA 5JW4M 4F7TA 4NZUH 1R0AH 2DIAA 4CU7A 1G9MH 3HG1E 1YMME 3NFNA 4Y19E 4I18C 2IH3A 1Q0XL 3HNTL 3QWQB 5DSCB 1NMCB 4HH9A 1JWMB 5KANG 3T0BA 5SWZD 1JGVH 4I2XB 4MAYC 3OQ3B 5CBEB 2PXYB 3OSKA 4F8TA 1OLLA 1W72H 3NVQA 1GIGH 4XHQA 3DV6A 4LLMB 1RUAL 4DUWA 5I8KH 3SDAA 5I1EL 3C60D 1E4KA 2AEQH 5CJQH 2K7QA 5IVXA 3VMOA 3F65A 1FNGA 4K9EH 4P0DA 3MLTA 3DX8A 4J6RH 2JK5A 4WTXA 1MCRA 1MUJB 4HXBL 2W0FB 5BZWB 3I6GA 1AKJD 1WWWX 1UXSB 3HAEB 4XC3L 4Z5RB 3B5GA 4I4WA 4GKZA 3VA6A 2KDGA 1B9ZA 2ZUYA 4S10A 4G6KL 1DE4B 2FGZA 2YC1A 4KKNA 4W4OA 1IT9H 1MRFL 2OL3H 5IFHH 1GAFL 1ZA3A 4G9FB 4UV7L 3FO9B 3O45B 2WP3T 4M6OH 2EICA 1HH6B 5DWUH 1XGRB 1KXTB 2CIKB 3IJYA 4JO1H 2BFVH 1FFPB 3V0VA 1UWXH 3EO1B 5E03A 3I50L 1T21A 1B4JH 2MKWA 1ORQB 3ARFD 5I0ZA 2V2TA 2E7MA 3WFBL 4U6VL 1AD0B 4ZO7A 4PLNC 4PJ5A 1GSMA 2ERJC 1KIPA 3OKEA 1FIGL 1TZIA 5C0NC 4KDTC 4AG4H 4OTXH 1IQDB 1QOKA 3V7MA 4S1QL 5IMLA 2F58H 4IBLT 1MJ7L 5D5MB 4BSVA 3FHQA 4WIQA 2V7NB 4TOYL 1FL6A 5KOMC 1I7TA 5IB4A 1ZHBA 3L3KB 4GH7B 1MIMH 3MBXL 1HKLL 8CGTA 1JE6A 1X5AA 4RISL 4YO0A 5KANI 2YOCA 3TH2T 2C3GA 1NFDF 5JQ6H 3K1DA 5IVXF 5DHYB 4NKDB 1T66C 4P2QE 5IB2A 1P6FA 1L0QA 5SWZA 3VFSB 2VLMD 1WBXB 2R4RH 2YD9A 4LVNC 1XGPB 3NA9H 4PRHA 4LLDB 3KR3H 2AJZB 3BEWA 2Z4QB 4P2CG 1X4YA 3HRPA 2VXUL 1BD2E 3LQAL 1LO4L 4QF1A 4IRJB 3CLFL 2ED8A 3MRDA 4N0FA 4R26H 5C09B 2X4UA 1AR1D 3V52L 2EH8H 2CQVA 4ZAKB 5F1NB 2FSEB 4M02A 1W0YT 4JKWA 1RJZA 4OUOA 4HT1L 5JIKA 3QUXD 4X4ME 4Q9QH 3AXLB 2FECL 2VDOH 3NPZB 4KTDL 5DZLA 3EOAB 4QT5A 1SJEA 4NQUA 4X0KB 6FABL 3VXOB 1AKJA 1S9YA 5KS9E 4MSWA 4NRZB 2FJFA 3P0VH 4XMLL 3RNKB 4P3DA 4G8FB 2NZ9C 3BVNB 4NZDA 3FRPG 5GSRA 4F57H 3DSFH 4MCZB 3ZYIA 5E5MA 3B3IA 1U3YA 4XCCH 2A38A 4KQ4L 4PLJD 4MA8H 1AFVH 3WYRA 1MFAH 3AVEA 1D6VL 2P24A 3VD3A 1IGYB 1PX4A 2X1WL 2EDQA 1CFVH 1D5ZB 4LSRH 2YZ8A 1G7PB 4FXLA 4OLEA 1FSKC 4GW1A 1P4IL 4JJHA 4K7PL 1NCAH 1S8DA 4JGMA 4HIEA 3GMQA 3BPCA 4OF5A 4PFEA 3TWCH 2DQEL 1T7ZA 3SGKC 5KVMC 4LEOB 2H26A 5F8RC 2VXQL 3MRNA 3T3PF 2ZG3A 1L6ZA 4R4NC 2R0LL 1T2QL 1KYOK 4MXVE 4U1MB 3RP1A 4P2OD 1WZKA 2ATPB 5L2JA 3D69B 2Y07H 2WBJB 4I0PB 5GGTA 2NCMA 2P7TB 3A6OA 4Z77B 1K4DA 4FZEL 2NW3A 3HPJA 1RUKL 4Z9KB 3QUML 3WCYA 3EW3B 3VXRA 3H8NA 4U1LA 3L3OA 3F6LA 5DMKA 4TVSa 1GGTA 2H6PB 2HJFA 5I1LA 3EOTL 1HYSC 4ODVL