2G8HA

B. halodurans rnase h catalytic domain d192n mutant in complex with mg2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKANYGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 40
structure length 136
sequence length 136
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8hA00
3LZIA 4DU1A 3MEGA 4O55A 4C8LA 3I0RA 1S9GA 4DSJA 4H8KA 4B8CA 3LANA 4DTSA 3KLGA 1I39A 5EU7A 3U3YA 4W5QA 1JL2A 4C8NA 1SUQA 3CFRA 4LSNA 3KLHA 2F8SA 3B6PA 3ZT1A 3TARA 3PX6A 4DQQA 1GOAA 1IG9A 4M3XA 3NF8A 2IGIA 1BL3A 4DLEA 1WNSA 3LAMA 4M3WA 4Y1CA 3ZT3A 3RTVA 3HJFA 3AA2A 3G10A 2Y1JA 4OKJA 3ALYA 3OYLA 3TABA 1WSFA 4DQIA 1BCOA 2IS3A 3QEVA 3HPGA 3MEEA 1QSLA 4B3OA 3RMDA 1RCHA 1S6QA 3OY9A 1U48A 4HUGA 2B4JA 2HNDA 1D9FA 5J2PA 5J2NA 4AHCA 2A1RA 4E3SA 3HK2A 4CJUA 4CGDA 4I9QA 3RMCA 4FCYA 3RMBA 1L3SA 4FJXA 2HHQA 1TAUA 1J9AA 4UQGA 1X1PA 3D0PA 5DK5A 3HT3A 4DFJA 1NJWA 3IG1A 4CJLA 4BE0A 1VSDA 4B8AB 3DRPA 1VRUA 4DU3A 2OA8A 4KTWA 1UAXA 2RF2A 3L2VA 4RW6A 1RT2A 4CGGA 5KRTA 3NAEA 1IH7A 3TAGA 4DWIA 4CHZA 3P83D 4Z4HA 2HB5A 4KV8A 2FBTA 1RTJA 5C25A 3HL8A 4FJIA 1BQNA 1U47A 4EP4A 4F3OA 5FROA 4RW9A 1IKVA 2X78A 2XY8A 1JXBA 3NFAA 4B9TA 4GMJB 1SV5A 5HRPA 4JS5A 3SCXA 2HVIA 3SI6A 4QCLA 5FRNA 5CY4A 3OYGA 2RKIA 3HPHA 3AVNA 3VQBA 1TK5A 3ZSWA 1RDBA 4BDPA 2WONA 3F9KA 1CXUA 1S1UA 3AO3A 4DFMA 3OYMA 5I42A 2G8HA 3BDPA 3NGIA 1D9DA 1RTDA 1UWBA 1WSHA 1BIUA 4DSFA 1SKWA 4CEBA 4O44A 4CJEA 2E6LA 4PA1A 3OYBA 4KI4A 2XO7A 4KAZA 2NUBA 4EZ9A 4FM2A 3I8DA 4KRFA 1KVCA 1YTUA 1ASUA 3OJSA 4FK0A 3KLEA 1DLOA 3V9UA 4DTRA 1BHLA 3SUOA 1S1TA 1NK5A 4WE1A 4PWDA 2HVHA 2IDOA 5KGWA 3SUPA 3K5MA 3SNNA 1C1BA 2R7YA 3C94A 1WSEA 3DMJA 4CF9A 1EXQA 3K59A 1T8EA 4E7JA 1VSHA 4HUEA 1TVRA 3KKRA 4NCGA 3SQ2A 1RT7A 1NOYA 4B9NA 3AVCA 4KHUA 4FJ9A 1HPZA 4Z4FA 3K57A 1RBTA 1TV6A 1KVAA 3K5LA 1C0TA 3FFIA 3KLIA 4Y1DA 1NK4A 1J5OA 1TAQA 3RWUA 4ZHRA 3OYEA 1EX4A 4FLXA 4FLYA 4J2EA 3CFOA 5CYQA 1C1CA 5E41A 2G8VA 3OYFA 4KHNA 3KK2A 1IKWA 3EZ5A 5SWMA 1SL1A 1G15A 4IFVA 3AVKA 1JLAA 3AO5A 5CZ2A 1NK0A 1D8YA 4KB1A 1WLJA 3ZSZA 5T7BA 3OS2A 1D5AA 1L5UA 2Y1IA 4FJ8A 3AA3A 4ICLA 3V9SA 2JGUA 3UIQA 4OGEA 4M3RA 3AV9A 1RILA 3AVJA 4CEQA 4CGIA 2KQ2A 2G8FA 3SUQA 1DTTA 3AVAA 4CEDA 2EX3A 3PO4A 4Z4CA 4HHTA 4CF1A 3HM9A 2G8WA 4DF4A 3KLFA 4CJTA 1JLGA 4DTXA 4F2RA 5KTQA 1SL0A 4FXDA 4FLTA 2F96A 3IAYA 4CESA 3ITHA 4B9UA 3VQPA 4YNQA 1HQEA 4NYNA 3I0SA 1FK9A 2I5JA 1KLNA 3OYKA 3L2WA 3QESA 4NYFA 3VQ4A 1RTIA 5FRMA 1Z26A 2EHGA 4CJ4A 3HVTA 5HBMA 2VG6A 3HP9A 4CK3A 3OYAA 3B6OA 3MXMA 1NKCA 4M3UA 2AJQA 2QXFA 3DLEA 4N56A 4DTNA 3QIOA 4DQRA 4KREA 1B9DA 2YKMA 3DI6A 2RN2A 4HVJA 3HO1A 1RDCA 2LSNA 2DFHA 4DTPA 1XI1A 4Z4EA 2HHSA 1XHXA 3KTQA 1C1AA 1RT3A 4PUOA 1O1WA 1Q9YA 3KD1E 4CJQA 1HRHA 4FZXC 3MECA 3S3NA 2OYQA 3OYIA 3AVMA 1S6PA 3DLKA 4CGFA 3RRGA 2HHXA 2Q3SA 1L3VA 4DFPA 4O4GA 4CF0A 3NDKA 1TL1A 1TKZA 1RBUA 2JLEA 1U04A 2ZD1A 3K5OA 3OYDA 3LWMA 4AILC 4B9MA 2OZSA 4G1QA 1YTAA 5CZ1A 3LP2A 5HRSA 1T03A 5J2QA 4W5NA 4M41A 3TAEA 3L8BA 1XHZA 3KD5E 4E7HA 4N41A 4FJLA 3CG7A 3ZSRA 3NHGA 3MXJA 3SUNA 4NCAA 3RR7A 3QNNA 4OKEA 4I2PA 3T3FA 3MAQA 5KGXA 3PX0A 4CEZA 2XHBA 1T05A 2OPQA 3V4IA 1WAFA 4EZ6A 4AHVA 3QINA 3TAFA 4JRPA 4CFBA 1RBRA 4CFCA 2DFEA 3P5JA 3CM6A 3KKSA 3JYTA 3LDSA 2BGGA 3S3MA 3IRXA 4CGHA 1ZBIA 4CF2A 1QHTA 4F4KA 1A5XA 1VRTA 2D0BA 3NF6A 4HTUA 4KPYA 4KHQA 1MU2A 4K8XA 2HHUA 3L3UA 3OS0A 1L3UA 4LSLA 3HSTB 1X9WA 1NK7A 2ITGA 4W5OA 3ISNC 4DS5A 4B9VA 3NH1A 5J1EA 4CK1A 3OYNA 1DTQA 3ZSYA 2YNFA 3OS1A 3O4NA 2E4LA 1A5WA 2KZZA 4FLUA 2P51A 3DOKA 4FLZA 2BE2A 2YKNA 1GOBA 1GOCA 1VSFA 3WNFA 3QEIA 1KRPA 4L8RB 4KHSA 4CIEA 1RTHA 2RPIA 1BI4B 3DRSA 3QERA 1RT5A 1S1WA 1JLBA 4RW4A 3T19A 1LAWA 2Z1GA 5CYMA 4DG1A 4DQSA 1EKEA 1NK8A 2G8UA 2PYLA 4IFYA 1EP4A 4FZZA 4DSLA 1JKHA 1FKPA 2BANA 2X6NA 5KRSA 4KTQA 2YHBA 3ASMA 1KTQA 2G8KA 1NJYA 3AVFA 4OJRA 5HLFA 3QO9A 1NKBA 1VSKA 4M3ZA 3V6DA 1RT6A 4PY5A 4E7KA 1FXXA 1RT1A 1Y97A 1RBVA 4B08A 2IAJA 1NOZA 1KSPA 1CXQA 1BI4A 4M42A 4M3YA 4KKOA 3LP3A 3D45A 3JSMA 4DTJA 3KIOA 4IBNA 1NK9A 1SL2A 4F8RA 2G8IA 1LAVA 3DLHA 4FJ5A 4CEAA 5C42A 4CERA 4DF8A 4Q0BA 2OPPA 1JLFA 1S1VA 3QLHA 1JXEA 1QSSA 3NBPA 3CYMA 1LV5A 3LP1A 3S3OA 1QQCA 1QSYA 3T1AA 4J2BA 2PZSA 1KCFA 2GV9A 3M8PA 4JRQA 2PY5A 5K14A 3VQAA 1C6VA 3NH2A 1SKSA 3SV3A 1LW0A 1ZBFA 2A1SA 3H08A 4CJ5A 1NK6A 4OLAA 4FJHA 4CCHA 4M3TA 1EETA 4C8MA 4NCBA 4CJFA 4DQPA 3AO2A 3NH0A 1QE1A 4YFUA 3CQ8A 1IO2A 1KFSA 4HCBA 4IG3A 4K8ZA 3ZSQA 4Z4IA 2ATQA 3HYFA 1LW2A 3K5NA 1WSGA 2Z1JA 4CGJA 4AHTA 4FK2A 2F8TA 1C0UA 4ELVA 1F21A 3U3GA 1REVA 3TANA 4ELUA 1W0HA 3C95A 4CJWA 3KK1A 1UOCA 2YNIA 3M8SA 4FM0A 4AHRA 1U4BA 1B92A 1L3TA 3V1OA 5HRNA 4OPKA 4FLWA 3OYCA 3KJVA 2KFZA 3CFPA 4CEFA 3PX4A 2XY6A 3ZT0A 4JS4A 3G0ZA 3NE6A 3VA3A 3AVLA 3V81A 4ID1A 3V9ZA 3LZJA 1ZBUA 3SV4A 4CEEA 2B5JA 2VG5A 4KFBA 4AHUA 1HYSA 2OPSA 1BISA 3DLBA 3NCIA 4E1NA 1U45A 3VQ5A 3PO5A 4FZYA 1S5JA 5FDLA 4CFAA 3RR8A 4BDYA 1VSLA 3NGZA 3LPTA 3TR8A 3DRRA 1KFDA 3L2UA 5D3GA 4Z0UA 2VG7A 3L2RA 2GBZA 3LALA 4H4MA 3QEXA 5J2MA 2E6MA 3S9HA 4OGCA 3U6FA 4TSXA 4AHSA 4CHYA 4DSEA 2W42A 4CJVA 3L2QA 2PYJA 2X74A 4CHQA 1QTMA 4HCCA 4OLBA 3M8QA 1HNIA 5DMRA 3OYJA 1FKOA 3SYZA 2OPRA 4LH5A 1A5VA 1X9MA 4FM1A 1T7PA 1NJXA 1BGXT 4CJRA 3OYHA 3PY8A 1C0MA 1S1XA 1TKDA 4KB0A 5C24A 4BE2A 4CFDA 3K2PA 4KHYA 3TAQA 2HHTA 4O5BA 2HW3A 2P1JA 4Z4GA 4DU4A 1J53A 1R0AA 5KI6A 2ZE2A 1X9SA 2BDPA 1I3AA 2FBXA 2HNYA 3A2FA 4I2QA 2KZMA 2ZQBA 2HNZA 2HHVA 2FBYA 4DTMA 2D0AA 2YNGA 4MFBA 3VQQA 2DY4A 2DTUA 2FC0A 3AO4A 3VA0A 3QETA 3HP6A 4RW8A 3QIPA 4O0JA 4E19A 3DOLA 3MXIA 4F2SA 4R5PA 3DM2A 3PV8A 1U49A 1N6QA 4CJ3A 2KW4A 4OVLA 4FJNA 1Z25A 1UA1A 3O3HA 3HXMA 2D0CA 3TWHA 4GVMA 1RNHA 4DS4A 3AA4A 1RBSA 4E1MA 3SQ4A 4BACA 5HP1A 3V1QA 3SQ1A 1W9HA 1K6YA 1B9FA 1HQUA 2GUIA 1LWCA 1RDDA 3CM5A 3ZT2A 1HYVA 4CIGA 4W5RA 1NJZA 2QK9A 2O4IA 2ETJA 4CHOA 1JL1A 3QEPA 4J2AA 1TKTA 2P5OA 3LP0A 1NKEA 1S9EA 2Z1HA 4BWMA 4CK2A 1JLEA 3ZCMA 1WSJA 2VWKA 4Q5VA 1KVBA 3KK3A 2QKKA 4C8OA 1TL3A 2KFNA 2OZMA 3AA5X 2VWJA 4KHWA 3M8RA 1XWLA 3AVIA 4ID5A 4H4OA 3P1GA 4CE9A 4DTOA 4FJGA 3PUFA 4CJKA 4BE1A 1RDAA 4CF8A 1VSEA 3ZT4A 1QS4A 3O3GA 1TKXA 3DLRA 4DTUA 1KLMA 2XRIA 5JS2A 3RMAA 4QOZB 5JS1A 1LWEA 3VQ8A 4RG8A 4N5SA 2YNHA 1ZYQA 3VQEA 2YHAA 4I7FA 2Z1IA 4FW1A 4CHPA 2XY5A 3VN5A 3E01A 3BGRA 1BIZA 3V1RA 5HROA 3AVGA 4J2DA 4FW2A 4LH4A 4LY7A 3OJUA 4EP5A 2HHWA 3L3VA 3WNHA 1HJRA 2QKBA 1ASWA 3NF7A 4IG0A 1TK0A 4FJMA 4ELTA 1J54A 3WNEA 3O4QA 4HUFA 2WOMA 3OVNA 2KTQA 4CECA 3VQ7A 4CIFA 1WAJA 5I3UA 1CZ9A 4N47A 4O0IA 3QNOA 3VQ9A 3NF9A 4OKKA 3V9XA 4FJ7A 4KI6A 3VQCA 1YVUA 2D5RA 3C6UA 3MEDA 4CJPA 3O3FA 2O4GA 3THVA 4FYDA 4I9LA 2DFFA 4AH9A 1UA0A 1IKXA 3F73A 4XIUA 3SPYA 4DSKA 5HRRA 1BQMA 4M45A 4FJKA 3DLGA 4GW6A 4DSIA 4MQ3A 1JLQA 1CLQA 4KO0A 4CEOA 4CHNA 4B9SA 3ZSVA 1Q9XA 1RT4A 4FJJA 4BWJA 4IDKA 4QAGA 1WN7A 3ULDA 3TAMA 3SJJA 4B9LA 1BCMA 1Q8IA 3RRHA 3TAPA 1CZBA 2X6SA 1WSIA 4LD0A 4DLGA 4FLVA 3EYZA 1N5YA 1ZBHA 2HMIA 1ASVA 3ZSXA 4C8KA 1VSJA 3SPZA 4E7IA 4KTZA 2FBVA 4FK4A 3SQ0A 3IS9A 1HYZA 3HPOA 3NGYA 2YV0X 3VQ6A 1SKRA 3ZSOA 4N76A 3LWLA 4IKFA 3AVHA 1TGOA 1YT3A 3DYAA 3WNGA 4CJSA 3LAKA 1VK0A 1JLCA 3EY1A 2B6AA 3K58A 4DFKA 4ZTFA 4ZTJA 1IKYA 4E0DA 3C6TA 1HNVA 4DMNA 4E89A 4OPJA 2XY7A 1ZBLA 3LPUA 4JLHA 3AO1A 4BDZA 4PQUA 4E7LA 4FVMA 3SZ2A 3QEWA 3TI0A 1TK8A 2P5GA 2IOCA 4RW7A 1VSIA 3AVBA 3VQDA 1LWFA 1VSMA 1ITGA 1XC9A 2IC3A 4W5TA 4F3TA 5SZTA 1HMVA 3HVRA 3V9WA
chains in the Genus database with same CATH superfamily
4DU1A 3I0RA 1G99A 5AZIB 2NRXA 3B6PA 4GY2B 3P38A 1BL3A 3LAMA 4M3WA 4Y1CA 3RTVA 3AA2A 4OKJA 3ALYA 3LDLA 1BCOA 2IS3A 2V7ZA 3FE1A 1QSLA 2YJFA 2FF3B 2HNDA 1X3NA 1W2BM 5AQNA 1NGAA 2Q1NA 4I9QA 2HHQA 4FCYA 1L3SA 2UUAK 4BRDA 3EO3A 3VF4A 4UQGA 1X1PA 1NJWA 3IG1A 3DRPA 1GLJO 4KTWA 2RF2A 3L2VA 4RW6A 1RT2A 4CGGA 5I9EB 3C6HA 3PSIA 3PIPL 3HL8A 3I56N 4NXNK 2X78A 3RSEA 3H6EA 1SV5A 3SCXA 4ISGA 3SI6A 3BUZB 3AARA 1IBKK 1D4XA 5FRNA 3OYGA 5GAGP 2RKIA 3HPHA 3AVNA 3GBTA 1TK5A 1NGEA 4EFHA 3F9KA 1CXUA 2G8HA 3ZX2A 5BPLA 1UWBA 2OTLN 2KKZA 1XC3A 4CJEA 2E6LA 1K9MO 2A6AA 3F9MA 4KAZA 4FM2A 2D0OA 1ASUA 3VEWA 3V9UA 3ATUA 3CHWA 1GLLO 1S1TA 3SUOA 1NK5A 3NVKA 1W7AA 4JHDB 3SNNA 4IOXA 3U4LA 2R7YA 3DMJA 1WSEA 1GLAG 1VSHA 4HUEA 3KKRA 3AVCA 3KZBA 5F2RA 4Z4FA 1RBTA 4MLEA 1C0TA 5M1QA 3P31A 4FLYA 4KHNA 1SL1A 4K43A 3BY5A 1L5UA 1BG3A 2Y1IA 3CC2N 4WYBA 4CGIA 2G8FA 3A5LC 3T69A 4CBWA 4CZKA 4DQ8A 2ASPA 4Z4CA 5JVHL 1VAZA 4HHTA 4DF4A 4DTXA 4F2RA 4CD1A 5BRDA 4FLTA 4B9UA 4H0PA 3VQPA 1HQEA 3I0SA 2I5JA 3IDHA 3WT0A 4B3SK 3ZEUA 3OYKA 3L2WA 3QESA 3LDPA 1RTIA 4BRCA 3AAPA 2VG6A 3HP9A 1NKCA 3OYAA 3MXMA 4XEIA 3DLEA 1YJWN 4KREA 1B9DA 2YKMA 2RN2A 4C1NK 4HVJA 4DUYK 1YVNA 2W6KA 1O1WA 3KD1E 3FR0A 3M6GA 3THWA 3AVMA 3ULEA 3CJ1A 2PFUA 4DFPA 1TL1A 2JLEA 1RBUA 4AILC 1Z05A 3MK6A 2A41A 1GLDG 3O6WA 5HRSA 4ILJA 4A61A 3EZWA 3CCJN 3TAEA 3KD5E 4N41A 5JVGL 3ZSRA 4WQ4C 3T3FA 2FSJA 3FGUA 3B8AX 3ENBA 4BR4A 5KGXA 3MAQA 3V4IA 3U9ZA 5TKYA 1WAFA 3Q7BA 3CJ9A 4AHVA 3TAFA 4YOUA 3JAMO 4FWSA 1RBRA 4CFCA 3R8EA 2DFEA 3G4SN 1KD1O 1YIJN 1ZBIA 4CF2A 4KHQA 3NF6A 4HTUA 1MU2A 4JK9A 1L3UA 1X9WA 1NK7A 3ISNC 3ZSYA 5KQDA 4H0YB 4F9OA 3O4NA 3DOKA 1GOBA 4JI5K 3C7NB 4BVPA 2RPIA 1BI4B 5AQQA 4BR7A 4RW4A 1LAWA 4X64K 1JKHA 3U9DA 3IKMA 1KTQA 2G8KA 4DR6K 5HLFA 4FWQA 4JKDA 4M3ZA 1ESVA 4JKGA 1RT1A 4LF4K 3UKUA 4KKOA 3LP3A 3D45A 3H1QA 3JSMA 1JCFA 4IBNA 4L3QA 3D6RA 4H03B 4O8KA 5GAEP 5C42A 3TSUA 3QLHA 1JXEA 1QSSA 3NBPA 3S3OA 3OW2M 1QSYA 4JV5K 3NH2A 1SKSA 3A8YA 2A1SA 5DM6L 4CJ5A 4CCHA 4MDBA 5C15A 3CQ8A 4HCBA 1KFSA 4IG3A 1GLEG 4Z4IA 4FPAA 5AQTA 3BF1A 2Z1JA 2F8TA 4FK2A 3FZKA 1F21A 1OH5A 5M1NA 2AA4A 1M90O 3DAWA 3KK1A 2A3ZA 3M8SA 4AHRA 1B92A 1L3TA 4CZGA 4OPKA 3WXLA 1K8AO 2HBKA 2HBJA 1JJ2M 3ZT0A 2HF3A 2P9KB 4JS4A 1BOTO 3AVLA 4ID1A 3LZJA 2B5JA 2VG5A 4KFBA 5AQMA 2UXCK 3DLBA 3ID6A 3PO5A 5FPMA 4BR0A 4NB4A 1Q86O 5D3GA 5AQXA 4NLBA 2E6MA 3VGLA 2W42A 4HCCA 1QTMA 3P4IA 4H0TB 3SAHA 3OYJA 3U8XA 2OPRA 1WBDA 1A5VA 5M1PA 1BGXT 2DPNA 4CJRA 3OYHA 3JS6A 1S1XA 3PY8A 3TAQA 2HHTA 1BU6O 3D2EB 2P9PA 4DU4A 1ILYA 2CGJA 1X9SA 3A2FA 3O08A 2E1YA 1KQSM 2YNGA 4MFBA 3AO4A 4O0JA 5A2QO 3DOLA 3MWTA 1NLVA 3MXIA 2ZJPL 1GLBG 1U49A 3PV8A 4CJ3A 3MCPA 4HTLA 4IZ9A 4FJNA 1Z25A 5FPDA 1UA1A 1J6ZA 1HLUA 3M5RA 2A40A 4Y0WA 3CD6N 2NRHA 1K6YA 3VTIA 1NGBA 3TTFA 1NJZA 2A5XA 2UXBK 2F9TA 2QI2A 4A59A 5IT9O 3MWPA 3ENHA 3KK3A 2O8CB 4KHWA 4BRNA 2GTDA 4CE9A 1S72N 1TYQA 3CJBA 4BE1A 1VSEA 2YX6A 3ZT4A 3O4WA 4DTUA 5JS1A 3VQ8A 1YJ9N 2YNHA 4FSVA 3VQEA 3KK7A 2NRWA 1LCUA 2XY5A 3BGRA 3THYA 1Q18A 4LY7A 5C2DA 5BPNA 1HJRA 3NF7A 4ELTA 3O4QA 4WQ5A 4C1NI 2A42A 4BGAA 4CBXA 1HKCA 4O0IA 3NF9A 4OKKA 3V9XA 4FJ7A 4KI6A 4I9LA 3F73A 1NG9A 2NRTA 1Q7YO 4FWMA 4DSKA 1QVFM 1BQMA 4GW6A 4B9SA 4IJNA 2Q31A 3L0QA 4BWJA 3TAMA 1SS6A 4QS8A 3BEXA 4FLVA 2W6LA 1DKGD 1ZBHA 3O9UA 4C8KA 3MMVA 1XNRK 3R6MA 4N76A 3NGYA 2YV0X 4E1JA 1JLCA 2B6AA 4BROA 3C6TA 1ZBLA 3LPUA 4JLHA 1IBLK 4BDZA 3VENA 1HUXA 1QQMA 3KVGA 4GV9A 2RE2A 2ZJRL 3Q7CA 3FZMA 3BDPA 3M1FA 3MEGA 1S9GA 4DTSA 1I39A 3U3YA 1JL2A 4C8NA 1P90A 4KH4A 2F8SA 4DQQA 1GOAA 1IV0A 4M3XA 4DLEA 3H46O 1WNSA 4G9ZA 5JLHA 1WSFA 3WXIA 1LOTB 4X65K 2Q36A 1U2VA 4OO1J 2FF6A 3HPGA 3RMDA 3OY9A 3HRGA 3KWIA 3CMEN 2BUPA 4JI1K 2KLAA 2B4JA 3O9TA 4AHCA 2A1RA 3RSEB 4CD3A 4CJUA 4CGDA 3RMCA 1J9AA 3D0PA 4DFJA 2PY5A 1VHXA 4IFEA 1QVGM 4DR4K 1VRUA 3SJHA 4DU3A 3J7AP 3TAGA 5KRTA 1IH7A 4CHZA 4Z4HA 1NM1A 5M1FA 1BQNA 2XY8A 5BR8K 3NFAA 3SMSA 2HVIA 4BRKA 1RGIA 3TPQA 5CY4A 3VQBA 3C0BA 1VQPN 3ZSWA 1RDBA 2W41A 3AO3A 4FWLA 3MX2A 5I42A 1RDWX 3NGIA 1D9DA 1WSHA 4YOTA 4CEBA 4LF7K 4M63C 2ZGZA 4AQYK 3T1HK 4EZ9A 4KRFA 1BWFO 1KAZA 1X9JA 5AQJA 4DTRA 1YITN 3VEVA 4PWDA 4WE1A 2HVHA 5KGWA 5C12A 3CCEN 4BQZA 4CF9A 1T8EA 3DJCA 3I8BA 4NCGA 4DB3A 4JKAA 1HPZA 4MDAA 4XH1A 3KLIA 4IJAA 4Y1DA 1J5OA 1TAQA 4ZHRA 1EX4A 4FLXA 4J2EA 2KHOA 2CH5A 5CYQA 5E41A 4CZEA 1IKWA 5SWMA 4A2AA 1JCEA 4DV1K 1G15A 1JLAA 1NK0A 4KB1A 4JN4A 1HKBA 1WLJA 3ZSZA 3OS2A 1D5AA 3PSFA 3AA3A 3EEQA 3SAGA 4ICLA 4JYAK 3V9SA 4OGEA 3AVJA 4CEQA 3FZLA 2EX3A 4YY3K 3HM9A 1JLGA 4U7BA 4FXDA 5KTQA 5ADXA 3O1WA 4JNEA 2F96A 3ITHA 3LM9A 3L4IA 3SK3A 3P39A 3THWB 2GEMA 2NRRA 3ULEB 4DSLA 3A5OC 4CK3A 2QXFA 4HWIA 1VQ9N 2NZTA 4ISFA 4A5BA 2DFHA 4Z4EA 4GV6A 3KTQA 1C1AA 1Q9YA 4CJQA 1HRHA 1TUYA 1S6PA 1W97L 3DLKA 4JD2A 4BRFA 4O4GA 3K5OA 3LWMA 4B9MA 2OZSA 4FO0A 2Q0UA 4W5NA 4XH5A 2VWBA 1XHZA 4E7HA 4YORA 4FJLA 4NCAA 2Q2RA 3PX0A 4CEZA 1T05A 2NRZA 3VEZA 3P5JA 3CM6A 1EWRA 2YI1A 3LDSA 2BGGA 4NLCA 2QWMA 3LDOA 4A2BA 4MO4A 4F4KA 4BC4A 3ZX3A 2WTUA 5F1XA 4IOAL 4K8XA 2HHUA 3G6EN 2ITGA 4B9VA 1C0FA 5J1EA 4CK1A 3OS1A 1A5WA 4FLUA 4JKGB 1VSFA 1GOCA 3QEIA 1KRPA 4KHSA 1RTHA 3UKUB 3QERA 3M3ZA 2Z1GA 2OANA 5AQPA 4IFYA 1WOQA 1FKPA 2UYTA 3HOSA 3HM8A 4O5FA 3QO9A 5CE3A 3WEEA 1N32K 4BR2A 3V6DA 1RT6A 2E2PA 5M1OA 1FXXA 3VOVA 1RBVA 1NOZA 1ZC6A 2NNWA 1KSPA 1CXQA 3TU5A 4DTJA 4BRQA 1ATRA 1LAVA 3CF5L 2G8IA 4CERA 1S1VA 3CCSN 3CYMA 1QQCA 3T1AA 2PZSA 5GIPA 2GV9A 1FW6A 3VQAA 1C6VA 2QTDA 1NK6A 3SV3A 4H5NA 1ZBFA 3E9OA 4NCBA 2PBDA 4LF9K 4YFUA 3CERA 3ZSQA 5LMNK 2ATQA 3QICA 1E4GT 4B1XB 1WSGA 3J7ZO 4CGJA 4AHTA 4H0OA 1C0UA 3SMPA 4Z94A 5HRNA 2JWLA 3KJVA 3CFPA 3PX4A 5BRHA 3KHYA 3K9JA 3G0ZA 4BC3A 5BN9A 3V9ZA 3DLLL 2O8EA 4AHUA 4DV5K 1U45A 5F0XA 4FZYA 1XMQK 3CCVN 5FDLA 3RR8A 3QFUA 3LPTA 3TR8A 3DRRA 3LDNA 2UUCK 4FOIA 3L2RA 4H4MA 2P9PB 4OGCA 3VESA 2IIRA 4DSEA 2PYJA 4I6MA 4CJVA 2X74A 3SYZA 4FM1A 1T7PA 2W40A 1NJXA 2GX9A 3OBYA 5M1KA 1CZAN 4JK8A 4DV6K 5KI6A 3WQTA 1I3AA 2ASMA 4B1UB 1R59O 2FBYA 1V4TA 3CCRN 4DTMA 3EKSA 2DTUA 1ZXOA 2D1KA 3VA0A 4WQ5C 1NJIO 1QZ5A 4BGBA 2KW4A 4OVLA 1VQON 2QXLA 3HTVA 3HXMA 2D0CA 4DV7K 1HNXK 4DS4A 3AA4A 1B9FA 1LWCA 1TYQB 2HF4A 3CJ7A 3CQXA 4CIGA 4W5RA 2QK9A 1JL1A 4J2AA 3UKRA 4YOXA 1NKEA 4CK2A 4C8OA 2OZMA 3AA5X 2VWJA 3THYB 3M8RA 1XWLA 3AVIA 4ID5A 4CVNE 3PUFA 4CJKA 1RDAA 4CF8A 2O8FA 1QS4A 3O3GA 2XRIA 4A5AA 2HMPA 1M1KO 1ZYQA 2HOEA 1WB9A 3V1RA 5GINA 5AQWA 3AVGA 4CZHA 3E9LA 3A5NC 3VETA 4CZJA 1TK0A 2CH6A 4AM7A 4CW7B 5IWAK 4BRIA 4HUFA 2UUBK 3I33A 4PL8A 1CZ9A 3VQ9A 2P9IA 3AGRA 4FYDA 1YVUA 2D5RA 3THVA 2DFFA 4AH9A 1IKXA 5ADXH 3SPYA 2V52B 3DLGA 1JLQA 2VGNA 4CHNA 3CJCA 1Q9XA 4IDKA 3SJJA 1BCMA 1CZBA 4DLGA 3ZSXA 3VGMA 2GWKA 1VSJA 4K25A 4DR1K 4E7IA 4FK4A 2FBVA 3FZFA 1HYZA 4EHTA 3ZSOA 3LWLA 4IKFA 3AVHA 1TGOA 3WNGA 1XNQK 4ZTFA 4DFKA 1NWKA 5AQFA 3TTDA 4BG9A 3WXKA 3O8MA 4E0DA 1QZ6A 4DMNA 2XY7A 4FWOA 3AO1A 4E7LA 3QEWA 2P5GA 1HX1A 2IOCA 5CR4A 1VSIA 5AQOA 3VQDA 2IC3A 4W5TA 1U2VB 5SZTA 1HMVA 3HVRA 3LZIA 2E2QA 1I94K 4DSJA 3QFPA 4H8KA 4B8CA 1YJNN 3KLGA 5EVZA 2CGKA 1SUQA 3E1YA 3N4QA 3CFRA 4FVUA 4BREA 4K0KK 3ZT1A 2IVPA 5FPNA 3BP8A 3ZT3A 3HJFA 3TABA 3OYLA 2QWOA 4DQIA 2FSNA 3GG4A 1RCHA 1S6QA 5AQHA 1U48A 4H5TA 4LF6K 1D9FA 5J2PA 2AP1A 3LDQA 3HK2A 4YDUA 3RMBA 1TAUA 5AQLA 5JICA 5DK5A 3HT3A 4R79A 4BE0A 2OA8A 1NGIA 1VSDA 2JWKA 4B8AB 3P83D 4DKWA 4KV8A 4FWPA 2FBTA 4LFCK 5C25A 4EP4A 4RW9A 1IKVA 1JXBA 2F7TA 3THXA 3W0LA 1MWMA 2GWJA 2YCHA 3BZCA 4DV4K 4DFMA 2QWLA 1RTDA 2E2OA 1BIUA 2E88A 4O44A 1J5EK 3O80A 3OYBA 5BREA 1VQ5N 2NUBA 1T6CA 1KVCA 3OJSA 4B1VA 1S22A 3D2FA 2O8DA 3RVCA 3G25A 3KWGA 4BRHA 2GUPA 3CC4N 2IDOA 5GAHP 3K5MA 4GV3A 4DV3K 1C1BA 2QA4N 1N33K 4BVOA 1EXQA 3VPZA 3K59A 3SQ2A 1NOYA 5EY4A 3H45C 3C6AA 2VQEK 3K57A 1TV6A 4YHHK 1KVAA 1ZBSA 3FFIA 3AY9A 3OYEA 1DGKN 1U6ZA 2G8VA 3OYFA 3EZ5A 5JMVA 3AGKA 4BRPA 3AVKA 5TKWA 3OA9A 5LY3A 1D8YA 4YOWA 5LMUK 3WXMB 2HHHK 2ASOA 4M3RA 1RILA 3SUQA 3AVAA 3PO4A 1IBMK 1H1VA 4CJTA 2E2NA 3OBWA 4BR9A 5AR0A 4YNQA 1FK9A 4H5WA 4LC9B 1KLNA 4JI2K 4NYFA 3VQ4A 5FRMA 1Z26A 4CJ4A 4B1YB 4M3UA 4DR7K 3B6OA 2AJQA 4JD2B 4N56A 3CXCM 3QIOA 4DQRA 4B3MK 4KHPK 3O9SA 4C23A 1XI1A 1XHXA 1RT3A 2P9LA 4PUOA 2NRVA 3HSCA 3MECA 1HR0K 4H0XB 3S3NA 3OYIA 2Q97A 1P8ZA 3RRGA 2Q3SA 3GDQA 1T44A 3VEYA 3BZKA 4CF0A 1NU0A 3NDKA 3OYDA 1HNZK 1U04A 1SAZA 4G1QA 1FJGK 1NGFA 3DXMA 4EAHD 3L8BA 3GOIA 2WBNA 5FLXO 3CCUN 3NHGA 3SUNA 4PKIA 3QNNA 2XHBA 2OPQA 2HBLA 3T1YK 1K73O 4DV0K 4JRPA 4CFBA 3KKSA 2Q0RA 4LF5K 4LF8K 3S3MA 5AQUA 1QHTA 1VRTA 4KPYA 2D0BA 2D4WA 5LL6Z 5B8HA 3OS0A 3PIOL 3HSTB 4DS5A 3NH1A 1YF5L 2E4LA 3WEEB 2VCPA 2ZGYA 2P51A 4FLZA 2BE2A 1YHQN 2YKNA 5C0YA 3WNFA 1DT9A 4J8FA 4CIEA 3JXUA 1RT5A 4DG1A 1NK8A 3MN9A 2PYLA 1HPMA 5KRSA 4KTQA 2YHBA 3N4PA 3ASMA 1ATSA 1NJYA 3AVFA 1NKBA 1VSKA 2V7YA 1BO5O 1Y97A 1NMDA 3VMFB 3WQUA 1VQ7N 4M42A 3J7YP 4M3YA 1SL2A 3DLHA 2YJEA 4DF8A 4RTFD 2OPPA 1LV5A 4FOEA 4J2BA 3M8PA 3D7EO 4JRQA 3T7ZA 4H5RA 4M3TA 1EETA 3QB0A 4C8MA 4CJFA 4DQPA 3NH0A 1IO2A 3MDQA 3HBTA 1LW2A 4KH6A 2O8EB 4M7XA 1XQSC 4ELVA 2EWSA 3CIPA 3U3GA 1REVA 3E66A 4ELUA 1W0HA 3CCLN 3SBGA 2YNIA 3E9PA 3ZX0A 2QW9A 4PL7A 3NE6A 1YI2N 3V81A 3CC7N 3SV4A 4BRLA 4CEEA 4I6MB 1BISA 3NCIA 2F4VK 1HJOA 3CJAA 4OPAA 5AQGA 3G71N 4YOYA 4BDYA 3L2UA 1BA0A 5AZJA 4Z0UA 2VG7A 2YHWA 4AHSA 4CHYA 2P9NA 1JCGA 4OLBA 4JI4K 3M8QA 2YHXA 4LH5A 4CJ7A 1X9MA 2E8AA 3FLCO 4A62A 2J4RA 1TKDA 4KB0A 5C24A 4BE2A 3R1XA 3K2PA 4KHYA 1S3XA 3NMUA 4O5BA 4B9QA 3FFKB 2P1JA 4IOCL 2ZE2A 4JKFA 1NBWA 4DHYA 2FBXA 2HNYA 2KZMA 2ZQBA 2HNZA 2HHVA 4BRMA 2DY4A 2FC0A 4IO8A 4BY9C 4BQLA 3HP6A 4RW8A 3QIPA 1EO1A 3DM2A 1N6QA 3UKRB 2E1ZA 3QDKA 4OPHA 3AAQA 1RBSA 3SQ1A 1YUWA 1W9HA 3ZT2A 2ZJQL 5AQRA 2O8FB 2ETJA 3F2KA 3ZETA 1TKTA 4IEEA 4WFAL 3CQYA 3ID8A 3ZCMA 1BUPA 2NLXA 2VWKA 4Q5VA 3CMAN 2QKKA 1OKJA 1QQNA 4CBUA 5AFUA 4K42A 4FJGA 4JKBA 1QQOA 2FLOA 1TKXA 3DLRA 1KLMA 5JS2A 1LWEA 4CZIA 1OH8A 4RG8A 3EL2A 1K8KA 2P9IB 2YHAA 4FW1A 5HROA 3E01A 1BIZA 4FW2A 2HHWA 3L3VA 3FZHA 1ASWA 4DV2K 1J54A 5BN8A 3QMLA 2WOMA 2KTQA 4CECA 3VQ7A 1WAJA 4N47A 3QBWA 5BPMA 3VQCA 3C6UA 1XUPO 2FXUA 5E84A 3LL3A 2QEXN 5HOOA 1BA1A 1NGHA 4M45A 4FJKA 4DSIA 4KO0A 2OCEA 3ZSVA 5LJVA 3ZLJA 4JI8K 3R3LA 2P9SA 1RT4A 4BC5A 4YDUC 3J8AA 4QAGA 3ULDA 1Q8IA 2X6SA 1WSIA 1N5YA 1IJJA 2HMIA 2P9UA 4GKJK 3VF6A 3GL1A 4JEPA 5ELZA 3SQ0A 3IS9A 2VGMA 1N34K 1YT3A 1XMOK 4UY8O 2UXDK 1VK0A 3K58A 1GLCG 4ZTJA 1IKYA 4GVEA 4OPJA 5AQVA 4PQUA 3TI0A 2O8BA 4WFNL 4RW7A 3AVBA 1LWFA 1VQKN 1ITGA 4ILHA 3V9WA 2ZF5O 3QBXA 2BTFA 4O55A 1KC8O 4C8LA 3K9KA 3LANA 4LFAK 3DWLA 5EU7A 4O8UA 4W5QA 1VQ4N 4LSNA 3KLHA 3TARA 3PX6A 1NNEA 1IG9A 3NF8A 2IGIA 5EOYA 4EHUA 5JLFA 3G10A 3VEOA 2Y1JA 3QEVA 5AQIA 3MEEA 4B3OA 1KXPA 1KAXA 5AZIA 4HUGA 5KPZA 5J2NA 3IFRA 4E3SA 3THXB 3VEXA 4FJXA 5GADP 4NXMK 4U67L 4CJLA 1UAXA 2BH1A 3NAEA 4DWIA 4B1WB 1QHAA 2HB5A 1IG8A 1RTJA 3CI5A 3SLCA 4FJIA 4F3OA 1U47A 5FROA 5CHIA 4B9TA 4GMJB 5HRPA 4JS5A 3MCAB 3J81O 4QCLA 3O1BA 1VQ6N 3R9PA 2H3GX 5AQSA 4BDPA 3D2FB 3VF2A 2WONA 2O8DB 1S1UA 3OYMA 2E20A 1NGDA 4X66K 4DSFA 1SKWA 4DR5K 4FWRA 4PA1A 2QWNA 4KI4A 1WUAA 2XO7A 2WUSA 4K41A 3I8DA 1YTUA 4FK0A 3KLEA 1DLOA 1BHLA 3F5TA 3SUPA 4CZFA 4AF1A 3DXKB 3C94A 1Q81O 4E7JA 2RHKA 1TVRA 1RT7A 4B9NA 4KHUA 4FJ9A 3L6QA 1NGCA 3K5LA 1BDGA 5EXWA 3A0IX 1NK4A 1RDUA 3RWUA 5C2FA 3NVMA 4JHDA 3CFOA 1C1CA 5BRFA 3KK2A 4IFVA 5CZ2A 1X3MA 3AO5A 2F9WA 5T7BA 2D0PA 1ATNA 4WFBL 4FJ8A 1HKGA 2JGUA 3UIQA 3AV9A 2KQ2A 4CI6A 2HBMA 3O9RA 3ENOA 3HI0A 1DTTA 4CEDA 4JI0K 1EQYA 4CF1A 2G8WA 3KLFA 1SL0A 1NMNA 1Q82O 4CESA 2P9LB 3TTCA 1GLFO 1MA9B 4FWKA 5BR9A 4B1ZA 4NYNA 4IXCA 4JI3K 2EHGA 3HVTA 5HBMA 2IVNA 2QM1A 4IWVA 2HSTA 5LJWA 3VTHA 2CGLA 4DTNA 1O13A 3DI6A 1OVQA 1Z6RA 3HO1A 1RDCA 2LSNA 3EE8A 4DTPA 2HHSA 3DXMB 4FZXC 2OYQA 5KQ8A 3TSQA 4CGFA 2HHXA 4H5VA 4RWTA 1L3VA 5AQKA 1TKZA 2ZD1A 3EN9A 1YXQA 1YTAA 4FPBA 5CZ1A 3LP2A 3SBTA 1T03A 5J2QA 1N36K 4M41A 1NGJA 4FL9A 3CG7A 4DCHA 4BR5A 3K0SA 1T6DA 3MXJA 1RFQA 2I7NA 3RR7A 4OKEA 4I2PA 3OHRA 4V19S 4EZ6A 3QINA 5KPRA 2E5LK 5EX5A 1T3VA 4JKCA 5AFUH 4CZLA 3JYTA 1VQLN 1YAGA 3VERA 1KAYA 3IRXA 5KPTA 4CGHA 1A5XA 3L3UA 4LSLA 4W5OA 3OYNA 1DTQA 3J80O 2YNFA 3CPWM 2KZZA 3WUHA 4IEIA 4L8RB 3DRSA 4PKHA 5AQYA 4RCHA 1V4SA 3T19A 1S1WA 1JLBA 5CYMA 3S41A 4DQSA 2OTJN 1EKEA 2QWPA 3UB5A 2G8UA 1EP4A 4FZZA 2BANA 2X6NA 3GE1A 4DR2K 3MN5A 4AM6A 4OJRA 2YHYA 4PHTX 4PY5A 4E7KA 3C7NA 4B08A 2IAJA 4JI7K 1BI4A 1NGGA 4F8RA 1NK9A 3KIOA 1HNWK 4FJ5A 4CEAA 4Q0BA 4OX9K 1JLFA 4IO9L 3O9QA 3LP1A 4WQ4A 1KCFA 5K14A 4M7YA 2I7PA 1LW0A 4OLAA 3H08A 4GKKK 5C10A 4FJHA 2UU9K 2QWRA 5HL7L 3DXKA 1E3MA 3AO2A 1QE1A 2GELA 4K8ZA 3CCMN 3HYFA 4JKHA 2PAVA 3K5NA 3TANA 3C95A 4GNIA 4CJWA 1UOCA 4FM0A 3MN7A 1U4BA 3W3DA 3V1OA 4BRGA 3OYCA 5AZJB 3CCQN 4FLWA 2KFZA 4CEFA 2XY6A 2WC9A 3IMXA 1EWQA 3VA3A 1VQNN 1ZBUA 3HZ6A 2P9NB 1HYSA 2OPSA 4E1NA 3SAFA 3VQ5A 4JKEA 1S5JA 4CFAA 4EIAA 1VSLA 3NGZA 1KFDA 3H3OB 2GBZA 2P9KA 3LALA 3QEXA 4DR3K 5J2MA 3S9HA 3U6FA 4BRAA 3HOTA 4TSXA 4LFBK 4CZMA 3L2QA 4CHQA 1HNIA 5DMRA 1FKOA 3OTOK 1VQ8N 1C0MA 4ISEA 4CFDA 2HW3A 4Z4GA 3I55N 1J53A 1R0AA 2VYPA 2BDPA 4I2QA 5AQZA 3TSPA 1VQMN 3L4QA 3MX5A 2D0AA 4X62K 3VQQA 1OVYA 3QETA 4JAXA 4E19A 1MDUB 3C65A 4F2SA 4R5PA 2ITMA 2VQFK 3ZETB 3VGKA 1C0GA 3D2EA 4JI6K 1MWKA 2IVOA 4A57A 3CETA 4WCEL 3O3HA 3TWHA 4GVMA 5DM7L 1RNHA 4E1MA 3SQ4A 4BACA 5HP1A 3V1QA 1OH6A 1HQUA 2GUIA 1RDDA 3CM5A 1HYVA 2O4IA 2QWQA 4FWNA 4CHOA 3ATVA 3QEPA 2ZWHA 1Y64A 2V51B 2P5OA 3LP0A 1S9EA 4ILGB 2Z1HA 4BWMA 1JLEA 1WSJA 5AJ3K 1KVBA 2KFNA 1TL3A 1K8KB 4H4OA 3P1GA 4DTOA 1DEJA 3MN6A 1N8RO 3EE9A 3RMAA 4QOZB 4N5SA 3EKUA 4I7FA 4MLHA 4QS7A 2Z1IA 4CHPA 3VN5A 2O8CA 4J2DA 4H0VB 4LH4A 3OJUA 4EP5A 5FPEA 4DUZK 3WNHA 4KH5A 2QKBA 4IG0A 4FJMA 3A5MC 3WXJA 4QS9A 3WNEA 4B3RK 3OVNA 3O5BA 2P9SB 4CIFA 5I3UA 3BF3A 4PKGA 3QNOA 4KBOA 4CJPA 3MEDA 5E26A 3O3FA 2O4GA 4MO5A 3H1VX 2ZM6K 1UA0A 2P9UB 4BC2A 3CPEA 4XIUA 3ZYYX 5HRRA 4MQ3A 1CLQA 4CEOA 2FSKA 4XH4A 4YOVA 4FJJA 4BG8A 1WN7A 4B9LA 1E4FT 3RRHA 3TAPA 4LD0A 4B3TK 3EYZA 2O8BB 1ASVA 1TUUA 4IDHA 3UE5A 1WBBA 3ZEUB 3SPZA 3PLAA 4JK7A 4KTZA 5H1SQ 3LM2A 3HPOA 3IUCA 3VQ6A 1SKRA 3IAYA 3DYAA 4CJSA 3EY1A 3LAKA 1OH7A 2WFBA 5GIOA 5MLCQ 4E89A 1HNVA 4NO7A 1TK8A 4FVMA 3SZ2A 1SQKA 1SZ2A 4WF9L 1VSMA 1XC9A 4F3TA 3H3NO
chains in the Genus database with same CATH topology
3LZIA 4DU1A 3MEGA 4O55A 4C8LA 3I0RA 1S9GA 4DSJA 4H8KA 4B8CA 3LANA 4DTSA 3KLGA 1I39A 5EU7A 3U3YA 4W5QA 1JL2A 4C8NA 1SUQA 3CFRA 4LSNA 3KLHA 2F8SA 3B6PA 3ZT1A 3TARA 3PX6A 4DQQA 1GOAA 1IG9A 4M3XA 3NF8A 2IGIA 1BL3A 4DLEA 1WNSA 3LAMA 4M3WA 4Y1CA 3ZT3A 3RTVA 3HJFA 3AA2A 3G10A 2Y1JA 4OKJA 3ALYA 3OYLA 3TABA 1WSFA 4DQIA 1BCOA 2IS3A 3QEVA 3HPGA 3MEEA 1QSLA 4B3OA 3RMDA 1RCHA 1S6QA 3OY9A 1U48A 4HUGA 2B4JA 2HNDA 1D9FA 5J2PA 5J2NA 4AHCA 2A1RA 4E3SA 3HK2A 4CJUA 4CGDA 4I9QA 3RMCA 4FCYA 3RMBA 1L3SA 4FJXA 2HHQA 1TAUA 1J9AA 4UQGA 1X1PA 3D0PA 5DK5A 3HT3A 4DFJA 1NJWA 3IG1A 4CJLA 4BE0A 1VSDA 4B8AB 3DRPA 1VRUA 4DU3A 2OA8A 4KTWA 1UAXA 2RF2A 3L2VA 4RW6A 1RT2A 4CGGA 5KRTA 3NAEA 1IH7A 3TAGA 4DWIA 4CHZA 3P83D 4Z4HA 2HB5A 4KV8A 2FBTA 1RTJA 5C25A 3HL8A 4FJIA 1BQNA 1U47A 4EP4A 4F3OA 5FROA 4RW9A 1IKVA 2X78A 2XY8A 1JXBA 3NFAA 4B9TA 4GMJB 1SV5A 5HRPA 4JS5A 3SCXA 2HVIA 3SI6A 4QCLA 5FRNA 5CY4A 3OYGA 2RKIA 3HPHA 3AVNA 3VQBA 1TK5A 3ZSWA 1RDBA 4BDPA 2WONA 3F9KA 1CXUA 1S1UA 3AO3A 4DFMA 3OYMA 5I42A 2G8HA 3BDPA 3NGIA 1D9DA 1RTDA 1UWBA 1WSHA 1BIUA 4DSFA 1SKWA 4CEBA 4O44A 4CJEA 2E6LA 4PA1A 3OYBA 4KI4A 2XO7A 4KAZA 2NUBA 4EZ9A 4FM2A 3I8DA 4KRFA 1KVCA 1YTUA 1ASUA 3OJSA 4FK0A 3KLEA 1DLOA 3V9UA 4DTRA 1BHLA 3SUOA 1S1TA 1NK5A 4WE1A 4PWDA 2HVHA 2IDOA 5KGWA 3SUPA 3K5MA 3SNNA 1C1BA 2R7YA 3C94A 1WSEA 3DMJA 4CF9A 1EXQA 3K59A 1T8EA 4E7JA 1VSHA 4HUEA 1TVRA 3KKRA 4NCGA 3SQ2A 1RT7A 1NOYA 4B9NA 3AVCA 4KHUA 4FJ9A 1HPZA 4Z4FA 3K57A 1RBTA 1TV6A 1KVAA 3K5LA 1C0TA 3FFIA 3KLIA 4Y1DA 1NK4A 1J5OA 1TAQA 3RWUA 4ZHRA 3OYEA 1EX4A 4FLXA 4FLYA 4J2EA 3CFOA 5CYQA 1C1CA 5E41A 2G8VA 3OYFA 4KHNA 3KK2A 1IKWA 3EZ5A 5SWMA 1SL1A 1G15A 4IFVA 3AVKA 1JLAA 3AO5A 5CZ2A 1NK0A 1D8YA 4KB1A 1WLJA 3ZSZA 5T7BA 3OS2A 1D5AA 1L5UA 2Y1IA 4FJ8A 3AA3A 4ICLA 3V9SA 2JGUA 3UIQA 4OGEA 4M3RA 3AV9A 1RILA 3AVJA 4CEQA 4CGIA 2KQ2A 2G8FA 3SUQA 1DTTA 3AVAA 4CEDA 2EX3A 3PO4A 4Z4CA 4HHTA 4CF1A 3HM9A 2G8WA 4DF4A 3KLFA 4CJTA 1JLGA 4DTXA 4F2RA 5KTQA 1SL0A 4FXDA 4FLTA 2F96A 3IAYA 4CESA 3ITHA 4B9UA 3VQPA 4YNQA 1HQEA 4NYNA 3I0SA 1FK9A 2I5JA 1KLNA 3OYKA 3L2WA 3QESA 4NYFA 3VQ4A 1RTIA 5FRMA 1Z26A 2EHGA 4CJ4A 3HVTA 5HBMA 2VG6A 3HP9A 4CK3A 3OYAA 3B6OA 3MXMA 1NKCA 4M3UA 2AJQA 2QXFA 3DLEA 4N56A 4DTNA 3QIOA 4DQRA 4KREA 1B9DA 2YKMA 3DI6A 2RN2A 4HVJA 3HO1A 1RDCA 2LSNA 2DFHA 4DTPA 1XI1A 4Z4EA 2HHSA 1XHXA 3KTQA 1C1AA 1RT3A 4PUOA 1O1WA 1Q9YA 3KD1E 4CJQA 1HRHA 4FZXC 3MECA 3S3NA 2OYQA 3OYIA 3AVMA 1S6PA 3DLKA 4CGFA 3RRGA 2HHXA 2Q3SA 1L3VA 4DFPA 4O4GA 4CF0A 3NDKA 1TL1A 1TKZA 1RBUA 2JLEA 1U04A 2ZD1A 3K5OA 3OYDA 3LWMA 4AILC 4B9MA 2OZSA 4G1QA 1YTAA 5CZ1A 3LP2A 5HRSA 1T03A 5J2QA 4W5NA 4M41A 3TAEA 3L8BA 1XHZA 3KD5E 4E7HA 4N41A 4FJLA 3CG7A 3ZSRA 3NHGA 3MXJA 3SUNA 4NCAA 3RR7A 3QNNA 4OKEA 4I2PA 3T3FA 3MAQA 5KGXA 3PX0A 4CEZA 2XHBA 1T05A 2OPQA 3V4IA 1WAFA 4EZ6A 4AHVA 3QINA 3TAFA 4JRPA 4CFBA 1RBRA 4CFCA 2DFEA 3P5JA 3CM6A 3KKSA 3JYTA 3LDSA 2BGGA 3S3MA 3IRXA 4CGHA 1ZBIA 4CF2A 1QHTA 4F4KA 1A5XA 1VRTA 2D0BA 3NF6A 4HTUA 4KPYA 4KHQA 1MU2A 4K8XA 2HHUA 3L3UA 3OS0A 1L3UA 4LSLA 3HSTB 1X9WA 1NK7A 2ITGA 4W5OA 3ISNC 4DS5A 4B9VA 3NH1A 5J1EA 4CK1A 3OYNA 1DTQA 3ZSYA 2YNFA 3OS1A 3O4NA 2E4LA 1A5WA 2KZZA 4FLUA 2P51A 3DOKA 4FLZA 2BE2A 2YKNA 1GOBA 1GOCA 1VSFA 3WNFA 3QEIA 1KRPA 4L8RB 4KHSA 4CIEA 1RTHA 2RPIA 1BI4B 3DRSA 3QERA 1RT5A 1S1WA 1JLBA 4RW4A 3T19A 1LAWA 2Z1GA 5CYMA 4DG1A 4DQSA 1EKEA 1NK8A 2G8UA 2PYLA 4IFYA 1EP4A 4FZZA 4DSLA 1JKHA 1FKPA 2BANA 2X6NA 5KRSA 4KTQA 2YHBA 3ASMA 1KTQA 2G8KA 1NJYA 3AVFA 4OJRA 5HLFA 3QO9A 1NKBA 1VSKA 4M3ZA 3V6DA 1RT6A 4PY5A 4E7KA 1FXXA 1RT1A 1Y97A 1RBVA 4B08A 2IAJA 1NOZA 1KSPA 1CXQA 1BI4A 4M42A 4M3YA 4KKOA 3LP3A 3D45A 3JSMA 4DTJA 3KIOA 4IBNA 1NK9A 1SL2A 4F8RA 2G8IA 1LAVA 3DLHA 4FJ5A 4CEAA 5C42A 4CERA 4DF8A 4Q0BA 2OPPA 1JLFA 1S1VA 3QLHA 1JXEA 1QSSA 3NBPA 3CYMA 1LV5A 3LP1A 3S3OA 1QQCA 1QSYA 3T1AA 4J2BA 2PZSA 1KCFA 2GV9A 3M8PA 4JRQA 2PY5A 5K14A 3VQAA 1C6VA 3NH2A 1SKSA 3SV3A 1LW0A 1ZBFA 2A1SA 3H08A 4CJ5A 1NK6A 4OLAA 4FJHA 4CCHA 4M3TA 1EETA 4C8MA 4NCBA 4CJFA 4DQPA 3AO2A 3NH0A 1QE1A 4YFUA 3CQ8A 1IO2A 1KFSA 4HCBA 4IG3A 4K8ZA 3ZSQA 4Z4IA 2ATQA 3HYFA 1LW2A 3K5NA 1WSGA 2Z1JA 4CGJA 4AHTA 4FK2A 2F8TA 1C0UA 4ELVA 1F21A 3U3GA 1REVA 3TANA 4ELUA 1W0HA 3C95A 4CJWA 3KK1A 1UOCA 2YNIA 3M8SA 4FM0A 4AHRA 1U4BA 1B92A 1L3TA 3V1OA 5HRNA 4OPKA 4FLWA 3OYCA 3KJVA 2KFZA 3CFPA 4CEFA 3PX4A 2XY6A 3ZT0A 4JS4A 3G0ZA 3NE6A 3VA3A 3AVLA 3V81A 4ID1A 3V9ZA 3LZJA 1ZBUA 3SV4A 4CEEA 2B5JA 2VG5A 4KFBA 4AHUA 1HYSA 2OPSA 1BISA 3DLBA 3NCIA 4E1NA 1U45A 3VQ5A 3PO5A 4FZYA 1S5JA 5FDLA 4CFAA 3RR8A 4BDYA 1VSLA 3NGZA 3LPTA 3TR8A 3DRRA 1KFDA 3L2UA 5D3GA 4Z0UA 2VG7A 3L2RA 2GBZA 3LALA 4H4MA 3QEXA 5J2MA 2E6MA 3S9HA 4OGCA 3U6FA 4TSXA 4AHSA 4CHYA 4DSEA 2W42A 4CJVA 3L2QA 2PYJA 2X74A 4CHQA 1QTMA 4HCCA 4OLBA 3M8QA 1HNIA 5DMRA 3OYJA 1FKOA 3SYZA 2OPRA 4LH5A 1A5VA 1X9MA 4FM1A 1T7PA 1NJXA 1BGXT 4CJRA 3OYHA 3PY8A 1C0MA 1S1XA 1TKDA 4KB0A 5C24A 4BE2A 4CFDA 3K2PA 4KHYA 3TAQA 2HHTA 4O5BA 2HW3A 2P1JA 4Z4GA 4DU4A 1J53A 1R0AA 5KI6A 2ZE2A 1X9SA 2BDPA 1I3AA 2FBXA 2HNYA 3A2FA 4I2QA 2KZMA 2ZQBA 2HNZA 2HHVA 2FBYA 4DTMA 2D0AA 2YNGA 4MFBA 3VQQA 2DY4A 2DTUA 2FC0A 3AO4A 3VA0A 3QETA 3HP6A 4RW8A 3QIPA 4O0JA 4E19A 3DOLA 3MXIA 4F2SA 4R5PA 3DM2A 3PV8A 1U49A 1N6QA 4CJ3A 2KW4A 4OVLA 4FJNA 1Z25A 1UA1A 3O3HA 3HXMA 2D0CA 3TWHA 4GVMA 1RNHA 4DS4A 3AA4A 1RBSA 4E1MA 3SQ4A 4BACA 5HP1A 3V1QA 3SQ1A 1W9HA 1K6YA 1B9FA 1HQUA 2GUIA 1LWCA 1RDDA 3CM5A 3ZT2A 1HYVA 4CIGA 4W5RA 1NJZA 2QK9A 2O4IA 2ETJA 4CHOA 1JL1A 3QEPA 4J2AA 1TKTA 2P5OA 3LP0A 1NKEA 1S9EA 2Z1HA 4BWMA 4CK2A 1JLEA 3ZCMA 1WSJA 2VWKA 4Q5VA 1KVBA 3KK3A 2QKKA 4C8OA 1TL3A 2KFNA 2OZMA 3AA5X 2VWJA 4KHWA 3M8RA 1XWLA 3AVIA 4ID5A 4H4OA 3P1GA 4CE9A 4DTOA 4FJGA 3PUFA 4CJKA 4BE1A 1RDAA 4CF8A 1VSEA 3ZT4A 1QS4A 3O3GA 1TKXA 3DLRA 4DTUA 1KLMA 2XRIA 5JS2A 3RMAA 4QOZB 5JS1A 1LWEA 3VQ8A 4RG8A 4N5SA 2YNHA 1ZYQA 3VQEA 2YHAA 4I7FA 2Z1IA 4FW1A 4CHPA 2XY5A 3VN5A 3E01A 3BGRA 1BIZA 3V1RA 5HROA 3AVGA 4J2DA 4FW2A 4LH4A 4LY7A 3OJUA 4EP5A 2HHWA 3L3VA 3WNHA 1HJRA 2QKBA 1ASWA 3NF7A 4IG0A 1TK0A 4FJMA 4ELTA 1J54A 3WNEA 3O4QA 4HUFA 2WOMA 3OVNA 2KTQA 4CECA 3VQ7A 4CIFA 1WAJA 5I3UA 1CZ9A 4N47A 4O0IA 3QNOA 3VQ9A 3NF9A 4OKKA 3V9XA 4FJ7A 4KI6A 3VQCA 1YVUA 2D5RA 3C6UA 3MEDA 4CJPA 3O3FA 2O4GA 3THVA 4FYDA 4I9LA 2DFFA 4AH9A 1UA0A 1IKXA 3F73A 4XIUA 3SPYA 4DSKA 5HRRA 1BQMA 4M45A 4FJKA 3DLGA 4GW6A 4DSIA 4MQ3A 1JLQA 1CLQA 4KO0A 4CEOA 4CHNA 4B9SA 3ZSVA 1Q9XA 1RT4A 4FJJA 4BWJA 4IDKA 4QAGA 1WN7A 3ULDA 3TAMA 3SJJA 4B9LA 1BCMA 1Q8IA 3RRHA 3TAPA 1CZBA 2X6SA 1WSIA 4LD0A 4DLGA 4FLVA 3EYZA 1N5YA 1ZBHA 2HMIA 1ASVA 3ZSXA 4C8KA 1VSJA 3SPZA 4E7IA 4KTZA 2FBVA 4FK4A 3SQ0A 3IS9A 1HYZA 3HPOA 3NGYA 2YV0X 3VQ6A 1SKRA 3ZSOA 4N76A 3LWLA 4IKFA 3AVHA 1TGOA 1YT3A 3DYAA 3WNGA 4CJSA 3LAKA 1VK0A 1JLCA 3EY1A 2B6AA 3K58A 4DFKA 4ZTFA 4ZTJA 1IKYA 4E0DA 3C6TA 1HNVA 4DMNA 4E89A 4OPJA 2XY7A 1ZBLA 3LPUA 4JLHA 3AO1A 4BDZA 4PQUA 4E7LA 4FVMA 3SZ2A 3QEWA 3TI0A 1TK8A 2P5GA 2IOCA 4RW7A 1VSIA 3AVBA 3VQDA 1LWFA 1VSMA 1ITGA 1XC9A 2IC3A 4W5TA 4F3TA 5SZTA 1HMVA 3HVRA 3V9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZI A;  4DU1 A;  3MEG A;  4O55 A;  4C8L A;  3I0R A;  1S9G A;  4DSJ A;  4H8K A;  4B8C A;  3LAN A;  4DTS A;  3KLG A;  1I39 A;  5EU7 A;  3U3Y A;  4W5Q A;  1JL2 A;  4C8N A;  1SUQ A;  3CFR A;  4LSN A;  3KLH A;  2F8S A;  3B6P A;  3ZT1 A;  3TAR A;  3PX6 A;  4DQQ A;  1GOA A;  1IG9 A;  4M3X A;  3NF8 A;  2IGI A;  1BL3 A;  4DLE A;  1WNS A;  3LAM A;  4M3W A;  4Y1C A;  3ZT3 A;  3RTV A;  3HJF A;  3AA2 A;  3G10 A;  2Y1J A;  4OKJ A;  3ALY A;  3OYL A;  3TAB A;  1WSF A;  4DQI A;  1BCO A;  2IS3 A;  3QEV A;  3HPG A;  3MEE A;  1QSL A;  4B3O A;  3RMD A;  1RCH A;  1S6Q A;  3OY9 A;  1U48 A;  4HUG A;  2B4J A;  2HND A;  1D9F A;  5J2P A;  5J2N A;  4AHC A;  2A1R A;  4E3S A;  3HK2 A;  4CJU A;  4CGD A;  4I9Q A;  3RMC A;  4FCY A;  3RMB A;  1L3S A;  4FJX A;  2HHQ A;  1TAU A;  1J9A A;  4UQG A;  1X1P A;  3D0P A;  5DK5 A;  3HT3 A;  4DFJ A;  1NJW A;  3IG1 A;  4CJL A;  4BE0 A;  1VSD A;  4B8A B;  3DRP A;  1VRU A;  4DU3 A;  2OA8 A;  4KTW A;  1UAX A;  2RF2 A;  3L2V A;  4RW6 A;  1RT2 A;  4CGG A;  5KRT A;  3NAE A;  1IH7 A;  3TAG A;  4DWI A;  4CHZ A;  3P83 D;  4Z4H A;  2HB5 A;  4KV8 A;  2FBT A;  1RTJ A;  5C25 A;  3HL8 A;  4FJI A;  1BQN A;  1U47 A;  4EP4 A;  4F3O A;  5FRO A;  4RW9 A;  1IKV A;  2X78 A;  2XY8 A;  1JXB A;  3NFA A;  4B9T A;  4GMJ B;  1SV5 A;  5HRP A;  4JS5 A;  3SCX A;  2HVI A;  3SI6 A;  4QCL A;  5FRN A;  5CY4 A;  3OYG A;  2RKI A;  3HPH A;  3AVN A;  3VQB A;  1TK5 A;  3ZSW A;  1RDB A;  4BDP A;  2WON A;  3F9K A;  1CXU A;  1S1U A;  3AO3 A;  4DFM A;  3OYM A;  5I42 A;  2G8H A;  3BDP A;  3NGI A;  1D9D A;  1RTD A;  1UWB A;  1WSH A;  1BIU A;  4DSF A;  1SKW A;  4CEB A;  4O44 A;  4CJE A;  2E6L A;  4PA1 A;  3OYB A;  4KI4 A;  2XO7 A;  4KAZ A;  2NUB A;  4EZ9 A;  4FM2 A;  3I8D A;  4KRF A;  1KVC A;  1YTU A;  1ASU A;  3OJS A;  4FK0 A;  3KLE A;  1DLO A;  3V9U A;  4DTR A;  1BHL A;  3SUO A;  1S1T A;  1NK5 A;  4WE1 A;  4PWD A;  2HVH A;  2IDO A;  5KGW A;  3SUP A;  3K5M A;  3SNN A;  1C1B A;  2R7Y A;  3C94 A;  1WSE A;  3DMJ A;  4CF9 A;  1EXQ A;  3K59 A;  1T8E A;  4E7J A;  1VSH A;  4HUE A;  1TVR A;  3KKR A;  4NCG A;  3SQ2 A;  1RT7 A;  1NOY A;  4B9N A;  3AVC A;  4KHU A;  4FJ9 A;  1HPZ A;  4Z4F A;  3K57 A;  1RBT A;  1TV6 A;  1KVA A;  3K5L A;  1C0T A;  3FFI A;  3KLI A;  4Y1D A;  1NK4 A;  1J5O A;  1TAQ A;  3RWU A;  4ZHR A;  3OYE A;  1EX4 A;  4FLX A;  4FLY A;  4J2E A;  3CFO A;  5CYQ A;  1C1C A;  5E41 A;  2G8V A;  3OYF A;  4KHN A;  3KK2 A;  1IKW A;  3EZ5 A;  5SWM A;  1SL1 A;  1G15 A;  4IFV A;  3AVK A;  1JLA A;  3AO5 A;  5CZ2 A;  1NK0 A;  1D8Y A;  4KB1 A;  1WLJ A;  3ZSZ A;  5T7B A;  3OS2 A;  1D5A A;  1L5U A;  2Y1I A;  4FJ8 A;  3AA3 A;  4ICL A;  3V9S A;  2JGU A;  3UIQ A;  4OGE A;  4M3R A;  3AV9 A;  1RIL A;  3AVJ A;  4CEQ A;  4CGI A;  2KQ2 A;  2G8F A;  3SUQ A;  1DTT A;  3AVA A;  4CED A;  2EX3 A;  3PO4 A;  4Z4C A;  4HHT A;  4CF1 A;  3HM9 A;  2G8W A;  4DF4 A;  3KLF A;  4CJT A;  1JLG A;  4DTX A;  4F2R A;  5KTQ A;  1SL0 A;  4FXD A;  4FLT A;  2F96 A;  3IAY A;  4CES A;  3ITH A;  4B9U A;  3VQP A;  4YNQ A;  1HQE A;  4NYN A;  3I0S A;  1FK9 A;  2I5J A;  1KLN A;  3OYK A;  3L2W A;  3QES A;  4NYF A;  3VQ4 A;  1RTI A;  5FRM A;  1Z26 A;  2EHG A;  4CJ4 A;  3HVT A;  5HBM A;  2VG6 A;  3HP9 A;  4CK3 A;  3OYA A;  3B6O A;  3MXM A;  1NKC A;  4M3U A;  2AJQ A;  2QXF A;  3DLE A;  4N56 A;  4DTN A;  3QIO A;  4DQR A;  4KRE A;  1B9D A;  2YKM A;  3DI6 A;  2RN2 A;  4HVJ A;  3HO1 A;  1RDC A;  2LSN A;  2DFH A;  4DTP A;  1XI1 A;  4Z4E A;  2HHS A;  1XHX A;  3KTQ A;  1C1A A;  1RT3 A;  4PUO A;  1O1W A;  1Q9Y A;  3KD1 E;  4CJQ A;  1HRH A;  4FZX C;  3MEC A;  3S3N A;  2OYQ A;  3OYI A;  3AVM A;  1S6P A;  3DLK A;  4CGF A;  3RRG A;  2HHX A;  2Q3S A;  1L3V A;  4DFP A;  4O4G A;  4CF0 A;  3NDK A;  1TL1 A;  1TKZ A;  1RBU A;  2JLE A;  1U04 A;  2ZD1 A;  3K5O A;  3OYD A;  3LWM A;  4AIL C;  4B9M A;  2OZS A;  4G1Q A;  1YTA A;  5CZ1 A;  3LP2 A;  5HRS A;  1T03 A;  5J2Q A;  4W5N A;  4M41 A;  3TAE A;  3L8B A;  1XHZ A;  3KD5 E;  4E7H A;  4N41 A;  4FJL A;  3CG7 A;  3ZSR A;  3NHG A;  3MXJ A;  3SUN A;  4NCA A;  3RR7 A;  3QNN A;  4OKE A;  4I2P A;  3T3F A;  3MAQ A;  5KGX A;  3PX0 A;  4CEZ A;  2XHB A;  1T05 A;  2OPQ A;  3V4I A;  1WAF A;  4EZ6 A;  4AHV A;  3QIN A;  3TAF A;  4JRP A;  4CFB A;  1RBR A;  4CFC A;  2DFE A;  3P5J A;  3CM6 A;  3KKS A;  3JYT A;  3LDS A;  2BGG A;  3S3M A;  3IRX A;  4CGH A;  1ZBI A;  4CF2 A;  1QHT A;  4F4K A;  1A5X A;  1VRT A;  2D0B A;  3NF6 A;  4HTU A;  4KPY A;  4KHQ A;  1MU2 A;  4K8X A;  2HHU A;  3L3U A;  3OS0 A;  1L3U A;  4LSL A;  3HST B;  1X9W A;  1NK7 A;  2ITG A;  4W5O A;  3ISN C;  4DS5 A;  4B9V A;  3NH1 A;  5J1E A;  4CK1 A;  3OYN A;  1DTQ A;  3ZSY A;  2YNF A;  3OS1 A;  3O4N A;  2E4L A;  1A5W A;  2KZZ A;  4FLU A;  2P51 A;  3DOK A;  4FLZ A;  2BE2 A;  2YKN A;  1GOB A;  1GOC A;  1VSF A;  3WNF A;  3QEI A;  1KRP A;  4L8R B;  4KHS A;  4CIE A;  1RTH A;  2RPI A;  1BI4 B;  3DRS A;  3QER A;  1RT5 A;  1S1W A;  1JLB A;  4RW4 A;  3T19 A;  1LAW A;  2Z1G A;  5CYM A;  4DG1 A;  4DQS A;  1EKE A;  1NK8 A;  2G8U A;  2PYL A;  4IFY A;  1EP4 A;  4FZZ A;  4DSL A;  1JKH A;  1FKP A;  2BAN A;  2X6N A;  5KRS A;  4KTQ A;  2YHB A;  3ASM A;  1KTQ A;  2G8K A;  1NJY A;  3AVF A;  4OJR A;  5HLF A;  3QO9 A;  1NKB A;  1VSK A;  4M3Z A;  3V6D A;  1RT6 A;  4PY5 A;  4E7K A;  1FXX A;  1RT1 A;  1Y97 A;  1RBV A;  4B08 A;  2IAJ A;  1NOZ A;  1KSP A;  1CXQ A;  1BI4 A;  4M42 A;  4M3Y A;  4KKO A;  3LP3 A;  3D45 A;  3JSM A;  4DTJ A;  3KIO A;  4IBN A;  1NK9 A;  1SL2 A;  4F8R A;  2G8I A;  1LAV A;  3DLH A;  4FJ5 A;  4CEA A;  5C42 A;  4CER A;  4DF8 A;  4Q0B A;  2OPP A;  1JLF A;  1S1V A;  3QLH A;  1JXE A;  1QSS A;  3NBP A;  3CYM A;  1LV5 A;  3LP1 A;  3S3O A;  1QQC A;  1QSY A;  3T1A A;  4J2B A;  2PZS A;  1KCF A;  2GV9 A;  3M8P A;  4JRQ A;  2PY5 A;  5K14 A;  3VQA A;  1C6V A;  3NH2 A;  1SKS A;  3SV3 A;  1LW0 A;  1ZBF A;  2A1S A;  3H08 A;  4CJ5 A;  1NK6 A;  4OLA A;  4FJH A;  4CCH A;  4M3T A;  1EET A;  4C8M A;  4NCB A;  4CJF A;  4DQP A;  3AO2 A;  3NH0 A;  1QE1 A;  4YFU A;  3CQ8 A;  1IO2 A;  1KFS A;  4HCB A;  4IG3 A;  4K8Z A;  3ZSQ A;  4Z4I A;  2ATQ A;  3HYF A;  1LW2 A;  3K5N A;  1WSG A;  2Z1J A;  4CGJ A;  4AHT A;  4FK2 A;  2F8T A;  1C0U A;  4ELV A;  1F21 A;  3U3G A;  1REV A;  3TAN A;  4ELU A;  1W0H A;  3C95 A;  4CJW A;  3KK1 A;  1UOC A;  2YNI A;  3M8S A;  4FM0 A;  4AHR A;  1U4B A;  1B92 A;  1L3T A;  3V1O A;  5HRN A;  4OPK A;  4FLW A;  3OYC A;  3KJV A;  2KFZ A;  3CFP A;  4CEF A;  3PX4 A;  2XY6 A;  3ZT0 A;  4JS4 A;  3G0Z A;  3NE6 A;  3VA3 A;  3AVL A;  3V81 A;  4ID1 A;  3V9Z A;  3LZJ A;  1ZBU A;  3SV4 A;  4CEE A;  2B5J A;  2VG5 A;  4KFB A;  4AHU A;  1HYS A;  2OPS A;  1BIS A;  3DLB A;  3NCI A;  4E1N A;  1U45 A;  3VQ5 A;  3PO5 A;  4FZY A;  1S5J A;  5FDL A;  4CFA A;  3RR8 A;  4BDY A;  1VSL A;  3NGZ A;  3LPT A;  3TR8 A;  3DRR A;  1KFD A;  3L2U A;  5D3G A;  4Z0U A;  2VG7 A;  3L2R A;  2GBZ A;  3LAL A;  4H4M A;  3QEX A;  5J2M A;  2E6M A;  3S9H A;  4OGC A;  3U6F A;  4TSX A;  4AHS A;  4CHY A;  4DSE A;  2W42 A;  4CJV A;  3L2Q A;  2PYJ A;  2X74 A;  4CHQ A;  1QTM A;  4HCC A;  4OLB A;  3M8Q A;  1HNI A;  5DMR A;  3OYJ A;  1FKO A;  3SYZ A;  2OPR A;  4LH5 A;  1A5V A;  1X9M A;  4FM1 A;  1T7P A;  1NJX A;  1BGX T;  4CJR A;  3OYH A;  3PY8 A;  1C0M A;  1S1X A;  1TKD A;  4KB0 A;  5C24 A;  4BE2 A;  4CFD A;  3K2P A;  4KHY A;  3TAQ A;  2HHT A;  4O5B A;  2HW3 A;  2P1J A;  4Z4G A;  4DU4 A;  1J53 A;  1R0A A;  5KI6 A;  2ZE2 A;  1X9S A;  2BDP A;  1I3A A;  2FBX A;  2HNY A;  3A2F A;  4I2Q A;  2KZM A;  2ZQB A;  2HNZ A;  2HHV A;  2FBY A;  4DTM A;  2D0A A;  2YNG A;  4MFB A;  3VQQ A;  2DY4 A;  2DTU A;  2FC0 A;  3AO4 A;  3VA0 A;  3QET A;  3HP6 A;  4RW8 A;  3QIP A;  4O0J A;  4E19 A;  3DOL A;  3MXI A;  4F2S A;  4R5P A;  3DM2 A;  3PV8 A;  1U49 A;  1N6Q A;  4CJ3 A;  2KW4 A;  4OVL A;  4FJN A;  1Z25 A;  1UA1 A;  3O3H A;  3HXM A;  2D0C A;  3TWH A;  4GVM A;  1RNH A;  4DS4 A;  3AA4 A;  1RBS A;  4E1M A;  3SQ4 A;  4BAC A;  5HP1 A;  3V1Q A;  3SQ1 A;  1W9H A;  1K6Y A;  1B9F A;  1HQU A;  2GUI A;  1LWC A;  1RDD A;  3CM5 A;  3ZT2 A;  1HYV A;  4CIG A;  4W5R A;  1NJZ A;  2QK9 A;  2O4I A;  2ETJ A;  4CHO A;  1JL1 A;  3QEP A;  4J2A A;  1TKT A;  2P5O A;  3LP0 A;  1NKE A;  1S9E A;  2Z1H A;  4BWM A;  4CK2 A;  1JLE A;  3ZCM A;  1WSJ A;  2VWK A;  4Q5V A;  1KVB A;  3KK3 A;  2QKK A;  4C8O A;  1TL3 A;  2KFN A;  2OZM A;  3AA5 X;  2VWJ A;  4KHW A;  3M8R A;  1XWL A;  3AVI A;  4ID5 A;  4H4O A;  3P1G A;  4CE9 A;  4DTO A;  4FJG A;  3PUF A;  4CJK A;  4BE1 A;  1RDA A;  4CF8 A;  1VSE A;  3ZT4 A;  1QS4 A;  3O3G A;  1TKX A;  3DLR A;  4DTU A;  1KLM A;  2XRI A;  5JS2 A;  3RMA A;  4QOZ B;  5JS1 A;  1LWE A;  3VQ8 A;  4RG8 A;  4N5S A;  2YNH A;  1ZYQ A;  3VQE A;  2YHA A;  4I7F A;  2Z1I A;  4FW1 A;  4CHP A;  2XY5 A;  3VN5 A;  3E01 A;  3BGR A;  1BIZ A;  3V1R A;  5HRO A;  3AVG A;  4J2D A;  4FW2 A;  4LH4 A;  4LY7 A;  3OJU A;  4EP5 A;  2HHW A;  3L3V A;  3WNH A;  1HJR A;  2QKB A;  1ASW A;  3NF7 A;  4IG0 A;  1TK0 A;  4FJM A;  4ELT A;  1J54 A;  3WNE A;  3O4Q A;  4HUF A;  2WOM A;  3OVN A;  2KTQ A;  4CEC A;  3VQ7 A;  4CIF A;  1WAJ A;  5I3U A;  1CZ9 A;  4N47 A;  4O0I A;  3QNO A;  3VQ9 A;  3NF9 A;  4OKK A;  3V9X A;  4FJ7 A;  4KI6 A;  3VQC A;  1YVU A;  2D5R A;  3C6U A;  3MED A;  4CJP A;  3O3F A;  2O4G A;  3THV A;  4FYD A;  4I9L A;  2DFF A;  4AH9 A;  1UA0 A;  1IKX A;  3F73 A;  4XIU A;  3SPY A;  4DSK A;  5HRR A;  1BQM A;  4M45 A;  4FJK A;  3DLG A;  4GW6 A;  4DSI A;  4MQ3 A;  1JLQ A;  1CLQ A;  4KO0 A;  4CEO A;  4CHN A;  4B9S A;  3ZSV A;  1Q9X A;  1RT4 A;  4FJJ A;  4BWJ A;  4IDK A;  4QAG A;  1WN7 A;  3ULD A;  3TAM A;  3SJJ A;  4B9L A;  1BCM A;  1Q8I A;  3RRH A;  3TAP A;  1CZB A;  2X6S A;  1WSI A;  4LD0 A;  4DLG A;  4FLV A;  3EYZ A;  1N5Y A;  1ZBH A;  2HMI A;  1ASV A;  3ZSX A;  4C8K A;  1VSJ A;  3SPZ A;  4E7I A;  4KTZ A;  2FBV A;  4FK4 A;  3SQ0 A;  3IS9 A;  1HYZ A;  3HPO A;  3NGY A;  2YV0 X;  3VQ6 A;  1SKR A;  3ZSO A;  4N76 A;  3LWL A;  4IKF A;  3AVH A;  1TGO A;  1YT3 A;  3DYA A;  3WNG A;  4CJS A;  3LAK A;  1VK0 A;  1JLC A;  3EY1 A;  2B6A A;  3K58 A;  4DFK A;  4ZTF A;  4ZTJ A;  1IKY A;  4E0D A;  3C6T A;  1HNV A;  4DMN A;  4E89 A;  4OPJ A;  2XY7 A;  1ZBL A;  3LPU A;  4JLH A;  3AO1 A;  4BDZ A;  4PQU A;  4E7L A;  4FVM A;  3SZ2 A;  3QEW A;  3TI0 A;  1TK8 A;  2P5G A;  2IOC A;  4RW7 A;  1VSI A;  3AVB A;  3VQD A;  1LWF A;  1VSM A;  1ITG A;  1XC9 A;  2IC3 A;  4W5T A;  4F3T A;  5SZT A;  1HMV A;  3HVR A;  3V9W A; 
#chains in the Genus database with same CATH topology
 4DU1 A;  3I0R A;  1G99 A;  5AZI B;  2NRX A;  3B6P A;  4GY2 B;  3P38 A;  1BL3 A;  3LAM A;  4M3W A;  4Y1C A;  3RTV A;  3AA2 A;  4OKJ A;  3ALY A;  3LDL A;  1BCO A;  2IS3 A;  2V7Z A;  3FE1 A;  1QSL A;  2YJF A;  2FF3 B;  2HND A;  1X3N A;  1W2B M;  5AQN A;  1NGA A;  2Q1N A;  4I9Q A;  2HHQ A;  4FCY A;  1L3S A;  2UUA K;  4BRD A;  3EO3 A;  3VF4 A;  4UQG A;  1X1P A;  1NJW A;  3IG1 A;  3DRP A;  1GLJ O;  4KTW A;  2RF2 A;  3L2V A;  4RW6 A;  1RT2 A;  4CGG A;  5I9E B;  3C6H A;  3PSI A;  3PIP L;  3HL8 A;  3I56 N;  4NXN K;  2X78 A;  3RSE A;  3H6E A;  1SV5 A;  3SCX A;  4ISG A;  3SI6 A;  3BUZ B;  3AAR A;  1IBK K;  1D4X A;  5FRN A;  3OYG A;  5GAG P;  2RKI A;  3HPH A;  3AVN A;  3GBT A;  1TK5 A;  1NGE A;  4EFH A;  3F9K A;  1CXU A;  2G8H A;  3ZX2 A;  5BPL A;  1UWB A;  2OTL N;  2KKZ A;  1XC3 A;  4CJE A;  2E6L A;  1K9M O;  2A6A A;  3F9M A;  4KAZ A;  4FM2 A;  2D0O A;  1ASU A;  3VEW A;  3V9U A;  3ATU A;  3CHW A;  1GLL O;  1S1T A;  3SUO A;  1NK5 A;  3NVK A;  1W7A A;  4JHD B;  3SNN A;  4IOX A;  3U4L A;  2R7Y A;  3DMJ A;  1WSE A;  1GLA G;  1VSH A;  4HUE A;  3KKR A;  3AVC A;  3KZB A;  5F2R A;  4Z4F A;  1RBT A;  4MLE A;  1C0T A;  5M1Q A;  3P31 A;  4FLY A;  4KHN A;  1SL1 A;  4K43 A;  3BY5 A;  1L5U A;  1BG3 A;  2Y1I A;  3CC2 N;  4WYB A;  4CGI A;  2G8F A;  3A5L C;  3T69 A;  4CBW A;  4CZK A;  4DQ8 A;  2ASP A;  4Z4C A;  5JVH L;  1VAZ A;  4HHT A;  4DF4 A;  4DTX A;  4F2R A;  4CD1 A;  5BRD A;  4FLT A;  4B9U A;  4H0P A;  3VQP A;  1HQE A;  3I0S A;  2I5J A;  3IDH A;  3WT0 A;  4B3S K;  3ZEU A;  3OYK A;  3L2W A;  3QES A;  3LDP A;  1RTI A;  4BRC A;  3AAP A;  2VG6 A;  3HP9 A;  1NKC A;  3OYA A;  3MXM A;  4XEI A;  3DLE A;  1YJW N;  4KRE A;  1B9D A;  2YKM A;  2RN2 A;  4C1N K;  4HVJ A;  4DUY K;  1YVN A;  2W6K A;  1O1W A;  3KD1 E;  3FR0 A;  3M6G A;  3THW A;  3AVM A;  3ULE A;  3CJ1 A;  2PFU A;  4DFP A;  1TL1 A;  2JLE A;  1RBU A;  4AIL C;  1Z05 A;  3MK6 A;  2A41 A;  1GLD G;  3O6W A;  5HRS A;  4ILJ A;  4A61 A;  3EZW A;  3CCJ N;  3TAE A;  3KD5 E;  4N41 A;  5JVG L;  3ZSR A;  4WQ4 C;  3T3F A;  2FSJ A;  3FGU A;  3B8A X;  3ENB A;  4BR4 A;  5KGX A;  3MAQ A;  3V4I A;  3U9Z A;  5TKY A;  1WAF A;  3Q7B A;  3CJ9 A;  4AHV A;  3TAF A;  4YOU A;  3JAM O;  4FWS A;  1RBR A;  4CFC A;  3R8E A;  2DFE A;  3G4S N;  1KD1 O;  1YIJ N;  1ZBI A;  4CF2 A;  4KHQ A;  3NF6 A;  4HTU A;  1MU2 A;  4JK9 A;  1L3U A;  1X9W A;  1NK7 A;  3ISN C;  3ZSY A;  5KQD A;  4H0Y B;  4F9O A;  3O4N A;  3DOK A;  1GOB A;  4JI5 K;  3C7N B;  4BVP A;  2RPI A;  1BI4 B;  5AQQ A;  4BR7 A;  4RW4 A;  1LAW A;  4X64 K;  1JKH A;  3U9D A;  3IKM A;  1KTQ A;  2G8K A;  4DR6 K;  5HLF A;  4FWQ A;  4JKD A;  4M3Z A;  1ESV A;  4JKG A;  1RT1 A;  4LF4 K;  3UKU A;  4KKO A;  3LP3 A;  3D45 A;  3H1Q A;  3JSM A;  1JCF A;  4IBN A;  4L3Q A;  3D6R A;  4H03 B;  4O8K A;  5GAE P;  5C42 A;  3TSU A;  3QLH A;  1JXE A;  1QSS A;  3NBP A;  3S3O A;  3OW2 M;  1QSY A;  4JV5 K;  3NH2 A;  1SKS A;  3A8Y A;  2A1S A;  5DM6 L;  4CJ5 A;  4CCH A;  4MDB A;  5C15 A;  3CQ8 A;  4HCB A;  1KFS A;  4IG3 A;  1GLE G;  4Z4I A;  4FPA A;  5AQT A;  3BF1 A;  2Z1J A;  2F8T A;  4FK2 A;  3FZK A;  1F21 A;  1OH5 A;  5M1N A;  2AA4 A;  1M90 O;  3DAW A;  3KK1 A;  2A3Z A;  3M8S A;  4AHR A;  1B92 A;  1L3T A;  4CZG A;  4OPK A;  3WXL A;  1K8A O;  2HBK A;  2HBJ A;  1JJ2 M;  3ZT0 A;  2HF3 A;  2P9K B;  4JS4 A;  1BOT O;  3AVL A;  4ID1 A;  3LZJ A;  2B5J A;  2VG5 A;  4KFB A;  5AQM A;  2UXC K;  3DLB A;  3ID6 A;  3PO5 A;  5FPM A;  4BR0 A;  4NB4 A;  1Q86 O;  5D3G A;  5AQX A;  4NLB A;  2E6M A;  3VGL A;  2W42 A;  4HCC A;  1QTM A;  3P4I A;  4H0T B;  3SAH A;  3OYJ A;  3U8X A;  2OPR A;  1WBD A;  1A5V A;  5M1P A;  1BGX T;  2DPN A;  4CJR A;  3OYH A;  3JS6 A;  1S1X A;  3PY8 A;  3TAQ A;  2HHT A;  1BU6 O;  3D2E B;  2P9P A;  4DU4 A;  1ILY A;  2CGJ A;  1X9S A;  3A2F A;  3O08 A;  2E1Y A;  1KQS M;  2YNG A;  4MFB A;  3AO4 A;  4O0J A;  5A2Q O;  3DOL A;  3MWT A;  1NLV A;  3MXI A;  2ZJP L;  1GLB G;  1U49 A;  3PV8 A;  4CJ3 A;  3MCP A;  4HTL A;  4IZ9 A;  4FJN A;  1Z25 A;  5FPD A;  1UA1 A;  1J6Z A;  1HLU A;  3M5R A;  2A40 A;  4Y0W A;  3CD6 N;  2NRH A;  1K6Y A;  3VTI A;  1NGB A;  3TTF A;  1NJZ A;  2A5X A;  2UXB K;  2F9T A;  2QI2 A;  4A59 A;  5IT9 O;  3MWP A;  3ENH A;  3KK3 A;  2O8C B;  4KHW A;  4BRN A;  2GTD A;  4CE9 A;  1S72 N;  1TYQ A;  3CJB A;  4BE1 A;  1VSE A;  2YX6 A;  3ZT4 A;  3O4W A;  4DTU A;  5JS1 A;  3VQ8 A;  1YJ9 N;  2YNH A;  4FSV A;  3VQE A;  3KK7 A;  2NRW A;  1LCU A;  2XY5 A;  3BGR A;  3THY A;  1Q18 A;  4LY7 A;  5C2D A;  5BPN A;  1HJR A;  3NF7 A;  4ELT A;  3O4Q A;  4WQ5 A;  4C1N I;  2A42 A;  4BGA A;  4CBX A;  1HKC A;  4O0I A;  3NF9 A;  4OKK A;  3V9X A;  4FJ7 A;  4KI6 A;  4I9L A;  3F73 A;  1NG9 A;  2NRT A;  1Q7Y O;  4FWM A;  4DSK A;  1QVF M;  1BQM A;  4GW6 A;  4B9S A;  4IJN A;  2Q31 A;  3L0Q A;  4BWJ A;  3TAM A;  1SS6 A;  4QS8 A;  3BEX A;  4FLV A;  2W6L A;  1DKG D;  1ZBH A;  3O9U A;  4C8K A;  3MMV A;  1XNR K;  3R6M A;  4N76 A;  3NGY A;  2YV0 X;  4E1J A;  1JLC A;  2B6A A;  4BRO A;  3C6T A;  1ZBL A;  3LPU A;  4JLH A;  1IBL K;  4BDZ A;  3VEN A;  1HUX A;  1QQM A;  3KVG A;  4GV9 A;  2RE2 A;  2ZJR L;  3Q7C A;  3FZM A;  3BDP A;  3M1F A;  3MEG A;  1S9G A;  4DTS A;  1I39 A;  3U3Y A;  1JL2 A;  4C8N A;  1P90 A;  4KH4 A;  2F8S A;  4DQQ A;  1GOA A;  1IV0 A;  4M3X A;  4DLE A;  3H46 O;  1WNS A;  4G9Z A;  5JLH A;  1WSF A;  3WXI A;  1LOT B;  4X65 K;  2Q36 A;  1U2V A;  4OO1 J;  2FF6 A;  3HPG A;  3RMD A;  3OY9 A;  3HRG A;  3KWI A;  3CME N;  2BUP A;  4JI1 K;  2KLA A;  2B4J A;  3O9T A;  4AHC A;  2A1R A;  3RSE B;  4CD3 A;  4CJU A;  4CGD A;  3RMC A;  1J9A A;  3D0P A;  4DFJ A;  2PY5 A;  1VHX A;  4IFE A;  1QVG M;  4DR4 K;  1VRU A;  3SJH A;  4DU3 A;  3J7A P;  3TAG A;  5KRT A;  1IH7 A;  4CHZ A;  4Z4H A;  1NM1 A;  5M1F A;  1BQN A;  2XY8 A;  5BR8 K;  3NFA A;  3SMS A;  2HVI A;  4BRK A;  1RGI A;  3TPQ A;  5CY4 A;  3VQB A;  3C0B A;  1VQP N;  3ZSW A;  1RDB A;  2W41 A;  3AO3 A;  4FWL A;  3MX2 A;  5I42 A;  1RDW X;  3NGI A;  1D9D A;  1WSH A;  4YOT A;  4CEB A;  4LF7 K;  4M63 C;  2ZGZ A;  4AQY K;  3T1H K;  4EZ9 A;  4KRF A;  1BWF O;  1KAZ A;  1X9J A;  5AQJ A;  4DTR A;  1YIT N;  3VEV A;  4PWD A;  4WE1 A;  2HVH A;  5KGW A;  5C12 A;  3CCE N;  4BQZ A;  4CF9 A;  1T8E A;  3DJC A;  3I8B A;  4NCG A;  4DB3 A;  4JKA A;  1HPZ A;  4MDA A;  4XH1 A;  3KLI A;  4IJA A;  4Y1D A;  1J5O A;  1TAQ A;  4ZHR A;  1EX4 A;  4FLX A;  4J2E A;  2KHO A;  2CH5 A;  5CYQ A;  5E41 A;  4CZE A;  1IKW A;  5SWM A;  4A2A A;  1JCE A;  4DV1 K;  1G15 A;  1JLA A;  1NK0 A;  4KB1 A;  4JN4 A;  1HKB A;  1WLJ A;  3ZSZ A;  3OS2 A;  1D5A A;  3PSF A;  3AA3 A;  3EEQ A;  3SAG A;  4ICL A;  4JYA K;  3V9S A;  4OGE A;  3AVJ A;  4CEQ A;  3FZL A;  2EX3 A;  4YY3 K;  3HM9 A;  1JLG A;  4U7B A;  4FXD A;  5KTQ A;  5ADX A;  3O1W A;  4JNE A;  2F96 A;  3ITH A;  3LM9 A;  3L4I A;  3SK3 A;  3P39 A;  3THW B;  2GEM A;  2NRR A;  3ULE B;  4DSL A;  3A5O C;  4CK3 A;  2QXF A;  4HWI A;  1VQ9 N;  2NZT A;  4ISF A;  4A5B A;  2DFH A;  4Z4E A;  4GV6 A;  3KTQ A;  1C1A A;  1Q9Y A;  4CJQ A;  1HRH A;  1TUY A;  1S6P A;  1W97 L;  3DLK A;  4JD2 A;  4BRF A;  4O4G A;  3K5O A;  3LWM A;  4B9M A;  2OZS A;  4FO0 A;  2Q0U A;  4W5N A;  4XH5 A;  2VWB A;  1XHZ A;  4E7H A;  4YOR A;  4FJL A;  4NCA A;  2Q2R A;  3PX0 A;  4CEZ A;  1T05 A;  2NRZ A;  3VEZ A;  3P5J A;  3CM6 A;  1EWR A;  2YI1 A;  3LDS A;  2BGG A;  4NLC A;  2QWM A;  3LDO A;  4A2B A;  4MO4 A;  4F4K A;  4BC4 A;  3ZX3 A;  2WTU A;  5F1X A;  4IOA L;  4K8X A;  2HHU A;  3G6E N;  2ITG A;  4B9V A;  1C0F A;  5J1E A;  4CK1 A;  3OS1 A;  1A5W A;  4FLU A;  4JKG B;  1VSF A;  1GOC A;  3QEI A;  1KRP A;  4KHS A;  1RTH A;  3UKU B;  3QER A;  3M3Z A;  2Z1G A;  2OAN A;  5AQP A;  4IFY A;  1WOQ A;  1FKP A;  2UYT A;  3HOS A;  3HM8 A;  4O5F A;  3QO9 A;  5CE3 A;  3WEE A;  1N32 K;  4BR2 A;  3V6D A;  1RT6 A;  2E2P A;  5M1O A;  1FXX A;  3VOV A;  1RBV A;  1NOZ A;  1ZC6 A;  2NNW A;  1KSP A;  1CXQ A;  3TU5 A;  4DTJ A;  4BRQ A;  1ATR A;  1LAV A;  3CF5 L;  2G8I A;  4CER A;  1S1V A;  3CCS N;  3CYM A;  1QQC A;  3T1A A;  2PZS A;  5GIP A;  2GV9 A;  1FW6 A;  3VQA A;  1C6V A;  2QTD A;  1NK6 A;  3SV3 A;  4H5N A;  1ZBF A;  3E9O A;  4NCB A;  2PBD A;  4LF9 K;  4YFU A;  3CER A;  3ZSQ A;  5LMN K;  2ATQ A;  3QIC A;  1E4G T;  4B1X B;  1WSG A;  3J7Z O;  4CGJ A;  4AHT A;  4H0O A;  1C0U A;  3SMP A;  4Z94 A;  5HRN A;  2JWL A;  3KJV A;  3CFP A;  3PX4 A;  5BRH A;  3KHY A;  3K9J A;  3G0Z A;  4BC3 A;  5BN9 A;  3V9Z A;  3DLL L;  2O8E A;  4AHU A;  4DV5 K;  1U45 A;  5F0X A;  4FZY A;  1XMQ K;  3CCV N;  5FDL A;  3RR8 A;  3QFU A;  3LPT A;  3TR8 A;  3DRR A;  3LDN A;  2UUC K;  4FOI A;  3L2R A;  4H4M A;  2P9P B;  4OGC A;  3VES A;  2IIR A;  4DSE A;  2PYJ A;  4I6M A;  4CJV A;  2X74 A;  3SYZ A;  4FM1 A;  1T7P A;  2W40 A;  1NJX A;  2GX9 A;  3OBY A;  5M1K A;  1CZA N;  4JK8 A;  4DV6 K;  5KI6 A;  3WQT A;  1I3A A;  2ASM A;  4B1U B;  1R59 O;  2FBY A;  1V4T A;  3CCR N;  4DTM A;  3EKS A;  2DTU A;  1ZXO A;  2D1K A;  3VA0 A;  4WQ5 C;  1NJI O;  1QZ5 A;  4BGB A;  2KW4 A;  4OVL A;  1VQO N;  2QXL A;  3HTV A;  3HXM A;  2D0C A;  4DV7 K;  1HNX K;  4DS4 A;  3AA4 A;  1B9F A;  1LWC A;  1TYQ B;  2HF4 A;  3CJ7 A;  3CQX A;  4CIG A;  4W5R A;  2QK9 A;  1JL1 A;  4J2A A;  3UKR A;  4YOX A;  1NKE A;  4CK2 A;  4C8O A;  2OZM A;  3AA5 X;  2VWJ A;  3THY B;  3M8R A;  1XWL A;  3AVI A;  4ID5 A;  4CVN E;  3PUF A;  4CJK A;  1RDA A;  4CF8 A;  2O8F A;  1QS4 A;  3O3G A;  2XRI A;  4A5A A;  2HMP A;  1M1K O;  1ZYQ A;  2HOE A;  1WB9 A;  3V1R A;  5GIN A;  5AQW A;  3AVG A;  4CZH A;  3E9L A;  3A5N C;  3VET A;  4CZJ A;  1TK0 A;  2CH6 A;  4AM7 A;  4CW7 B;  5IWA K;  4BRI A;  4HUF A;  2UUB K;  3I33 A;  4PL8 A;  1CZ9 A;  3VQ9 A;  2P9I A;  3AGR A;  4FYD A;  1YVU A;  2D5R A;  3THV A;  2DFF A;  4AH9 A;  1IKX A;  5ADX H;  3SPY A;  2V52 B;  3DLG A;  1JLQ A;  2VGN A;  4CHN A;  3CJC A;  1Q9X A;  4IDK A;  3SJJ A;  1BCM A;  1CZB A;  4DLG A;  3ZSX A;  3VGM A;  2GWK A;  1VSJ A;  4K25 A;  4DR1 K;  4E7I A;  4FK4 A;  2FBV A;  3FZF A;  1HYZ A;  4EHT A;  3ZSO A;  3LWL A;  4IKF A;  3AVH A;  1TGO A;  3WNG A;  1XNQ K;  4ZTF A;  4DFK A;  1NWK A;  5AQF A;  3TTD A;  4BG9 A;  3WXK A;  3O8M A;  4E0D A;  1QZ6 A;  4DMN A;  2XY7 A;  4FWO A;  3AO1 A;  4E7L A;  3QEW A;  2P5G A;  1HX1 A;  2IOC A;  5CR4 A;  1VSI A;  5AQO A;  3VQD A;  2IC3 A;  4W5T A;  1U2V B;  5SZT A;  1HMV A;  3HVR A;  3LZI A;  2E2Q A;  1I94 K;  4DSJ A;  3QFP A;  4H8K A;  4B8C A;  1YJN N;  3KLG A;  5EVZ A;  2CGK A;  1SUQ A;  3E1Y A;  3N4Q A;  3CFR A;  4FVU A;  4BRE A;  4K0K K;  3ZT1 A;  2IVP A;  5FPN A;  3BP8 A;  3ZT3 A;  3HJF A;  3TAB A;  3OYL A;  2QWO A;  4DQI A;  2FSN A;  3GG4 A;  1RCH A;  1S6Q A;  5AQH A;  1U48 A;  4H5T A;  4LF6 K;  1D9F A;  5J2P A;  2AP1 A;  3LDQ A;  3HK2 A;  4YDU A;  3RMB A;  1TAU A;  5AQL A;  5JIC A;  5DK5 A;  3HT3 A;  4R79 A;  4BE0 A;  2OA8 A;  1NGI A;  1VSD A;  2JWK A;  4B8A B;  3P83 D;  4DKW A;  4KV8 A;  4FWP A;  2FBT A;  4LFC K;  5C25 A;  4EP4 A;  4RW9 A;  1IKV A;  1JXB A;  2F7T A;  3THX A;  3W0L A;  1MWM A;  2GWJ A;  2YCH A;  3BZC A;  4DV4 K;  4DFM A;  2QWL A;  1RTD A;  2E2O A;  1BIU A;  2E88 A;  4O44 A;  1J5E K;  3O80 A;  3OYB A;  5BRE A;  1VQ5 N;  2NUB A;  1T6C A;  1KVC A;  3OJS A;  4B1V A;  1S22 A;  3D2F A;  2O8D A;  3RVC A;  3G25 A;  3KWG A;  4BRH A;  2GUP A;  3CC4 N;  2IDO A;  5GAH P;  3K5M A;  4GV3 A;  4DV3 K;  1C1B A;  2QA4 N;  1N33 K;  4BVO A;  1EXQ A;  3VPZ A;  3K59 A;  3SQ2 A;  1NOY A;  5EY4 A;  3H45 C;  3C6A A;  2VQE K;  3K57 A;  1TV6 A;  4YHH K;  1KVA A;  1ZBS A;  3FFI A;  3AY9 A;  3OYE A;  1DGK N;  1U6Z A;  2G8V A;  3OYF A;  3EZ5 A;  5JMV A;  3AGK A;  4BRP A;  3AVK A;  5TKW A;  3OA9 A;  5LY3 A;  1D8Y A;  4YOW A;  5LMU K;  3WXM B;  2HHH K;  2ASO A;  4M3R A;  1RIL A;  3SUQ A;  3AVA A;  3PO4 A;  1IBM K;  1H1V A;  4CJT A;  2E2N A;  3OBW A;  4BR9 A;  5AR0 A;  4YNQ A;  1FK9 A;  4H5W A;  4LC9 B;  1KLN A;  4JI2 K;  4NYF A;  3VQ4 A;  5FRM A;  1Z26 A;  4CJ4 A;  4B1Y B;  4M3U A;  4DR7 K;  3B6O A;  2AJQ A;  4JD2 B;  4N56 A;  3CXC M;  3QIO A;  4DQR A;  4B3M K;  4KHP K;  3O9S A;  4C23 A;  1XI1 A;  1XHX A;  1RT3 A;  2P9L A;  4PUO A;  2NRV A;  3HSC A;  3MEC A;  1HR0 K;  4H0X B;  3S3N A;  3OYI A;  2Q97 A;  1P8Z A;  3RRG A;  2Q3S A;  3GDQ A;  1T44 A;  3VEY A;  3BZK A;  4CF0 A;  1NU0 A;  3NDK A;  3OYD A;  1HNZ K;  1U04 A;  1SAZ A;  4G1Q A;  1FJG K;  1NGF A;  3DXM A;  4EAH D;  3L8B A;  3GOI A;  2WBN A;  5FLX O;  3CCU N;  3NHG A;  3SUN A;  4PKI A;  3QNN A;  2XHB A;  2OPQ A;  2HBL A;  3T1Y K;  1K73 O;  4DV0 K;  4JRP A;  4CFB A;  3KKS A;  2Q0R A;  4LF5 K;  4LF8 K;  3S3M A;  5AQU A;  1QHT A;  1VRT A;  4KPY A;  2D0B A;  2D4W A;  5LL6 Z;  5B8H A;  3OS0 A;  3PIO L;  3HST B;  4DS5 A;  3NH1 A;  1YF5 L;  2E4L A;  3WEE B;  2VCP A;  2ZGY A;  2P51 A;  4FLZ A;  2BE2 A;  1YHQ N;  2YKN A;  5C0Y A;  3WNF A;  1DT9 A;  4J8F A;  4CIE A;  3JXU A;  1RT5 A;  4DG1 A;  1NK8 A;  3MN9 A;  2PYL A;  1HPM A;  5KRS A;  4KTQ A;  2YHB A;  3N4P A;  3ASM A;  1ATS A;  1NJY A;  3AVF A;  1NKB A;  1VSK A;  2V7Y A;  1BO5 O;  1Y97 A;  1NMD A;  3VMF B;  3WQU A;  1VQ7 N;  4M42 A;  3J7Y P;  4M3Y A;  1SL2 A;  3DLH A;  2YJE A;  4DF8 A;  4RTF D;  2OPP A;  1LV5 A;  4FOE A;  4J2B A;  3M8P A;  3D7E O;  4JRQ A;  3T7Z A;  4H5R A;  4M3T A;  1EET A;  3QB0 A;  4C8M A;  4CJF A;  4DQP A;  3NH0 A;  1IO2 A;  3MDQ A;  3HBT A;  1LW2 A;  4KH6 A;  2O8E B;  4M7X A;  1XQS C;  4ELV A;  2EWS A;  3CIP A;  3U3G A;  1REV A;  3E66 A;  4ELU A;  1W0H A;  3CCL N;  3SBG A;  2YNI A;  3E9P A;  3ZX0 A;  2QW9 A;  4PL7 A;  3NE6 A;  1YI2 N;  3V81 A;  3CC7 N;  3SV4 A;  4BRL A;  4CEE A;  4I6M B;  1BIS A;  3NCI A;  2F4V K;  1HJO A;  3CJA A;  4OPA A;  5AQG A;  3G71 N;  4YOY A;  4BDY A;  3L2U A;  1BA0 A;  5AZJ A;  4Z0U A;  2VG7 A;  2YHW A;  4AHS A;  4CHY A;  2P9N A;  1JCG A;  4OLB A;  4JI4 K;  3M8Q A;  2YHX A;  4LH5 A;  4CJ7 A;  1X9M A;  2E8A A;  3FLC O;  4A62 A;  2J4R A;  1TKD A;  4KB0 A;  5C24 A;  4BE2 A;  3R1X A;  3K2P A;  4KHY A;  1S3X A;  3NMU A;  4O5B A;  4B9Q A;  3FFK B;  2P1J A;  4IOC L;  2ZE2 A;  4JKF A;  1NBW A;  4DHY A;  2FBX A;  2HNY A;  2KZM A;  2ZQB A;  2HNZ A;  2HHV A;  4BRM A;  2DY4 A;  2FC0 A;  4IO8 A;  4BY9 C;  4BQL A;  3HP6 A;  4RW8 A;  3QIP A;  1EO1 A;  3DM2 A;  1N6Q A;  3UKR B;  2E1Z A;  3QDK A;  4OPH A;  3AAQ A;  1RBS A;  3SQ1 A;  1YUW A;  1W9H A;  3ZT2 A;  2ZJQ L;  5AQR A;  2O8F B;  2ETJ A;  3F2K A;  3ZET A;  1TKT A;  4IEE A;  4WFA L;  3CQY A;  3ID8 A;  3ZCM A;  1BUP A;  2NLX A;  2VWK A;  4Q5V A;  3CMA N;  2QKK A;  1OKJ A;  1QQN A;  4CBU A;  5AFU A;  4K42 A;  4FJG A;  4JKB A;  1QQO A;  2FLO A;  1TKX A;  3DLR A;  1KLM A;  5JS2 A;  1LWE A;  4CZI A;  1OH8 A;  4RG8 A;  3EL2 A;  1K8K A;  2P9I B;  2YHA A;  4FW1 A;  5HRO A;  3E01 A;  1BIZ A;  4FW2 A;  2HHW A;  3L3V A;  3FZH A;  1ASW A;  4DV2 K;  1J54 A;  5BN8 A;  3QML A;  2WOM A;  2KTQ A;  4CEC A;  3VQ7 A;  1WAJ A;  4N47 A;  3QBW A;  5BPM A;  3VQC A;  3C6U A;  1XUP O;  2FXU A;  5E84 A;  3LL3 A;  2QEX N;  5HOO A;  1BA1 A;  1NGH A;  4M45 A;  4FJK A;  4DSI A;  4KO0 A;  2OCE A;  3ZSV A;  5LJV A;  3ZLJ A;  4JI8 K;  3R3L A;  2P9S A;  1RT4 A;  4BC5 A;  4YDU C;  3J8A A;  4QAG A;  3ULD A;  1Q8I A;  2X6S A;  1WSI A;  1N5Y A;  1IJJ A;  2HMI A;  2P9U A;  4GKJ K;  3VF6 A;  3GL1 A;  4JEP A;  5ELZ A;  3SQ0 A;  3IS9 A;  2VGM A;  1N34 K;  1YT3 A;  1XMO K;  4UY8 O;  2UXD K;  1VK0 A;  3K58 A;  1GLC G;  4ZTJ A;  1IKY A;  4GVE A;  4OPJ A;  5AQV A;  4PQU A;  3TI0 A;  2O8B A;  4WFN L;  4RW7 A;  3AVB A;  1LWF A;  1VQK N;  1ITG A;  4ILH A;  3V9W A;  2ZF5 O;  3QBX A;  2BTF A;  4O55 A;  1KC8 O;  4C8L A;  3K9K A;  3LAN A;  4LFA K;  3DWL A;  5EU7 A;  4O8U A;  4W5Q A;  1VQ4 N;  4LSN A;  3KLH A;  3TAR A;  3PX6 A;  1NNE A;  1IG9 A;  3NF8 A;  2IGI A;  5EOY A;  4EHU A;  5JLF A;  3G10 A;  3VEO A;  2Y1J A;  3QEV A;  5AQI A;  3MEE A;  4B3O A;  1KXP A;  1KAX A;  5AZI A;  4HUG A;  5KPZ A;  5J2N A;  3IFR A;  4E3S A;  3THX B;  3VEX A;  4FJX A;  5GAD P;  4NXM K;  4U67 L;  4CJL A;  1UAX A;  2BH1 A;  3NAE A;  4DWI A;  4B1W B;  1QHA A;  2HB5 A;  1IG8 A;  1RTJ A;  3CI5 A;  3SLC A;  4FJI A;  4F3O A;  1U47 A;  5FRO A;  5CHI A;  4B9T A;  4GMJ B;  5HRP A;  4JS5 A;  3MCA B;  3J81 O;  4QCL A;  3O1B A;  1VQ6 N;  3R9P A;  2H3G X;  5AQS A;  4BDP A;  3D2F B;  3VF2 A;  2WON A;  2O8D B;  1S1U A;  3OYM A;  2E20 A;  1NGD A;  4X66 K;  4DSF A;  1SKW A;  4DR5 K;  4FWR A;  4PA1 A;  2QWN A;  4KI4 A;  1WUA A;  2XO7 A;  2WUS A;  4K41 A;  3I8D A;  1YTU A;  4FK0 A;  3KLE A;  1DLO A;  1BHL A;  3F5T A;  3SUP A;  4CZF A;  4AF1 A;  3DXK B;  3C94 A;  1Q81 O;  4E7J A;  2RHK A;  1TVR A;  1RT7 A;  4B9N A;  4KHU A;  4FJ9 A;  3L6Q A;  1NGC A;  3K5L A;  1BDG A;  5EXW A;  3A0I X;  1NK4 A;  1RDU A;  3RWU A;  5C2F A;  3NVM A;  4JHD A;  3CFO A;  1C1C A;  5BRF A;  3KK2 A;  4IFV A;  5CZ2 A;  1X3M A;  3AO5 A;  2F9W A;  5T7B A;  2D0P A;  1ATN A;  4WFB L;  4FJ8 A;  1HKG A;  2JGU A;  3UIQ A;  3AV9 A;  2KQ2 A;  4CI6 A;  2HBM A;  3O9R A;  3ENO A;  3HI0 A;  1DTT A;  4CED A;  4JI0 K;  1EQY A;  4CF1 A;  2G8W A;  3KLF A;  1SL0 A;  1NMN A;  1Q82 O;  4CES A;  2P9L B;  3TTC A;  1GLF O;  1MA9 B;  4FWK A;  5BR9 A;  4B1Z A;  4NYN A;  4IXC A;  4JI3 K;  2EHG A;  3HVT A;  5HBM A;  2IVN A;  2QM1 A;  4IWV A;  2HST A;  5LJW A;  3VTH A;  2CGL A;  4DTN A;  1O13 A;  3DI6 A;  1OVQ A;  1Z6R A;  3HO1 A;  1RDC A;  2LSN A;  3EE8 A;  4DTP A;  2HHS A;  3DXM B;  4FZX C;  2OYQ A;  5KQ8 A;  3TSQ A;  4CGF A;  2HHX A;  4H5V A;  4RWT A;  1L3V A;  5AQK A;  1TKZ A;  2ZD1 A;  3EN9 A;  1YXQ A;  1YTA A;  4FPB A;  5CZ1 A;  3LP2 A;  3SBT A;  1T03 A;  5J2Q A;  1N36 K;  4M41 A;  1NGJ A;  4FL9 A;  3CG7 A;  4DCH A;  4BR5 A;  3K0S A;  1T6D A;  3MXJ A;  1RFQ A;  2I7N A;  3RR7 A;  4OKE A;  4I2P A;  3OHR A;  4V19 S;  4EZ6 A;  3QIN A;  5KPR A;  2E5L K;  5EX5 A;  1T3V A;  4JKC A;  5AFU H;  4CZL A;  3JYT A;  1VQL N;  1YAG A;  3VER A;  1KAY A;  3IRX A;  5KPT A;  4CGH A;  1A5X A;  3L3U A;  4LSL A;  4W5O A;  3OYN A;  1DTQ A;  3J80 O;  2YNF A;  3CPW M;  2KZZ A;  3WUH A;  4IEI A;  4L8R B;  3DRS A;  4PKH A;  5AQY A;  4RCH A;  1V4S A;  3T19 A;  1S1W A;  1JLB A;  5CYM A;  3S41 A;  4DQS A;  2OTJ N;  1EKE A;  2QWP A;  3UB5 A;  2G8U A;  1EP4 A;  4FZZ A;  2BAN A;  2X6N A;  3GE1 A;  4DR2 K;  3MN5 A;  4AM6 A;  4OJR A;  2YHY A;  4PHT X;  4PY5 A;  4E7K A;  3C7N A;  4B08 A;  2IAJ A;  4JI7 K;  1BI4 A;  1NGG A;  4F8R A;  1NK9 A;  3KIO A;  1HNW K;  4FJ5 A;  4CEA A;  4Q0B A;  4OX9 K;  1JLF A;  4IO9 L;  3O9Q A;  3LP1 A;  4WQ4 A;  1KCF A;  5K14 A;  4M7Y A;  2I7P A;  1LW0 A;  4OLA A;  3H08 A;  4GKK K;  5C10 A;  4FJH A;  2UU9 K;  2QWR A;  5HL7 L;  3DXK A;  1E3M A;  3AO2 A;  1QE1 A;  2GEL A;  4K8Z A;  3CCM N;  3HYF A;  4JKH A;  2PAV A;  3K5N A;  3TAN A;  3C95 A;  4GNI A;  4CJW A;  1UOC A;  4FM0 A;  3MN7 A;  1U4B A;  3W3D A;  3V1O A;  4BRG A;  3OYC A;  5AZJ B;  3CCQ N;  4FLW A;  2KFZ A;  4CEF A;  2XY6 A;  2WC9 A;  3IMX A;  1EWQ A;  3VA3 A;  1VQN N;  1ZBU A;  3HZ6 A;  2P9N B;  1HYS A;  2OPS A;  4E1N A;  3SAF A;  3VQ5 A;  4JKE A;  1S5J A;  4CFA A;  4EIA A;  1VSL A;  3NGZ A;  1KFD A;  3H3O B;  2GBZ A;  2P9K A;  3LAL A;  3QEX A;  4DR3 K;  5J2M A;  3S9H A;  3U6F A;  4BRA A;  3HOT A;  4TSX A;  4LFB K;  4CZM A;  3L2Q A;  4CHQ A;  1HNI A;  5DMR A;  1FKO A;  3OTO K;  1VQ8 N;  1C0M A;  4ISE A;  4CFD A;  2HW3 A;  4Z4G A;  3I55 N;  1J53 A;  1R0A A;  2VYP A;  2BDP A;  4I2Q A;  5AQZ A;  3TSP A;  1VQM N;  3L4Q A;  3MX5 A;  2D0A A;  4X62 K;  3VQQ A;  1OVY A;  3QET A;  4JAX A;  4E19 A;  1MDU B;  3C65 A;  4F2S A;  4R5P A;  2ITM A;  2VQF K;  3ZET B;  3VGK A;  1C0G A;  3D2E A;  4JI6 K;  1MWK A;  2IVO A;  4A57 A;  3CET A;  4WCE L;  3O3H A;  3TWH A;  4GVM A;  5DM7 L;  1RNH A;  4E1M A;  3SQ4 A;  4BAC A;  5HP1 A;  3V1Q A;  1OH6 A;  1HQU A;  2GUI A;  1RDD A;  3CM5 A;  1HYV A;  2O4I A;  2QWQ A;  4FWN A;  4CHO A;  3ATV A;  3QEP A;  2ZWH A;  1Y64 A;  2V51 B;  2P5O A;  3LP0 A;  1S9E A;  4ILG B;  2Z1H A;  4BWM A;  1JLE A;  1WSJ A;  5AJ3 K;  1KVB A;  2KFN A;  1TL3 A;  1K8K B;  4H4O A;  3P1G A;  4DTO A;  1DEJ A;  3MN6 A;  1N8R O;  3EE9 A;  3RMA A;  4QOZ B;  4N5S A;  3EKU A;  4I7F A;  4MLH A;  4QS7 A;  2Z1I A;  4CHP A;  3VN5 A;  2O8C A;  4J2D A;  4H0V B;  4LH4 A;  3OJU A;  4EP5 A;  5FPE A;  4DUZ K;  3WNH A;  4KH5 A;  2QKB A;  4IG0 A;  4FJM A;  3A5M C;  3WXJ A;  4QS9 A;  3WNE A;  4B3R K;  3OVN A;  3O5B A;  2P9S B;  4CIF A;  5I3U A;  3BF3 A;  4PKG A;  3QNO A;  4KBO A;  4CJP A;  3MED A;  5E26 A;  3O3F A;  2O4G A;  4MO5 A;  3H1V X;  2ZM6 K;  1UA0 A;  2P9U B;  4BC2 A;  3CPE A;  4XIU A;  3ZYY X;  5HRR A;  4MQ3 A;  1CLQ A;  4CEO A;  2FSK A;  4XH4 A;  4YOV A;  4FJJ A;  4BG8 A;  1WN7 A;  4B9L A;  1E4F T;  3RRH A;  3TAP A;  4LD0 A;  4B3T K;  3EYZ A;  2O8B B;  1ASV A;  1TUU A;  4IDH A;  3UE5 A;  1WBB A;  3ZEU B;  3SPZ A;  3PLA A;  4JK7 A;  4KTZ A;  5H1S Q;  3LM2 A;  3HPO A;  3IUC A;  3VQ6 A;  1SKR A;  3IAY A;  3DYA A;  4CJS A;  3EY1 A;  3LAK A;  1OH7 A;  2WFB A;  5GIO A;  5MLC Q;  4E89 A;  1HNV A;  4NO7 A;  1TK8 A;  4FVM A;  3SZ2 A;  1SQK A;  1SZ2 A;  4WF9 L;  1VSM A;  1XC9 A;  4F3T A;  3H3N O; 
#chains in the Genus database with same CATH homology
 3LZI A;  4DU1 A;  3MEG A;  4O55 A;  4C8L A;  3I0R A;  1S9G A;  4DSJ A;  4H8K A;  4B8C A;  3LAN A;  4DTS A;  3KLG A;  1I39 A;  5EU7 A;  3U3Y A;  4W5Q A;  1JL2 A;  4C8N A;  1SUQ A;  3CFR A;  4LSN A;  3KLH A;  2F8S A;  3B6P A;  3ZT1 A;  3TAR A;  3PX6 A;  4DQQ A;  1GOA A;  1IG9 A;  4M3X A;  3NF8 A;  2IGI A;  1BL3 A;  4DLE A;  1WNS A;  3LAM A;  4M3W A;  4Y1C A;  3ZT3 A;  3RTV A;  3HJF A;  3AA2 A;  3G10 A;  2Y1J A;  4OKJ A;  3ALY A;  3OYL A;  3TAB A;  1WSF A;  4DQI A;  1BCO A;  2IS3 A;  3QEV A;  3HPG A;  3MEE A;  1QSL A;  4B3O A;  3RMD A;  1RCH A;  1S6Q A;  3OY9 A;  1U48 A;  4HUG A;  2B4J A;  2HND A;  1D9F A;  5J2P A;  5J2N A;  4AHC A;  2A1R A;  4E3S A;  3HK2 A;  4CJU A;  4CGD A;  4I9Q A;  3RMC A;  4FCY A;  3RMB A;  1L3S A;  4FJX A;  2HHQ A;  1TAU A;  1J9A A;  4UQG A;  1X1P A;  3D0P A;  5DK5 A;  3HT3 A;  4DFJ A;  1NJW A;  3IG1 A;  4CJL A;  4BE0 A;  1VSD A;  4B8A B;  3DRP A;  1VRU A;  4DU3 A;  2OA8 A;  4KTW A;  1UAX A;  2RF2 A;  3L2V A;  4RW6 A;  1RT2 A;  4CGG A;  5KRT A;  3NAE A;  1IH7 A;  3TAG A;  4DWI A;  4CHZ A;  3P83 D;  4Z4H A;  2HB5 A;  4KV8 A;  2FBT A;  1RTJ A;  5C25 A;  3HL8 A;  4FJI A;  1BQN A;  1U47 A;  4EP4 A;  4F3O A;  5FRO A;  4RW9 A;  1IKV A;  2X78 A;  2XY8 A;  1JXB A;  3NFA A;  4B9T A;  4GMJ B;  1SV5 A;  5HRP A;  4JS5 A;  3SCX A;  2HVI A;  3SI6 A;  4QCL A;  5FRN A;  5CY4 A;  3OYG A;  2RKI A;  3HPH A;  3AVN A;  3VQB A;  1TK5 A;  3ZSW A;  1RDB A;  4BDP A;  2WON A;  3F9K A;  1CXU A;  1S1U A;  3AO3 A;  4DFM A;  3OYM A;  5I42 A;  2G8H A;  3BDP A;  3NGI A;  1D9D A;  1RTD A;  1UWB A;  1WSH A;  1BIU A;  4DSF A;  1SKW A;  4CEB A;  4O44 A;  4CJE A;  2E6L A;  4PA1 A;  3OYB A;  4KI4 A;  2XO7 A;  4KAZ A;  2NUB A;  4EZ9 A;  4FM2 A;  3I8D A;  4KRF A;  1KVC A;  1YTU A;  1ASU A;  3OJS A;  4FK0 A;  3KLE A;  1DLO A;  3V9U A;  4DTR A;  1BHL A;  3SUO A;  1S1T A;  1NK5 A;  4WE1 A;  4PWD A;  2HVH A;  2IDO A;  5KGW A;  3SUP A;  3K5M A;  3SNN A;  1C1B A;  2R7Y A;  3C94 A;  1WSE A;  3DMJ A;  4CF9 A;  1EXQ A;  3K59 A;  1T8E A;  4E7J A;  1VSH A;  4HUE A;  1TVR A;  3KKR A;  4NCG A;  3SQ2 A;  1RT7 A;  1NOY A;  4B9N A;  3AVC A;  4KHU A;  4FJ9 A;  1HPZ A;  4Z4F A;  3K57 A;  1RBT A;  1TV6 A;  1KVA A;  3K5L A;  1C0T A;  3FFI A;  3KLI A;  4Y1D A;  1NK4 A;  1J5O A;  1TAQ A;  3RWU A;  4ZHR A;  3OYE A;  1EX4 A;  4FLX A;  4FLY A;  4J2E A;  3CFO A;  5CYQ A;  1C1C A;  5E41 A;  2G8V A;  3OYF A;  4KHN A;  3KK2 A;  1IKW A;  3EZ5 A;  5SWM A;  1SL1 A;  1G15 A;  4IFV A;  3AVK A;  1JLA A;  3AO5 A;  5CZ2 A;  1NK0 A;  1D8Y A;  4KB1 A;  1WLJ A;  3ZSZ A;  5T7B A;  3OS2 A;  1D5A A;  1L5U A;  2Y1I A;  4FJ8 A;  3AA3 A;  4ICL A;  3V9S A;  2JGU A;  3UIQ A;  4OGE A;  4M3R A;  3AV9 A;  1RIL A;  3AVJ A;  4CEQ A;  4CGI A;  2KQ2 A;  2G8F A;  3SUQ A;  1DTT A;  3AVA A;  4CED A;  2EX3 A;  3PO4 A;  4Z4C A;  4HHT A;  4CF1 A;  3HM9 A;  2G8W A;  4DF4 A;  3KLF A;  4CJT A;  1JLG A;  4DTX A;  4F2R A;  5KTQ A;  1SL0 A;  4FXD A;  4FLT A;  2F96 A;  3IAY A;  4CES A;  3ITH A;  4B9U A;  3VQP A;  4YNQ A;  1HQE A;  4NYN A;  3I0S A;  1FK9 A;  2I5J A;  1KLN A;  3OYK A;  3L2W A;  3QES A;  4NYF A;  3VQ4 A;  1RTI A;  5FRM A;  1Z26 A;  2EHG A;  4CJ4 A;  3HVT A;  5HBM A;  2VG6 A;  3HP9 A;  4CK3 A;  3OYA A;  3B6O A;  3MXM A;  1NKC A;  4M3U A;  2AJQ A;  2QXF A;  3DLE A;  4N56 A;  4DTN A;  3QIO A;  4DQR A;  4KRE A;  1B9D A;  2YKM A;  3DI6 A;  2RN2 A;  4HVJ A;  3HO1 A;  1RDC A;  2LSN A;  2DFH A;  4DTP A;  1XI1 A;  4Z4E A;  2HHS A;  1XHX A;  3KTQ A;  1C1A A;  1RT3 A;  4PUO A;  1O1W A;  1Q9Y A;  3KD1 E;  4CJQ A;  1HRH A;  4FZX C;  3MEC A;  3S3N A;  2OYQ A;  3OYI A;  3AVM A;  1S6P A;  3DLK A;  4CGF A;  3RRG A;  2HHX A;  2Q3S A;  1L3V A;  4DFP A;  4O4G A;  4CF0 A;  3NDK A;  1TL1 A;  1TKZ A;  1RBU A;  2JLE A;  1U04 A;  2ZD1 A;  3K5O A;  3OYD A;  3LWM A;  4AIL C;  4B9M A;  2OZS A;  4G1Q A;  1YTA A;  5CZ1 A;  3LP2 A;  5HRS A;  1T03 A;  5J2Q A;  4W5N A;  4M41 A;  3TAE A;  3L8B A;  1XHZ A;  3KD5 E;  4E7H A;  4N41 A;  4FJL A;  3CG7 A;  3ZSR A;  3NHG A;  3MXJ A;  3SUN A;  4NCA A;  3RR7 A;  3QNN A;  4OKE A;  4I2P A;  3T3F A;  3MAQ A;  5KGX A;  3PX0 A;  4CEZ A;  2XHB A;  1T05 A;  2OPQ A;  3V4I A;  1WAF A;  4EZ6 A;  4AHV A;  3QIN A;  3TAF A;  4JRP A;  4CFB A;  1RBR A;  4CFC A;  2DFE A;  3P5J A;  3CM6 A;  3KKS A;  3JYT A;  3LDS A;  2BGG A;  3S3M A;  3IRX A;  4CGH A;  1ZBI A;  4CF2 A;  1QHT A;  4F4K A;  1A5X A;  1VRT A;  2D0B A;  3NF6 A;  4HTU A;  4KPY A;  4KHQ A;  1MU2 A;  4K8X A;  2HHU A;  3L3U A;  3OS0 A;  1L3U A;  4LSL A;  3HST B;  1X9W A;  1NK7 A;  2ITG A;  4W5O A;  3ISN C;  4DS5 A;  4B9V A;  3NH1 A;  5J1E A;  4CK1 A;  3OYN A;  1DTQ A;  3ZSY A;  2YNF A;  3OS1 A;  3O4N A;  2E4L A;  1A5W A;  2KZZ A;  4FLU A;  2P51 A;  3DOK A;  4FLZ A;  2BE2 A;  2YKN A;  1GOB A;  1GOC A;  1VSF A;  3WNF A;  3QEI A;  1KRP A;  4L8R B;  4KHS A;  4CIE A;  1RTH A;  2RPI A;  1BI4 B;  3DRS A;  3QER A;  1RT5 A;  1S1W A;  1JLB A;  4RW4 A;  3T19 A;  1LAW A;  2Z1G A;  5CYM A;  4DG1 A;  4DQS A;  1EKE A;  1NK8 A;  2G8U A;  2PYL A;  4IFY A;  1EP4 A;  4FZZ A;  4DSL A;  1JKH A;  1FKP A;  2BAN A;  2X6N A;  5KRS A;  4KTQ A;  2YHB A;  3ASM A;  1KTQ A;  2G8K A;  1NJY A;  3AVF A;  4OJR A;  5HLF A;  3QO9 A;  1NKB A;  1VSK A;  4M3Z A;  3V6D A;  1RT6 A;  4PY5 A;  4E7K A;  1FXX A;  1RT1 A;  1Y97 A;  1RBV A;  4B08 A;  2IAJ A;  1NOZ A;  1KSP A;  1CXQ A;  1BI4 A;  4M42 A;  4M3Y A;  4KKO A;  3LP3 A;  3D45 A;  3JSM A;  4DTJ A;  3KIO A;  4IBN A;  1NK9 A;  1SL2 A;  4F8R A;  2G8I A;  1LAV A;  3DLH A;  4FJ5 A;  4CEA A;  5C42 A;  4CER A;  4DF8 A;  4Q0B A;  2OPP A;  1JLF A;  1S1V A;  3QLH A;  1JXE A;  1QSS A;  3NBP A;  3CYM A;  1LV5 A;  3LP1 A;  3S3O A;  1QQC A;  1QSY A;  3T1A A;  4J2B A;  2PZS A;  1KCF A;  2GV9 A;  3M8P A;  4JRQ A;  2PY5 A;  5K14 A;  3VQA A;  1C6V A;  3NH2 A;  1SKS A;  3SV3 A;  1LW0 A;  1ZBF A;  2A1S A;  3H08 A;  4CJ5 A;  1NK6 A;  4OLA A;  4FJH A;  4CCH A;  4M3T A;  1EET A;  4C8M A;  4NCB A;  4CJF A;  4DQP A;  3AO2 A;  3NH0 A;  1QE1 A;  4YFU A;  3CQ8 A;  1IO2 A;  1KFS A;  4HCB A;  4IG3 A;  4K8Z A;  3ZSQ A;  4Z4I A;  2ATQ A;  3HYF A;  1LW2 A;  3K5N A;  1WSG A;  2Z1J A;  4CGJ A;  4AHT A;  4FK2 A;  2F8T A;  1C0U A;  4ELV A;  1F21 A;  3U3G A;  1REV A;  3TAN A;  4ELU A;  1W0H A;  3C95 A;  4CJW A;  3KK1 A;  1UOC A;  2YNI A;  3M8S A;  4FM0 A;  4AHR A;  1U4B A;  1B92 A;  1L3T A;  3V1O A;  5HRN A;  4OPK A;  4FLW A;  3OYC A;  3KJV A;  2KFZ A;  3CFP A;  4CEF A;  3PX4 A;  2XY6 A;  3ZT0 A;  4JS4 A;  3G0Z A;  3NE6 A;  3VA3 A;  3AVL A;  3V81 A;  4ID1 A;  3V9Z A;  3LZJ A;  1ZBU A;  3SV4 A;  4CEE A;  2B5J A;  2VG5 A;  4KFB A;  4AHU A;  1HYS A;  2OPS A;  1BIS A;  3DLB A;  3NCI A;  4E1N A;  1U45 A;  3VQ5 A;  3PO5 A;  4FZY A;  1S5J A;  5FDL A;  4CFA A;  3RR8 A;  4BDY A;  1VSL A;  3NGZ A;  3LPT A;  3TR8 A;  3DRR A;  1KFD A;  3L2U A;  5D3G A;  4Z0U A;  2VG7 A;  3L2R A;  2GBZ A;  3LAL A;  4H4M A;  3QEX A;  5J2M A;  2E6M A;  3S9H A;  4OGC A;  3U6F A;  4TSX A;  4AHS A;  4CHY A;  4DSE A;  2W42 A;  4CJV A;  3L2Q A;  2PYJ A;  2X74 A;  4CHQ A;  1QTM A;  4HCC A;  4OLB A;  3M8Q A;  1HNI A;  5DMR A;  3OYJ A;  1FKO A;  3SYZ A;  2OPR A;  4LH5 A;  1A5V A;  1X9M A;  4FM1 A;  1T7P A;  1NJX A;  1BGX T;  4CJR A;  3OYH A;  3PY8 A;  1C0M A;  1S1X A;  1TKD A;  4KB0 A;  5C24 A;  4BE2 A;  4CFD A;  3K2P A;  4KHY A;  3TAQ A;  2HHT A;  4O5B A;  2HW3 A;  2P1J A;  4Z4G A;  4DU4 A;  1J53 A;  1R0A A;  5KI6 A;  2ZE2 A;  1X9S A;  2BDP A;  1I3A A;  2FBX A;  2HNY A;  3A2F A;  4I2Q A;  2KZM A;  2ZQB A;  2HNZ A;  2HHV A;  2FBY A;  4DTM A;  2D0A A;  2YNG A;  4MFB A;  3VQQ A;  2DY4 A;  2DTU A;  2FC0 A;  3AO4 A;  3VA0 A;  3QET A;  3HP6 A;  4RW8 A;  3QIP A;  4O0J A;  4E19 A;  3DOL A;  3MXI A;  4F2S A;  4R5P A;  3DM2 A;  3PV8 A;  1U49 A;  1N6Q A;  4CJ3 A;  2KW4 A;  4OVL A;  4FJN A;  1Z25 A;  1UA1 A;  3O3H A;  3HXM A;  2D0C A;  3TWH A;  4GVM A;  1RNH A;  4DS4 A;  3AA4 A;  1RBS A;  4E1M A;  3SQ4 A;  4BAC A;  5HP1 A;  3V1Q A;  3SQ1 A;  1W9H A;  1K6Y A;  1B9F A;  1HQU A;  2GUI A;  1LWC A;  1RDD A;  3CM5 A;  3ZT2 A;  1HYV A;  4CIG A;  4W5R A;  1NJZ A;  2QK9 A;  2O4I A;  2ETJ A;  4CHO A;  1JL1 A;  3QEP A;  4J2A A;  1TKT A;  2P5O A;  3LP0 A;  1NKE A;  1S9E A;  2Z1H A;  4BWM A;  4CK2 A;  1JLE A;  3ZCM A;  1WSJ A;  2VWK A;  4Q5V A;  1KVB A;  3KK3 A;  2QKK A;  4C8O A;  1TL3 A;  2KFN A;  2OZM A;  3AA5 X;  2VWJ A;  4KHW A;  3M8R A;  1XWL A;  3AVI A;  4ID5 A;  4H4O A;  3P1G A;  4CE9 A;  4DTO A;  4FJG A;  3PUF A;  4CJK A;  4BE1 A;  1RDA A;  4CF8 A;  1VSE A;  3ZT4 A;  1QS4 A;  3O3G A;  1TKX A;  3DLR A;  4DTU A;  1KLM A;  2XRI A;  5JS2 A;  3RMA A;  4QOZ B;  5JS1 A;  1LWE A;  3VQ8 A;  4RG8 A;  4N5S A;  2YNH A;  1ZYQ A;  3VQE A;  2YHA A;  4I7F A;  2Z1I A;  4FW1 A;  4CHP A;  2XY5 A;  3VN5 A;  3E01 A;  3BGR A;  1BIZ A;  3V1R A;  5HRO A;  3AVG A;  4J2D A;  4FW2 A;  4LH4 A;  4LY7 A;  3OJU A;  4EP5 A;  2HHW A;  3L3V A;  3WNH A;  1HJR A;  2QKB A;  1ASW A;  3NF7 A;  4IG0 A;  1TK0 A;  4FJM A;  4ELT A;  1J54 A;  3WNE A;  3O4Q A;  4HUF A;  2WOM A;  3OVN A;  2KTQ A;  4CEC A;  3VQ7 A;  4CIF A;  1WAJ A;  5I3U A;  1CZ9 A;  4N47 A;  4O0I A;  3QNO A;  3VQ9 A;  3NF9 A;  4OKK A;  3V9X A;  4FJ7 A;  4KI6 A;  3VQC A;  1YVU A;  2D5R A;  3C6U A;  3MED A;  4CJP A;  3O3F A;  2O4G A;  3THV A;  4FYD A;  4I9L A;  2DFF A;  4AH9 A;  1UA0 A;  1IKX A;  3F73 A;  4XIU A;  3SPY A;  4DSK A;  5HRR A;  1BQM A;  4M45 A;  4FJK A;  3DLG A;  4GW6 A;  4DSI A;  4MQ3 A;  1JLQ A;  1CLQ A;  4KO0 A;  4CEO A;  4CHN A;  4B9S A;  3ZSV A;  1Q9X A;  1RT4 A;  4FJJ A;  4BWJ A;  4IDK A;  4QAG A;  1WN7 A;  3ULD A;  3TAM A;  3SJJ A;  4B9L A;  1BCM A;  1Q8I A;  3RRH A;  3TAP A;  1CZB A;  2X6S A;  1WSI A;  4LD0 A;  4DLG A;  4FLV A;  3EYZ A;  1N5Y A;  1ZBH A;  2HMI A;  1ASV A;  3ZSX A;  4C8K A;  1VSJ A;  3SPZ A;  4E7I A;  4KTZ A;  2FBV A;  4FK4 A;  3SQ0 A;  3IS9 A;  1HYZ A;  3HPO A;  3NGY A;  2YV0 X;  3VQ6 A;  1SKR A;  3ZSO A;  4N76 A;  3LWL A;  4IKF A;  3AVH A;  1TGO A;  1YT3 A;  3DYA A;  3WNG A;  4CJS A;  3LAK A;  1VK0 A;  1JLC A;  3EY1 A;  2B6A A;  3K58 A;  4DFK A;  4ZTF A;  4ZTJ A;  1IKY A;  4E0D A;  3C6T A;  1HNV A;  4DMN A;  4E89 A;  4OPJ A;  2XY7 A;  1ZBL A;  3LPU A;  4JLH A;  3AO1 A;  4BDZ A;  4PQU A;  4E7L A;  4FVM A;  3SZ2 A;  3QEW A;  3TI0 A;  1TK8 A;  2P5G A;  2IOC A;  4RW7 A;  1VSI A;  3AVB A;  3VQD A;  1LWF A;  1VSM A;  1ITG A;  1XC9 A;  2IC3 A;  4W5T A;  4F3T A;  5SZT A;  1HMV A;  3HVR A;  3V9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...