2G7IA

Structure of human complement factor h carboxyl terminal domains 19-20: a basis for atypical hemolytic uremic syndrome
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
124
structure length
124
Chain Sequence
GKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement factor H
publication title Structure of complement factor H carboxyl-terminus reveals molecular basis of atypical haemolytic uremic syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 22
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2006-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2g7iA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2g7iA02
1OK1A 2KMSA 3RJ3D 4AYIA 1HFHA 4A5WB 4ZH1D 3GXEA 1LY2A 3OP8A 2CG7A 5I0QB 3NFPI 1HCCA 1ELVA 2BZMA 2KRIA 3CALA 5HYUB 3O8EB 3ZD1A 2O39C 1FBRA 1VVCA 1OK2A 4F4OC 1TPMA 2XWJI 2EC3A 1OK9A 2A55A 3T5OA 2UWNA 2G7IA 1Z92B 2RLPA 3ZD2A 4ONTD 1O9AA 3ERBA 1E88A 2WIIC 4IGDA 1VVDA 3INBC 3IU3I 4C16A 2CKUA 1OJYA 1TPNA 4JHSA 1SRZA 1C1ZA 1OK3A 3MQLA 3OEDC 2JGXA 4PZ5A 5HYPA 2B5ID 3R62A 2MCZA 3SW0X 2MCYA 4CSYA 4LOTA 4B2RA 4DJZA 4WJG2 3TVJA 2RL0A 1MD7A 1GKNA 1UOTP 1G4FA 4YNXA 1E5GA 5FO8C 4KKDA 1GHQB 1QGBA 4B2SA 1H03P 5HYTB 1GKGA 1HFIA 2QY0A 2XRBA 2JRAA 1U5MA 5JPMG 1SS2A 3L89M 2YBYA 1CKLA 4LOSA 1H2QP 1Q3XA 1E8BA 3IX0A 1G4GA 1QUBA 4AYDA 2LOJA 3KXVA 1QO6A 1OJVA 2XWBF 2W81A 1TPGA 4FXGG 1OJWA 3OXUD 1MD8A 3ZRZA 4AYMA 2ERJA 1H2PP 2XQWC 2W80A 4K12A 2IZ3A 2IZ4A 1NWVA 2YRAA 1GPZA 3KZJA 2RKZA 4J38B 3M7PA 5HZPB 2CG6A 4MUCA 2EHFA 3EJHA 2V8EA 2XRDA 4AYEA 3GOVA 2RKYA 1H04P 1ZJKA 1PPQA 2JGWA 2RLQA
chains in the Genus database with same CATH superfamily
1OK1A 2KMSA 3RJ3D 4PO7A 1HFHA 4AYIA 4A5WB 4ZH1D 3GXEA 1LY2A 3OP8A 2CG7A 4MSLA 5I0QB 3NFPI 1HCCA 1ELVA 2BZMA 2KRIA 3CALA 5HYUB 3O8EB 3ZD1A 2O39C 1FBRA 1VVCA 4N7EA 1OK2A 4F4OC 1TPMA 5DN5A 3WSXA 2XWJI 2EC3A 1OK9A 2A55A 3T5OA 2UWNA 2G7IA 1Z92B 2RLPA 3ZD2A 4ONTD 1O9AA 3ERBA 1E88A 2WIIC 2X2ZA 4IGDA 1VVDA 3INBC 3IU3I 4C16A 2CKUA 1OJYA 3ZLDA 1TPNA 4JHSA 1SRZA 4BWCA 1C1ZA 1OK3A 3MQLA 3OEDC 2JGXA 4PZ5A 3WSYA 5HYPA 3K3TA 2B5ID 3CI0J 2Y8RA 3R62A 2Y8SA 2MCZA 3FGRA 3SW0X 2MCYA 4CSYA 4LOTA 4B2RA 4DJZA 4WJG2 3TVJA 2RL0A 1MD7A 1GKNA 1UOTP 1G4FA 4YNXA 1E5GA 5FO8C 2I2LA 5DN4A 3F6KA 4KKDA 1GHQB 1QGBA 4B2SA 1H03P 5HYTB 1GKGA 1HFIA 2QY0A 2XRBA 2JRAA 1U5MA 5JPMG 3ZLEA 1SS2A 4YIZA 3L89M 2YBYA 1CKLA 4LOSA 1H2QP 3NJAA 1Q3XA 1E8BA 3IX0A 1G4GA 1QUBA 4AYDA 2LOJA 3KXVA 1QO6A 4APLA 1OJVA 2XWBF 2W81A 1TPGA 4FXGG 1OJWA 3OXUD 1MD8A 2Y8TA 3ZRZA 4AYMA 2ERJA 3FGTA 1H2PP 2XQWC 2W80A 4K12A 2IZ3A 2IZ4A 1NWVA 2YRAA 2ZYCA 1GPZA 3KZJA 2RKZA 4J38B 3M7PA 5HZPB 2CG6A 4MUCA 2EHFA 3VWOA 3EJHA 2V8EA 2XRDA 4AYEA 3GOVA 2RKYA 1RLHA 1H04P 1ZJKA 1PPQA 2JGWA 2RLQA
chains in the Genus database with same CATH topology
1OK1A 2KMSA 3RJ3D 4AYIA 1HFHA 4A5WB 4ZH1D 3GXEA 1LY2A 3OP8A 2CG7A 5I0QB 3NFPI 1HCCA 1ELVA 2BZMA 2KRIA 3CALA 5HYUB 3O8EB 3ZD1A 2O39C 1FBRA 1VVCA 1OK2A 4F4OC 1TPMA 2XWJI 2EC3A 1OK9A 2A55A 3T5OA 2UWNA 2G7IA 1Z92B 2RLPA 3ZD2A 4ONTD 1O9AA 3ERBA 1E88A 2WIIC 4IGDA 1VVDA 3INBC 3IU3I 4C16A 2CKUA 1OJYA 1TPNA 4JHSA 1SRZA 1C1ZA 1OK3A 3MQLA 3OEDC 2JGXA 4PZ5A 5HYPA 2B5ID 3R62A 2MCZA 3SW0X 2MCYA 4CSYA 4LOTA 4B2RA 4DJZA 4WJG2 3TVJA 2RL0A 1MD7A 1GKNA 1UOTP 1G4FA 4YNXA 1E5GA 5FO8C 4KKDA 1GHQB 1QGBA 4B2SA 1H03P 5HYTB 1GKGA 1HFIA 2QY0A 2XRBA 2JRAA 1U5MA 5JPMG 1SS2A 3L89M 2YBYA 1CKLA 4LOSA 1H2QP 1Q3XA 1E8BA 3IX0A 1G4GA 1QUBA 4AYDA 2LOJA 3KXVA 1QO6A 1OJVA 2XWBF 2W81A 1TPGA 4FXGG 1OJWA 3OXUD 1MD8A 3ZRZA 4AYMA 2ERJA 1H2PP 2XQWC 2W80A 4K12A 2IZ3A 2IZ4A 1NWVA 2YRAA 1GPZA 3KZJA 2RKZA 4J38B 3M7PA 5HZPB 2CG6A 4MUCA 2EHFA 3EJHA 2V8EA 2XRDA 4AYEA 3GOVA 2RKYA 1H04P 1ZJKA 1PPQA 2JGWA 2RLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OK1 A;  2KMS A;  3RJ3 D;  4AYI A;  1HFH A;  4A5W B;  4ZH1 D;  3GXE A;  1LY2 A;  3OP8 A;  2CG7 A;  5I0Q B;  3NFP I;  1HCC A;  1ELV A;  2BZM A;  2KRI A;  3CAL A;  5HYU B;  3O8E B;  3ZD1 A;  2O39 C;  1FBR A;  1VVC A;  1OK2 A;  4F4O C;  1TPM A;  2XWJ I;  2EC3 A;  1OK9 A;  2A55 A;  3T5O A;  2UWN A;  2G7I A;  1Z92 B;  2RLP A;  3ZD2 A;  4ONT D;  1O9A A;  3ERB A;  1E88 A;  2WII C;  4IGD A;  1VVD A;  3INB C;  3IU3 I;  4C16 A;  2CKU A;  1OJY A;  1TPN A;  4JHS A;  1SRZ A;  1C1Z A;  1OK3 A;  3MQL A;  3OED C;  2JGX A;  4PZ5 A;  5HYP A;  2B5I D;  3R62 A;  2MCZ A;  3SW0 X;  2MCY A;  4CSY A;  4LOT A;  4B2R A;  4DJZ A;  4WJG 2;  3TVJ A;  2RL0 A;  1MD7 A;  1GKN A;  1UOT P;  1G4F A;  4YNX A;  1E5G A;  5FO8 C;  4KKD A;  1GHQ B;  1QGB A;  4B2S A;  1H03 P;  5HYT B;  1GKG A;  1HFI A;  2QY0 A;  2XRB A;  2JRA A;  1U5M A;  5JPM G;  1SS2 A;  3L89 M;  2YBY A;  1CKL A;  4LOS A;  1H2Q P;  1Q3X A;  1E8B A;  3IX0 A;  1G4G A;  1QUB A;  4AYD A;  2LOJ A;  3KXV A;  1QO6 A;  1OJV A;  2XWB F;  2W81 A;  1TPG A;  4FXG G;  1OJW A;  3OXU D;  1MD8 A;  3ZRZ A;  4AYM A;  2ERJ A;  1H2P P;  2XQW C;  2W80 A;  4K12 A;  2IZ3 A;  2IZ4 A;  1NWV A;  2YRA A;  1GPZ A;  3KZJ A;  2RKZ A;  4J38 B;  3M7P A;  5HZP B;  2CG6 A;  4MUC A;  2EHF A;  3EJH A;  2V8E A;  2XRD A;  4AYE A;  3GOV A;  2RKY A;  1H04 P;  1ZJK A;  1PPQ A;  2JGW A;  2RLQ A; 
#chains in the Genus database with same CATH topology
 1OK1 A;  2KMS A;  3RJ3 D;  4PO7 A;  1HFH A;  4AYI A;  4A5W B;  4ZH1 D;  3GXE A;  1LY2 A;  3OP8 A;  2CG7 A;  4MSL A;  5I0Q B;  3NFP I;  1HCC A;  1ELV A;  2BZM A;  2KRI A;  3CAL A;  5HYU B;  3O8E B;  3ZD1 A;  2O39 C;  1FBR A;  1VVC A;  4N7E A;  1OK2 A;  4F4O C;  1TPM A;  5DN5 A;  3WSX A;  2XWJ I;  2EC3 A;  1OK9 A;  2A55 A;  3T5O A;  2UWN A;  2G7I A;  1Z92 B;  2RLP A;  3ZD2 A;  4ONT D;  1O9A A;  3ERB A;  1E88 A;  2WII C;  2X2Z A;  4IGD A;  1VVD A;  3INB C;  3IU3 I;  4C16 A;  2CKU A;  1OJY A;  3ZLD A;  1TPN A;  4JHS A;  1SRZ A;  4BWC A;  1C1Z A;  1OK3 A;  3MQL A;  3OED C;  2JGX A;  4PZ5 A;  3WSY A;  5HYP A;  3K3T A;  2B5I D;  3CI0 J;  2Y8R A;  3R62 A;  2Y8S A;  2MCZ A;  3FGR A;  3SW0 X;  2MCY A;  4CSY A;  4LOT A;  4B2R A;  4DJZ A;  4WJG 2;  3TVJ A;  2RL0 A;  1MD7 A;  1GKN A;  1UOT P;  1G4F A;  4YNX A;  1E5G A;  5FO8 C;  2I2L A;  5DN4 A;  3F6K A;  4KKD A;  1GHQ B;  1QGB A;  4B2S A;  1H03 P;  5HYT B;  1GKG A;  1HFI A;  2QY0 A;  2XRB A;  2JRA A;  1U5M A;  5JPM G;  3ZLE A;  1SS2 A;  4YIZ A;  3L89 M;  2YBY A;  1CKL A;  4LOS A;  1H2Q P;  3NJA A;  1Q3X A;  1E8B A;  3IX0 A;  1G4G A;  1QUB A;  4AYD A;  2LOJ A;  3KXV A;  1QO6 A;  4APL A;  1OJV A;  2XWB F;  2W81 A;  1TPG A;  4FXG G;  1OJW A;  3OXU D;  1MD8 A;  2Y8T A;  3ZRZ A;  4AYM A;  2ERJ A;  3FGT A;  1H2P P;  2XQW C;  2W80 A;  4K12 A;  2IZ3 A;  2IZ4 A;  1NWV A;  2YRA A;  2ZYC A;  1GPZ A;  3KZJ A;  2RKZ A;  4J38 B;  3M7P A;  5HZP B;  2CG6 A;  4MUC A;  2EHF A;  3VWO A;  3EJH A;  2V8E A;  2XRD A;  4AYE A;  3GOV A;  2RKY A;  1RLH A;  1H04 P;  1ZJK A;  1PPQ A;  2JGW A;  2RLQ A; 
#chains in the Genus database with same CATH homology
 1OK1 A;  2KMS A;  3RJ3 D;  4AYI A;  1HFH A;  4A5W B;  4ZH1 D;  3GXE A;  1LY2 A;  3OP8 A;  2CG7 A;  5I0Q B;  3NFP I;  1HCC A;  1ELV A;  2BZM A;  2KRI A;  3CAL A;  5HYU B;  3O8E B;  3ZD1 A;  2O39 C;  1FBR A;  1VVC A;  1OK2 A;  4F4O C;  1TPM A;  2XWJ I;  2EC3 A;  1OK9 A;  2A55 A;  3T5O A;  2UWN A;  2G7I A;  1Z92 B;  2RLP A;  3ZD2 A;  4ONT D;  1O9A A;  3ERB A;  1E88 A;  2WII C;  4IGD A;  1VVD A;  3INB C;  3IU3 I;  4C16 A;  2CKU A;  1OJY A;  1TPN A;  4JHS A;  1SRZ A;  1C1Z A;  1OK3 A;  3MQL A;  3OED C;  2JGX A;  4PZ5 A;  5HYP A;  2B5I D;  3R62 A;  2MCZ A;  3SW0 X;  2MCY A;  4CSY A;  4LOT A;  4B2R A;  4DJZ A;  4WJG 2;  3TVJ A;  2RL0 A;  1MD7 A;  1GKN A;  1UOT P;  1G4F A;  4YNX A;  1E5G A;  5FO8 C;  4KKD A;  1GHQ B;  1QGB A;  4B2S A;  1H03 P;  5HYT B;  1GKG A;  1HFI A;  2QY0 A;  2XRB A;  2JRA A;  1U5M A;  5JPM G;  1SS2 A;  3L89 M;  2YBY A;  1CKL A;  4LOS A;  1H2Q P;  1Q3X A;  1E8B A;  3IX0 A;  1G4G A;  1QUB A;  4AYD A;  2LOJ A;  3KXV A;  1QO6 A;  1OJV A;  2XWB F;  2W81 A;  1TPG A;  4FXG G;  1OJW A;  3OXU D;  1MD8 A;  3ZRZ A;  4AYM A;  2ERJ A;  1H2P P;  2XQW C;  2W80 A;  4K12 A;  2IZ3 A;  2IZ4 A;  1NWV A;  2YRA A;  1GPZ A;  3KZJ A;  2RKZ A;  4J38 B;  3M7P A;  5HZP B;  2CG6 A;  4MUC A;  2EHF A;  3EJH A;  2V8E A;  2XRD A;  4AYE A;  3GOV A;  2RKY A;  1H04 P;  1ZJK A;  1PPQ A;  2JGW A;  2RLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...