2G7BA

Crystal structure of the r132k:r111l:l121e mutant of cellular retinoic acid binding protein type ii in complex with all-trans-retinal at 1.18 angstroms resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
137
structure length
137
Chain Sequence
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGELIETMTADDVVCTKVYVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular retinoic acid-binding protein 2
publication title Protein design: reengineering cellular retinoic acid binding protein II into a rhodopsin protein mimic.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 38
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2g7bA00
2F73A 2N93A 1KOIA 1VYGA 1SXYA 5C0NA 1ZNGA 4QGWA 2GTFX 4WFVA 2L5PA 2BLGA 3VG4A 4LKTA 4A8ZA 3UEVA 4GRJA 2XSTA 2MO5A 1GT3A 1I06A 2QO4A 3D95A 1BRPA 1GT5A 4DQ4A 3IFBA 5EPQA 3ELXA 1BSYA 4TKJA 2LKKA 3FIQA 4TKBA 1DZKA 3BU9A 4IB9A 1I4UA 1AQBA 5EDCA 1ZNEA 1CBSA 2AT0X 2X46A 2XKLA 4QGXA 1LIDA 3P6CA 3UEUA 4N7DA 2NNEA 3KQ0A 2PY1A 4QAEA 4AZRA 5HZ9A 3FR5A 1HMTA 1TOUA 3APUA 5D8JA 1FELA 4XMGA 3FEPA 3KFIA 1VPRA 2JU7A 5LJGA 1YP6A 2R74A 1GXAA 1KT7A 5F6ZA 3BS2A 1TW4A 4IAWA 3BSZE 3NX2A 3FLLA 2Q39A 2JU3A 1IW2A 1GX9A 3NP1A 4HPCA 5DPQA 3KFFA 1DFVA 1DV9A 1KZWA 2P8GA 4QYPA 3WJDA 4GNWA 1MX8A 1KQWA 2NNDA 4IMOA 4AW8A 2IFBA 4EDEA 1XKIA 1D2UA 4CK4A 1XCAA 2AT5X 4GNYA 2W2FA 1FEMA 3FELA 2Q2PA 3TGAA 3FEKA 3O19A 3P6EA 2FS7A 4PSQA 2A2GA 3TGCA 1KT3A 1LNMA 1ALBA 4WBKA 5HZ6A 3NR3A 4ORYA 5KICA 1X89A 3JS1A 3G7XA 2RQ0A 3AKNA 3F9DA 1EPAA 5FFHA 1SXWA 4ZHCA 1MDCA 2WEXA 3STKA 5K06A 5FAZA 1KQXA 1TVQA 5B29A 4ODDA 2K62A 4ORRA 3FA8A 1NP4A 4A60A 2Q9SA 3CQRA 1YUPA 4LKPA 2QO6A 1Z24A 3WJEA 3MBTA 2CZTA 4O9SA 4BVMA 1KT5A 3RZYA 1EALA 5LJCA 2MM3A 2NNQA 3SAOA 5HCCC 1HQPA 3JSQA 1QFVA 4ARHA 1X8OA 1QY1A 3FA6A 1SY1A 1T68X 3BY0A 3BX8A 4OS3A 4TLJA 5LJBA 4EXZA 4YCHA 2W2AA 4D6AA 4YFQA 1ZNDA 4I3CA 3CBCA 1I05A 3FMZA 1JYDA 4XMEA 1QG5A 3UEWA 1SY0A 1U0XA 4ORXA 1GT4A 4AZNA 4LZUA 3K3LA 2WWPA 4NLJA 4IB7A 4QZTA 1OEEA 1SXXA 1ZNKA 4MVLA 3PECA 1DZPA 3AKMA 3TF6A 1U18A 5LJEA 5EEDA 1CRBA 3I0AA 4NP1A 3D96A 3WJCA 2FS6A 2CBSA 3KFHA 1YWAA 3FENA 4HPAA 3VG6A 1KT6A 5JR8A 2L67A 2RCTA 1X71A 1UREA 3CWKA 1EIOA 2OFRX 4DQ3A 2K23A 4YFPA 4AZOA 4IBAA 1EQDA 5HCDC 1ICMA 1AVGI 2G7BA 3B2KA 4N7CA 5H9LA 1OEKA 1YIVA 2WQ9A 3WBGA 1DF3A 5DG4A 2AT8X 4AYHA 1H91A 1OPAA 4NNTA 1KGLA 4OMXA 3FW5A 1G7NA 2GJ5A 5KHPA 1O1VA 2GC9A 4K19A 2CM4A 2CBRA 1YWBA 2L9CA 1ACDA 4RUNA 1I04A 3HWFA 1BM5A 3TZSA 2POAA 1OBUA 1CJ5A 3U03A 1GKAB 3ZUOA 3P6GA 1DZJA 4BOEA 5HZQA 3HWDA 1N0SA 1P6PA 4YH0A 5D47A 5D4AA 1B56A 3IA8A 1OPBA 5HWZA 1S7DA 1JJJA 1ZNLA 1BSQA 4I3BA 3CBSA 5IO6A 2QO5A 2HMBA 1GGLA 4OS8A 1G74A 4NNSA 5IO5A 1X8QA 1OEJA 1SXUA 4ALBA 1HMSA 1MVGA 1TXLA 2ACOA 3KZAA 4QZUA 4ALOA 3RSWA 2FR3A 5HZ5A 2OVDA 3APXA 4A1HA 1YWDA 3BU1A 2CZUA 3NQ9A 2E4JA 5HTDA 1R0UA 1SY3A 1BRQA 5D48A 4ZH6A 5H9KA 3EM0A 1E02A 1G5WA 1T0VA 3PH6A 4GH7A 4UU2A 3NQ3A 2JU8A 2ACPX 3PH5A 4YBPA 2O62A 4IMNA 1IKEA 1ICNA 4XMFA 1TOWA 2KTDA 4BQUA 4M7MA 3P6FA 3NX1A 5IO7A 2LB6A 4Y0RA 4YDAA 4TKHA 2HLVA 5F7GA 4MVIA 1LIEA 2WUTA 1LKEA 1X8UA 1NGLA 3CQNA 2AL0X 4I3DA 3ZQ3A 1BWYA 3I17A 2FLJA 3WJGA 3FW4A 5AQ6A 5BVSA 1RLBE 1HBPA 1EXSA 3NPOA 3C77X 3P6DA 4GKCA 4R0BA 5HBSA 3EBWA 3FR4A 1UZ2X 1IIUA 4I9SA 4IB8A 2OVAA 3P6HA 4NYQA 4QYNA 3FR2A 5HA0A 1GX8A 2AKQA 1LIFA 2MJIA 4ZHHA 3HWEA 1MX7A 2OZQA 2WQAE 3B2HA 3PPTA 3U9PC 1PBOA 4A1YA 5HZ8A 1BBPA 1QFTA 3GAQA 2A2UA 4QGVA 2L68A 4ZCBA 1GT1A 3B2JA 4KIIA 1A3YA 5EDBA 1GM6A 4EFGA 5KIDA 4YKMA 2HZRA 1A57A 3FA9A 5HCEC 5H9NA 2Q2MA 3CMPA 4ORUA 1ADLA 3QKGA 3BLGA 1RBPA 1KT4A 1G85A 1B0OA 4GETA 1JZUA 4XMCA 1PM1X 3U0DA 2OVEA 3UEXA 3VG7A 2CM9A 1FE3A 1B4MA 2A3FX 2WR6A 1BJ7A 1QQSA 2LBVA 4GE1A 2WSJA 3ZUIA 5H8TA 3STNA 3C78X 3D97A 1DZMA 3OJYC 5FENA 1EUOA 4ZH9A 3ELZA 1IKJA 1IFBA 2AT3X 3B2IA 5BVQA 3WJFA 4ZFXA 4Y0QA 1QWDA 3DSZA 2A0AA 5HA1A 5LJHA 5LKFA 4ZGUA 4XMHA 5H9AA 4OMWA 4YGZA 4ZHGA 3B2LA 1YWCA 2X45A 3C76X 1EPBA 1D3SA 1O8VA 2QOSC 1KZXA 3O2YA 1NP1A 4IB6A 5L8NA 1LF7A 1E00A 2QM9A 3APWA 2HZQA 2LBAA 5BVTA 1FDQA 3WXQA 4LZVA 1ZNHA 3PEDA 1L6MA 1S44A 1B8EA 1X8NA 5D45A 5F58A 4AZPA 4TNNA 2ASNX 2A13A 1JYJA 3BDRA 3S26A 4AZQA 4IAXA 1GKAA 4YCEA 3T1DA 2OFMX 4HFOA 1U17A 2JOZA 3PP6A 2RA6A 4ZJ0A 2EU7X 4D6BA 1KXOA 3Q6LA 1ERBA 4UU3A 2WEWA 1JBHA 1HBQA 1OBQA 4YBUA 2ANSA 2JN3A 5HAEA 3FA7A 3HK1A 1IFCA 1QABE 2ALLX 2HNXA 1LFOA 1SY2A 1MUPA 1PMPA 4Y0SA 2AT6X 4YGHA 4TJZA 1A18A 4YMYA 2R73A 4HPDA 3HWGA 1QY2A 1LICA 3CR6A 5HTEA 2LFOA 3NADA 3APVA 4EEJA 1EIIA 4Y0PA 1HMRA 5LKEA 3MVFA 1ZRYA 1JJXA 1BSOA 1BEBA 2FR2A 4HPBA 2FT9A 4XMDA 5EZ2A 1DC9A 5F1EA 1CBQA 4I9RA 1QY0A 4NYRA 3O22A 3EBKA 4YKOA 1E5PA 5EEEA 5LJDA 5CE4A 2KT4B 3WJBA 1S2PA 1ERXA 2FTBA 4TQ2A 3L4RA 4OS0A 1PEEA 1SA8A 2FWVA 5L8IA 2G78A 4ES7A 4ZR2A 2G79A 3VG2A 3VG3A 1JV4A 2FRSA 3WVMA 2W2BA 3VG5A 2R56A 4WFUA 3F8AA 1O1UA 5B27A 1A2DA 2AMMX 1HN2A 1LPJA 4NLIA 4RUUA 2Q4NA 4YDBA 1T8VA 1CBRA 1YP7A 3BX7A 1BLRA 2HYSA 3TGBA 1CBIA 1X8PA 2DM5A 1ML7A 3EMMA 3KFGA 3STMX 4ORWA 1LIBA 5LJKA 4ORSA 1AB0A 4MVKA 1OBPA 1AELA 3EYCA 1FTPA 1FENA 5F6BA 4ZHFA 2RD7C 1EW3A 2YG2A 4ZHDA 2RCQA 3BRNA 1VYFA 4YGGA 1E06A 4AZMA 2AH7X 4YFRA 4M6SA 5L8OA 2NP1A 3DTQA
chains in the Genus database with same CATH superfamily
2F73A 2IZIA 2N93A 2VFBA 1KOIA 1VYGA 1SXYA 5C0NA 1ZNGA 4IABA 1SWCA 2GTFX 4QGWA 2Z4IA 4WFVA 2L5PA 2BLGA 3VG4A 4LKTA 4U9CA 4A8ZA 4C5PA 3UEVA 3HTYA 2XSTA 4GRJA 5B11O 4BJ8A 4O49A 2MO5A 1GT3A 2AF5A 1I06A 2QO4A 3D95A 1BRPA 1GT5A 2AVIA 4DQ4A 3LHNA 3IFBA 1MK5A 3ELXA 5EPQA 1BSYA 4TKJA 2LKKA 3FIQA 4TKBA 1DZKA 3BU9A 4IB9A 1I4UA 4U8UO 5K68A 1AQBA 5EDCA 1ZNEA 1CBSA 2AT0X 2X46A 2XKLA 4QGXA 1LIDA 3P6CA 3UEUA 4Z6JA 1VWOB 4N7DA 2NNEA 3KQ0A 4KH8A 2PY1A 4GGZA 1W5RA 4QAEA 1VYOA 1SWKA 3VHIA 4AZRA 3FR5A 4FBVA 5HZ9A 1HMTA 1TOUA 3APUA 5D8JA 1FELA 5CYBA 4CDCA 4XMGA 3FEPA 1JMZA 3KFIA 1VPRA 2JU7A 5LJGA 3VPJE 1YP6A 2R74A 1GXAA 1KT7A 1VWNB 1Y53X 4QNIA 4Y59A 3BS2A 5F6ZA 1NQNA 3RKGA 1TW4A 2DJGA 4IAWA 1NDJA 3BSZE 2OL6O 3WYPA 2RTIB 3NX2A 3FLLA 3EW2A 3RE6A 4EKVA 2Q39A 2JU3A 1IW2A 1GX9A 2RTPB 3NP1A 4HPCA 5DPQA 3KFFA 1DFVA 3RY2A 1DV9A 4JGLA 1KZWA 2P8GA 4QYPA 3HOEA 3WJDA 4GNWA 4U46A 2GTLO 1MX8A 4CDDA 1KQWA 2NNDA 2ZAIA 1SWTA 2IFBA 1VWGB 4IMOA 1XKIA 1D2UA 2C1SA 1XCAA 4U8UN 2AT5X 4GNYA 2RTDB 2W2FA 4CK4A 4ID2A 4GK9A 3RDXA 2DJFA 3VE1A 1FEMA 2IZFB 1K3BA 2Q2PA 2RTNB 3FELA 3TGAA 3FEKA 3O19A 2A5CA 3P6EA 1SRIA 2FS7A 4PSQA 4KCAA 3CKFA 4JNJA 2KTSA 2A2GA 5JD2A 1KT3A 3TGCA 1LNMA 1ALBA 4WBKA 5HZ6A 3NR3A 4BX7B 4ORYA 3WJCA 4CSBA 5KICA 1X89A 3JS1A 4GGRA 3G7XA 3VU1A 2RQ0A 1EI5A 4CPIA 1W6FA 3AKNA 1EPAA 3F9DA 3FYFA 1SXWA 2X8FA 5FFHA 2IZBA 4ZHCA 1MDCA 2QCBA 2WEXA 3PDFA 3STKA 5FAZA 1KQXA 2OY1O 5K06A 2JGSA 1TVQA 2RTRB 4WHIA 5B29A 4ODDA 2K62A 4ORRA 3FA8A 2VFCA 1NP4A 4A60A 2Q9SA 3CQRA 1YUPA 4LKPA 2QO6A 1Z24A 3WJEA 1JIWI 3RDQA 3MBTA 1NBXA 2CZTA 4O9SA 4BVMA 4BX7A 1KT5A 3RZYA 1EALA 1Y55X 5LJCA 2MM3A 2NNQA 3SAOA 5HCCC 1HQPA 3JSQA 5AEOA 4LQZA 2OVSA 5IRAA 4GUZA 5L3YA 1QFVA 4ARHA 1KFFA 1QY1A 1X8OA 2BC3A 4GJSA 3FA6A 1SY1A 1T68X 2MHDA 3BX8A 3BY0A 4OS3A 4TLJA 5LJBA 4EXZA 4YCHA 4COTA 2W2AA 4D6AA 4YFQA 1ZNDA 2BT9A 4I3CA 3CBCA 4AW8A 1I05A 2RTGB 1JYDA 3FMZA 4XMEA 1QG5A 3UEWA 3FDCA 1SY0A 4B55A 4BCSA 3ZZVA 1U0XA 3S5VA 2RTQB 4ORXA 1SWNA 1GT4A 2JMBA 3WZNA 4AZNA 4LZUA 3CKGA 2WPUA 3K3LA 1UYOX 2WWPA 1MOYA 4NLJA 2X34A 4IB7A 4QZTA 1OEEA 4O3WA 4CDFA 3S60A 1WBIA 3H3IA 1SXXA 1ZNKA 4MVLA 2RTOB 3PECA 1DZPA 3AKMA 1VWJB 3TF6A 4I60A 1U18A 5IRUA 5LJEA 5EEDA 1CRBA 3AEHA 3I0AA 3PQUA 1SREA 3D96A 4NP1A 2FS6A 2CBSA 3KFHA 3MX7A 1YWAA 2RTMA 3FENA 2FGSA 1KT6A 3P02A 4HPAA 5CSEA 3VG6A 2Y3FA 4BX5A 3SLOA 3LTWA 5JR8A 4CDEA 2L67A 2RCTA 1SRFA 1X71A 3VHHA 4Z2VA 1VWIB 1UREA 3CWKA 1I9HA 2UZ2A 2OFRX 4DQ3A 4FBRA 1EIOA 2IZEB 2K23A 4YFPA 4AZOA 4IBAA 1EQDA 5HCDC 1JMXA 1ICMA 1STPA 1AVGI 4KC7A 2G7BA 3EC5A 3B2KA 4N7CA 5H9LA 1OEKA 1YIVA 2WQ9A 3WBGA 4CV7A 1DF3A 5DG4A 2AT8X 1SRHA 4AYHA 1H91A 5FQ6E 4L3RA 4O4SA 1OPAA 2HKDA 2CAMA 1PTSA 2YMSA 4NNTA 3WZOA 4O3XB 4FBOA 1KGLA 2OFBA 4OMXA 1AVEA 5B5GA 1I78A 1G7NA 2GJ5A 3FW5A 2GTLN 5KHPA 2OFAA 3ZW0A 1O1VA 2GC9A 1LUQA 4K19A 2CM4A 2CBRA 1YWBA 2L9CA 1ACDA 4RUNA 4Z28A 1I04A 3HWFA 4NV7A 2X55A 3SOTA 1BM5A 3TZSA 2POAA 1OBUA 1CJ5A 3U03A 1GKAB 2BSZA 2OL8O 3P6GA 3ZUOA 1DZJA 4BOEA 1MM9A 5HZQA 4KC8A 4BBOA 2RTAA 3HWDA 1N0SA 2FKGA 3RDMA 1P6PA 1VWPB 4YH0A 3ZW1B 1HY2A 5D47A 1VWEB 1JQPA 5D4AA 3OD9A 1B56A 4O4XA 3V8UA 3IA8A 1OPBA 2RTEB 5HWZA 2X8TA 1SWEA 1S7DA 4IRWA 1JJJA 1ZNLA 1BSQA 4I3BA 1SWBA 3CBSA 5IO6A 3UAQA 2RTKA 2QO5A 2HMBA 1GGLA 2IZAA 4NW4A 4OS8A 1G74A 4NNSA 4Y5DA 5IO5A 1SLGB 1X8QA 1OEJA 1SXUA 4U8UM 4GGTA 2F09A 4ALBA 1HMSA 1MVGA 1TXLA 5BVSA 2ACOA 3KZAA 4QZUA 4ALOA 3RSWA 1DF8A 2FR3A 5HZ5A 2OVDA 1KL3A 3APXA 4A1HA 1YWDA 3BU1A 4OEMA 2CZUA 3NQ9A 2E4JA 3QQ2A 1VWKB 1R0UA 5HTDA 1SY3A 1BRQA 3JQOA 5D48A 4ZH6A 5H9KA 2IZDB 3EM0A 1E02A 1G5WA 1T0VA 3PH6A 4GH7A 2FHNX 3SLTA 4GZVA 4UU2A 3NQ3A 4JO6A 1SLEB 2JU8A 2ACPX 3PH5A 4YBPA 2O62A 4IMNA 5BYPA 1IKEA 1ICNA 4XMFA 1TOWA 2A5BA 2KTDA 3F6ZB 2IZGB 2UYWA 4M7MA 4BQUA 3P6FA 3NX1A 5IO7A 2G5LA 2LB6A 4Y0RA 4YDAA 4TKHA 2HLVA 5F7GA 4MVIA 3RBYA 2FKJA 1LIEA 2WUTA 1LKEA 1SWOA 1X8UA 1NGLA 2GTLM 4EDEA 3ZWEA 3CQNA 2AL0X 4I3DA 3ZQ3A 1BWYA 1STRB 3I17A 2FLJA 1UYNX 3WJGA 3FW4A 5IRWA 3SZHA 1VWFB 1VWCB 1RLBE 2I5ZO 1HBPA 2BS6A 5AQ6A 2BHVA 5B2AO 1EXSA 3NPOA 3C77X 3P6DA 4GKCA 4R0BA 5FQ8E 3EBWA 5HBSA 4L1NA 3WZPA 3KVNA 3FR4A 1VWMB 1UZ2X 1IIUA 4I9SA 1RSUB 4IB8A 2OVAA 3P6HA 4GU8A 4NYQA 4CPFA 4QYNA 4CPHB 3FR2A 5HA0A 1SWQA 4GDAA 2ZAGA 1GX8A 2C4IA 2AKQA 1LDOA 2GH7A 1LIFA 1K24A 2MJIA 4ZHHA 3HWEA 3RWXA 2QOMA 3PK2A 2X56A 2X4MA 1MX7A 2OZQA 1SWUA 2WQAE 3B2HA 3PPTA 4YVBA 3U9PC 1PBOA 4A1YA 5HZ8A 1BBPA 1QFTA 3GAQA 2A2UA 4QGVA 5AJCA 4O4OA 3MG5A 2OL7A 4CPHA 1N9MA 2L68A 2Z4HA 1GT1A 1IJ8A 4ZCBA 4INNA 4CPEA 3B2JA 4KIIA 1A3YA 1SLFB 1SWHA 5EDBA 1GM6A 4EFGA 5KIDA 4NV8A 4YKMA 2HZRA 3D4RA 3FA9A 1A57A 1SWSA 2C1QA 5F2BA 5HCEC 4MEEA 5H9NA 4MVEA 2Q2MA 3CMPA 4ORUA 1GX3A 3VE2A 4BX6B 1ADLA 3QKGA 1SRJA 3BLGA 1SWRA 1RBPA 1SWAA 1KT4A 4ES7A 1G85A 1B0OA 2OF9A 4GETA 3S5XA 1LELA 1JZUA 1KL5A 1PM1X 4XMCA 3U0DA 2OVEA 2PI3O 4MIRA 5CHKA 3UEXA 3VG7A 4Z2PA 2CM9A 1FE3A 1B4MA 3E3CA 2A3FX 3HPEA 5AJBA 2MF6A 2WR6A 4MISA 1BJ7A 2BS5A 4OKAA 3ZW2A 1QQSA 2LBVA 1RXJA 4GE1A 2RTHB 1PBYA 2MWHA 2WSJA 3ZUIA 5H8TA 3STNA 2RTLA 3C78X 1NC9A 1VWDB 2FHLA 3D97A 1DZMA 4OELA 3OJYC 5FENA 4BX6A 1EUOA 4ZH9A 3ELZA 1IKJA 1E2TA 1IFBA 2AT3X 3B2IA 5BVQA 4O4UA 3WJFA 4ZFXA 3WYQA 4Y0QA 1QWDA 3DSZA 2A0AA 5HA1A 5LJHA 5LKFA 4ZGUA 4XMHA 4DCBA 5H9AA 4OMWA 4YGZA 4ZHGA 3B2LA 1YWCA 2X45A 3C76X 1EPBA 1D3SA 4DNEA 3FIDA 1Y9TA 1O8VA 2QOSC 3X00A 3O2YA 4ZGFA 4O3ZA 1KZXA 1NP1A 1VWLB 4IB6A 1SWFA 3RDUA 5L8NA 1SWGA 1LF7A 1E00A 2QMIA 2QM9A 1VWQB 3APWA 4BGFA 2HZQA 2LBAA 2RTCB 5BVTA 1FDQA 1FJ1E 2IZCB 3OBLA 4GDZA 4LZVA 3WXQA 3RDOA 1ZNHA 3PEDA 1L6MA 2RTBB 1S44A 1B8EA 1X8NA 3HOLA 5D45A 5F58A 4AZPA 4TNNA 1VWAB 2ASNX 4QRLA 4I6SA 1MEPA 2A13A 1JYJA 2A8GA 2KW1A 3BDRA 3S26A 4AZQA 4IAXA 1GKAA 4YCEA 3ZI8A 3T1DA 2OFMX 4HFOA 1U17A 1SWDA 1Y0GA 2JOZA 2RTJA 3PP6A 3SZIA 2RA6A 4ZJ0A 4GJVA 2EU7X 2JW1A 3EW1A 1KXOA 1LCVA 3Q6LA 4D6BA 1ERBA 3ZW1A 4UU3A 2WEWA 4U3QA 1JBHA 1HBQA 2ZSCA 2RTFB 1W4TA 1LCWA 1OBQA 4YBUA 2ANSA 2JN3A 5HAEA 3LV4A 1VWHB 3FA7A 3HK1A 1IFCA 4JHQA 1QABE 2ALLX 2HNXA 3PQSA 1LFOA 3NBXX 1SY2A 4I95A 2F01A 3OE3A 1MUPA 1PMPA 1Y9LA 3NQKA 1RXKA 4Y0SA 1VWRB 2AT6X 4YGHA 4TJZA 1A18A 1AVDA 1OSPO 2R73A 4YMYA 4HPDA 3HWGA 2OF8A 1QY2A 1LICA 3CR6A 5HTEA 2IZLB 2OYBO 2LFOA 3NADA 4KT5A 1Y52X 2OY8A 4QQ1A 1N43A 4O3YA 2OY7A 3APVA 4EEJA 1EIIA 4Y0PA 1HMRA 2G8CO 5LKEA 1HXLA 3RDSA 1KL4A 3MM0A 3MVFA 1ZRYA 2Y32A 3Q34A 1JJXA 1BSOA 1BEBA 4Z27A 3RE5A 2FR2A 3T2WA 4HPBA 3WZQA 2FT9A 4XMDA 5EZ2A 1SWLA 1NQMA 2OY5O 1DC9A 1STSB 5F1EA 1CBQA 3AUMO 1QY0A 4I9RA 3O22A 4NYRA 4Z2OA 4FGIB 3VHMA 3EBKA 4YKOA 4PJ2A 1E5PA 5EEEA 3GE2A 5LJDA 5CE4A 2KT4B 2VDFA 3WJBA 1S2PA 1SRGA 1ERXA 1LDQA 3P24A 2FTBA 4TQ2A 1SWJA 2X32A 3L4RA 2IZHB 4OS0A 1PEEA 1SA8A 2FWVA 1VWBB 5L8IA 5K67A 2G78A 2RN4A 3N91A 2KD2A 4ZR2A 1RXHA 5B10O 2G79A 3RY1A 3VG2A 3VG3A 1JV4A 2FRSA 3WVMA 2W2BA 4GD9A 2R56A 4WFUA 3VG5A 3F8AA 4ML7B 1O1UA 5B27A 2M4LA 1SMPI 3SZJA 1N4JA 1A2DA 2AMMX 1HN2A 1LPJA 4NLIA 2X8SA 2Q4NA 4RUUA 3WOVA 3T6LA 5FQ7E 3VGWA 1HQQA 1SLDB 1RSTB 1T8VA 4YDBA 5B3MO 1CBRA 1N7YA 1YP7A 3BX7A 3T2XA 1BLRA 2HYSA 2Y3EA 4FQBB 3TGBA 1CBIA 3ZW0B 1X8PA 1WUBA 2DM5A 1ML7A 2IZKA 3EMMA 3T6FA 4BX5B 5IXGA 2LA7A 3KFGA 1N9YA 3STMX 4ORWA 1LIBA 5LJKA 4ORSA 1AB0A 4MVKA 1OBPA 2IZJA 1AELA 3EYCA 1FTPA 1FENA 5F6BA 4ZHFA 4EQAC 2RD7C 1SWPA 1EW3A 3SLJA 2YG2A 4HWMA 2RCQA 1JJUA 3D9WA 3BRNA 2I5VO 1VYFA 4ON1A 4ZHDA 4YGGA 1E06A 4AZMA 2AH7X 4YFRA 5B5FA 1HXZA 4M6SA 5L8OA 1RAVA 2NP1A 3DTQA 1LCZA
chains in the Genus database with same CATH topology
2F73A 2N93A 1KOIA 1VYGA 1SXYA 5C0NA 1ZNGA 4IABA 4QGWA 2GTFX 2Z4IA 4WFVA 2L5PA 2BLGA 3VG4A 4LKTA 4U9CA 4A8ZA 3UEVA 3HTYA 2XSTA 4GRJA 4O49A 2MO5A 1GT3A 1I06A 2QO4A 3D95A 1BRPA 1GT5A 4DQ4A 3LHNA 3IFBA 5EPQA 3ELXA 1BSYA 4TKJA 2LKKA 3FIQA 4TKBA 1DZKA 3BU9A 4IB9A 1I4UA 4U8UO 1AQBA 5EDCA 1ZNEA 1CBSA 2AT0X 2X46A 2XKLA 4QGXA 1LIDA 3P6CA 3UEUA 4N7DA 2NNEA 3KQ0A 4KH8A 2PY1A 4QAEA 4AZRA 5HZ9A 3FR5A 4FBVA 1HMTA 1TOUA 3APUA 5D8JA 1FELA 5CYBA 4XMGA 3FEPA 3KFIA 1VPRA 2JU7A 5LJGA 3VPJE 1YP6A 2R74A 1GXAA 1KT7A 4QNIA 5F6ZA 3BS2A 3RKGA 1TW4A 4IAWA 3BSZE 3NX2A 3FLLA 2Q39A 2JU3A 1IW2A 1GX9A 3NP1A 4HPCA 5DPQA 3KFFA 1DFVA 1DV9A 4JGLA 1KZWA 2P8GA 4QYPA 3HOEA 3WJDA 4GNWA 2GTLO 1MX8A 1KQWA 2NNDA 2ZAIA 4IMOA 2IFBA 4AW8A 4EDEA 1XKIA 1D2UA 4CK4A 1XCAA 2AT5X 4GNYA 2W2FA 4ID2A 4GK9A 3VE1A 1FEMA 3FELA 2Q2PA 3TGAA 3FEKA 3O19A 3P6EA 2FS7A 4PSQA 4KCAA 2KTSA 2A2GA 3TGCA 1KT3A 1LNMA 1ALBA 4WBKA 5HZ6A 3NR3A 4ORYA 3WJCA 4CSBA 5KICA 1X89A 3JS1A 3G7XA 3VU1A 2RQ0A 1EI5A 3AKNA 3F9DA 1EPAA 3FYFA 5FFHA 1SXWA 2X8FA 4ZHCA 1MDCA 2WEXA 3STKA 5K06A 5FAZA 1KQXA 1TVQA 4WHIA 5B29A 4ODDA 2K62A 4ORRA 3FA8A 1NP4A 4A60A 2Q9SA 3CQRA 1YUPA 4LKPA 2QO6A 1Z24A 3WJEA 1JIWI 3MBTA 2CZTA 4O9SA 4BVMA 1KT5A 3RZYA 1EALA 5LJCA 2MM3A 2NNQA 3SAOA 5HCCC 1HQPA 3JSQA 5AEOA 4LQZA 2OVSA 1QFVA 4ARHA 1X8OA 1QY1A 3FA6A 1SY1A 1T68X 2MHDA 3BX8A 3BY0A 4OS3A 4TLJA 5LJBA 4EXZA 4YCHA 4COTA 2W2AA 4D6AA 4YFQA 1ZNDA 2BT9A 4I3CA 3CBCA 1I05A 3FMZA 1JYDA 4XMEA 1QG5A 3UEWA 1SY0A 3ZZVA 1U0XA 3S5VA 4ORXA 1GT4A 2JMBA 4AZNA 4LZUA 3K3LA 2WWPA 4NLJA 4IB7A 4QZTA 1OEEA 4O3WA 3S60A 3H3IA 1SXXA 1ZNKA 4MVLA 3PECA 1DZPA 3AKMA 3TF6A 1U18A 5LJEA 5EEDA 1CRBA 3I0AA 3PQUA 3D96A 4NP1A 4U8UN 2FS6A 2CBSA 3KFHA 3MX7A 1YWAA 3FENA 4HPAA 3P02A 1KT6A 3VG6A 3ZW0A 5JR8A 2L67A 2RCTA 1X71A 1UREA 3CWKA 1EIOA 2OFRX 4DQ3A 4FBRA 2K23A 4YFPA 4AZOA 4IBAA 1EQDA 5HCDC 1ICMA 1AVGI 4KC7A 2G7BA 3B2KA 4N7CA 5H9LA 1OEKA 1YIVA 2WQ9A 3WBGA 4CV7A 1DF3A 5DG4A 2AT8X 4AYHA 1H91A 5FQ6E 4L3RA 4O4SA 1OPAA 2YMSA 4NNTA 4O3XB 4FBOA 1KGLA 4OMXA 3FW5A 1G7NA 2GJ5A 5KHPA 2GTLN 1O1VA 2GC9A 4K19A 2CM4A 2CBRA 1YWBA 2L9CA 1ACDA 4RUNA 1I04A 3HWFA 3SOTA 1BM5A 3TZSA 2POAA 1OBUA 1CJ5A 3U03A 1GKAB 3ZUOA 3P6GA 1DZJA 4BOEA 5HZQA 4KC8A 3HWDA 1N0SA 1P6PA 4YH0A 3ZW1B 5D47A 5D4AA 3OD9A 1B56A 4O4XA 3V8UA 3IA8A 1OPBA 5HWZA 2X8TA 1S7DA 1JJJA 1ZNLA 1BSQA 4I3BA 3CBSA 5IO6A 3UAQA 2QO5A 2HMBA 1GGLA 4NW4A 4OS8A 1G74A 4NNSA 5IO5A 1X8QA 1OEJA 1SXUA 4U8UM 2F09A 4ALBA 1HMSA 1MVGA 1TXLA 2ACOA 3KZAA 4QZUA 4ALOA 3RSWA 2FR3A 5HZ5A 2OVDA 3APXA 4A1HA 1YWDA 3BU1A 2CZUA 3NQ9A 2E4JA 5HTDA 1R0UA 1SY3A 1BRQA 3JQOA 5D48A 4ZH6A 5H9KA 3EM0A 1E02A 1G5WA 1T0VA 3PH6A 4GH7A 4GZVA 4UU2A 3NQ3A 2JU8A 2ACPX 3PH5A 4YBPA 2O62A 4IMNA 5BYPA 1IKEA 1ICNA 4XMFA 1TOWA 2KTDA 3F6ZB 4BQUA 4M7MA 3P6FA 3NX1A 5IO7A 2LB6A 4Y0RA 4YDAA 4TKHA 2HLVA 5F7GA 4MVIA 3RBYA 1LIEA 2WUTA 1LKEA 1X8UA 1NGLA 2GTLM 3ZWEA 3CQNA 2AL0X 4I3DA 3ZQ3A 1BWYA 3I17A 2FLJA 3WJGA 3FW4A 5AQ6A 5BVSA 1RLBE 1HBPA 2BS6A 2BHVA 1EXSA 3NPOA 3C77X 3P6DA 4GKCA 4R0BA 5FQ8E 3EBWA 5HBSA 4L1NA 3FR4A 1UZ2X 1IIUA 4I9SA 4IB8A 2OVAA 3P6HA 4GU8A 4NYQA 4QYNA 3FR2A 5HA0A 2ZAGA 1GX8A 2AKQA 1LIFA 2MJIA 4ZHHA 3HWEA 3RWXA 1MX7A 2OZQA 2WQAE 3B2HA 3PPTA 3U9PC 1PBOA 4A1YA 5HZ8A 1BBPA 1QFTA 3GAQA 2A2UA 4QGVA 5AJCA 4O4OA 2L68A 2Z4HA 1GT1A 4ZCBA 4INNA 3B2JA 4KIIA 1A3YA 5EDBA 1GM6A 4EFGA 5KIDA 4YKMA 2HZRA 3D4RA 3FA9A 1A57A 5HCEC 5H9NA 4MVEA 2Q2MA 3CMPA 4ORUA 3VE2A 1ADLA 3QKGA 3BLGA 1RBPA 1KT4A 1G85A 1B0OA 4GETA 3S5XA 1JZUA 4XMCA 1PM1X 3U0DA 2OVEA 3UEXA 4MIRA 3VG7A 2CM9A 1FE3A 1B4MA 3E3CA 2A3FX 5AJBA 2WR6A 4MISA 1BJ7A 2BS5A 3ZW2A 1QQSA 2LBVA 4GE1A 2MWHA 2WSJA 3ZUIA 5H8TA 3STNA 3C78X 3D97A 1DZMA 3OJYC 5FENA 1EUOA 4ZH9A 3ELZA 1IKJA 1IFBA 2AT3X 3B2IA 5BVQA 3WJFA 4O4UA 4ZFXA 4Y0QA 1QWDA 3DSZA 2A0AA 5HA1A 5LJHA 5LKFA 4ZGUA 4XMHA 5H9AA 4OMWA 4YGZA 4ZHGA 3B2LA 1YWCA 2X45A 3C76X 1EPBA 1D3SA 1Y9TA 1O8VA 2QOSC 4ZGFA 3O2YA 1KZXA 4O3ZA 1NP1A 4IB6A 5L8NA 1LF7A 1E00A 2QMIA 2QM9A 3APWA 2HZQA 2LBAA 5BVTA 1FDQA 3OBLA 4LZVA 3WXQA 4GDZA 1ZNHA 3PEDA 1L6MA 1S44A 1B8EA 1X8NA 3HOLA 5D45A 5F58A 4AZPA 4TNNA 2ASNX 4QRLA 4I6SA 2A13A 1JYJA 2KW1A 3BDRA 3S26A 4AZQA 4IAXA 1GKAA 4YCEA 3ZI8A 3T1DA 2OFMX 4HFOA 1U17A 2JOZA 3PP6A 2RA6A 4ZJ0A 2EU7X 2JW1A 4D6BA 1KXOA 3Q6LA 1ERBA 3ZW1A 4UU3A 2WEWA 4U3QA 1JBHA 1HBQA 1OBQA 4YBUA 2ANSA 2JN3A 5HAEA 3LV4A 3FA7A 3HK1A 1IFCA 1QABE 2ALLX 2HNXA 3PQSA 1LFOA 3NBXX 1SY2A 4I95A 3OE3A 1MUPA 1PMPA 1Y9LA 3NQKA 4Y0SA 2AT6X 4YGHA 4TJZA 1A18A 4YMYA 2R73A 4HPDA 3HWGA 1QY2A 1LICA 3CR6A 5HTEA 2LFOA 3NADA 4KT5A 4QQ1A 4O3YA 3APVA 4EEJA 1EIIA 4Y0PA 1HMRA 5LKEA 3MVFA 1ZRYA 1JJXA 1BSOA 1BEBA 2FR2A 4HPBA 2FT9A 4XMDA 5EZ2A 1DC9A 5F1EA 1CBQA 4I9RA 1QY0A 4NYRA 3O22A 4FGIB 3EBKA 4YKOA 4PJ2A 1E5PA 5EEEA 3GE2A 5LJDA 5CE4A 2KT4B 3WJBA 1S2PA 1ERXA 3P24A 2FTBA 4TQ2A 3L4RA 4OS0A 1PEEA 1SA8A 2FWVA 5L8IA 2G78A 2RN4A 3N91A 2KD2A 4ZR2A 4ES7A 2G79A 3VG2A 3VG3A 1JV4A 2FRSA 3WVMA 2W2BA 3VG5A 2R56A 4WFUA 3F8AA 4ML7B 1O1UA 5B27A 2M4LA 1SMPI 3WOVA 1A2DA 2AMMX 1HN2A 1LPJA 4NLIA 2X8SA 2Q4NA 4RUUA 5FQ7E 4YDBA 1T8VA 1CBRA 1YP7A 3BX7A 1BLRA 2HYSA 4FQBB 3TGBA 1CBIA 3ZW0B 1X8PA 2DM5A 1ML7A 3EMMA 2LA7A 3KFGA 3STMX 4ORWA 1LIBA 5LJKA 4ORSA 1AB0A 4MVKA 1OBPA 1AELA 3EYCA 1FTPA 1FENA 5F6BA 4ZHFA 4EQAC 2RD7C 1EW3A 2YG2A 4HWMA 2RCQA 4ZHDA 3BRNA 1VYFA 4ON1A 4YGGA 1E06A 4AZMA 2AH7X 4YFRA 4M6SA 5L8OA 2NP1A 3DTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F73 A;  2N93 A;  1KOI A;  1VYG A;  1SXY A;  5C0N A;  1ZNG A;  4QGW A;  2GTF X;  4WFV A;  2L5P A;  2BLG A;  3VG4 A;  4LKT A;  4A8Z A;  3UEV A;  4GRJ A;  2XST A;  2MO5 A;  1GT3 A;  1I06 A;  2QO4 A;  3D95 A;  1BRP A;  1GT5 A;  4DQ4 A;  3IFB A;  5EPQ A;  3ELX A;  1BSY A;  4TKJ A;  2LKK A;  3FIQ A;  4TKB A;  1DZK A;  3BU9 A;  4IB9 A;  1I4U A;  1AQB A;  5EDC A;  1ZNE A;  1CBS A;  2AT0 X;  2X46 A;  2XKL A;  4QGX A;  1LID A;  3P6C A;  3UEU A;  4N7D A;  2NNE A;  3KQ0 A;  2PY1 A;  4QAE A;  4AZR A;  5HZ9 A;  3FR5 A;  1HMT A;  1TOU A;  3APU A;  5D8J A;  1FEL A;  4XMG A;  3FEP A;  3KFI A;  1VPR A;  2JU7 A;  5LJG A;  1YP6 A;  2R74 A;  1GXA A;  1KT7 A;  5F6Z A;  3BS2 A;  1TW4 A;  4IAW A;  3BSZ E;  3NX2 A;  3FLL A;  2Q39 A;  2JU3 A;  1IW2 A;  1GX9 A;  3NP1 A;  4HPC A;  5DPQ A;  3KFF A;  1DFV A;  1DV9 A;  1KZW A;  2P8G A;  4QYP A;  3WJD A;  4GNW A;  1MX8 A;  1KQW A;  2NND A;  4IMO A;  4AW8 A;  2IFB A;  4EDE A;  1XKI A;  1D2U A;  4CK4 A;  1XCA A;  2AT5 X;  4GNY A;  2W2F A;  1FEM A;  3FEL A;  2Q2P A;  3TGA A;  3FEK A;  3O19 A;  3P6E A;  2FS7 A;  4PSQ A;  2A2G A;  3TGC A;  1KT3 A;  1LNM A;  1ALB A;  4WBK A;  5HZ6 A;  3NR3 A;  4ORY A;  5KIC A;  1X89 A;  3JS1 A;  3G7X A;  2RQ0 A;  3AKN A;  3F9D A;  1EPA A;  5FFH A;  1SXW A;  4ZHC A;  1MDC A;  2WEX A;  3STK A;  5K06 A;  5FAZ A;  1KQX A;  1TVQ A;  5B29 A;  4ODD A;  2K62 A;  4ORR A;  3FA8 A;  1NP4 A;  4A60 A;  2Q9S A;  3CQR A;  1YUP A;  4LKP A;  2QO6 A;  1Z24 A;  3WJE A;  3MBT A;  2CZT A;  4O9S A;  4BVM A;  1KT5 A;  3RZY A;  1EAL A;  5LJC A;  2MM3 A;  2NNQ A;  3SAO A;  5HCC C;  1HQP A;  3JSQ A;  1QFV A;  4ARH A;  1X8O A;  1QY1 A;  3FA6 A;  1SY1 A;  1T68 X;  3BY0 A;  3BX8 A;  4OS3 A;  4TLJ A;  5LJB A;  4EXZ A;  4YCH A;  2W2A A;  4D6A A;  4YFQ A;  1ZND A;  4I3C A;  3CBC A;  1I05 A;  3FMZ A;  1JYD A;  4XME A;  1QG5 A;  3UEW A;  1SY0 A;  1U0X A;  4ORX A;  1GT4 A;  4AZN A;  4LZU A;  3K3L A;  2WWP A;  4NLJ A;  4IB7 A;  4QZT A;  1OEE A;  1SXX A;  1ZNK A;  4MVL A;  3PEC A;  1DZP A;  3AKM A;  3TF6 A;  1U18 A;  5LJE A;  5EED A;  1CRB A;  3I0A A;  4NP1 A;  3D96 A;  3WJC A;  2FS6 A;  2CBS A;  3KFH A;  1YWA A;  3FEN A;  4HPA A;  3VG6 A;  1KT6 A;  5JR8 A;  2L67 A;  2RCT A;  1X71 A;  1URE A;  3CWK A;  1EIO A;  2OFR X;  4DQ3 A;  2K23 A;  4YFP A;  4AZO A;  4IBA A;  1EQD A;  5HCD C;  1ICM A;  1AVG I;  2G7B A;  3B2K A;  4N7C A;  5H9L A;  1OEK A;  1YIV A;  2WQ9 A;  3WBG A;  1DF3 A;  5DG4 A;  2AT8 X;  4AYH A;  1H91 A;  1OPA A;  4NNT A;  1KGL A;  4OMX A;  3FW5 A;  1G7N A;  2GJ5 A;  5KHP A;  1O1V A;  2GC9 A;  4K19 A;  2CM4 A;  2CBR A;  1YWB A;  2L9C A;  1ACD A;  4RUN A;  1I04 A;  3HWF A;  1BM5 A;  3TZS A;  2POA A;  1OBU A;  1CJ5 A;  3U03 A;  1GKA B;  3ZUO A;  3P6G A;  1DZJ A;  4BOE A;  5HZQ A;  3HWD A;  1N0S A;  1P6P A;  4YH0 A;  5D47 A;  5D4A A;  1B56 A;  3IA8 A;  1OPB A;  5HWZ A;  1S7D A;  1JJJ A;  1ZNL A;  1BSQ A;  4I3B A;  3CBS A;  5IO6 A;  2QO5 A;  2HMB A;  1GGL A;  4OS8 A;  1G74 A;  4NNS A;  5IO5 A;  1X8Q A;  1OEJ A;  1SXU A;  4ALB A;  1HMS A;  1MVG A;  1TXL A;  2ACO A;  3KZA A;  4QZU A;  4ALO A;  3RSW A;  2FR3 A;  5HZ5 A;  2OVD A;  3APX A;  4A1H A;  1YWD A;  3BU1 A;  2CZU A;  3NQ9 A;  2E4J A;  5HTD A;  1R0U A;  1SY3 A;  1BRQ A;  5D48 A;  4ZH6 A;  5H9K A;  3EM0 A;  1E02 A;  1G5W A;  1T0V A;  3PH6 A;  4GH7 A;  4UU2 A;  3NQ3 A;  2JU8 A;  2ACP X;  3PH5 A;  4YBP A;  2O62 A;  4IMN A;  1IKE A;  1ICN A;  4XMF A;  1TOW A;  2KTD A;  4BQU A;  4M7M A;  3P6F A;  3NX1 A;  5IO7 A;  2LB6 A;  4Y0R A;  4YDA A;  4TKH A;  2HLV A;  5F7G A;  4MVI A;  1LIE A;  2WUT A;  1LKE A;  1X8U A;  1NGL A;  3CQN A;  2AL0 X;  4I3D A;  3ZQ3 A;  1BWY A;  3I17 A;  2FLJ A;  3WJG A;  3FW4 A;  5AQ6 A;  5BVS A;  1RLB E;  1HBP A;  1EXS A;  3NPO A;  3C77 X;  3P6D A;  4GKC A;  4R0B A;  5HBS A;  3EBW A;  3FR4 A;  1UZ2 X;  1IIU A;  4I9S A;  4IB8 A;  2OVA A;  3P6H A;  4NYQ A;  4QYN A;  3FR2 A;  5HA0 A;  1GX8 A;  2AKQ A;  1LIF A;  2MJI A;  4ZHH A;  3HWE A;  1MX7 A;  2OZQ A;  2WQA E;  3B2H A;  3PPT A;  3U9P C;  1PBO A;  4A1Y A;  5HZ8 A;  1BBP A;  1QFT A;  3GAQ A;  2A2U A;  4QGV A;  2L68 A;  4ZCB A;  1GT1 A;  3B2J A;  4KII A;  1A3Y A;  5EDB A;  1GM6 A;  4EFG A;  5KID A;  4YKM A;  2HZR A;  1A57 A;  3FA9 A;  5HCE C;  5H9N A;  2Q2M A;  3CMP A;  4ORU A;  1ADL A;  3QKG A;  3BLG A;  1RBP A;  1KT4 A;  1G85 A;  1B0O A;  4GET A;  1JZU A;  4XMC A;  1PM1 X;  3U0D A;  2OVE A;  3UEX A;  3VG7 A;  2CM9 A;  1FE3 A;  1B4M A;  2A3F X;  2WR6 A;  1BJ7 A;  1QQS A;  2LBV A;  4GE1 A;  2WSJ A;  3ZUI A;  5H8T A;  3STN A;  3C78 X;  3D97 A;  1DZM A;  3OJY C;  5FEN A;  1EUO A;  4ZH9 A;  3ELZ A;  1IKJ A;  1IFB A;  2AT3 X;  3B2I A;  5BVQ A;  3WJF A;  4ZFX A;  4Y0Q A;  1QWD A;  3DSZ A;  2A0A A;  5HA1 A;  5LJH A;  5LKF A;  4ZGU A;  4XMH A;  5H9A A;  4OMW A;  4YGZ A;  4ZHG A;  3B2L A;  1YWC A;  2X45 A;  3C76 X;  1EPB A;  1D3S A;  1O8V A;  2QOS C;  1KZX A;  3O2Y A;  1NP1 A;  4IB6 A;  5L8N A;  1LF7 A;  1E00 A;  2QM9 A;  3APW A;  2HZQ A;  2LBA A;  5BVT A;  1FDQ A;  3WXQ A;  4LZV A;  1ZNH A;  3PED A;  1L6M A;  1S44 A;  1B8E A;  1X8N A;  5D45 A;  5F58 A;  4AZP A;  4TNN A;  2ASN X;  2A13 A;  1JYJ A;  3BDR A;  3S26 A;  4AZQ A;  4IAX A;  1GKA A;  4YCE A;  3T1D A;  2OFM X;  4HFO A;  1U17 A;  2JOZ A;  3PP6 A;  2RA6 A;  4ZJ0 A;  2EU7 X;  4D6B A;  1KXO A;  3Q6L A;  1ERB A;  4UU3 A;  2WEW A;  1JBH A;  1HBQ A;  1OBQ A;  4YBU A;  2ANS A;  2JN3 A;  5HAE A;  3FA7 A;  3HK1 A;  1IFC A;  1QAB E;  2ALL X;  2HNX A;  1LFO A;  1SY2 A;  1MUP A;  1PMP A;  4Y0S A;  2AT6 X;  4YGH A;  4TJZ A;  1A18 A;  4YMY A;  2R73 A;  4HPD A;  3HWG A;  1QY2 A;  1LIC A;  3CR6 A;  5HTE A;  2LFO A;  3NAD A;  3APV A;  4EEJ A;  1EII A;  4Y0P A;  1HMR A;  5LKE A;  3MVF A;  1ZRY A;  1JJX A;  1BSO A;  1BEB A;  2FR2 A;  4HPB A;  2FT9 A;  4XMD A;  5EZ2 A;  1DC9 A;  5F1E A;  1CBQ A;  4I9R A;  1QY0 A;  4NYR A;  3O22 A;  3EBK A;  4YKO A;  1E5P A;  5EEE A;  5LJD A;  5CE4 A;  2KT4 B;  3WJB A;  1S2P A;  1ERX A;  2FTB A;  4TQ2 A;  3L4R A;  4OS0 A;  1PEE A;  1SA8 A;  2FWV A;  5L8I A;  2G78 A;  4ES7 A;  4ZR2 A;  2G79 A;  3VG2 A;  3VG3 A;  1JV4 A;  2FRS A;  3WVM A;  2W2B A;  3VG5 A;  2R56 A;  4WFU A;  3F8A A;  1O1U A;  5B27 A;  1A2D A;  2AMM X;  1HN2 A;  1LPJ A;  4NLI A;  4RUU A;  2Q4N A;  4YDB A;  1T8V A;  1CBR A;  1YP7 A;  3BX7 A;  1BLR A;  2HYS A;  3TGB A;  1CBI A;  1X8P A;  2DM5 A;  1ML7 A;  3EMM A;  3KFG A;  3STM X;  4ORW A;  1LIB A;  5LJK A;  4ORS A;  1AB0 A;  4MVK A;  1OBP A;  1AEL A;  3EYC A;  1FTP A;  1FEN A;  5F6B A;  4ZHF A;  2RD7 C;  1EW3 A;  2YG2 A;  4ZHD A;  2RCQ A;  3BRN A;  1VYF A;  4YGG A;  1E06 A;  4AZM A;  2AH7 X;  4YFR A;  4M6S A;  5L8O A;  2NP1 A;  3DTQ A; 
#chains in the Genus database with same CATH topology
 2F73 A;  2IZI A;  2N93 A;  2VFB A;  1KOI A;  1VYG A;  1SXY A;  5C0N A;  1ZNG A;  4IAB A;  1SWC A;  2GTF X;  4QGW A;  2Z4I A;  4WFV A;  2L5P A;  2BLG A;  3VG4 A;  4LKT A;  4U9C A;  4A8Z A;  4C5P A;  3UEV A;  3HTY A;  2XST A;  4GRJ A;  5B11 O;  4BJ8 A;  4O49 A;  2MO5 A;  1GT3 A;  2AF5 A;  1I06 A;  2QO4 A;  3D95 A;  1BRP A;  1GT5 A;  2AVI A;  4DQ4 A;  3LHN A;  3IFB A;  1MK5 A;  3ELX A;  5EPQ A;  1BSY A;  4TKJ A;  2LKK A;  3FIQ A;  4TKB A;  1DZK A;  3BU9 A;  4IB9 A;  1I4U A;  4U8U O;  5K68 A;  1AQB A;  5EDC A;  1ZNE A;  1CBS A;  2AT0 X;  2X46 A;  2XKL A;  4QGX A;  1LID A;  3P6C A;  3UEU A;  4Z6J A;  1VWO B;  4N7D A;  2NNE A;  3KQ0 A;  4KH8 A;  2PY1 A;  4GGZ A;  1W5R A;  4QAE A;  1VYO A;  1SWK A;  3VHI A;  4AZR A;  3FR5 A;  4FBV A;  5HZ9 A;  1HMT A;  1TOU A;  3APU A;  5D8J A;  1FEL A;  5CYB A;  4CDC A;  4XMG A;  3FEP A;  1JMZ A;  3KFI A;  1VPR A;  2JU7 A;  5LJG A;  3VPJ E;  1YP6 A;  2R74 A;  1GXA A;  1KT7 A;  1VWN B;  1Y53 X;  4QNI A;  4Y59 A;  3BS2 A;  5F6Z A;  1NQN A;  3RKG A;  1TW4 A;  2DJG A;  4IAW A;  1NDJ A;  3BSZ E;  2OL6 O;  3WYP A;  2RTI B;  3NX2 A;  3FLL A;  3EW2 A;  3RE6 A;  4EKV A;  2Q39 A;  2JU3 A;  1IW2 A;  1GX9 A;  2RTP B;  3NP1 A;  4HPC A;  5DPQ A;  3KFF A;  1DFV A;  3RY2 A;  1DV9 A;  4JGL A;  1KZW A;  2P8G A;  4QYP A;  3HOE A;  3WJD A;  4GNW A;  4U46 A;  2GTL O;  1MX8 A;  4CDD A;  1KQW A;  2NND A;  2ZAI A;  1SWT A;  2IFB A;  1VWG B;  4IMO A;  1XKI A;  1D2U A;  2C1S A;  1XCA A;  4U8U N;  2AT5 X;  4GNY A;  2RTD B;  2W2F A;  4CK4 A;  4ID2 A;  4GK9 A;  3RDX A;  2DJF A;  3VE1 A;  1FEM A;  2IZF B;  1K3B A;  2Q2P A;  2RTN B;  3FEL A;  3TGA A;  3FEK A;  3O19 A;  2A5C A;  3P6E A;  1SRI A;  2FS7 A;  4PSQ A;  4KCA A;  3CKF A;  4JNJ A;  2KTS A;  2A2G A;  5JD2 A;  1KT3 A;  3TGC A;  1LNM A;  1ALB A;  4WBK A;  5HZ6 A;  3NR3 A;  4BX7 B;  4ORY A;  3WJC A;  4CSB A;  5KIC A;  1X89 A;  3JS1 A;  4GGR A;  3G7X A;  3VU1 A;  2RQ0 A;  1EI5 A;  4CPI A;  1W6F A;  3AKN A;  1EPA A;  3F9D A;  3FYF A;  1SXW A;  2X8F A;  5FFH A;  2IZB A;  4ZHC A;  1MDC A;  2QCB A;  2WEX A;  3PDF A;  3STK A;  5FAZ A;  1KQX A;  2OY1 O;  5K06 A;  2JGS A;  1TVQ A;  2RTR B;  4WHI A;  5B29 A;  4ODD A;  2K62 A;  4ORR A;  3FA8 A;  2VFC A;  1NP4 A;  4A60 A;  2Q9S A;  3CQR A;  1YUP A;  4LKP A;  2QO6 A;  1Z24 A;  3WJE A;  1JIW I;  3RDQ A;  3MBT A;  1NBX A;  2CZT A;  4O9S A;  4BVM A;  4BX7 A;  1KT5 A;  3RZY A;  1EAL A;  1Y55 X;  5LJC A;  2MM3 A;  2NNQ A;  3SAO A;  5HCC C;  1HQP A;  3JSQ A;  5AEO A;  4LQZ A;  2OVS A;  5IRA A;  4GUZ A;  5L3Y A;  1QFV A;  4ARH A;  1KFF A;  1QY1 A;  1X8O A;  2BC3 A;  4GJS A;  3FA6 A;  1SY1 A;  1T68 X;  2MHD A;  3BX8 A;  3BY0 A;  4OS3 A;  4TLJ A;  5LJB A;  4EXZ A;  4YCH A;  4COT A;  2W2A A;  4D6A A;  4YFQ A;  1ZND A;  2BT9 A;  4I3C A;  3CBC A;  4AW8 A;  1I05 A;  2RTG B;  1JYD A;  3FMZ A;  4XME A;  1QG5 A;  3UEW A;  3FDC A;  1SY0 A;  4B55 A;  4BCS A;  3ZZV A;  1U0X A;  3S5V A;  2RTQ B;  4ORX A;  1SWN A;  1GT4 A;  2JMB A;  3WZN A;  4AZN A;  4LZU A;  3CKG A;  2WPU A;  3K3L A;  1UYO X;  2WWP A;  1MOY A;  4NLJ A;  2X34 A;  4IB7 A;  4QZT A;  1OEE A;  4O3W A;  4CDF A;  3S60 A;  1WBI A;  3H3I A;  1SXX A;  1ZNK A;  4MVL A;  2RTO B;  3PEC A;  1DZP A;  3AKM A;  1VWJ B;  3TF6 A;  4I60 A;  1U18 A;  5IRU A;  5LJE A;  5EED A;  1CRB A;  3AEH A;  3I0A A;  3PQU A;  1SRE A;  3D96 A;  4NP1 A;  2FS6 A;  2CBS A;  3KFH A;  3MX7 A;  1YWA A;  2RTM A;  3FEN A;  2FGS A;  1KT6 A;  3P02 A;  4HPA A;  5CSE A;  3VG6 A;  2Y3F A;  4BX5 A;  3SLO A;  3LTW A;  5JR8 A;  4CDE A;  2L67 A;  2RCT A;  1SRF A;  1X71 A;  3VHH A;  4Z2V A;  1VWI B;  1URE A;  3CWK A;  1I9H A;  2UZ2 A;  2OFR X;  4DQ3 A;  4FBR A;  1EIO A;  2IZE B;  2K23 A;  4YFP A;  4AZO A;  4IBA A;  1EQD A;  5HCD C;  1JMX A;  1ICM A;  1STP A;  1AVG I;  4KC7 A;  2G7B A;  3EC5 A;  3B2K A;  4N7C A;  5H9L A;  1OEK A;  1YIV A;  2WQ9 A;  3WBG A;  4CV7 A;  1DF3 A;  5DG4 A;  2AT8 X;  1SRH A;  4AYH A;  1H91 A;  5FQ6 E;  4L3R A;  4O4S A;  1OPA A;  2HKD A;  2CAM A;  1PTS A;  2YMS A;  4NNT A;  3WZO A;  4O3X B;  4FBO A;  1KGL A;  2OFB A;  4OMX A;  1AVE A;  5B5G A;  1I78 A;  1G7N A;  2GJ5 A;  3FW5 A;  2GTL N;  5KHP A;  2OFA A;  3ZW0 A;  1O1V A;  2GC9 A;  1LUQ A;  4K19 A;  2CM4 A;  2CBR A;  1YWB A;  2L9C A;  1ACD A;  4RUN A;  4Z28 A;  1I04 A;  3HWF A;  4NV7 A;  2X55 A;  3SOT A;  1BM5 A;  3TZS A;  2POA A;  1OBU A;  1CJ5 A;  3U03 A;  1GKA B;  2BSZ A;  2OL8 O;  3P6G A;  3ZUO A;  1DZJ A;  4BOE A;  1MM9 A;  5HZQ A;  4KC8 A;  4BBO A;  2RTA A;  3HWD A;  1N0S A;  2FKG A;  3RDM A;  1P6P A;  1VWP B;  4YH0 A;  3ZW1 B;  1HY2 A;  5D47 A;  1VWE B;  1JQP A;  5D4A A;  3OD9 A;  1B56 A;  4O4X A;  3V8U A;  3IA8 A;  1OPB A;  2RTE B;  5HWZ A;  2X8T A;  1SWE A;  1S7D A;  4IRW A;  1JJJ A;  1ZNL A;  1BSQ A;  4I3B A;  1SWB A;  3CBS A;  5IO6 A;  3UAQ A;  2RTK A;  2QO5 A;  2HMB A;  1GGL A;  2IZA A;  4NW4 A;  4OS8 A;  1G74 A;  4NNS A;  4Y5D A;  5IO5 A;  1SLG B;  1X8Q A;  1OEJ A;  1SXU A;  4U8U M;  4GGT A;  2F09 A;  4ALB A;  1HMS A;  1MVG A;  1TXL A;  5BVS A;  2ACO A;  3KZA A;  4QZU A;  4ALO A;  3RSW A;  1DF8 A;  2FR3 A;  5HZ5 A;  2OVD A;  1KL3 A;  3APX A;  4A1H A;  1YWD A;  3BU1 A;  4OEM A;  2CZU A;  3NQ9 A;  2E4J A;  3QQ2 A;  1VWK B;  1R0U A;  5HTD A;  1SY3 A;  1BRQ A;  3JQO A;  5D48 A;  4ZH6 A;  5H9K A;  2IZD B;  3EM0 A;  1E02 A;  1G5W A;  1T0V A;  3PH6 A;  4GH7 A;  2FHN X;  3SLT A;  4GZV A;  4UU2 A;  3NQ3 A;  4JO6 A;  1SLE B;  2JU8 A;  2ACP X;  3PH5 A;  4YBP A;  2O62 A;  4IMN A;  5BYP A;  1IKE A;  1ICN A;  4XMF A;  1TOW A;  2A5B A;  2KTD A;  3F6Z B;  2IZG B;  2UYW A;  4M7M A;  4BQU A;  3P6F A;  3NX1 A;  5IO7 A;  2G5L A;  2LB6 A;  4Y0R A;  4YDA A;  4TKH A;  2HLV A;  5F7G A;  4MVI A;  3RBY A;  2FKJ A;  1LIE A;  2WUT A;  1LKE A;  1SWO A;  1X8U A;  1NGL A;  2GTL M;  4EDE A;  3ZWE A;  3CQN A;  2AL0 X;  4I3D A;  3ZQ3 A;  1BWY A;  1STR B;  3I17 A;  2FLJ A;  1UYN X;  3WJG A;  3FW4 A;  5IRW A;  3SZH A;  1VWF B;  1VWC B;  1RLB E;  2I5Z O;  1HBP A;  2BS6 A;  5AQ6 A;  2BHV A;  5B2A O;  1EXS A;  3NPO A;  3C77 X;  3P6D A;  4GKC A;  4R0B A;  5FQ8 E;  3EBW A;  5HBS A;  4L1N A;  3WZP A;  3KVN A;  3FR4 A;  1VWM B;  1UZ2 X;  1IIU A;  4I9S A;  1RSU B;  4IB8 A;  2OVA A;  3P6H A;  4GU8 A;  4NYQ A;  4CPF A;  4QYN A;  4CPH B;  3FR2 A;  5HA0 A;  1SWQ A;  4GDA A;  2ZAG A;  1GX8 A;  2C4I A;  2AKQ A;  1LDO A;  2GH7 A;  1LIF A;  1K24 A;  2MJI A;  4ZHH A;  3HWE A;  3RWX A;  2QOM A;  3PK2 A;  2X56 A;  2X4M A;  1MX7 A;  2OZQ A;  1SWU A;  2WQA E;  3B2H A;  3PPT A;  4YVB A;  3U9P C;  1PBO A;  4A1Y A;  5HZ8 A;  1BBP A;  1QFT A;  3GAQ A;  2A2U A;  4QGV A;  5AJC A;  4O4O A;  3MG5 A;  2OL7 A;  4CPH A;  1N9M A;  2L68 A;  2Z4H A;  1GT1 A;  1IJ8 A;  4ZCB A;  4INN A;  4CPE A;  3B2J A;  4KII A;  1A3Y A;  1SLF B;  1SWH A;  5EDB A;  1GM6 A;  4EFG A;  5KID A;  4NV8 A;  4YKM A;  2HZR A;  3D4R A;  3FA9 A;  1A57 A;  1SWS A;  2C1Q A;  5F2B A;  5HCE C;  4MEE A;  5H9N A;  4MVE A;  2Q2M A;  3CMP A;  4ORU A;  1GX3 A;  3VE2 A;  4BX6 B;  1ADL A;  3QKG A;  1SRJ A;  3BLG A;  1SWR A;  1RBP A;  1SWA A;  1KT4 A;  4ES7 A;  1G85 A;  1B0O A;  2OF9 A;  4GET A;  3S5X A;  1LEL A;  1JZU A;  1KL5 A;  1PM1 X;  4XMC A;  3U0D A;  2OVE A;  2PI3 O;  4MIR A;  5CHK A;  3UEX A;  3VG7 A;  4Z2P A;  2CM9 A;  1FE3 A;  1B4M A;  3E3C A;  2A3F X;  3HPE A;  5AJB A;  2MF6 A;  2WR6 A;  4MIS A;  1BJ7 A;  2BS5 A;  4OKA A;  3ZW2 A;  1QQS A;  2LBV A;  1RXJ A;  4GE1 A;  2RTH B;  1PBY A;  2MWH A;  2WSJ A;  3ZUI A;  5H8T A;  3STN A;  2RTL A;  3C78 X;  1NC9 A;  1VWD B;  2FHL A;  3D97 A;  1DZM A;  4OEL A;  3OJY C;  5FEN A;  4BX6 A;  1EUO A;  4ZH9 A;  3ELZ A;  1IKJ A;  1E2T A;  1IFB A;  2AT3 X;  3B2I A;  5BVQ A;  4O4U A;  3WJF A;  4ZFX A;  3WYQ A;  4Y0Q A;  1QWD A;  3DSZ A;  2A0A A;  5HA1 A;  5LJH A;  5LKF A;  4ZGU A;  4XMH A;  4DCB A;  5H9A A;  4OMW A;  4YGZ A;  4ZHG A;  3B2L A;  1YWC A;  2X45 A;  3C76 X;  1EPB A;  1D3S A;  4DNE A;  3FID A;  1Y9T A;  1O8V A;  2QOS C;  3X00 A;  3O2Y A;  4ZGF A;  4O3Z A;  1KZX A;  1NP1 A;  1VWL B;  4IB6 A;  1SWF A;  3RDU A;  5L8N A;  1SWG A;  1LF7 A;  1E00 A;  2QMI A;  2QM9 A;  1VWQ B;  3APW A;  4BGF A;  2HZQ A;  2LBA A;  2RTC B;  5BVT A;  1FDQ A;  1FJ1 E;  2IZC B;  3OBL A;  4GDZ A;  4LZV A;  3WXQ A;  3RDO A;  1ZNH A;  3PED A;  1L6M A;  2RTB B;  1S44 A;  1B8E A;  1X8N A;  3HOL A;  5D45 A;  5F58 A;  4AZP A;  4TNN A;  1VWA B;  2ASN X;  4QRL A;  4I6S A;  1MEP A;  2A13 A;  1JYJ A;  2A8G A;  2KW1 A;  3BDR A;  3S26 A;  4AZQ A;  4IAX A;  1GKA A;  4YCE A;  3ZI8 A;  3T1D A;  2OFM X;  4HFO A;  1U17 A;  1SWD A;  1Y0G A;  2JOZ A;  2RTJ A;  3PP6 A;  3SZI A;  2RA6 A;  4ZJ0 A;  4GJV A;  2EU7 X;  2JW1 A;  3EW1 A;  1KXO A;  1LCV A;  3Q6L A;  4D6B A;  1ERB A;  3ZW1 A;  4UU3 A;  2WEW A;  4U3Q A;  1JBH A;  1HBQ A;  2ZSC A;  2RTF B;  1W4T A;  1LCW A;  1OBQ A;  4YBU A;  2ANS A;  2JN3 A;  5HAE A;  3LV4 A;  1VWH B;  3FA7 A;  3HK1 A;  1IFC A;  4JHQ A;  1QAB E;  2ALL X;  2HNX A;  3PQS A;  1LFO A;  3NBX X;  1SY2 A;  4I95 A;  2F01 A;  3OE3 A;  1MUP A;  1PMP A;  1Y9L A;  3NQK A;  1RXK A;  4Y0S A;  1VWR B;  2AT6 X;  4YGH A;  4TJZ A;  1A18 A;  1AVD A;  1OSP O;  2R73 A;  4YMY A;  4HPD A;  3HWG A;  2OF8 A;  1QY2 A;  1LIC A;  3CR6 A;  5HTE A;  2IZL B;  2OYB O;  2LFO A;  3NAD A;  4KT5 A;  1Y52 X;  2OY8 A;  4QQ1 A;  1N43 A;  4O3Y A;  2OY7 A;  3APV A;  4EEJ A;  1EII A;  4Y0P A;  1HMR A;  2G8C O;  5LKE A;  1HXL A;  3RDS A;  1KL4 A;  3MM0 A;  3MVF A;  1ZRY A;  2Y32 A;  3Q34 A;  1JJX A;  1BSO A;  1BEB A;  4Z27 A;  3RE5 A;  2FR2 A;  3T2W A;  4HPB A;  3WZQ A;  2FT9 A;  4XMD A;  5EZ2 A;  1SWL A;  1NQM A;  2OY5 O;  1DC9 A;  1STS B;  5F1E A;  1CBQ A;  3AUM O;  1QY0 A;  4I9R A;  3O22 A;  4NYR A;  4Z2O A;  4FGI B;  3VHM A;  3EBK A;  4YKO A;  4PJ2 A;  1E5P A;  5EEE A;  3GE2 A;  5LJD A;  5CE4 A;  2KT4 B;  2VDF A;  3WJB A;  1S2P A;  1SRG A;  1ERX A;  1LDQ A;  3P24 A;  2FTB A;  4TQ2 A;  1SWJ A;  2X32 A;  3L4R A;  2IZH B;  4OS0 A;  1PEE A;  1SA8 A;  2FWV A;  1VWB B;  5L8I A;  5K67 A;  2G78 A;  2RN4 A;  3N91 A;  2KD2 A;  4ZR2 A;  1RXH A;  5B10 O;  2G79 A;  3RY1 A;  3VG2 A;  3VG3 A;  1JV4 A;  2FRS A;  3WVM A;  2W2B A;  4GD9 A;  2R56 A;  4WFU A;  3VG5 A;  3F8A A;  4ML7 B;  1O1U A;  5B27 A;  2M4L A;  1SMP I;  3SZJ A;  1N4J A;  1A2D A;  2AMM X;  1HN2 A;  1LPJ A;  4NLI A;  2X8S A;  2Q4N A;  4RUU A;  3WOV A;  3T6L A;  5FQ7 E;  3VGW A;  1HQQ A;  1SLD B;  1RST B;  1T8V A;  4YDB A;  5B3M O;  1CBR A;  1N7Y A;  1YP7 A;  3BX7 A;  3T2X A;  1BLR A;  2HYS A;  2Y3E A;  4FQB B;  3TGB A;  1CBI A;  3ZW0 B;  1X8P A;  1WUB A;  2DM5 A;  1ML7 A;  2IZK A;  3EMM A;  3T6F A;  4BX5 B;  5IXG A;  2LA7 A;  3KFG A;  1N9Y A;  3STM X;  4ORW A;  1LIB A;  5LJK A;  4ORS A;  1AB0 A;  4MVK A;  1OBP A;  2IZJ A;  1AEL A;  3EYC A;  1FTP A;  1FEN A;  5F6B A;  4ZHF A;  4EQA C;  2RD7 C;  1SWP A;  1EW3 A;  3SLJ A;  2YG2 A;  4HWM A;  2RCQ A;  1JJU A;  3D9W A;  3BRN A;  2I5V O;  1VYF A;  4ON1 A;  4ZHD A;  4YGG A;  1E06 A;  4AZM A;  2AH7 X;  4YFR A;  5B5F A;  1HXZ A;  4M6S A;  5L8O A;  1RAV A;  2NP1 A;  3DTQ A;  1LCZ A; 
#chains in the Genus database with same CATH homology
 2F73 A;  2N93 A;  1KOI A;  1VYG A;  1SXY A;  5C0N A;  1ZNG A;  4IAB A;  4QGW A;  2GTF X;  2Z4I A;  4WFV A;  2L5P A;  2BLG A;  3VG4 A;  4LKT A;  4U9C A;  4A8Z A;  3UEV A;  3HTY A;  2XST A;  4GRJ A;  4O49 A;  2MO5 A;  1GT3 A;  1I06 A;  2QO4 A;  3D95 A;  1BRP A;  1GT5 A;  4DQ4 A;  3LHN A;  3IFB A;  5EPQ A;  3ELX A;  1BSY A;  4TKJ A;  2LKK A;  3FIQ A;  4TKB A;  1DZK A;  3BU9 A;  4IB9 A;  1I4U A;  4U8U O;  1AQB A;  5EDC A;  1ZNE A;  1CBS A;  2AT0 X;  2X46 A;  2XKL A;  4QGX A;  1LID A;  3P6C A;  3UEU A;  4N7D A;  2NNE A;  3KQ0 A;  4KH8 A;  2PY1 A;  4QAE A;  4AZR A;  5HZ9 A;  3FR5 A;  4FBV A;  1HMT A;  1TOU A;  3APU A;  5D8J A;  1FEL A;  5CYB A;  4XMG A;  3FEP A;  3KFI A;  1VPR A;  2JU7 A;  5LJG A;  3VPJ E;  1YP6 A;  2R74 A;  1GXA A;  1KT7 A;  4QNI A;  5F6Z A;  3BS2 A;  3RKG A;  1TW4 A;  4IAW A;  3BSZ E;  3NX2 A;  3FLL A;  2Q39 A;  2JU3 A;  1IW2 A;  1GX9 A;  3NP1 A;  4HPC A;  5DPQ A;  3KFF A;  1DFV A;  1DV9 A;  4JGL A;  1KZW A;  2P8G A;  4QYP A;  3HOE A;  3WJD A;  4GNW A;  2GTL O;  1MX8 A;  1KQW A;  2NND A;  2ZAI A;  4IMO A;  2IFB A;  4AW8 A;  4EDE A;  1XKI A;  1D2U A;  4CK4 A;  1XCA A;  2AT5 X;  4GNY A;  2W2F A;  4ID2 A;  4GK9 A;  3VE1 A;  1FEM A;  3FEL A;  2Q2P A;  3TGA A;  3FEK A;  3O19 A;  3P6E A;  2FS7 A;  4PSQ A;  4KCA A;  2KTS A;  2A2G A;  3TGC A;  1KT3 A;  1LNM A;  1ALB A;  4WBK A;  5HZ6 A;  3NR3 A;  4ORY A;  3WJC A;  4CSB A;  5KIC A;  1X89 A;  3JS1 A;  3G7X A;  3VU1 A;  2RQ0 A;  1EI5 A;  3AKN A;  3F9D A;  1EPA A;  3FYF A;  5FFH A;  1SXW A;  2X8F A;  4ZHC A;  1MDC A;  2WEX A;  3STK A;  5K06 A;  5FAZ A;  1KQX A;  1TVQ A;  4WHI A;  5B29 A;  4ODD A;  2K62 A;  4ORR A;  3FA8 A;  1NP4 A;  4A60 A;  2Q9S A;  3CQR A;  1YUP A;  4LKP A;  2QO6 A;  1Z24 A;  3WJE A;  1JIW I;  3MBT A;  2CZT A;  4O9S A;  4BVM A;  1KT5 A;  3RZY A;  1EAL A;  5LJC A;  2MM3 A;  2NNQ A;  3SAO A;  5HCC C;  1HQP A;  3JSQ A;  5AEO A;  4LQZ A;  2OVS A;  1QFV A;  4ARH A;  1X8O A;  1QY1 A;  3FA6 A;  1SY1 A;  1T68 X;  2MHD A;  3BX8 A;  3BY0 A;  4OS3 A;  4TLJ A;  5LJB A;  4EXZ A;  4YCH A;  4COT A;  2W2A A;  4D6A A;  4YFQ A;  1ZND A;  2BT9 A;  4I3C A;  3CBC A;  1I05 A;  3FMZ A;  1JYD A;  4XME A;  1QG5 A;  3UEW A;  1SY0 A;  3ZZV A;  1U0X A;  3S5V A;  4ORX A;  1GT4 A;  2JMB A;  4AZN A;  4LZU A;  3K3L A;  2WWP A;  4NLJ A;  4IB7 A;  4QZT A;  1OEE A;  4O3W A;  3S60 A;  3H3I A;  1SXX A;  1ZNK A;  4MVL A;  3PEC A;  1DZP A;  3AKM A;  3TF6 A;  1U18 A;  5LJE A;  5EED A;  1CRB A;  3I0A A;  3PQU A;  3D96 A;  4NP1 A;  4U8U N;  2FS6 A;  2CBS A;  3KFH A;  3MX7 A;  1YWA A;  3FEN A;  4HPA A;  3P02 A;  1KT6 A;  3VG6 A;  3ZW0 A;  5JR8 A;  2L67 A;  2RCT A;  1X71 A;  1URE A;  3CWK A;  1EIO A;  2OFR X;  4DQ3 A;  4FBR A;  2K23 A;  4YFP A;  4AZO A;  4IBA A;  1EQD A;  5HCD C;  1ICM A;  1AVG I;  4KC7 A;  2G7B A;  3B2K A;  4N7C A;  5H9L A;  1OEK A;  1YIV A;  2WQ9 A;  3WBG A;  4CV7 A;  1DF3 A;  5DG4 A;  2AT8 X;  4AYH A;  1H91 A;  5FQ6 E;  4L3R A;  4O4S A;  1OPA A;  2YMS A;  4NNT A;  4O3X B;  4FBO A;  1KGL A;  4OMX A;  3FW5 A;  1G7N A;  2GJ5 A;  5KHP A;  2GTL N;  1O1V A;  2GC9 A;  4K19 A;  2CM4 A;  2CBR A;  1YWB A;  2L9C A;  1ACD A;  4RUN A;  1I04 A;  3HWF A;  3SOT A;  1BM5 A;  3TZS A;  2POA A;  1OBU A;  1CJ5 A;  3U03 A;  1GKA B;  3ZUO A;  3P6G A;  1DZJ A;  4BOE A;  5HZQ A;  4KC8 A;  3HWD A;  1N0S A;  1P6P A;  4YH0 A;  3ZW1 B;  5D47 A;  5D4A A;  3OD9 A;  1B56 A;  4O4X A;  3V8U A;  3IA8 A;  1OPB A;  5HWZ A;  2X8T A;  1S7D A;  1JJJ A;  1ZNL A;  1BSQ A;  4I3B A;  3CBS A;  5IO6 A;  3UAQ A;  2QO5 A;  2HMB A;  1GGL A;  4NW4 A;  4OS8 A;  1G74 A;  4NNS A;  5IO5 A;  1X8Q A;  1OEJ A;  1SXU A;  4U8U M;  2F09 A;  4ALB A;  1HMS A;  1MVG A;  1TXL A;  2ACO A;  3KZA A;  4QZU A;  4ALO A;  3RSW A;  2FR3 A;  5HZ5 A;  2OVD A;  3APX A;  4A1H A;  1YWD A;  3BU1 A;  2CZU A;  3NQ9 A;  2E4J A;  5HTD A;  1R0U A;  1SY3 A;  1BRQ A;  3JQO A;  5D48 A;  4ZH6 A;  5H9K A;  3EM0 A;  1E02 A;  1G5W A;  1T0V A;  3PH6 A;  4GH7 A;  4GZV A;  4UU2 A;  3NQ3 A;  2JU8 A;  2ACP X;  3PH5 A;  4YBP A;  2O62 A;  4IMN A;  5BYP A;  1IKE A;  1ICN A;  4XMF A;  1TOW A;  2KTD A;  3F6Z B;  4BQU A;  4M7M A;  3P6F A;  3NX1 A;  5IO7 A;  2LB6 A;  4Y0R A;  4YDA A;  4TKH A;  2HLV A;  5F7G A;  4MVI A;  3RBY A;  1LIE A;  2WUT A;  1LKE A;  1X8U A;  1NGL A;  2GTL M;  3ZWE A;  3CQN A;  2AL0 X;  4I3D A;  3ZQ3 A;  1BWY A;  3I17 A;  2FLJ A;  3WJG A;  3FW4 A;  5AQ6 A;  5BVS A;  1RLB E;  1HBP A;  2BS6 A;  2BHV A;  1EXS A;  3NPO A;  3C77 X;  3P6D A;  4GKC A;  4R0B A;  5FQ8 E;  3EBW A;  5HBS A;  4L1N A;  3FR4 A;  1UZ2 X;  1IIU A;  4I9S A;  4IB8 A;  2OVA A;  3P6H A;  4GU8 A;  4NYQ A;  4QYN A;  3FR2 A;  5HA0 A;  2ZAG A;  1GX8 A;  2AKQ A;  1LIF A;  2MJI A;  4ZHH A;  3HWE A;  3RWX A;  1MX7 A;  2OZQ A;  2WQA E;  3B2H A;  3PPT A;  3U9P C;  1PBO A;  4A1Y A;  5HZ8 A;  1BBP A;  1QFT A;  3GAQ A;  2A2U A;  4QGV A;  5AJC A;  4O4O A;  2L68 A;  2Z4H A;  1GT1 A;  4ZCB A;  4INN A;  3B2J A;  4KII A;  1A3Y A;  5EDB A;  1GM6 A;  4EFG A;  5KID A;  4YKM A;  2HZR A;  3D4R A;  3FA9 A;  1A57 A;  5HCE C;  5H9N A;  4MVE A;  2Q2M A;  3CMP A;  4ORU A;  3VE2 A;  1ADL A;  3QKG A;  3BLG A;  1RBP A;  1KT4 A;  1G85 A;  1B0O A;  4GET A;  3S5X A;  1JZU A;  4XMC A;  1PM1 X;  3U0D A;  2OVE A;  3UEX A;  4MIR A;  3VG7 A;  2CM9 A;  1FE3 A;  1B4M A;  3E3C A;  2A3F X;  5AJB A;  2WR6 A;  4MIS A;  1BJ7 A;  2BS5 A;  3ZW2 A;  1QQS A;  2LBV A;  4GE1 A;  2MWH A;  2WSJ A;  3ZUI A;  5H8T A;  3STN A;  3C78 X;  3D97 A;  1DZM A;  3OJY C;  5FEN A;  1EUO A;  4ZH9 A;  3ELZ A;  1IKJ A;  1IFB A;  2AT3 X;  3B2I A;  5BVQ A;  3WJF A;  4O4U A;  4ZFX A;  4Y0Q A;  1QWD A;  3DSZ A;  2A0A A;  5HA1 A;  5LJH A;  5LKF A;  4ZGU A;  4XMH A;  5H9A A;  4OMW A;  4YGZ A;  4ZHG A;  3B2L A;  1YWC A;  2X45 A;  3C76 X;  1EPB A;  1D3S A;  1Y9T A;  1O8V A;  2QOS C;  4ZGF A;  3O2Y A;  1KZX A;  4O3Z A;  1NP1 A;  4IB6 A;  5L8N A;  1LF7 A;  1E00 A;  2QMI A;  2QM9 A;  3APW A;  2HZQ A;  2LBA A;  5BVT A;  1FDQ A;  3OBL A;  4LZV A;  3WXQ A;  4GDZ A;  1ZNH A;  3PED A;  1L6M A;  1S44 A;  1B8E A;  1X8N A;  3HOL A;  5D45 A;  5F58 A;  4AZP A;  4TNN A;  2ASN X;  4QRL A;  4I6S A;  2A13 A;  1JYJ A;  2KW1 A;  3BDR A;  3S26 A;  4AZQ A;  4IAX A;  1GKA A;  4YCE A;  3ZI8 A;  3T1D A;  2OFM X;  4HFO A;  1U17 A;  2JOZ A;  3PP6 A;  2RA6 A;  4ZJ0 A;  2EU7 X;  2JW1 A;  4D6B A;  1KXO A;  3Q6L A;  1ERB A;  3ZW1 A;  4UU3 A;  2WEW A;  4U3Q A;  1JBH A;  1HBQ A;  1OBQ A;  4YBU A;  2ANS A;  2JN3 A;  5HAE A;  3LV4 A;  3FA7 A;  3HK1 A;  1IFC A;  1QAB E;  2ALL X;  2HNX A;  3PQS A;  1LFO A;  3NBX X;  1SY2 A;  4I95 A;  3OE3 A;  1MUP A;  1PMP A;  1Y9L A;  3NQK A;  4Y0S A;  2AT6 X;  4YGH A;  4TJZ A;  1A18 A;  4YMY A;  2R73 A;  4HPD A;  3HWG A;  1QY2 A;  1LIC A;  3CR6 A;  5HTE A;  2LFO A;  3NAD A;  4KT5 A;  4QQ1 A;  4O3Y A;  3APV A;  4EEJ A;  1EII A;  4Y0P A;  1HMR A;  5LKE A;  3MVF A;  1ZRY A;  1JJX A;  1BSO A;  1BEB A;  2FR2 A;  4HPB A;  2FT9 A;  4XMD A;  5EZ2 A;  1DC9 A;  5F1E A;  1CBQ A;  4I9R A;  1QY0 A;  4NYR A;  3O22 A;  4FGI B;  3EBK A;  4YKO A;  4PJ2 A;  1E5P A;  5EEE A;  3GE2 A;  5LJD A;  5CE4 A;  2KT4 B;  3WJB A;  1S2P A;  1ERX A;  3P24 A;  2FTB A;  4TQ2 A;  3L4R A;  4OS0 A;  1PEE A;  1SA8 A;  2FWV A;  5L8I A;  2G78 A;  2RN4 A;  3N91 A;  2KD2 A;  4ZR2 A;  4ES7 A;  2G79 A;  3VG2 A;  3VG3 A;  1JV4 A;  2FRS A;  3WVM A;  2W2B A;  3VG5 A;  2R56 A;  4WFU A;  3F8A A;  4ML7 B;  1O1U A;  5B27 A;  2M4L A;  1SMP I;  3WOV A;  1A2D A;  2AMM X;  1HN2 A;  1LPJ A;  4NLI A;  2X8S A;  2Q4N A;  4RUU A;  5FQ7 E;  4YDB A;  1T8V A;  1CBR A;  1YP7 A;  3BX7 A;  1BLR A;  2HYS A;  4FQB B;  3TGB A;  1CBI A;  3ZW0 B;  1X8P A;  2DM5 A;  1ML7 A;  3EMM A;  2LA7 A;  3KFG A;  3STM X;  4ORW A;  1LIB A;  5LJK A;  4ORS A;  1AB0 A;  4MVK A;  1OBP A;  1AEL A;  3EYC A;  1FTP A;  1FEN A;  5F6B A;  4ZHF A;  4EQA C;  2RD7 C;  1EW3 A;  2YG2 A;  4HWM A;  2RCQ A;  4ZHD A;  3BRN A;  1VYF A;  4ON1 A;  4YGG A;  1E06 A;  4AZM A;  2AH7 X;  4YFR A;  4M6S A;  5L8O A;  2NP1 A;  3DTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...