2G8HA

B. halodurans rnase h catalytic domain d192n mutant in complex with mg2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKANYGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
total genus 40
structure length 136
sequence length 136
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8hA00
3LAMA 3O3FA 3OYKA 1LWEA 2IGIA 3ZSXA 1DLOA 4CE9A 3RTVA 1TKDA 2G8KA 1U47A 3KLGA 4C8KA 5JS1A 4BWMA 2HNDA 4QCLA 4CF9A 4JRPA 4OGCA 3OS0A 1ZBIA 3ISNC 4CFDA 4FM1A 1TGOA 2DTUA 3TARA 4E7JA 3NF8A 3G0ZA 4JS5A 1BQNA 3IAYA 4M42A 3NH1A 3OYIA 1RTHA 2BDPA 1D9DA 4O0IA 1QHTA 3THVA 3AA2A 1FK9A 4C8OA 2DFFA 3AVFA 3SV3A 4FJNA 2Z1JA 1SUQA 4KHUA 5KI6A 4UQGA 3VQPA 3K59A 3VQ8A 4I2QA 4DWIA 1RCHA 1RBRA 2Z1HA 4GW6A 1UOCA 5EU7A 4OKEA 4CJWA 5C24A 1TKTA 1C0UA 4N41A 1BL3A 1TK8A 4KHYA 1XC9A 1BIZA 3NGYA 2QKKA 4CJLA 2XY6A 3HM9A 4PY5A 1K6YA 5J2QA 1NK9A 3K5MA 3AVBA 2FBXA 1HMVA 4KAZA 1WSJA 1HPZA 3DLKA 3ZSRA 4DFMA 3SQ0A 1XHXA 4O0JA 4RW6A 1VSJA 4HUGA 4FM2A 2X78A 3CFPA 4RW4A 4DFPA 4OKJA 4CJRA 1W9HA 3LWLA 4E1MA 3DM2A 5J2NA 4FJ8A 3MAQA 3OYAA 4DF8A 3DLRA 3QEIA 2VWKA 2P1JA 3ZT3A 2ITGA 3JYTA 3O3GA 4E7HA 1HQEA 1YTAA 1FXXA 2OA8A 4CESA 4CHOA 1RTDA 4H4MA 5FRMA 1N5YA 4B9VA 1G15A 3WNHA 4J2DA 5KRTA 1SV5A 4E0DA 4M3YA 1BIUA 3HJFA 4IFVA 3V1OA 2Z1GA 3MXJA 4PA1A 3IRXA 4FZZA 4RW7A 4CK1A 2O4GA 1NK7A 1TK0A 2ATQA 4DF4A 1EKEA 4GMJB 1RBVA 4FJLA 2D5RA 2IC3A 4CEBA 1KLMA 1XI1A 1KVAA 4B8CA 2OPPA 2ZQBA 1WAJA 1KFSA 1ASVA 3K58A 1B92A 3DRRA 3LZJA 4ZTJA 3AVLA 3QO9A 4F2RA 1SL0A 4FLVA 2RPIA 1S1WA 1U04A 1U48A 4CJEA 4DQRA 2IS3A 3CFOA 1CLQA 1HQUA 3RRHA 1WN7A 3AVGA 1ASWA 3AVNA 2HHXA 3V4IA 4MQ3A 1L5UA 3HO1A 3SYZA 2AJQA 2RN2A 3AVMA 3HPOA 3ZT2A 2QKBA 1GOCA 1CZBA 3NFAA 1ITGA 1JLCA 2EX3A 1JLGA 3EZ5A 3NAEA 1X9SA 1NJWA 4C8MA 4FJ5A 4E19A 1VSMA 4DTPA 5HRNA 1A5XA 3CG7A 3I8DA 3NF6A 4Q5VA 3LPTA 4FLUA 3DOKA 3LALA 3AVHA 4GVMA 4B8AB 2A1SA 4LY7A 1KVCA 4FYDA 1VRUA 5J2MA 5C25A 1KCFA 3KK2A 3VA0A 4DSIA 3SI6A 5FDLA 3V1QA 3AA5X 5I3UA 1RT1A 1JLEA 1X1PA 4CGJA 5HP1A 3KD5E 1RT4A 4W5RA 3KK3A 4CIGA 1BQMA 2HHUA 2KFZA 3EY1A 2HHVA 4CJKA 3S3NA 2VG5A 1X9WA 4NYNA 2ZD1A 4B9SA 1UA1A 4KTZA 3SJJA 1CXQA 4DFKA 2IOCA 4J2BA 1TVRA 4LSNA 2G8UA 5C42A 3HXMA 1KLNA 5DK5A 2HHSA 2YNHA 1S9EA 1C0TA 5HBMA 3M8RA 4CJSA 1VSDA 3P83D 1JL2A 2YNFA 4CERA 4HUEA 4B08A 3TAMA 1YT3A 4CGDA 1HJRA 1GOBA 3DYAA 4XIUA 3IS9A 4E7KA 4DTSA 3NHGA 1WSIA 3QLHA 3AO2A 3KKSA 1NJZA 3V6DA 4ID5A 4CJFA 5HRPA 3H08A 4KHNA 4CCHA 3AA3A 1S1XA 2OPQA 3G10A 4J2AA 4CF2A 1Z26A 3VQBA 2HNZA 4Z4EA 1JXBA 3WNEA 4ELTA 1LWCA 4WE1A 1NK8A 4CJUA 3PX4A 3ASMA 4M3TA 3QNOA 1RT2A 1B9FA 4RW9A 5CZ1A 1L3TA 1RBUA 4CJQA 5E41A 3V9ZA 3SCXA 2Y1JA 3LWMA 1C0MA 1XHZA 3CM6A 3DLGA 1NK5A 4M45A 1BCOA 4K8XA 2XRIA 3P1GA 4DMNA 3QEXA 1QQCA 2XY8A 1VSFA 1WLJA 4KHQA 1LWFA 3T19A 4I9LA 4N5SA 4W5OA 3K5LA 4CHQA 3QETA 2FBYA 2NUBA 3OS2A 4M3UA 3PY8A 4N56A 3SUPA 4M3WA 3AVIA 3D0PA 2OYQA 3TAPA 1WSHA 4ELUA 4FLTA 1RILA 1REVA 2G8WA 1NK4A 4PWDA 1WNSA 1XWLA 3HL8A 1FKOA 4O44A 3ZT1A 1NOZA 3NH0A 4RW8A 4DLGA 3V9XA 4FJMA 4PUOA 5FROA 4H8KA 4FJXA 4CGFA 4EP4A 2G8IA 3LP2A 4CF0A 3ZSZA 3OJUA 2IDOA 3O4QA 2HHWA 3HSTB 3AVJA 4W5NA 1HYZA 4BDPA 4OPJA 1Y97A 1YVUA 1W0HA 4E7IA 4B9NA 1S1VA 1RDDA 3S3OA 4CGHA 4B9MA 3V9WA 2YV0X 4CJ4A 2GV9A 4CEQA 4QOZB 2KZZA 4KO0A 3QIPA 2ZE2A 3OYCA 5CY4A 2X6SA 1TL3A 4AHRA 4F8RA 4KB0A 1YTUA 4DTMA 3T3FA 1EX4A 2KQ2A 3B6PA 3V81A 1VSIA 2LSNA 3OJSA 3RR7A 2KZMA 3PX0A 1RBSA 2JLEA 1VSEA 1SL2A 2HVIA 3LPUA 2YHBA 1Q8IA 1TKXA 3VQEA 3SZ2A 4N76A 4FJ9A 3OYDA 1C1BA 3LP3A 4CJ5A 3DLHA 1QTMA 3CFRA 5HROA 4DSFA 2P5GA 3DMJA 4W5QA 4KKOA 4FJHA 4CECA 4FJIA 2YNIA 1WAFA 1TL1A 1HNVA 2HVHA 3KTQA 3NGZA 4FW2A 1WSFA 1RTIA 3C6TA 2HNYA 4DU3A 2X74A 3SUQA 4DSEA 4JRQA 4Z4CA 5J1EA 4E3SA 2HMIA 2B4JA 4IBNA 4MFBA 3VQ9A 4BE1A 4DFJA 3HT3A 4NCBA 4KHWA 4EP5A 3WNFA 3NGIA 3C95A 3NCIA 1ZBLA 1NKBA 3KLIA 1VSHA 3V9UA 3FFIA 3LP1A 1F21A 3RMDA 3AVCA 1RDCA 3QEWA 3AA4A 4LH5A 1JLBA 3AO5A 1T03A 2KTQA 3ALYA 3VQ6A 3LDSA 1SL1A 4HUFA 2XY7A 3V9SA 1SKRA 3IG1A 4L8RB 3BDPA 1RDAA 2YNGA 5KRSA 4HTUA 4BDYA 4M3RA 3K57A 4LH4A 1RDBA 4CFCA 1CXUA 1BGXT 4IFYA 4CFAA 3KK1A 4AHVA 1X9MA 3LZIA 1I3AA 3OYBA 3RWUA 1RT3A 3HK2A 3TANA 3KD1E 1D5AA 4Z0UA 3MXIA 5JS2A 4DTXA 4N47A 1SKSA 3VQDA 5SWMA 2GUIA 3U3YA 4CEZA 5DMRA 4KB1A 2QXFA 5SZTA 1LW2A 4PQUA 2PYJA 4LSLA 3NDKA 2DFEA 4Z4GA 3OY9A 3OYJA 3PO5A 1S6QA 2F8TA 3HYFA 3ZT0A 3OYMA 3OYFA 1ZYQA 1ZBFA 3AO3A 4NCGA 2DFHA 3AO1A 4QAGA 4AH9A 4AHCA 1D8YA 4KHSA 5FRNA 3RMBA 3QERA 4FZYA 4C8LA 4FLYA 4FLXA 1JXEA 4CIFA 3RR8A 4HHTA 2OZSA 1NK0A 4O5BA 4LD0A 3CM5A 4CEFA 3BGRA 3TAGA 3AVAA 3L2UA 1J53A 3SQ1A 3TAQA 2YKNA 3DOLA 2G8HA 3F73A 1ASUA 4RG8A 4TSXA 3MXMA 4DS5A 4EZ6A 4CHZA 1MU2A 4Z4IA 3L2RA 1UAXA 2BANA 4OKKA 1KFDA 1RT6A 3QEVA 1NOYA 2HHTA 4DTRA 4CEDA 1Z25A 3TI0A 4FM0A 4FJ7A 2HHQA 3NE6A 3RMCA 2VWJA 3MEGA 4CHPA 1T8EA 1Q9YA 1VRTA 3NBPA 3KIOA 1N6QA 1U45A 4Y1CA 4AHUA 1WSEA 1TV6A 4FJJA 2YKMA 2KFNA 3SUOA 2XY5A 4K8ZA 1IKVA 1TKZA 2X6NA 4JLHA 3SQ2A 1QSLA 4F3OA 4KREA 4FJGA 4C8NA 1C6VA 4OVLA 4Q0BA 3ZSYA 2FBTA 5J2PA 1L3UA 3L3VA 4KTWA 4R5PA 5D3GA 4CHNA 2PY5A 4E89A 5CZ2A 3DLEA 3K5NA 3SPZA 1BI4A 3T1AA 4F4KA 4Z4FA 3LP0A 1HNIA 1JL1A 2E6MA 3O4NA 4E7LA 2RF2A 3M8QA 1I39A 1LAVA 1LW0A 1J9AA 3O3HA 2IAJA 4HCCA 2QK9A 1ZBHA 4KPYA 3TWHA 4IKFA 3F9KA 3ZSQA 1RNHA 3KJVA 3U6FA 1IG9A 4FVMA 2O4IA 4CJPA 4CEAA 2OPSA 4CJ3A 3SV4A 1B9DA 4DSJA 3A2FA 1QS4A 4IG0A 4YFUA 2OPRA 3NF7A 2R7YA 1A5WA 3AVKA 3M8SA 3PO4A 4FJKA 1EXQA 4H4OA 3OYNA 4OLBA 2RKIA 2OZMA 5KGXA 3HPHA 2FC0A 3KLFA 1U4BA 2JGUA 4BWJA 2YHAA 4CEEA 4CEOA 1RT7A 2B5JA 3K2PA 3TAEA 2BGGA 3NF9A 4AHSA 4F3TA 3L2VA 1UWBA 3K5OA 3OYHA 2G8VA 3VQ7A 4ZTFA 3PX6A 2P5OA 1NJYA 1S1TA 4CGIA 5HRRA 3HP6A 3QNNA 4B9TA 1O1WA 4JS4A 4W5TA 1DTTA 4CK2A 5KGWA 4YNQA 4ZHRA 4CJTA 2G8FA 1KSPA 1S5JA 4I7FA 3AV9A 2VG6A 4KTQA 3VQCA 4DQQA 4KI6A 3D45A 3DRPA 4FZXC 4AILC 1L3SA 2D0AA 4CJVA 3L2QA 3CQ8A 2HW3A 2BE2A 2D0BA 4CHYA 4AHTA 1KVBA 2KW4A 3CYMA 2XO7A 1R0AA 4CF1A 4CF8A 4OPKA 3NH2A 1U49A 4DQPA 4FK0A 3ZSOA 3HVRA 1DTQA 1QSYA 2B6AA 1IKYA 4F2SA 1IKWA 2ETJA 3WNGA 2A1RA 1A5VA 1NKEA 1EP4A 3SQ4A 2F8SA 3MEDA 4DQIA 1RTJA 4OJRA 5K14A 4BDZA 3E01A 3VQAA 1HYSA 3AO4A 3DRSA 3I0RA 1JLQA 3QINA 3QEPA 4HVJA 1RT5A 3DLBA 3KKRA 3VN5A 2EHGA 2P51A 4DG1A 3SPYA 3S3MA 1NKCA 3HVTA 2XHBA 1LV5A 3OYLA 4E1NA 2I5JA 1TAUA 1BCMA 1JKHA 1FKPA 4DQSA 4DU1A 1BI4B 1VSLA 3L2WA 3RMAA 1T05A 3PV8A 4KFBA 3RRGA 4FK4A 4EZ9A 1S1UA 4CGGA 3ULDA 4KV8A 4M41A 3M8PA 3TABA 1NJXA 3DI6A 1T7PA 1HYVA 1BISA 2WONA 5CYQA 3ZCMA 3SNNA 4KI4A 4M3XA 3V1RA 2DY4A 4ELVA 1ZBUA 2VG7A 3QESA 3VQ5A 4B9UA 2WOMA 3OS1A 1VSKA 5T7BA 2E4LA 3HPGA 4OLAA 3L8BA 4FLZA 4O4GA 4DLEA 4DTNA 1WSGA 3HP9A 1BHLA 5CYMA 2GBZA 3LANA 3C6UA 1EETA 1KRPA 5HLFA 2W42A 4O55A 4DTOA 2PZSA 1J54A 5HRSA 3LAKA 1IH7A 2FBVA 4NYFA 4DTUA 3S9HA 3EYZA 3ZSWA 1CZ9A 1TK5A 3KLEA 3TAFA 2HB5A 1UA0A 1GOAA 1D9FA 4KRFA 5I42A 3P5JA 4FW1A 4FCYA 1QSSA 4DSLA 3TR8A 2D0CA 4NCAA 3OVNA 3PUFA 1C1AA 3VA3A 4DS4A 1JLFA 3ITHA 4J2EA 4FK2A 1S9GA 1TAQA 4OGEA 1RBTA 4CK3A 1QE1A 3QIOA 4BACA 4FLWA 3ZT4A 1IKXA 4DSKA 4IDKA 2PYLA 4Z4HA 4B3OA 5KTQA 1LAWA 1VK0A 4ICLA 4I2PA 4ID1A 3ZSVA 1KTQA 3VQQA 3VQ4A 4IG3A 4CIEA 3SUNA 1C1CA 3OYGA 4FXDA 2F96A 2E6LA 3L3UA 4HCBA 4M3ZA 1HRHA 1S6PA 2Y1IA 3JSMA 4B9LA 1Q9XA 3UIQA 4DTJA 4G1QA 4I9QA 1SKWA 1L3VA 3B6OA 4Y1DA 4DU4A 1J5OA 2Q3SA 3KLHA 1IO2A 1JLAA 1NK6A 3C94A 4BE2A 3U3GA 2Z1IA 4CFBA 3OYEA 3MEEA 3I0SA 3MECA 4BE0A
chains in the Genus database with same CATH superfamily
2FXUA 3OYKA 4K43A 1LWEA 4E1JA 2IGIA 4CE9A 3RTVA 2HF3A 1W7AA 4C8KA 5JS1A 1LOTB 3O08A 2HBJA 3BY5A 4OGCA 3QDKA 4H5RA 1TGOA 2ZWHA 4E7JA 4LFBK 3G0ZA 5AQMA 1OKJA 4Z94A 4BREA 1FJGK 5KI6A 4H0PA 4UQGA 3K59A 4DWIA 2Z1HA 4CJWA 5EU7A 1C0UA 4N41A 1BL3A 3ATUA 5EOYA 5J2QA 1NK9A 3CETA 3K5MA 3AVBA 3C65A 1HMVA 5LMNK 4KAZA 1BUPA 1XHXA 4O0JA 4FM2A 2H3GX 3CCVN 4RW4A 4RTFD 3IUCA 1W9HA 4H0XB 1VQ9N 3VEOA 3DM2A 2HBLA 5C10A 4FJ8A 4IJAA 3A5LC 4AM7A 3O4WA 2F9WA 4RCHA 2E2PA 3EO3A 1FXXA 4CESA 4CHOA 1N5YA 5GAHP 4B3RK 3T69A 3HJFA 3M6GA 5AZIB 3VERA 4IFVA 3V1OA 2KLAA 2Z1GA 4PA1A 5B8HA 4WQ5C 3AAPA 3R9PA 1T3VA 4CEBA 4U7BA 2UXCK 3DRRA 4ZTJA 4FLVA 1S1WA 1U48A 4CJEA 2NRZA 3CFOA 3CC2N 2VGMA 4MQ3A 3HO1A 4DKWA 2AJQA 2RN2A 4DR5K 2QKBA 1GOCA 1CZBA 3MWTA 3M3ZA 3I8BA 3CD6N 1X9SA 5A2QO 4E19A 5C2DA 3TU5A 2Q0UA 3CG7A 3CCLN 3NF6A 4J8FA 4PKGA 1P8ZA 3LPTA 4FLUA 4GV6A 2GWJA 1KVCA 4BY9C 3KK2A 4DSIA 3FZKA 4W5RA 3KK3A 2KFZA 1IG8A 4CJKA 1R59O 1UA1A 3H45C 1CXQA 1E4GT 4DFKA 2IOCA 5AQZA 3EN9A 1WBBA 3HXMA 5M1NA 1C0TA 3M8RA 1VSDA 3THYB 2I7NA 3TAMA 4KBOA 4IOCL 4CBUA 5KPZA 3J7YP 1WSIA 2O8DA 3QLHA 3KKSA 5HRPA 4X64K 1S1XA 3G10A 4YOUA 4J2AA 3CJBA 1Z26A 2PAVA 4K25A 3ULEB 3SBTA 4M3TA 4RW9A 2UXDK 5E41A 3Q7CA 3CPWM 3LDLA 5BR8K 4AF1A 2EWSA 3UKUA 1TUUA 4M45A 3QEXA 4BR2A 5AQKA 1W97L 1WLJA 3J7ZO 3L4IA 4W5OA 4X62K 4CHQA 2NUBA 4N56A 4M3WA 3DXKB 3KWGA 3D0PA 4ELUA 2G8WA 1WNSA 3NVMA 3HL8A 4O44A 3ZT1A 3V9XA 4NXNK 4PUOA 5FROA 4FJXA 4GVEA 2W41A 4CF0A 3VPZA 1WBDA 3O4QA 3CF5L 3K0SA 3IFRA 4JI5K 1U2VA 2QM1A 2YHWA 3U9ZA 2GUPA 1JCGA 2GV9A 2KZZA 3H3OB 3QIPA 3W3DA 2X6SA 1M90O 3THXA 3RR7A 3PX0A 4K41A 2HVIA 3HZ6A 4JNEA 3OYDA 4JK8A 3LP3A 1XMOK 3QBWA 2P5GA 4W5QA 4KKOA 4JI0K 3N4QA 4CI6A 1WAFA 4YOXA 3C6TA 3SUQA 4Z4CA 5J1EA 4E3SA 1E4FT 4KHWA 3TSQA 3WNFA 3NCIA 2YX6A 3LP1A 3RMDA 3AA4A 3H1VX 2P9PA 2BUPA 3M1FA 3IG1A 2WFBA 4L8RB 1RDAA 1WOQA 4HTUA 4FWLA 3GBTA 2OTJN 1QHAA 4CFCA 4KHUA 3LZIA 3WEEB 1CZAN 3TANA 2QWPA 4ILGB 3MX5A 1NLVA 2HBMA 1SZ2A 3WT0A 1LW2A 3UKUB 3OYJA 3PO5A 1S6QA 3HYFA 1FW6A 2PBDA 4PKHA 1XNRK 4NCGA 4QAGA 2DFHA 2VCPA 3IKMA 4FZYA 4FLXA 4CIFA 1NK0A 4NO7A 4OO1J 1GLBG 4JKGB 3TAGA 1J53A 5GAEP 2YKNA 1YJNN 3QICA 4RG8A 3MXMA 1C0FA 4EZ6A 1MU2A 2A42A 4OKKA 1IBMK 5EY4A 4FM0A 2HHQA 1Q81O 1DT9A 3MEGA 3SAGA 1IV0A 4AHUA 1WSEA 1TV6A 1IBLK 4B1WB 1BO5O 3H46O 4K8ZA 1IKVA 4JLHA 3SQ2A 1QSLA 2YI1A 4G9ZA 4C8NA 5J2PA 3CCJN 4A57A 3DLEA 3F2KA 3D6RA 3LP0A 3SK3A 1MA9B 4FWSA 3WQUA 2A6AA 3O4NA 4JKFA 4E7LA 2RF2A 3M8QA 1J9AA 2IAJA 4BR5A 2Q31A 4HCCA 4KPYA 2W6KA 3F9KA 2O4IA 2OPSA 3U4LA 4BR7A 3SV4A 3A2FA 3VETA 2NRHA 4BRNA 4H4OA 4OLBA 1S22A 3MN7A 4JAXA 3HPHA 1U4BA 3CCUN 4EFHA 5LY3A 4CEEA 3DJCA 5M1FA 4H0OA 3NF9A 3ATVA 3OYHA 5AQRA 1NJYA 4A2BA 1HKGA 5HRRA 3HP6A 1O1WA 3SAHA 5HOOA 1X3NA 4CJTA 3UKRA 3AV9A 2CGLA 4KI6A 4FZXC 4AILC 1L3SA 3L2QA 2HW3A 2D0BA 4CHYA 4AHTA 4DV7K 4DQPA 4CF8A 4OPKA 1IKYA 5ELZA 4F2SA 2ETJA 3WNGA 1RTJA 3E9OA 3AO4A 3PSIA 1W2BM 3DXMB 4YORA 5AFUA 4JI2K 4BQLA 3SJHA 5E26A 2VYPA 3FR0A 3MN5A 1T05A 1IJJA 3WXMB 1HUXA 3PV8A 3RRGA 4IWVA 4PL7A 2VGNA 4CGGA 3ULDA 4K0KK 1NNEA 4JI6K 4M3XA 3SNNA 2DY4A 3T1HK 3VQ5A 4B9UA 4DR3K 3BF3A 2GTDA 5T7BA 3QB0A 3HPGA 5AQNA 4BRHA 5BPNA 4O5FA 1TYQA 3GDQA 4DUYK 1KRPA 5HLFA 4DTOA 1RGIA 4FWNA 3WUHA 3BP8A 4DB3A 2BTFA 1NMDA 1NGIA 2W40A 5I42A 1GLFO 4JI7K 4H5NA 3EE9A 1C1AA 1JLFA 3ITHA 4FK2A 4OGEA 4BRFA 1RBTA 2QI2A 4L3QA 2F4VK 1QE1A 4BACA 3ZT4A 2OTLN 3EE8A 4IDKA 1QZ6A 4B3OA 1LAWA 1QVFM 1O13A 5JLFA 3ZSVA 1WB9A 5AQWA 3W0LA 3OYGA 4FXDA 1QQNA 2E6LA 1JCFA 2F9TA 4A61A 2Y1IA 3WEEA 1I94K 4I9QA 2Q36A 1MWMA 2Q3SA 3KLHA 1IO2A 1JLAA 3C94A 3U3GA 4DV3K 3VQ9A 3I0SA 3P4IA 3MECA 5AQXA 2O8EB 1DLOA 3IDHA 4WQ5A 3KLGA 1U47A 4MO4A 4IOAL 4BWMA 4RWTA 2D1KA 3SAFA 4JRPA 3G6EN 3ISNC 4FM1A 2DTUA 3TARA 4M42A 4O0IA 1QHTA 3THVA 3AA2A 1FK9A 1TUYA 3AVFA 3SV3A 5ADXA 4FJNA 1NG9A 3VENA 5AR0A 3BF1A 3PSFA 5BR9A 3I56N 1RBRA 3C0BA 5H1SQ 4OKEA 5C24A 5JMVA 4H0TB 1NGDA 3CPEA 1HNZK 5TKWA 2QKKA 1BWFO 4CJLA 2XY6A 3K9JA 4WFAL 4CBXA 1WSJA 5M1OA 3ZEUB 1HPZA 3ZSRA 4JKHA 3ZETA 1VSJA 3HOTA 4HUGA 2X78A 3DAWA 3CFPA 1EO1A 5M1KA 4CJRA 3LWLA 4E1MA 5J2NA 4BC5A 3OYAA 3DLRA 3O3GA 4E7HA 1HQEA 2OA8A 1RTDA 2CGKA 4B9VA 3ZEUA 4J2DA 4E0DA 1SV5A 2P9NB 5ADXH 4XH4A 1P90A 4FZZA 3LL3A 4CK1A 1KXPA 2O4GA 1GLEG 3O9QA 3QBXA 2ATQA 4WQ4A 4A59A 1RBVA 2D5RA 2GWKA 3CXCM 4B8CA 2ZQBA 3LZJA 1YUWA 1SS6A 1HQUA 3RRHA 1WN7A 1ASWA 3AVNA 5AQGA 3V4IA 3SYZA 1RFQA 1JLCA 2EX3A 1JLGA 3EZ5A 3NAEA 4FJ5A 4DTPA 4MLHA 3A5MC 3I33A 3I8DA 3CJ1A 4BRKA 1NGGA 4GVMA 4BVOA 4LY7A 3TSUA 4GY2B 2KHOA 4CZKA 3VA0A 3MCPA 4JHDB 4WYBA 2QWLA 1JLEA 2HHUA 3O9UA 5AZIA 3S3NA 2VG5A 4YOWA 5E84A 4KTZA 3SJJA 3TSPA 1TVRA 2HF4A 5C42A 2HHSA 1S9EA 5HBMA 3P83D 4HUEA 4B08A 3U8XA 4CGDA 1GOBA 4DTSA 3IS9A 5AJ3K 2QWQA 3AO2A 1GLJO 4JKEA 4CCHA 1E3MA 4EHUA 4GKJK 3WNEA 5BPLA 1LWCA 3L6QA 4WE1A 1NK8A 2NRXA 3PX4A 4HWIA 3QNOA 1B9FA 1L3TA 5CZ1A 4CJQA 2HHHK 4QS7A 2Y1JA 3LWMA 1C0MA 3L4QA 3DLGA 4M63C 3VGKA 2FF6A 2NRVA 1BCOA 1XHZA 2Q0RA 4NLCA 1QQCA 2XY8A 1HX1A 1Q86O 1LWFA 3PIOL 3J7AP 3OS2A 4M3UA 3SUPA 2ZGZA 3D2EB 2ITMA 1FKOA 4WQ4C 4DLGA 3THXB 1V4TA 1NWKA 4H8KA 3OJUA 3ZSZA 1VQON 4W5NA 3IMXA 3U9DA 2I7PA 4JYAK 4B9NA 3S3OA 1HPMA 4BG9A 4CJ4A 1KAXA 4CEQA 3M5RA 3OYCA 1LCUA 3HOSA 1TL3A 4AHRA 4F8RA 4KB0A 1YTUA 5BRFA 2KZMA 2O8FB 3BZKA 2JLEA 1SL2A 4QS9A 2YHBA 1QVGM 1C1BA 2IVPA 1QTMA 3CFRA 2CH5A 5HROA 4CECA 2YNIA 4BR0A 2P9SB 2HNYA 4DU3A 2X74A 2HMIA 1S72N 4O8UA 3D2EA 1NKBA 1VSHA 1Z6RA 4KH6A 5C12A 1F21A 1T6CA 1RDCA 5AQTA 4LH5A 1SL1A 4HUFA 2XY7A 1C0GA 4BRQA 4BDYA 2P9KA 1CXUA 4IFYA 1I3AA 3OYBA 4BC2A 2IIRA 1D5AA 5JS2A 4WFNL 4N47A 4XH1A 5SWMA 2GUIA 5DMRA 1EWRA 3OBYA 2QXFA 5SZTA 4PQUA 5LJWA 2DFEA 2YHYA 3OYMA 1ZYQA 2J4RA 3AO1A 3J80O 5FRNA 1D8YA 4LF8K 3AGRA 4C8LA 3EEQA 4B3TK 5DM6L 4CD3A 4O5BA 5BN9A 3CM5A 3WQTA 4U67L 3DOLA 2G8HA 3F73A 1ASUA 4TSXA 2F7TA 1NMNA 4JKBA 3L2RA 2BANA 1NOYA 3VMFB 3QEVA 4KHPK 2HHTA 4DTRA 4CEDA 1U6ZA 4FJ7A 3UKRB 3CQYA 3VEZA 3NBPA 1N6QA 4Y1CA 3Q7BA 2X6NA 3B8AX 4F3OA 3ZETB 3MDQA 1VHXA 3MN6A 3THWA 4H0VB 3ZSYA 2FBTA 2WBNA 3L3VA 2QEXN 5D3GA 4CHNA 2UUBK 4OX9K 3KHYA 2VWBA 2V51B 4ILJA 4FSVA 2QK9A 3GL1A 5GINA 4FVMA 4CEAA 1GLLO 4CJ3A 1B9DA 4IG0A 2DPNA 2OPRA 3T7ZA 3VEYA 3P39A 1VQ6N 1EXQA 2OZMA 1QQMA 2VQFK 3KLFA 3CJAA 4BWJA 1RT7A 3K2PA 3CJ9A 3TAEA 3C6AA 3K5OA 3L2VA 5KPTA 1ATNA 4ZTFA 5BN8A 1NGAA 2ZF5O 5KGWA 4YNQA 4I7FA 4JK9A 2VG6A 1RDWX 4DQQA 4KTQA 2E1ZA 4ISFA 3H3NO 1YHQN 1OH6A 1KVBA 1TK5A 3CYMA 2XO7A 3NH2A 1U49A 3WXKA 2WTUA 3ZYYX 3DLLL 1XUPO 3O9TA 4OJRA 4BDZA 3CIPA 1HYSA 3I0RA 3QINA 3FE1A 1JLQA 3J81O 2JWKA 3FZFA 4DQSA 3RMAA 1BI4B 4BC4A 3ENOA 4M41A 1NJXA 1HYVA 1BISA 1U2VB 3E1YA 1HKCA 4ELVA 2CH6A 2VG7A 3QESA 2WOMA 3OS1A 2E4LA 2YJFA 2OCEA 4O4GA 3HP9A 3P38A 2GBZA 4O55A 1J54A 2QWNA 4NYFA 5AZJB 1BA0A 3TAFA 1NGFA 4FPAA 1UA0A 4HTLA 5JVHL 3CI5A 4FWRA 3P5JA 4FW1A 4FCYA 3TR8A 4BQZA 4NCAA 4ISEA 1K8KB 3HTVA 4CJ7A 4WF9L 3VA3A 4DS4A 2A3ZA 4BRGA 1IKXA 5KTQA 2NZTA 1NU0A 4ICLA 1KTQA 4CIEA 1C1CA 2F96A 2FSKA 4M3ZA 1S6PA 1YVNA 1Q9XA 1V4SA 4NXMK 3B6OA 4Y1DA 4DU4A 1DGKN 2O8DB 2Z1IA 3MEEA 1KLNA 4DHYA 3LAMA 3CERA 4I6MB 3ZSXA 1TKDA 2G8KA 1X3MA 4FWMA 4LF4K 5MLCQ 2HNDA 1HNWK 4QCLA 3OS0A 4CFDA 3NF8A 1KAZA 3IAYA 3QFPA 3NH1A 3OYIA 5CR4A 2P9PB 4C1NI 4DR1K 2DFFA 3RSEB 4O8KA 1TK8A 1EWQA 1BIZA 2Q1NA 2NNWA 5AQLA 4PY5A 1Q7YO 1K6YA 4FWPA 4XH5A 2P9NA 3C6HA 3QFUA 2FBXA 4LF9K 3HSCA 4IFEA 4DFMA 4RW6A 3ZX0A 4CVNE 4IO9L 3SMSA 4KH5A 4OKJA 3CCQN 2NRWA 3MAQA 4BRCA 2VWKA 2P1JA 3ZT3A 3JYTA 1YTAA 4B1UB 4GV3A 2P9UA 4FL9A 3WNHA 2P9IB 4B3MK 1GLCG 3MXJA 3IRXA 2NLXA 3EL2A 3EZWA 1NK7A 4DF4A 1N32K 2YCHA 4OPAA 3VF6A 4GMJB 2QXLA 4BRLA 4FJLA 1XI1A 1ASVA 2QWMA 4F2RA 2E20A 1U04A 2NRTA 2IS3A 3L0QA 1CLQA 3O9SA 5LJVA 3AVGA 1L5UA 4JHDA 3AVMA 3HPOA 2E88A 5IT9O 3NFAA 4H03B 1NJWA 1VSMA 2O8CA 4YY3K 5HRNA 5C0YA 1A5XA 4DV1K 5FPNA 3DOKA 3LALA 3AVHA 4B8AB 2A1SA 4FYDA 4V19S 5C25A 4WFBL 5FDLA 5I9EB 3V1QA 5I3UA 1RT1A 4CGJA 1X1PA 5HP1A 1MDUB 1RT4A 3MN9A 3O1BA 4CIGA 1NBWA 2RHKA 3AGKA 2HHVA 4A62A 4EAHD 4B9SA 1Y64A 4DCHA 4JKAA 4J2BA 4LSNA 2G8UA 2ZJQL 1GLDG 2YNHA 3KWIA 3OHRA 4BRMA 4R79A 4CERA 2YNFA 1H1VA 1HJRA 2ZGYA 3BEXA 3DYAA 4CD1A 4XIUA 3NHGA 2O8BB 5BRDA 4EIAA 1NJZA 3J8AA 3V6DA 4KHNA 4CJFA 3H08A 2OPQA 1NGHA 5AQHA 4CF2A 3A5NC 1OVQA 2HNZA 4Z4EA 5GAGP 4MLEA 4CJUA 4K42A 1RBUA 5AQIA 2YJEA 3SCXA 5GIOA 3RSEA 3CM6A 1NK5A 1ZC6A 4DMNA 4BVPA 4CZFA 3CHWA 1VSFA 4KHQA 5EX5A 4FO0A 3K5LA 2VQEK 3CCSN 3PY8A 1ILYA 4ILHA 1WSHA 2JWLA 4FLTA 1RILA 1REVA 4PWDA 1NK4A 1XWLA 4OLAA 3JS6A 1NOZA 5F2RA 4RW8A 4YOYA 4FJMA 1M1KO 4JI8K 3HBTA 4X66K 3LP2A 2HHWA 2IDOA 3HSTB 3AVJA 4BDPA 3A5OC 3KK7A 4BC3A 5M1PA 1NGCA 1W0HA 2RE2A 1K73O 4CGHA 4B9MA 1ZBSA 3V9WA 2O8FA 4QOZB 1VQ7N 4KO0A 4AM6A 2ZM6K 2P9LB 1JJ2M 3GOIA 4DTMA 5AQYA 3T3FA 1EX4A 2KQ2A 3V81A 2LSNA 3OJSA 4LFAK 5KPRA 1RBSA 3LPUA 3VQEA 3SZ2A 4N76A 4FJ9A 3DLHA 3NMUA 4DSFA 3DMJA 4FJHA 4FJIA 4H5WA 2HVHA 1TL1A 1YAGA 1HNVA 4DSEA 1HNXK 4LF6K 4JRQA 4DV0K 3S41A 4MFBA 4IBNA 4BE1A 4DFJA 3HT3A 3E9LA 1EQYA 4EP5A 3C95A 1S3XA 3FFIA 1K8KA 3AVCA 3QEWA 1YIJN 1T03A 3AO5A 2KTQA 3ALYA 2D0OA 4CZGA 3V9SA 1SKRA 3BDPA 5KRSA 1VAZA 1SAZA 3K57A 2E2NA 3FZLA 2V7ZA 1BGXT 4CFAA 3KK1A 3RWUA 4AHVA 1Q82O 1YI2N 3VGMA 3KD1E 4Z0UA 4DTXA 4IEEA 1SKSA 5JICA 4FWOA 3U3YA 2PYJA 3P31A 3NDKA 4CW7B 4Z4GA 3OY9A 2D4WA 4DR4K 3AO3A 2PFUA 3MWPA 3QERA 3RMBA 2P9LA 4FLYA 5DM7L 1JXEA 4JI3K 4CEFA 3BGRA 3SQ1A 3OTOK 5FPMA 4Z4IA 4CZJA 1KFDA 1YJWN 1N33K 1Z25A 3D7EO 4MDBA 3RMCA 1Q9YA 1VRTA 3KIOA 1U45A 4FJJA 2YKMA 3SUOA 2XY5A 1TKZA 3RVCA 3FFKB 3OW2M 4KREA 4FJGA 3H6EA 3LDQA 4Q0BA 2A5XA 1L3UA 1XQSC 2PY5A 4E89A 3VEWA 3K5NA 3SPZA 4Z4FA 1HNIA 2E6MA 3KVGA 1I39A 1LAVA 4FPBA 1OH5A 5CE3A 4IKFA 4PKIA 3ZSQA 3U6FA 3TTCA 2FSJA 1D4XA 3R8EA 1QS4A 4YFUA 3NF7A 2R7YA 3AVKA 2UXBK 4FJKA 3C7NA 3OYNA 1OH8A 1Q18A 2RKIA 5KGXA 2IVNA 5FPDA 4GKKK 4F9OA 2JGUA 4CEOA 2BGGA 3F5TA 3TTFA 4AHSA 1VQLN 2G8VA 1UWBA 4B1XB 3PX6A 4YOVA 1S1TA 4JS4A 4W5TA 1DTTA 4DQ8A 1KSPA 5AQSA 3D2FA 3AY9A 3D45A 3E9PA 2D0AA 4CJVA 3CQ8A 4AQYK 2BE2A 3QMLA 2KW4A 1SL0A 4I6MA 4FK0A 3ZSOA 3HVRA 1DTQA 4MDAA 2A1RA 1NKEA 2F8SA 3WXLA 1EP4A 3JAMO 1N34K 5AQJA 5K14A 3MMVA 3DRSA 2E2QA 1RT5A 3DLBA 2GELA 3KKRA 3VN5A 2EHGA 4DG1A 3S3MA 3SPYA 3HVTA 4BG8A 4DR2K 3OYLA 1BCMA 1VSLA 3L2WA 1DKGD 2QW9A 3VEVA 3LDNA 4KFBA 3OA9A 4FK4A 1S1UA 3TABA 1T7PA 2WONA 3ZCMA 4GV9A 5KQ8A 1ZBUA 4B1VA 1ATRA 3PLAA 3WXIA 1VSKA 3DWLA 3CJ7A 3L8BA 1MWKA 4DTNA 1WSGA 2E8AA 4XEIA 1J6ZA 4X65K 3C6UA 4FOEA 1VQPN 3CJCA 1Z05A 2W42A 3LAKA 4H5VA 4DTUA 3ZSWA 1CZ9A 1KAYA 4IZ9A 3KLEA 2HB5A 4B3SK 1GOAA 1D9FA 4M7XA 4KRFA 1QSSA 2QWRA 4M7YA 3VESA 4PL8A 1S9GA 1TAQA 4CK3A 5F0XA 4FLWA 4DV5K 4DSKA 4I2PA 4ID1A 3CMEN 3HM8A 3VQQA 3VQ4A 3L3UA 1T44A 1HRHA 3JSMA 4B9LA 3UIQA 4DTJA 3DXMA 3CC7N 3JXUA 3AARA 1SKWA 1L3VA 5LL6Z 4BE2A 3OYEA 5C2FA 3CQXA 3O3FA 1QQOA 3LM2A 4JI1K 4JV5K 4B9QA 4JKCA 3O6WA 1NM1A 3FZHA 4CF9A 1ZBIA 1K9MO 2E1YA 4JKGA 5BRHA 1BQNA 3SBGA 4JS5A 1BG3A 1RTHA 2BDPA 1D9DA 2W6LA 4DUZK 4C8OA 1DEJA 2Z1JA 1SUQA 5GIPA 1VQ8N 2NRRA 5JLHA 3VQPA 3VQ8A 4I2QA 1GLAG 1RCHA 4BROA 4GW6A 1UOCA 3F9MA 1TKTA 3TPQA 4KHYA 1YXQA 1XC9A 4C23A 3NGYA 3HM9A 5AQPA 5LMUK 3EKSA 3DLKA 3SQ0A 1N36K 2O8BA 4DFPA 2QTDA 4DF8A 1BA1A 4DV4K 3QEIA 4JKDA 2IVOA 2ITGA 2HSTA 5FRMA 2Q2RA 4H4MA 3CC4N 2ASMA 1G15A 2ASOA 2YHXA 5KRTA 4M3YA 1BIUA 4FWQA 4RW7A 3EKUA 1TK0A 1EKEA 1HKBA 1VQ4N 2HMPA 2IC3A 1KLMA 1KVAA 2OPPA 1WAJA 1KFSA 3K58A 1B92A 4WCEL 1JCEA 3AVLA 1OVYA 3QO9A 2RPIA 4DQRA 3O9RA 2HHXA 2O8CB 3CCEN 4EHTA 3ZT2A 4GNIA 5FLXO 1XNQK 1KC8O 4PHTX 1ITGA 1OH7A 4BRIA 4C8MA 4LC9B 3HRGA 2HBKA 4DR6K 4OPHA 4Q5VA 4B1YB 4BR9A 1VRUA 4H5TA 5J2MA 1VQMN 1KCFA 3FLCO 3SI6A 3AA5X 3ZX2A 3KD5E 3O5BA 1BQMA 3EY1A 4YHHK 4NYNA 2ZD1A 1X9WA 2ZJRL 1BU6O 2V7YA 5DK5A 2AP1A 3N4PA 4CJSA 3VTHA 3UB5A 1JL2A 1VQNN 1YT3A 3FZMA 5KQDA 4E7KA 3FGUA 4ID5A 3AA3A 3GE1A 3VQBA 4BGAA 1JXBA 4ELTA 1NGJA 3BUZB 5GADP 1SQKA 3ASMA 5EXWA 4IJNA 1RT2A 2P9IA 3V9ZA 3ZLJA 3OBWA 5M1QA 4K8XA 2XRIA 3P1GA 1YJ9N 1J5EK 3DXKA 3LDPA 3T19A 3CCRN 2P9SA 4I9LA 4N5SA 3QETA 2FBYA 3SLCA 3ENHA 3AVIA 2OYQA 3TAPA 3VGLA 3O8MA 4FVUA 4DV6K 3NH0A 3C7NB 4CGFA 4EP4A 1NJIO 2G8IA 3VF2A 2QA4N 1HYZA 5AQVA 3R3LA 4OPJA 1Y97A 1YVUA 4E7IA 1S1VA 1RDDA 2YV0X 2WUSA 4JK7A 1HR0K 2ZE2A 5CY4A 4YOTA 3B6PA 4FWKA 1VSIA 1VSEA 1Q8IA 1TKXA 3A0IX 4CJ5A 4JEPA 4A2AA 1ESVA 4CZIA 4DV2K 3NGZA 4FW2A 3KTQA 1WSFA 1RTIA 2UYTA 4ISGA 2AA4A 2B4JA 4NCBA 2P9KB 3NGIA 5BPMA 1ZBLA 3H1QA 3KLIA 3V9UA 1G99A 2Q97A 1BOTO 1JLBA 3VQ6A 3LDSA 3O1WA 1XC3A 5AQOA 2YNGA 5AQQA 2OANA 4M3RA 4LH4A 1QZ5A 1RDBA 1X9MA 3HK2A 1RT3A 3T1YK 1X9JA 3MXIA 4IDHA 5JVGL 3VQDA 4CEZA 4CZHA 1HLUA 3ULEA 4KB1A 3PIPL 5CHIA 2HOEA 4LFCK 4LSLA 2CGJA 4YDUC 2F8TA 5AZJA 2QWOA 3ZT0A 3OYFA 1ZBFA 3SMPA 4AHCA 4AH9A 1VQKN 4KHSA 2V52B 2OZSA 4JN4A 3RR8A 4QS8A 4HHTA 4NLBA 4LD0A 1WUAA 3ID8A 3AVAA 3L2UA 3TAQA 3WXJA 3VF4A 1T6DA 5BREA 4DS5A 4H0YB 4CHZA 1VQ5N 1UAXA 2WC9A 1RT6A 3O80A 4IOXA 4BGBA 3G25A 3TI0A 4Y0WA 4BRPA 3NE6A 2VWJA 3ENBA 2KKZA 4CHPA 1T8EA 4LF5K 5HL7L 3A8YA 1NGEA 5TKYA 2KFNA 1C6VA 4OVLA 4NB4A 2UU9K 4KTWA 4R5PA 1YITN 3MCAB 5CZ2A 4CBWA 4F4KA 1BI4A 3T1AA 5F1XA 1JL1A 4IEIA 1LW0A 4FOIA 3O3HA 1ZBHA 3TWHA 3KJVA 1IG9A 1RNHA 2ASPA 4CJPA 1XMQK 2E2OA 4DSJA 1A5WA 3M8SA 3PO4A 3HI0A 1NGBA 4UY8O 1RDUA 2UUCK 2FC0A 3MX2A 1K8AO 3BZCA 2YHAA 3AAQA 2B5JA 4F3TA 4CZEA 3VEXA 3VQ7A 3ZX3A 2UUAK 4CZLA 3TTDA 2P5OA 4CGIA 3QNNA 2GX9A 3KZBA 1KQSM 4B9TA 4CK2A 4ZHRA 2G8FA 1S5JA 3R1XA 4BRDA 3VQCA 3DRPA 1ATSA 4LF7K 3NVKA 4B1ZA 2D0PA 1R0AA 1TAUA 4IXCA 2O8EA 5AQFA 4CF1A 2FF3B 3LM9A 3R6MA 2B6AA 1QSYA 1IKWA 1A5VA 3SQ4A 4DR7K 3MEDA 4DQIA 3E01A 3VQAA 3THWB 3QEPA 4HVJA 5AFUH 2ZJPL 3UE5A 3CCMN 2P51A 4C1NK 1NKCA 2XHBA 1LV5A 1TYQB 4E1NA 2I5JA 1JKHA 1FKPA 4MO5A 4DU1A 3CMAN 4IO8A 4JI4K 3VOVA 4EZ9A 4KV8A 3M8PA 3DI6A 4BRAA 5FPEA 5CYQA 4KI4A 3V1RA 3LDOA 5EVZA 1YF5L 1HJOA 2FSNA 2E5LK 5IWAK 3MK6A 4FLZA 4DLEA 4YDUA 1BHLA 5CYMA 3LANA 1BDGA 1EETA 2A41A 2PZSA 1ZXOA 5HRSA 1IH7A 2FBVA 3S9HA 3EYZA 4KH4A 2P9UB 1N8RO 2A40A 2BH1A 1IBKK 4DSLA 2D0CA 2GEMA 3OVNA 3PUFA 3E66A 3ID6A 1KD1O 4J2EA 4JD2B 3QIOA 5AQUA 3K9KA 2PYLA 4Z4HA 5C15A 3G4SN 1VK0A 3GG4A 2FLOA 4A5AA 3VTIA 3I55N 3G71N 3SUNA 4IG3A 4BR4A 3THYA 4HCBA 4G1QA 4A5BA 4JD2A 1J5OA 1NK6A 3D2FB 4CZMA 4CFBA 4BE0A
chains in the Genus database with same CATH topology
3LAMA 3O3FA 3OYKA 1LWEA 2IGIA 3ZSXA 1DLOA 4CE9A 3RTVA 1TKDA 2G8KA 1U47A 3KLGA 4C8KA 5JS1A 4BWMA 2HNDA 4QCLA 4CF9A 4JRPA 4OGCA 3OS0A 1ZBIA 3ISNC 4CFDA 4FM1A 1TGOA 2DTUA 3TARA 4E7JA 3NF8A 3G0ZA 4JS5A 1BQNA 3IAYA 4M42A 3NH1A 3OYIA 1RTHA 2BDPA 1D9DA 4O0IA 1QHTA 3THVA 3AA2A 1FK9A 4C8OA 2DFFA 3AVFA 3SV3A 4FJNA 2Z1JA 1SUQA 4KHUA 5KI6A 4UQGA 3VQPA 3K59A 3VQ8A 4I2QA 4DWIA 1RCHA 1RBRA 2Z1HA 4GW6A 1UOCA 5EU7A 4OKEA 4CJWA 5C24A 1TKTA 1C0UA 4N41A 1BL3A 1TK8A 4KHYA 1XC9A 1BIZA 3NGYA 2QKKA 4CJLA 2XY6A 3HM9A 4PY5A 1K6YA 5J2QA 1NK9A 3K5MA 3AVBA 2FBXA 1HMVA 4KAZA 1WSJA 1HPZA 3DLKA 3ZSRA 4DFMA 3SQ0A 1XHXA 4O0JA 4RW6A 1VSJA 4HUGA 4FM2A 2X78A 3CFPA 4RW4A 4DFPA 4OKJA 4CJRA 1W9HA 3LWLA 4E1MA 3DM2A 5J2NA 4FJ8A 3MAQA 3OYAA 4DF8A 3DLRA 3QEIA 2VWKA 2P1JA 3ZT3A 2ITGA 3JYTA 3O3GA 4E7HA 1HQEA 1YTAA 1FXXA 2OA8A 4CESA 4CHOA 1RTDA 4H4MA 5FRMA 1N5YA 4B9VA 1G15A 3WNHA 4J2DA 5KRTA 1SV5A 4E0DA 4M3YA 1BIUA 3HJFA 4IFVA 3V1OA 2Z1GA 3MXJA 4PA1A 3IRXA 4FZZA 4RW7A 4CK1A 2O4GA 1NK7A 1TK0A 2ATQA 4DF4A 1EKEA 4GMJB 1RBVA 4FJLA 2D5RA 2IC3A 4CEBA 1KLMA 1XI1A 1KVAA 4B8CA 2OPPA 2ZQBA 1WAJA 1KFSA 1ASVA 3K58A 1B92A 3DRRA 3LZJA 4ZTJA 3AVLA 3QO9A 4F2RA 1SL0A 4FLVA 2RPIA 1S1WA 1U04A 1U48A 4CJEA 4DQRA 2IS3A 3CFOA 1CLQA 1HQUA 3RRHA 1WN7A 3AVGA 1ASWA 3AVNA 2HHXA 3V4IA 4MQ3A 1L5UA 3HO1A 3SYZA 2AJQA 2RN2A 3AVMA 3HPOA 3ZT2A 2QKBA 1GOCA 1CZBA 3NFAA 1ITGA 1JLCA 2EX3A 1JLGA 3EZ5A 3NAEA 1X9SA 1NJWA 4C8MA 4FJ5A 4E19A 1VSMA 4DTPA 5HRNA 1A5XA 3CG7A 3I8DA 3NF6A 4Q5VA 3LPTA 4FLUA 3DOKA 3LALA 3AVHA 4GVMA 4B8AB 2A1SA 4LY7A 1KVCA 4FYDA 1VRUA 5J2MA 5C25A 1KCFA 3KK2A 3VA0A 4DSIA 3SI6A 5FDLA 3V1QA 3AA5X 5I3UA 1RT1A 1JLEA 1X1PA 4CGJA 5HP1A 3KD5E 1RT4A 4W5RA 3KK3A 4CIGA 1BQMA 2HHUA 2KFZA 3EY1A 2HHVA 4CJKA 3S3NA 2VG5A 1X9WA 4NYNA 2ZD1A 4B9SA 1UA1A 4KTZA 3SJJA 1CXQA 4DFKA 2IOCA 4J2BA 1TVRA 4LSNA 2G8UA 5C42A 3HXMA 1KLNA 5DK5A 2HHSA 2YNHA 1S9EA 1C0TA 5HBMA 3M8RA 4CJSA 1VSDA 3P83D 1JL2A 2YNFA 4CERA 4HUEA 4B08A 3TAMA 1YT3A 4CGDA 1HJRA 1GOBA 3DYAA 4XIUA 3IS9A 4E7KA 4DTSA 3NHGA 1WSIA 3QLHA 3AO2A 3KKSA 1NJZA 3V6DA 4ID5A 4CJFA 5HRPA 3H08A 4KHNA 4CCHA 3AA3A 1S1XA 2OPQA 3G10A 4J2AA 4CF2A 1Z26A 3VQBA 2HNZA 4Z4EA 1JXBA 3WNEA 4ELTA 1LWCA 4WE1A 1NK8A 4CJUA 3PX4A 3ASMA 4M3TA 3QNOA 1RT2A 1B9FA 4RW9A 5CZ1A 1L3TA 1RBUA 4CJQA 5E41A 3V9ZA 3SCXA 2Y1JA 3LWMA 1C0MA 1XHZA 3CM6A 3DLGA 1NK5A 4M45A 1BCOA 4K8XA 2XRIA 3P1GA 4DMNA 3QEXA 1QQCA 2XY8A 1VSFA 1WLJA 4KHQA 1LWFA 3T19A 4I9LA 4N5SA 4W5OA 3K5LA 4CHQA 3QETA 2FBYA 2NUBA 3OS2A 4M3UA 3PY8A 4N56A 3SUPA 4M3WA 3AVIA 3D0PA 2OYQA 3TAPA 1WSHA 4ELUA 4FLTA 1RILA 1REVA 2G8WA 1NK4A 4PWDA 1WNSA 1XWLA 3HL8A 1FKOA 4O44A 3ZT1A 1NOZA 3NH0A 4RW8A 4DLGA 3V9XA 4FJMA 4PUOA 5FROA 4H8KA 4FJXA 4CGFA 4EP4A 2G8IA 3LP2A 4CF0A 3ZSZA 3OJUA 2IDOA 3O4QA 2HHWA 3HSTB 3AVJA 4W5NA 1HYZA 4BDPA 4OPJA 1Y97A 1YVUA 1W0HA 4E7IA 4B9NA 1S1VA 1RDDA 3S3OA 4CGHA 4B9MA 3V9WA 2YV0X 4CJ4A 2GV9A 4CEQA 4QOZB 2KZZA 4KO0A 3QIPA 2ZE2A 3OYCA 5CY4A 2X6SA 1TL3A 4AHRA 4F8RA 4KB0A 1YTUA 4DTMA 3T3FA 1EX4A 2KQ2A 3B6PA 3V81A 1VSIA 2LSNA 3OJSA 3RR7A 2KZMA 3PX0A 1RBSA 2JLEA 1VSEA 1SL2A 2HVIA 3LPUA 2YHBA 1Q8IA 1TKXA 3VQEA 3SZ2A 4N76A 4FJ9A 3OYDA 1C1BA 3LP3A 4CJ5A 3DLHA 1QTMA 3CFRA 5HROA 4DSFA 2P5GA 3DMJA 4W5QA 4KKOA 4FJHA 4CECA 4FJIA 2YNIA 1WAFA 1TL1A 1HNVA 2HVHA 3KTQA 3NGZA 4FW2A 1WSFA 1RTIA 3C6TA 2HNYA 4DU3A 2X74A 3SUQA 4DSEA 4JRQA 4Z4CA 5J1EA 4E3SA 2HMIA 2B4JA 4IBNA 4MFBA 3VQ9A 4BE1A 4DFJA 3HT3A 4NCBA 4KHWA 4EP5A 3WNFA 3NGIA 3C95A 3NCIA 1ZBLA 1NKBA 3KLIA 1VSHA 3V9UA 3FFIA 3LP1A 1F21A 3RMDA 3AVCA 1RDCA 3QEWA 3AA4A 4LH5A 1JLBA 3AO5A 1T03A 2KTQA 3ALYA 3VQ6A 3LDSA 1SL1A 4HUFA 2XY7A 3V9SA 1SKRA 3IG1A 4L8RB 3BDPA 1RDAA 2YNGA 5KRSA 4HTUA 4BDYA 4M3RA 3K57A 4LH4A 1RDBA 4CFCA 1CXUA 1BGXT 4IFYA 4CFAA 3KK1A 4AHVA 1X9MA 3LZIA 1I3AA 3OYBA 3RWUA 1RT3A 3HK2A 3TANA 3KD1E 1D5AA 4Z0UA 3MXIA 5JS2A 4DTXA 4N47A 1SKSA 3VQDA 5SWMA 2GUIA 3U3YA 4CEZA 5DMRA 4KB1A 2QXFA 5SZTA 1LW2A 4PQUA 2PYJA 4LSLA 3NDKA 2DFEA 4Z4GA 3OY9A 3OYJA 3PO5A 1S6QA 2F8TA 3HYFA 3ZT0A 3OYMA 3OYFA 1ZYQA 1ZBFA 3AO3A 4NCGA 2DFHA 3AO1A 4QAGA 4AH9A 4AHCA 1D8YA 4KHSA 5FRNA 3RMBA 3QERA 4FZYA 4C8LA 4FLYA 4FLXA 1JXEA 4CIFA 3RR8A 4HHTA 2OZSA 1NK0A 4O5BA 4LD0A 3CM5A 4CEFA 3BGRA 3TAGA 3AVAA 3L2UA 1J53A 3SQ1A 3TAQA 2YKNA 3DOLA 2G8HA 3F73A 1ASUA 4RG8A 4TSXA 3MXMA 4DS5A 4EZ6A 4CHZA 1MU2A 4Z4IA 3L2RA 1UAXA 2BANA 4OKKA 1KFDA 1RT6A 3QEVA 1NOYA 2HHTA 4DTRA 4CEDA 1Z25A 3TI0A 4FM0A 4FJ7A 2HHQA 3NE6A 3RMCA 2VWJA 3MEGA 4CHPA 1T8EA 1Q9YA 1VRTA 3NBPA 3KIOA 1N6QA 1U45A 4Y1CA 4AHUA 1WSEA 1TV6A 4FJJA 2YKMA 2KFNA 3SUOA 2XY5A 4K8ZA 1IKVA 1TKZA 2X6NA 4JLHA 3SQ2A 1QSLA 4F3OA 4KREA 4FJGA 4C8NA 1C6VA 4OVLA 4Q0BA 3ZSYA 2FBTA 5J2PA 1L3UA 3L3VA 4KTWA 4R5PA 5D3GA 4CHNA 2PY5A 4E89A 5CZ2A 3DLEA 3K5NA 3SPZA 1BI4A 3T1AA 4F4KA 4Z4FA 3LP0A 1HNIA 1JL1A 2E6MA 3O4NA 4E7LA 2RF2A 3M8QA 1I39A 1LAVA 1LW0A 1J9AA 3O3HA 2IAJA 4HCCA 2QK9A 1ZBHA 4KPYA 3TWHA 4IKFA 3F9KA 3ZSQA 1RNHA 3KJVA 3U6FA 1IG9A 4FVMA 2O4IA 4CJPA 4CEAA 2OPSA 4CJ3A 3SV4A 1B9DA 4DSJA 3A2FA 1QS4A 4IG0A 4YFUA 2OPRA 3NF7A 2R7YA 1A5WA 3AVKA 3M8SA 3PO4A 4FJKA 1EXQA 4H4OA 3OYNA 4OLBA 2RKIA 2OZMA 5KGXA 3HPHA 2FC0A 3KLFA 1U4BA 2JGUA 4BWJA 2YHAA 4CEEA 4CEOA 1RT7A 2B5JA 3K2PA 3TAEA 2BGGA 3NF9A 4AHSA 4F3TA 3L2VA 1UWBA 3K5OA 3OYHA 2G8VA 3VQ7A 4ZTFA 3PX6A 2P5OA 1NJYA 1S1TA 4CGIA 5HRRA 3HP6A 3QNNA 4B9TA 1O1WA 4JS4A 4W5TA 1DTTA 4CK2A 5KGWA 4YNQA 4ZHRA 4CJTA 2G8FA 1KSPA 1S5JA 4I7FA 3AV9A 2VG6A 4KTQA 3VQCA 4DQQA 4KI6A 3D45A 3DRPA 4FZXC 4AILC 1L3SA 2D0AA 4CJVA 3L2QA 3CQ8A 2HW3A 2BE2A 2D0BA 4CHYA 4AHTA 1KVBA 2KW4A 3CYMA 2XO7A 1R0AA 4CF1A 4CF8A 4OPKA 3NH2A 1U49A 4DQPA 4FK0A 3ZSOA 3HVRA 1DTQA 1QSYA 2B6AA 1IKYA 4F2SA 1IKWA 2ETJA 3WNGA 2A1RA 1A5VA 1NKEA 1EP4A 3SQ4A 2F8SA 3MEDA 4DQIA 1RTJA 4OJRA 5K14A 4BDZA 3E01A 3VQAA 1HYSA 3AO4A 3DRSA 3I0RA 1JLQA 3QINA 3QEPA 4HVJA 1RT5A 3DLBA 3KKRA 3VN5A 2EHGA 2P51A 4DG1A 3SPYA 3S3MA 1NKCA 3HVTA 2XHBA 1LV5A 3OYLA 4E1NA 2I5JA 1TAUA 1BCMA 1JKHA 1FKPA 4DQSA 4DU1A 1BI4B 1VSLA 3L2WA 3RMAA 1T05A 3PV8A 4KFBA 3RRGA 4FK4A 4EZ9A 1S1UA 4CGGA 3ULDA 4KV8A 4M41A 3M8PA 3TABA 1NJXA 3DI6A 1T7PA 1HYVA 1BISA 2WONA 5CYQA 3ZCMA 3SNNA 4KI4A 4M3XA 3V1RA 2DY4A 4ELVA 1ZBUA 2VG7A 3QESA 3VQ5A 4B9UA 2WOMA 3OS1A 1VSKA 5T7BA 2E4LA 3HPGA 4OLAA 3L8BA 4FLZA 4O4GA 4DLEA 4DTNA 1WSGA 3HP9A 1BHLA 5CYMA 2GBZA 3LANA 3C6UA 1EETA 1KRPA 5HLFA 2W42A 4O55A 4DTOA 2PZSA 1J54A 5HRSA 3LAKA 1IH7A 2FBVA 4NYFA 4DTUA 3S9HA 3EYZA 3ZSWA 1CZ9A 1TK5A 3KLEA 3TAFA 2HB5A 1UA0A 1GOAA 1D9FA 4KRFA 5I42A 3P5JA 4FW1A 4FCYA 1QSSA 4DSLA 3TR8A 2D0CA 4NCAA 3OVNA 3PUFA 1C1AA 3VA3A 4DS4A 1JLFA 3ITHA 4J2EA 4FK2A 1S9GA 1TAQA 4OGEA 1RBTA 4CK3A 1QE1A 3QIOA 4BACA 4FLWA 3ZT4A 1IKXA 4DSKA 4IDKA 2PYLA 4Z4HA 4B3OA 5KTQA 1LAWA 1VK0A 4ICLA 4I2PA 4ID1A 3ZSVA 1KTQA 3VQQA 3VQ4A 4IG3A 4CIEA 3SUNA 1C1CA 3OYGA 4FXDA 2F96A 2E6LA 3L3UA 4HCBA 4M3ZA 1HRHA 1S6PA 2Y1IA 3JSMA 4B9LA 1Q9XA 3UIQA 4DTJA 4G1QA 4I9QA 1SKWA 1L3VA 3B6OA 4Y1DA 4DU4A 1J5OA 2Q3SA 3KLHA 1IO2A 1JLAA 1NK6A 3C94A 4BE2A 3U3GA 2Z1IA 4CFBA 3OYEA 3MEEA 3I0SA 3MECA 4BE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAM A;  3O3F A;  3OYK A;  1LWE A;  2IGI A;  3ZSX A;  1DLO A;  4CE9 A;  3RTV A;  1TKD A;  2G8K A;  1U47 A;  3KLG A;  4C8K A;  5JS1 A;  4BWM A;  2HND A;  4QCL A;  4CF9 A;  4JRP A;  4OGC A;  3OS0 A;  1ZBI A;  3ISN C;  4CFD A;  4FM1 A;  1TGO A;  2DTU A;  3TAR A;  4E7J A;  3NF8 A;  3G0Z A;  4JS5 A;  1BQN A;  3IAY A;  4M42 A;  3NH1 A;  3OYI A;  1RTH A;  2BDP A;  1D9D A;  4O0I A;  1QHT A;  3THV A;  3AA2 A;  1FK9 A;  4C8O A;  2DFF A;  3AVF A;  3SV3 A;  4FJN A;  2Z1J A;  1SUQ A;  4KHU A;  5KI6 A;  4UQG A;  3VQP A;  3K59 A;  3VQ8 A;  4I2Q A;  4DWI A;  1RCH A;  1RBR A;  2Z1H A;  4GW6 A;  1UOC A;  5EU7 A;  4OKE A;  4CJW A;  5C24 A;  1TKT A;  1C0U A;  4N41 A;  1BL3 A;  1TK8 A;  4KHY A;  1XC9 A;  1BIZ A;  3NGY A;  2QKK A;  4CJL A;  2XY6 A;  3HM9 A;  4PY5 A;  1K6Y A;  5J2Q A;  1NK9 A;  3K5M A;  3AVB A;  2FBX A;  1HMV A;  4KAZ A;  1WSJ A;  1HPZ A;  3DLK A;  3ZSR A;  4DFM A;  3SQ0 A;  1XHX A;  4O0J A;  4RW6 A;  1VSJ A;  4HUG A;  4FM2 A;  2X78 A;  3CFP A;  4RW4 A;  4DFP A;  4OKJ A;  4CJR A;  1W9H A;  3LWL A;  4E1M A;  3DM2 A;  5J2N A;  4FJ8 A;  3MAQ A;  3OYA A;  4DF8 A;  3DLR A;  3QEI A;  2VWK A;  2P1J A;  3ZT3 A;  2ITG A;  3JYT A;  3O3G A;  4E7H A;  1HQE A;  1YTA A;  1FXX A;  2OA8 A;  4CES A;  4CHO A;  1RTD A;  4H4M A;  5FRM A;  1N5Y A;  4B9V A;  1G15 A;  3WNH A;  4J2D A;  5KRT A;  1SV5 A;  4E0D A;  4M3Y A;  1BIU A;  3HJF A;  4IFV A;  3V1O A;  2Z1G A;  3MXJ A;  4PA1 A;  3IRX A;  4FZZ A;  4RW7 A;  4CK1 A;  2O4G A;  1NK7 A;  1TK0 A;  2ATQ A;  4DF4 A;  1EKE A;  4GMJ B;  1RBV A;  4FJL A;  2D5R A;  2IC3 A;  4CEB A;  1KLM A;  1XI1 A;  1KVA A;  4B8C A;  2OPP A;  2ZQB A;  1WAJ A;  1KFS A;  1ASV A;  3K58 A;  1B92 A;  3DRR A;  3LZJ A;  4ZTJ A;  3AVL A;  3QO9 A;  4F2R A;  1SL0 A;  4FLV A;  2RPI A;  1S1W A;  1U04 A;  1U48 A;  4CJE A;  4DQR A;  2IS3 A;  3CFO A;  1CLQ A;  1HQU A;  3RRH A;  1WN7 A;  3AVG A;  1ASW A;  3AVN A;  2HHX A;  3V4I A;  4MQ3 A;  1L5U A;  3HO1 A;  3SYZ A;  2AJQ A;  2RN2 A;  3AVM A;  3HPO A;  3ZT2 A;  2QKB A;  1GOC A;  1CZB A;  3NFA A;  1ITG A;  1JLC A;  2EX3 A;  1JLG A;  3EZ5 A;  3NAE A;  1X9S A;  1NJW A;  4C8M A;  4FJ5 A;  4E19 A;  1VSM A;  4DTP A;  5HRN A;  1A5X A;  3CG7 A;  3I8D A;  3NF6 A;  4Q5V A;  3LPT A;  4FLU A;  3DOK A;  3LAL A;  3AVH A;  4GVM A;  4B8A B;  2A1S A;  4LY7 A;  1KVC A;  4FYD A;  1VRU A;  5J2M A;  5C25 A;  1KCF A;  3KK2 A;  3VA0 A;  4DSI A;  3SI6 A;  5FDL A;  3V1Q A;  3AA5 X;  5I3U A;  1RT1 A;  1JLE A;  1X1P A;  4CGJ A;  5HP1 A;  3KD5 E;  1RT4 A;  4W5R A;  3KK3 A;  4CIG A;  1BQM A;  2HHU A;  2KFZ A;  3EY1 A;  2HHV A;  4CJK A;  3S3N A;  2VG5 A;  1X9W A;  4NYN A;  2ZD1 A;  4B9S A;  1UA1 A;  4KTZ A;  3SJJ A;  1CXQ A;  4DFK A;  2IOC A;  4J2B A;  1TVR A;  4LSN A;  2G8U A;  5C42 A;  3HXM A;  1KLN A;  5DK5 A;  2HHS A;  2YNH A;  1S9E A;  1C0T A;  5HBM A;  3M8R A;  4CJS A;  1VSD A;  3P83 D;  1JL2 A;  2YNF A;  4CER A;  4HUE A;  4B08 A;  3TAM A;  1YT3 A;  4CGD A;  1HJR A;  1GOB A;  3DYA A;  4XIU A;  3IS9 A;  4E7K A;  4DTS A;  3NHG A;  1WSI A;  3QLH A;  3AO2 A;  3KKS A;  1NJZ A;  3V6D A;  4ID5 A;  4CJF A;  5HRP A;  3H08 A;  4KHN A;  4CCH A;  3AA3 A;  1S1X A;  2OPQ A;  3G10 A;  4J2A A;  4CF2 A;  1Z26 A;  3VQB A;  2HNZ A;  4Z4E A;  1JXB A;  3WNE A;  4ELT A;  1LWC A;  4WE1 A;  1NK8 A;  4CJU A;  3PX4 A;  3ASM A;  4M3T A;  3QNO A;  1RT2 A;  1B9F A;  4RW9 A;  5CZ1 A;  1L3T A;  1RBU A;  4CJQ A;  5E41 A;  3V9Z A;  3SCX A;  2Y1J A;  3LWM A;  1C0M A;  1XHZ A;  3CM6 A;  3DLG A;  1NK5 A;  4M45 A;  1BCO A;  4K8X A;  2XRI A;  3P1G A;  4DMN A;  3QEX A;  1QQC A;  2XY8 A;  1VSF A;  1WLJ A;  4KHQ A;  1LWF A;  3T19 A;  4I9L A;  4N5S A;  4W5O A;  3K5L A;  4CHQ A;  3QET A;  2FBY A;  2NUB A;  3OS2 A;  4M3U A;  3PY8 A;  4N56 A;  3SUP A;  4M3W A;  3AVI A;  3D0P A;  2OYQ A;  3TAP A;  1WSH A;  4ELU A;  4FLT A;  1RIL A;  1REV A;  2G8W A;  1NK4 A;  4PWD A;  1WNS A;  1XWL A;  3HL8 A;  1FKO A;  4O44 A;  3ZT1 A;  1NOZ A;  3NH0 A;  4RW8 A;  4DLG A;  3V9X A;  4FJM A;  4PUO A;  5FRO A;  4H8K A;  4FJX A;  4CGF A;  4EP4 A;  2G8I A;  3LP2 A;  4CF0 A;  3ZSZ A;  3OJU A;  2IDO A;  3O4Q A;  2HHW A;  3HST B;  3AVJ A;  4W5N A;  1HYZ A;  4BDP A;  4OPJ A;  1Y97 A;  1YVU A;  1W0H A;  4E7I A;  4B9N A;  1S1V A;  1RDD A;  3S3O A;  4CGH A;  4B9M A;  3V9W A;  2YV0 X;  4CJ4 A;  2GV9 A;  4CEQ A;  4QOZ B;  2KZZ A;  4KO0 A;  3QIP A;  2ZE2 A;  3OYC A;  5CY4 A;  2X6S A;  1TL3 A;  4AHR A;  4F8R A;  4KB0 A;  1YTU A;  4DTM A;  3T3F A;  1EX4 A;  2KQ2 A;  3B6P A;  3V81 A;  1VSI A;  2LSN A;  3OJS A;  3RR7 A;  2KZM A;  3PX0 A;  1RBS A;  2JLE A;  1VSE A;  1SL2 A;  2HVI A;  3LPU A;  2YHB A;  1Q8I A;  1TKX A;  3VQE A;  3SZ2 A;  4N76 A;  4FJ9 A;  3OYD A;  1C1B A;  3LP3 A;  4CJ5 A;  3DLH A;  1QTM A;  3CFR A;  5HRO A;  4DSF A;  2P5G A;  3DMJ A;  4W5Q A;  4KKO A;  4FJH A;  4CEC A;  4FJI A;  2YNI A;  1WAF A;  1TL1 A;  1HNV A;  2HVH A;  3KTQ A;  3NGZ A;  4FW2 A;  1WSF A;  1RTI A;  3C6T A;  2HNY A;  4DU3 A;  2X74 A;  3SUQ A;  4DSE A;  4JRQ A;  4Z4C A;  5J1E A;  4E3S A;  2HMI A;  2B4J A;  4IBN A;  4MFB A;  3VQ9 A;  4BE1 A;  4DFJ A;  3HT3 A;  4NCB A;  4KHW A;  4EP5 A;  3WNF A;  3NGI A;  3C95 A;  3NCI A;  1ZBL A;  1NKB A;  3KLI A;  1VSH A;  3V9U A;  3FFI A;  3LP1 A;  1F21 A;  3RMD A;  3AVC A;  1RDC A;  3QEW A;  3AA4 A;  4LH5 A;  1JLB A;  3AO5 A;  1T03 A;  2KTQ A;  3ALY A;  3VQ6 A;  3LDS A;  1SL1 A;  4HUF A;  2XY7 A;  3V9S A;  1SKR A;  3IG1 A;  4L8R B;  3BDP A;  1RDA A;  2YNG A;  5KRS A;  4HTU A;  4BDY A;  4M3R A;  3K57 A;  4LH4 A;  1RDB A;  4CFC A;  1CXU A;  1BGX T;  4IFY A;  4CFA A;  3KK1 A;  4AHV A;  1X9M A;  3LZI A;  1I3A A;  3OYB A;  3RWU A;  1RT3 A;  3HK2 A;  3TAN A;  3KD1 E;  1D5A A;  4Z0U A;  3MXI A;  5JS2 A;  4DTX A;  4N47 A;  1SKS A;  3VQD A;  5SWM A;  2GUI A;  3U3Y A;  4CEZ A;  5DMR A;  4KB1 A;  2QXF A;  5SZT A;  1LW2 A;  4PQU A;  2PYJ A;  4LSL A;  3NDK A;  2DFE A;  4Z4G A;  3OY9 A;  3OYJ A;  3PO5 A;  1S6Q A;  2F8T A;  3HYF A;  3ZT0 A;  3OYM A;  3OYF A;  1ZYQ A;  1ZBF A;  3AO3 A;  4NCG A;  2DFH A;  3AO1 A;  4QAG A;  4AH9 A;  4AHC A;  1D8Y A;  4KHS A;  5FRN A;  3RMB A;  3QER A;  4FZY A;  4C8L A;  4FLY A;  4FLX A;  1JXE A;  4CIF A;  3RR8 A;  4HHT A;  2OZS A;  1NK0 A;  4O5B A;  4LD0 A;  3CM5 A;  4CEF A;  3BGR A;  3TAG A;  3AVA A;  3L2U A;  1J53 A;  3SQ1 A;  3TAQ A;  2YKN A;  3DOL A;  2G8H A;  3F73 A;  1ASU A;  4RG8 A;  4TSX A;  3MXM A;  4DS5 A;  4EZ6 A;  4CHZ A;  1MU2 A;  4Z4I A;  3L2R A;  1UAX A;  2BAN A;  4OKK A;  1KFD A;  1RT6 A;  3QEV A;  1NOY A;  2HHT A;  4DTR A;  4CED A;  1Z25 A;  3TI0 A;  4FM0 A;  4FJ7 A;  2HHQ A;  3NE6 A;  3RMC A;  2VWJ A;  3MEG A;  4CHP A;  1T8E A;  1Q9Y A;  1VRT A;  3NBP A;  3KIO A;  1N6Q A;  1U45 A;  4Y1C A;  4AHU A;  1WSE A;  1TV6 A;  4FJJ A;  2YKM A;  2KFN A;  3SUO A;  2XY5 A;  4K8Z A;  1IKV A;  1TKZ A;  2X6N A;  4JLH A;  3SQ2 A;  1QSL A;  4F3O A;  4KRE A;  4FJG A;  4C8N A;  1C6V A;  4OVL A;  4Q0B A;  3ZSY A;  2FBT A;  5J2P A;  1L3U A;  3L3V A;  4KTW A;  4R5P A;  5D3G A;  4CHN A;  2PY5 A;  4E89 A;  5CZ2 A;  3DLE A;  3K5N A;  3SPZ A;  1BI4 A;  3T1A A;  4F4K A;  4Z4F A;  3LP0 A;  1HNI A;  1JL1 A;  2E6M A;  3O4N A;  4E7L A;  2RF2 A;  3M8Q A;  1I39 A;  1LAV A;  1LW0 A;  1J9A A;  3O3H A;  2IAJ A;  4HCC A;  2QK9 A;  1ZBH A;  4KPY A;  3TWH A;  4IKF A;  3F9K A;  3ZSQ A;  1RNH A;  3KJV A;  3U6F A;  1IG9 A;  4FVM A;  2O4I A;  4CJP A;  4CEA A;  2OPS A;  4CJ3 A;  3SV4 A;  1B9D A;  4DSJ A;  3A2F A;  1QS4 A;  4IG0 A;  4YFU A;  2OPR A;  3NF7 A;  2R7Y A;  1A5W A;  3AVK A;  3M8S A;  3PO4 A;  4FJK A;  1EXQ A;  4H4O A;  3OYN A;  4OLB A;  2RKI A;  2OZM A;  5KGX A;  3HPH A;  2FC0 A;  3KLF A;  1U4B A;  2JGU A;  4BWJ A;  2YHA A;  4CEE A;  4CEO A;  1RT7 A;  2B5J A;  3K2P A;  3TAE A;  2BGG A;  3NF9 A;  4AHS A;  4F3T A;  3L2V A;  1UWB A;  3K5O A;  3OYH A;  2G8V A;  3VQ7 A;  4ZTF A;  3PX6 A;  2P5O A;  1NJY A;  1S1T A;  4CGI A;  5HRR A;  3HP6 A;  3QNN A;  4B9T A;  1O1W A;  4JS4 A;  4W5T A;  1DTT A;  4CK2 A;  5KGW A;  4YNQ A;  4ZHR A;  4CJT A;  2G8F A;  1KSP A;  1S5J A;  4I7F A;  3AV9 A;  2VG6 A;  4KTQ A;  3VQC A;  4DQQ A;  4KI6 A;  3D45 A;  3DRP A;  4FZX C;  4AIL C;  1L3S A;  2D0A A;  4CJV A;  3L2Q A;  3CQ8 A;  2HW3 A;  2BE2 A;  2D0B A;  4CHY A;  4AHT A;  1KVB A;  2KW4 A;  3CYM A;  2XO7 A;  1R0A A;  4CF1 A;  4CF8 A;  4OPK A;  3NH2 A;  1U49 A;  4DQP A;  4FK0 A;  3ZSO A;  3HVR A;  1DTQ A;  1QSY A;  2B6A A;  1IKY A;  4F2S A;  1IKW A;  2ETJ A;  3WNG A;  2A1R A;  1A5V A;  1NKE A;  1EP4 A;  3SQ4 A;  2F8S A;  3MED A;  4DQI A;  1RTJ A;  4OJR A;  5K14 A;  4BDZ A;  3E01 A;  3VQA A;  1HYS A;  3AO4 A;  3DRS A;  3I0R A;  1JLQ A;  3QIN A;  3QEP A;  4HVJ A;  1RT5 A;  3DLB A;  3KKR A;  3VN5 A;  2EHG A;  2P51 A;  4DG1 A;  3SPY A;  3S3M A;  1NKC A;  3HVT A;  2XHB A;  1LV5 A;  3OYL A;  4E1N A;  2I5J A;  1TAU A;  1BCM A;  1JKH A;  1FKP A;  4DQS A;  4DU1 A;  1BI4 B;  1VSL A;  3L2W A;  3RMA A;  1T05 A;  3PV8 A;  4KFB A;  3RRG A;  4FK4 A;  4EZ9 A;  1S1U A;  4CGG A;  3ULD A;  4KV8 A;  4M41 A;  3M8P A;  3TAB A;  1NJX A;  3DI6 A;  1T7P A;  1HYV A;  1BIS A;  2WON A;  5CYQ A;  3ZCM A;  3SNN A;  4KI4 A;  4M3X A;  3V1R A;  2DY4 A;  4ELV A;  1ZBU A;  2VG7 A;  3QES A;  3VQ5 A;  4B9U A;  2WOM A;  3OS1 A;  1VSK A;  5T7B A;  2E4L A;  3HPG A;  4OLA A;  3L8B A;  4FLZ A;  4O4G A;  4DLE A;  4DTN A;  1WSG A;  3HP9 A;  1BHL A;  5CYM A;  2GBZ A;  3LAN A;  3C6U A;  1EET A;  1KRP A;  5HLF A;  2W42 A;  4O55 A;  4DTO A;  2PZS A;  1J54 A;  5HRS A;  3LAK A;  1IH7 A;  2FBV A;  4NYF A;  4DTU A;  3S9H A;  3EYZ A;  3ZSW A;  1CZ9 A;  1TK5 A;  3KLE A;  3TAF A;  2HB5 A;  1UA0 A;  1GOA A;  1D9F A;  4KRF A;  5I42 A;  3P5J A;  4FW1 A;  4FCY A;  1QSS A;  4DSL A;  3TR8 A;  2D0C A;  4NCA A;  3OVN A;  3PUF A;  1C1A A;  3VA3 A;  4DS4 A;  1JLF A;  3ITH A;  4J2E A;  4FK2 A;  1S9G A;  1TAQ A;  4OGE A;  1RBT A;  4CK3 A;  1QE1 A;  3QIO A;  4BAC A;  4FLW A;  3ZT4 A;  1IKX A;  4DSK A;  4IDK A;  2PYL A;  4Z4H A;  4B3O A;  5KTQ A;  1LAW A;  1VK0 A;  4ICL A;  4I2P A;  4ID1 A;  3ZSV A;  1KTQ A;  3VQQ A;  3VQ4 A;  4IG3 A;  4CIE A;  3SUN A;  1C1C A;  3OYG A;  4FXD A;  2F96 A;  2E6L A;  3L3U A;  4HCB A;  4M3Z A;  1HRH A;  1S6P A;  2Y1I A;  3JSM A;  4B9L A;  1Q9X A;  3UIQ A;  4DTJ A;  4G1Q A;  4I9Q A;  1SKW A;  1L3V A;  3B6O A;  4Y1D A;  4DU4 A;  1J5O A;  2Q3S A;  3KLH A;  1IO2 A;  1JLA A;  1NK6 A;  3C94 A;  4BE2 A;  3U3G A;  2Z1I A;  4CFB A;  3OYE A;  3MEE A;  3I0S A;  3MEC A;  4BE0 A; 
#chains in the Genus database with same CATH topology
 2FXU A;  3OYK A;  4K43 A;  1LWE A;  4E1J A;  2IGI A;  4CE9 A;  3RTV A;  2HF3 A;  1W7A A;  4C8K A;  5JS1 A;  1LOT B;  3O08 A;  2HBJ A;  3BY5 A;  4OGC A;  3QDK A;  4H5R A;  1TGO A;  2ZWH A;  4E7J A;  4LFB K;  3G0Z A;  5AQM A;  1OKJ A;  4Z94 A;  4BRE A;  1FJG K;  5KI6 A;  4H0P A;  4UQG A;  3K59 A;  4DWI A;  2Z1H A;  4CJW A;  5EU7 A;  1C0U A;  4N41 A;  1BL3 A;  3ATU A;  5EOY A;  5J2Q A;  1NK9 A;  3CET A;  3K5M A;  3AVB A;  3C65 A;  1HMV A;  5LMN K;  4KAZ A;  1BUP A;  1XHX A;  4O0J A;  4FM2 A;  2H3G X;  3CCV N;  4RW4 A;  4RTF D;  3IUC A;  1W9H A;  4H0X B;  1VQ9 N;  3VEO A;  3DM2 A;  2HBL A;  5C10 A;  4FJ8 A;  4IJA A;  3A5L C;  4AM7 A;  3O4W A;  2F9W A;  4RCH A;  2E2P A;  3EO3 A;  1FXX A;  4CES A;  4CHO A;  1N5Y A;  5GAH P;  4B3R K;  3T69 A;  3HJF A;  3M6G A;  5AZI B;  3VER A;  4IFV A;  3V1O A;  2KLA A;  2Z1G A;  4PA1 A;  5B8H A;  4WQ5 C;  3AAP A;  3R9P A;  1T3V A;  4CEB A;  4U7B A;  2UXC K;  3DRR A;  4ZTJ A;  4FLV A;  1S1W A;  1U48 A;  4CJE A;  2NRZ A;  3CFO A;  3CC2 N;  2VGM A;  4MQ3 A;  3HO1 A;  4DKW A;  2AJQ A;  2RN2 A;  4DR5 K;  2QKB A;  1GOC A;  1CZB A;  3MWT A;  3M3Z A;  3I8B A;  3CD6 N;  1X9S A;  5A2Q O;  4E19 A;  5C2D A;  3TU5 A;  2Q0U A;  3CG7 A;  3CCL N;  3NF6 A;  4J8F A;  4PKG A;  1P8Z A;  3LPT A;  4FLU A;  4GV6 A;  2GWJ A;  1KVC A;  4BY9 C;  3KK2 A;  4DSI A;  3FZK A;  4W5R A;  3KK3 A;  2KFZ A;  1IG8 A;  4CJK A;  1R59 O;  1UA1 A;  3H45 C;  1CXQ A;  1E4G T;  4DFK A;  2IOC A;  5AQZ A;  3EN9 A;  1WBB A;  3HXM A;  5M1N A;  1C0T A;  3M8R A;  1VSD A;  3THY B;  2I7N A;  3TAM A;  4KBO A;  4IOC L;  4CBU A;  5KPZ A;  3J7Y P;  1WSI A;  2O8D A;  3QLH A;  3KKS A;  5HRP A;  4X64 K;  1S1X A;  3G10 A;  4YOU A;  4J2A A;  3CJB A;  1Z26 A;  2PAV A;  4K25 A;  3ULE B;  3SBT A;  4M3T A;  4RW9 A;  2UXD K;  5E41 A;  3Q7C A;  3CPW M;  3LDL A;  5BR8 K;  4AF1 A;  2EWS A;  3UKU A;  1TUU A;  4M45 A;  3QEX A;  4BR2 A;  5AQK A;  1W97 L;  1WLJ A;  3J7Z O;  3L4I A;  4W5O A;  4X62 K;  4CHQ A;  2NUB A;  4N56 A;  4M3W A;  3DXK B;  3KWG A;  3D0P A;  4ELU A;  2G8W A;  1WNS A;  3NVM A;  3HL8 A;  4O44 A;  3ZT1 A;  3V9X A;  4NXN K;  4PUO A;  5FRO A;  4FJX A;  4GVE A;  2W41 A;  4CF0 A;  3VPZ A;  1WBD A;  3O4Q A;  3CF5 L;  3K0S A;  3IFR A;  4JI5 K;  1U2V A;  2QM1 A;  2YHW A;  3U9Z A;  2GUP A;  1JCG A;  2GV9 A;  2KZZ A;  3H3O B;  3QIP A;  3W3D A;  2X6S A;  1M90 O;  3THX A;  3RR7 A;  3PX0 A;  4K41 A;  2HVI A;  3HZ6 A;  4JNE A;  3OYD A;  4JK8 A;  3LP3 A;  1XMO K;  3QBW A;  2P5G A;  4W5Q A;  4KKO A;  4JI0 K;  3N4Q A;  4CI6 A;  1WAF A;  4YOX A;  3C6T A;  3SUQ A;  4Z4C A;  5J1E A;  4E3S A;  1E4F T;  4KHW A;  3TSQ A;  3WNF A;  3NCI A;  2YX6 A;  3LP1 A;  3RMD A;  3AA4 A;  3H1V X;  2P9P A;  2BUP A;  3M1F A;  3IG1 A;  2WFB A;  4L8R B;  1RDA A;  1WOQ A;  4HTU A;  4FWL A;  3GBT A;  2OTJ N;  1QHA A;  4CFC A;  4KHU A;  3LZI A;  3WEE B;  1CZA N;  3TAN A;  2QWP A;  4ILG B;  3MX5 A;  1NLV A;  2HBM A;  1SZ2 A;  3WT0 A;  1LW2 A;  3UKU B;  3OYJ A;  3PO5 A;  1S6Q A;  3HYF A;  1FW6 A;  2PBD A;  4PKH A;  1XNR K;  4NCG A;  4QAG A;  2DFH A;  2VCP A;  3IKM A;  4FZY A;  4FLX A;  4CIF A;  1NK0 A;  4NO7 A;  4OO1 J;  1GLB G;  4JKG B;  3TAG A;  1J53 A;  5GAE P;  2YKN A;  1YJN N;  3QIC A;  4RG8 A;  3MXM A;  1C0F A;  4EZ6 A;  1MU2 A;  2A42 A;  4OKK A;  1IBM K;  5EY4 A;  4FM0 A;  2HHQ A;  1Q81 O;  1DT9 A;  3MEG A;  3SAG A;  1IV0 A;  4AHU A;  1WSE A;  1TV6 A;  1IBL K;  4B1W B;  1BO5 O;  3H46 O;  4K8Z A;  1IKV A;  4JLH A;  3SQ2 A;  1QSL A;  2YI1 A;  4G9Z A;  4C8N A;  5J2P A;  3CCJ N;  4A57 A;  3DLE A;  3F2K A;  3D6R A;  3LP0 A;  3SK3 A;  1MA9 B;  4FWS A;  3WQU A;  2A6A A;  3O4N A;  4JKF A;  4E7L A;  2RF2 A;  3M8Q A;  1J9A A;  2IAJ A;  4BR5 A;  2Q31 A;  4HCC A;  4KPY A;  2W6K A;  3F9K A;  2O4I A;  2OPS A;  3U4L A;  4BR7 A;  3SV4 A;  3A2F A;  3VET A;  2NRH A;  4BRN A;  4H4O A;  4OLB A;  1S22 A;  3MN7 A;  4JAX A;  3HPH A;  1U4B A;  3CCU N;  4EFH A;  5LY3 A;  4CEE A;  3DJC A;  5M1F A;  4H0O A;  3NF9 A;  3ATV A;  3OYH A;  5AQR A;  1NJY A;  4A2B A;  1HKG A;  5HRR A;  3HP6 A;  1O1W A;  3SAH A;  5HOO A;  1X3N A;  4CJT A;  3UKR A;  3AV9 A;  2CGL A;  4KI6 A;  4FZX C;  4AIL C;  1L3S A;  3L2Q A;  2HW3 A;  2D0B A;  4CHY A;  4AHT A;  4DV7 K;  4DQP A;  4CF8 A;  4OPK A;  1IKY A;  5ELZ A;  4F2S A;  2ETJ A;  3WNG A;  1RTJ A;  3E9O A;  3AO4 A;  3PSI A;  1W2B M;  3DXM B;  4YOR A;  5AFU A;  4JI2 K;  4BQL A;  3SJH A;  5E26 A;  2VYP A;  3FR0 A;  3MN5 A;  1T05 A;  1IJJ A;  3WXM B;  1HUX A;  3PV8 A;  3RRG A;  4IWV A;  4PL7 A;  2VGN A;  4CGG A;  3ULD A;  4K0K K;  1NNE A;  4JI6 K;  4M3X A;  3SNN A;  2DY4 A;  3T1H K;  3VQ5 A;  4B9U A;  4DR3 K;  3BF3 A;  2GTD A;  5T7B A;  3QB0 A;  3HPG A;  5AQN A;  4BRH A;  5BPN A;  4O5F A;  1TYQ A;  3GDQ A;  4DUY K;  1KRP A;  5HLF A;  4DTO A;  1RGI A;  4FWN A;  3WUH A;  3BP8 A;  4DB3 A;  2BTF A;  1NMD A;  1NGI A;  2W40 A;  5I42 A;  1GLF O;  4JI7 K;  4H5N A;  3EE9 A;  1C1A A;  1JLF A;  3ITH A;  4FK2 A;  4OGE A;  4BRF A;  1RBT A;  2QI2 A;  4L3Q A;  2F4V K;  1QE1 A;  4BAC A;  3ZT4 A;  2OTL N;  3EE8 A;  4IDK A;  1QZ6 A;  4B3O A;  1LAW A;  1QVF M;  1O13 A;  5JLF A;  3ZSV A;  1WB9 A;  5AQW A;  3W0L A;  3OYG A;  4FXD A;  1QQN A;  2E6L A;  1JCF A;  2F9T A;  4A61 A;  2Y1I A;  3WEE A;  1I94 K;  4I9Q A;  2Q36 A;  1MWM A;  2Q3S A;  3KLH A;  1IO2 A;  1JLA A;  3C94 A;  3U3G A;  4DV3 K;  3VQ9 A;  3I0S A;  3P4I A;  3MEC A;  5AQX A;  2O8E B;  1DLO A;  3IDH A;  4WQ5 A;  3KLG A;  1U47 A;  4MO4 A;  4IOA L;  4BWM A;  4RWT A;  2D1K A;  3SAF A;  4JRP A;  3G6E N;  3ISN C;  4FM1 A;  2DTU A;  3TAR A;  4M42 A;  4O0I A;  1QHT A;  3THV A;  3AA2 A;  1FK9 A;  1TUY A;  3AVF A;  3SV3 A;  5ADX A;  4FJN A;  1NG9 A;  3VEN A;  5AR0 A;  3BF1 A;  3PSF A;  5BR9 A;  3I56 N;  1RBR A;  3C0B A;  5H1S Q;  4OKE A;  5C24 A;  5JMV A;  4H0T B;  1NGD A;  3CPE A;  1HNZ K;  5TKW A;  2QKK A;  1BWF O;  4CJL A;  2XY6 A;  3K9J A;  4WFA L;  4CBX A;  1WSJ A;  5M1O A;  3ZEU B;  1HPZ A;  3ZSR A;  4JKH A;  3ZET A;  1VSJ A;  3HOT A;  4HUG A;  2X78 A;  3DAW A;  3CFP A;  1EO1 A;  5M1K A;  4CJR A;  3LWL A;  4E1M A;  5J2N A;  4BC5 A;  3OYA A;  3DLR A;  3O3G A;  4E7H A;  1HQE A;  2OA8 A;  1RTD A;  2CGK A;  4B9V A;  3ZEU A;  4J2D A;  4E0D A;  1SV5 A;  2P9N B;  5ADX H;  4XH4 A;  1P90 A;  4FZZ A;  3LL3 A;  4CK1 A;  1KXP A;  2O4G A;  1GLE G;  3O9Q A;  3QBX A;  2ATQ A;  4WQ4 A;  4A59 A;  1RBV A;  2D5R A;  2GWK A;  3CXC M;  4B8C A;  2ZQB A;  3LZJ A;  1YUW A;  1SS6 A;  1HQU A;  3RRH A;  1WN7 A;  1ASW A;  3AVN A;  5AQG A;  3V4I A;  3SYZ A;  1RFQ A;  1JLC A;  2EX3 A;  1JLG A;  3EZ5 A;  3NAE A;  4FJ5 A;  4DTP A;  4MLH A;  3A5M C;  3I33 A;  3I8D A;  3CJ1 A;  4BRK A;  1NGG A;  4GVM A;  4BVO A;  4LY7 A;  3TSU A;  4GY2 B;  2KHO A;  4CZK A;  3VA0 A;  3MCP A;  4JHD B;  4WYB A;  2QWL A;  1JLE A;  2HHU A;  3O9U A;  5AZI A;  3S3N A;  2VG5 A;  4YOW A;  5E84 A;  4KTZ A;  3SJJ A;  3TSP A;  1TVR A;  2HF4 A;  5C42 A;  2HHS A;  1S9E A;  5HBM A;  3P83 D;  4HUE A;  4B08 A;  3U8X A;  4CGD A;  1GOB A;  4DTS A;  3IS9 A;  5AJ3 K;  2QWQ A;  3AO2 A;  1GLJ O;  4JKE A;  4CCH A;  1E3M A;  4EHU A;  4GKJ K;  3WNE A;  5BPL A;  1LWC A;  3L6Q A;  4WE1 A;  1NK8 A;  2NRX A;  3PX4 A;  4HWI A;  3QNO A;  1B9F A;  1L3T A;  5CZ1 A;  4CJQ A;  2HHH K;  4QS7 A;  2Y1J A;  3LWM A;  1C0M A;  3L4Q A;  3DLG A;  4M63 C;  3VGK A;  2FF6 A;  2NRV A;  1BCO A;  1XHZ A;  2Q0R A;  4NLC A;  1QQC A;  2XY8 A;  1HX1 A;  1Q86 O;  1LWF A;  3PIO L;  3J7A P;  3OS2 A;  4M3U A;  3SUP A;  2ZGZ A;  3D2E B;  2ITM A;  1FKO A;  4WQ4 C;  4DLG A;  3THX B;  1V4T A;  1NWK A;  4H8K A;  3OJU A;  3ZSZ A;  1VQO N;  4W5N A;  3IMX A;  3U9D A;  2I7P A;  4JYA K;  4B9N A;  3S3O A;  1HPM A;  4BG9 A;  4CJ4 A;  1KAX A;  4CEQ A;  3M5R A;  3OYC A;  1LCU A;  3HOS A;  1TL3 A;  4AHR A;  4F8R A;  4KB0 A;  1YTU A;  5BRF A;  2KZM A;  2O8F B;  3BZK A;  2JLE A;  1SL2 A;  4QS9 A;  2YHB A;  1QVG M;  1C1B A;  2IVP A;  1QTM A;  3CFR A;  2CH5 A;  5HRO A;  4CEC A;  2YNI A;  4BR0 A;  2P9S B;  2HNY A;  4DU3 A;  2X74 A;  2HMI A;  1S72 N;  4O8U A;  3D2E A;  1NKB A;  1VSH A;  1Z6R A;  4KH6 A;  5C12 A;  1F21 A;  1T6C A;  1RDC A;  5AQT A;  4LH5 A;  1SL1 A;  4HUF A;  2XY7 A;  1C0G A;  4BRQ A;  4BDY A;  2P9K A;  1CXU A;  4IFY A;  1I3A A;  3OYB A;  4BC2 A;  2IIR A;  1D5A A;  5JS2 A;  4WFN L;  4N47 A;  4XH1 A;  5SWM A;  2GUI A;  5DMR A;  1EWR A;  3OBY A;  2QXF A;  5SZT A;  4PQU A;  5LJW A;  2DFE A;  2YHY A;  3OYM A;  1ZYQ A;  2J4R A;  3AO1 A;  3J80 O;  5FRN A;  1D8Y A;  4LF8 K;  3AGR A;  4C8L A;  3EEQ A;  4B3T K;  5DM6 L;  4CD3 A;  4O5B A;  5BN9 A;  3CM5 A;  3WQT A;  4U67 L;  3DOL A;  2G8H A;  3F73 A;  1ASU A;  4TSX A;  2F7T A;  1NMN A;  4JKB A;  3L2R A;  2BAN A;  1NOY A;  3VMF B;  3QEV A;  4KHP K;  2HHT A;  4DTR A;  4CED A;  1U6Z A;  4FJ7 A;  3UKR B;  3CQY A;  3VEZ A;  3NBP A;  1N6Q A;  4Y1C A;  3Q7B A;  2X6N A;  3B8A X;  4F3O A;  3ZET B;  3MDQ A;  1VHX A;  3MN6 A;  3THW A;  4H0V B;  3ZSY A;  2FBT A;  2WBN A;  3L3V A;  2QEX N;  5D3G A;  4CHN A;  2UUB K;  4OX9 K;  3KHY A;  2VWB A;  2V51 B;  4ILJ A;  4FSV A;  2QK9 A;  3GL1 A;  5GIN A;  4FVM A;  4CEA A;  1GLL O;  4CJ3 A;  1B9D A;  4IG0 A;  2DPN A;  2OPR A;  3T7Z A;  3VEY A;  3P39 A;  1VQ6 N;  1EXQ A;  2OZM A;  1QQM A;  2VQF K;  3KLF A;  3CJA A;  4BWJ A;  1RT7 A;  3K2P A;  3CJ9 A;  3TAE A;  3C6A A;  3K5O A;  3L2V A;  5KPT A;  1ATN A;  4ZTF A;  5BN8 A;  1NGA A;  2ZF5 O;  5KGW A;  4YNQ A;  4I7F A;  4JK9 A;  2VG6 A;  1RDW X;  4DQQ A;  4KTQ A;  2E1Z A;  4ISF A;  3H3N O;  1YHQ N;  1OH6 A;  1KVB A;  1TK5 A;  3CYM A;  2XO7 A;  3NH2 A;  1U49 A;  3WXK A;  2WTU A;  3ZYY X;  3DLL L;  1XUP O;  3O9T A;  4OJR A;  4BDZ A;  3CIP A;  1HYS A;  3I0R A;  3QIN A;  3FE1 A;  1JLQ A;  3J81 O;  2JWK A;  3FZF A;  4DQS A;  3RMA A;  1BI4 B;  4BC4 A;  3ENO A;  4M41 A;  1NJX A;  1HYV A;  1BIS A;  1U2V B;  3E1Y A;  1HKC A;  4ELV A;  2CH6 A;  2VG7 A;  3QES A;  2WOM A;  3OS1 A;  2E4L A;  2YJF A;  2OCE A;  4O4G A;  3HP9 A;  3P38 A;  2GBZ A;  4O55 A;  1J54 A;  2QWN A;  4NYF A;  5AZJ B;  1BA0 A;  3TAF A;  1NGF A;  4FPA A;  1UA0 A;  4HTL A;  5JVH L;  3CI5 A;  4FWR A;  3P5J A;  4FW1 A;  4FCY A;  3TR8 A;  4BQZ A;  4NCA A;  4ISE A;  1K8K B;  3HTV A;  4CJ7 A;  4WF9 L;  3VA3 A;  4DS4 A;  2A3Z A;  4BRG A;  1IKX A;  5KTQ A;  2NZT A;  1NU0 A;  4ICL A;  1KTQ A;  4CIE A;  1C1C A;  2F96 A;  2FSK A;  4M3Z A;  1S6P A;  1YVN A;  1Q9X A;  1V4S A;  4NXM K;  3B6O A;  4Y1D A;  4DU4 A;  1DGK N;  2O8D B;  2Z1I A;  3MEE A;  1KLN A;  4DHY A;  3LAM A;  3CER A;  4I6M B;  3ZSX A;  1TKD A;  2G8K A;  1X3M A;  4FWM A;  4LF4 K;  5MLC Q;  2HND A;  1HNW K;  4QCL A;  3OS0 A;  4CFD A;  3NF8 A;  1KAZ A;  3IAY A;  3QFP A;  3NH1 A;  3OYI A;  5CR4 A;  2P9P B;  4C1N I;  4DR1 K;  2DFF A;  3RSE B;  4O8K A;  1TK8 A;  1EWQ A;  1BIZ A;  2Q1N A;  2NNW A;  5AQL A;  4PY5 A;  1Q7Y O;  1K6Y A;  4FWP A;  4XH5 A;  2P9N A;  3C6H A;  3QFU A;  2FBX A;  4LF9 K;  3HSC A;  4IFE A;  4DFM A;  4RW6 A;  3ZX0 A;  4CVN E;  4IO9 L;  3SMS A;  4KH5 A;  4OKJ A;  3CCQ N;  2NRW A;  3MAQ A;  4BRC A;  2VWK A;  2P1J A;  3ZT3 A;  3JYT A;  1YTA A;  4B1U B;  4GV3 A;  2P9U A;  4FL9 A;  3WNH A;  2P9I B;  4B3M K;  1GLC G;  3MXJ A;  3IRX A;  2NLX A;  3EL2 A;  3EZW A;  1NK7 A;  4DF4 A;  1N32 K;  2YCH A;  4OPA A;  3VF6 A;  4GMJ B;  2QXL A;  4BRL A;  4FJL A;  1XI1 A;  1ASV A;  2QWM A;  4F2R A;  2E20 A;  1U04 A;  2NRT A;  2IS3 A;  3L0Q A;  1CLQ A;  3O9S A;  5LJV A;  3AVG A;  1L5U A;  4JHD A;  3AVM A;  3HPO A;  2E88 A;  5IT9 O;  3NFA A;  4H03 B;  1NJW A;  1VSM A;  2O8C A;  4YY3 K;  5HRN A;  5C0Y A;  1A5X A;  4DV1 K;  5FPN A;  3DOK A;  3LAL A;  3AVH A;  4B8A B;  2A1S A;  4FYD A;  4V19 S;  5C25 A;  4WFB L;  5FDL A;  5I9E B;  3V1Q A;  5I3U A;  1RT1 A;  4CGJ A;  1X1P A;  5HP1 A;  1MDU B;  1RT4 A;  3MN9 A;  3O1B A;  4CIG A;  1NBW A;  2RHK A;  3AGK A;  2HHV A;  4A62 A;  4EAH D;  4B9S A;  1Y64 A;  4DCH A;  4JKA A;  4J2B A;  4LSN A;  2G8U A;  2ZJQ L;  1GLD G;  2YNH A;  3KWI A;  3OHR A;  4BRM A;  4R79 A;  4CER A;  2YNF A;  1H1V A;  1HJR A;  2ZGY A;  3BEX A;  3DYA A;  4CD1 A;  4XIU A;  3NHG A;  2O8B B;  5BRD A;  4EIA A;  1NJZ A;  3J8A A;  3V6D A;  4KHN A;  4CJF A;  3H08 A;  2OPQ A;  1NGH A;  5AQH A;  4CF2 A;  3A5N C;  1OVQ A;  2HNZ A;  4Z4E A;  5GAG P;  4MLE A;  4CJU A;  4K42 A;  1RBU A;  5AQI A;  2YJE A;  3SCX A;  5GIO A;  3RSE A;  3CM6 A;  1NK5 A;  1ZC6 A;  4DMN A;  4BVP A;  4CZF A;  3CHW A;  1VSF A;  4KHQ A;  5EX5 A;  4FO0 A;  3K5L A;  2VQE K;  3CCS N;  3PY8 A;  1ILY A;  4ILH A;  1WSH A;  2JWL A;  4FLT A;  1RIL A;  1REV A;  4PWD A;  1NK4 A;  1XWL A;  4OLA A;  3JS6 A;  1NOZ A;  5F2R A;  4RW8 A;  4YOY A;  4FJM A;  1M1K O;  4JI8 K;  3HBT A;  4X66 K;  3LP2 A;  2HHW A;  2IDO A;  3HST B;  3AVJ A;  4BDP A;  3A5O C;  3KK7 A;  4BC3 A;  5M1P A;  1NGC A;  1W0H A;  2RE2 A;  1K73 O;  4CGH A;  4B9M A;  1ZBS A;  3V9W A;  2O8F A;  4QOZ B;  1VQ7 N;  4KO0 A;  4AM6 A;  2ZM6 K;  2P9L B;  1JJ2 M;  3GOI A;  4DTM A;  5AQY A;  3T3F A;  1EX4 A;  2KQ2 A;  3V81 A;  2LSN A;  3OJS A;  4LFA K;  5KPR A;  1RBS A;  3LPU A;  3VQE A;  3SZ2 A;  4N76 A;  4FJ9 A;  3DLH A;  3NMU A;  4DSF A;  3DMJ A;  4FJH A;  4FJI A;  4H5W A;  2HVH A;  1TL1 A;  1YAG A;  1HNV A;  4DSE A;  1HNX K;  4LF6 K;  4JRQ A;  4DV0 K;  3S41 A;  4MFB A;  4IBN A;  4BE1 A;  4DFJ A;  3HT3 A;  3E9L A;  1EQY A;  4EP5 A;  3C95 A;  1S3X A;  3FFI A;  1K8K A;  3AVC A;  3QEW A;  1YIJ N;  1T03 A;  3AO5 A;  2KTQ A;  3ALY A;  2D0O A;  4CZG A;  3V9S A;  1SKR A;  3BDP A;  5KRS A;  1VAZ A;  1SAZ A;  3K57 A;  2E2N A;  3FZL A;  2V7Z A;  1BGX T;  4CFA A;  3KK1 A;  3RWU A;  4AHV A;  1Q82 O;  1YI2 N;  3VGM A;  3KD1 E;  4Z0U A;  4DTX A;  4IEE A;  1SKS A;  5JIC A;  4FWO A;  3U3Y A;  2PYJ A;  3P31 A;  3NDK A;  4CW7 B;  4Z4G A;  3OY9 A;  2D4W A;  4DR4 K;  3AO3 A;  2PFU A;  3MWP A;  3QER A;  3RMB A;  2P9L A;  4FLY A;  5DM7 L;  1JXE A;  4JI3 K;  4CEF A;  3BGR A;  3SQ1 A;  3OTO K;  5FPM A;  4Z4I A;  4CZJ A;  1KFD A;  1YJW N;  1N33 K;  1Z25 A;  3D7E O;  4MDB A;  3RMC A;  1Q9Y A;  1VRT A;  3KIO A;  1U45 A;  4FJJ A;  2YKM A;  3SUO A;  2XY5 A;  1TKZ A;  3RVC A;  3FFK B;  3OW2 M;  4KRE A;  4FJG A;  3H6E A;  3LDQ A;  4Q0B A;  2A5X A;  1L3U A;  1XQS C;  2PY5 A;  4E89 A;  3VEW A;  3K5N A;  3SPZ A;  4Z4F A;  1HNI A;  2E6M A;  3KVG A;  1I39 A;  1LAV A;  4FPB A;  1OH5 A;  5CE3 A;  4IKF A;  4PKI A;  3ZSQ A;  3U6F A;  3TTC A;  2FSJ A;  1D4X A;  3R8E A;  1QS4 A;  4YFU A;  3NF7 A;  2R7Y A;  3AVK A;  2UXB K;  4FJK A;  3C7N A;  3OYN A;  1OH8 A;  1Q18 A;  2RKI A;  5KGX A;  2IVN A;  5FPD A;  4GKK K;  4F9O A;  2JGU A;  4CEO A;  2BGG A;  3F5T A;  3TTF A;  4AHS A;  1VQL N;  2G8V A;  1UWB A;  4B1X B;  3PX6 A;  4YOV A;  1S1T A;  4JS4 A;  4W5T A;  1DTT A;  4DQ8 A;  1KSP A;  5AQS A;  3D2F A;  3AY9 A;  3D45 A;  3E9P A;  2D0A A;  4CJV A;  3CQ8 A;  4AQY K;  2BE2 A;  3QML A;  2KW4 A;  1SL0 A;  4I6M A;  4FK0 A;  3ZSO A;  3HVR A;  1DTQ A;  4MDA A;  2A1R A;  1NKE A;  2F8S A;  3WXL A;  1EP4 A;  3JAM O;  1N34 K;  5AQJ A;  5K14 A;  3MMV A;  3DRS A;  2E2Q A;  1RT5 A;  3DLB A;  2GEL A;  3KKR A;  3VN5 A;  2EHG A;  4DG1 A;  3S3M A;  3SPY A;  3HVT A;  4BG8 A;  4DR2 K;  3OYL A;  1BCM A;  1VSL A;  3L2W A;  1DKG D;  2QW9 A;  3VEV A;  3LDN A;  4KFB A;  3OA9 A;  4FK4 A;  1S1U A;  3TAB A;  1T7P A;  2WON A;  3ZCM A;  4GV9 A;  5KQ8 A;  1ZBU A;  4B1V A;  1ATR A;  3PLA A;  3WXI A;  1VSK A;  3DWL A;  3CJ7 A;  3L8B A;  1MWK A;  4DTN A;  1WSG A;  2E8A A;  4XEI A;  1J6Z A;  4X65 K;  3C6U A;  4FOE A;  1VQP N;  3CJC A;  1Z05 A;  2W42 A;  3LAK A;  4H5V A;  4DTU A;  3ZSW A;  1CZ9 A;  1KAY A;  4IZ9 A;  3KLE A;  2HB5 A;  4B3S K;  1GOA A;  1D9F A;  4M7X A;  4KRF A;  1QSS A;  2QWR A;  4M7Y A;  3VES A;  4PL8 A;  1S9G A;  1TAQ A;  4CK3 A;  5F0X A;  4FLW A;  4DV5 K;  4DSK A;  4I2P A;  4ID1 A;  3CME N;  3HM8 A;  3VQQ A;  3VQ4 A;  3L3U A;  1T44 A;  1HRH A;  3JSM A;  4B9L A;  3UIQ A;  4DTJ A;  3DXM A;  3CC7 N;  3JXU A;  3AAR A;  1SKW A;  1L3V A;  5LL6 Z;  4BE2 A;  3OYE A;  5C2F A;  3CQX A;  3O3F A;  1QQO A;  3LM2 A;  4JI1 K;  4JV5 K;  4B9Q A;  4JKC A;  3O6W A;  1NM1 A;  3FZH A;  4CF9 A;  1ZBI A;  1K9M O;  2E1Y A;  4JKG A;  5BRH A;  1BQN A;  3SBG A;  4JS5 A;  1BG3 A;  1RTH A;  2BDP A;  1D9D A;  2W6L A;  4DUZ K;  4C8O A;  1DEJ A;  2Z1J A;  1SUQ A;  5GIP A;  1VQ8 N;  2NRR A;  5JLH A;  3VQP A;  3VQ8 A;  4I2Q A;  1GLA G;  1RCH A;  4BRO A;  4GW6 A;  1UOC A;  3F9M A;  1TKT A;  3TPQ A;  4KHY A;  1YXQ A;  1XC9 A;  4C23 A;  3NGY A;  3HM9 A;  5AQP A;  5LMU K;  3EKS A;  3DLK A;  3SQ0 A;  1N36 K;  2O8B A;  4DFP A;  2QTD A;  4DF8 A;  1BA1 A;  4DV4 K;  3QEI A;  4JKD A;  2IVO A;  2ITG A;  2HST A;  5FRM A;  2Q2R A;  4H4M A;  3CC4 N;  2ASM A;  1G15 A;  2ASO A;  2YHX A;  5KRT A;  4M3Y A;  1BIU A;  4FWQ A;  4RW7 A;  3EKU A;  1TK0 A;  1EKE A;  1HKB A;  1VQ4 N;  2HMP A;  2IC3 A;  1KLM A;  1KVA A;  2OPP A;  1WAJ A;  1KFS A;  3K58 A;  1B92 A;  4WCE L;  1JCE A;  3AVL A;  1OVY A;  3QO9 A;  2RPI A;  4DQR A;  3O9R A;  2HHX A;  2O8C B;  3CCE N;  4EHT A;  3ZT2 A;  4GNI A;  5FLX O;  1XNQ K;  1KC8 O;  4PHT X;  1ITG A;  1OH7 A;  4BRI A;  4C8M A;  4LC9 B;  3HRG A;  2HBK A;  4DR6 K;  4OPH A;  4Q5V A;  4B1Y B;  4BR9 A;  1VRU A;  4H5T A;  5J2M A;  1VQM N;  1KCF A;  3FLC O;  3SI6 A;  3AA5 X;  3ZX2 A;  3KD5 E;  3O5B A;  1BQM A;  3EY1 A;  4YHH K;  4NYN A;  2ZD1 A;  1X9W A;  2ZJR L;  1BU6 O;  2V7Y A;  5DK5 A;  2AP1 A;  3N4P A;  4CJS A;  3VTH A;  3UB5 A;  1JL2 A;  1VQN N;  1YT3 A;  3FZM A;  5KQD A;  4E7K A;  3FGU A;  4ID5 A;  3AA3 A;  3GE1 A;  3VQB A;  4BGA A;  1JXB A;  4ELT A;  1NGJ A;  3BUZ B;  5GAD P;  1SQK A;  3ASM A;  5EXW A;  4IJN A;  1RT2 A;  2P9I A;  3V9Z A;  3ZLJ A;  3OBW A;  5M1Q A;  4K8X A;  2XRI A;  3P1G A;  1YJ9 N;  1J5E K;  3DXK A;  3LDP A;  3T19 A;  3CCR N;  2P9S A;  4I9L A;  4N5S A;  3QET A;  2FBY A;  3SLC A;  3ENH A;  3AVI A;  2OYQ A;  3TAP A;  3VGL A;  3O8M A;  4FVU A;  4DV6 K;  3NH0 A;  3C7N B;  4CGF A;  4EP4 A;  1NJI O;  2G8I A;  3VF2 A;  2QA4 N;  1HYZ A;  5AQV A;  3R3L A;  4OPJ A;  1Y97 A;  1YVU A;  4E7I A;  1S1V A;  1RDD A;  2YV0 X;  2WUS A;  4JK7 A;  1HR0 K;  2ZE2 A;  5CY4 A;  4YOT A;  3B6P A;  4FWK A;  1VSI A;  1VSE A;  1Q8I A;  1TKX A;  3A0I X;  4CJ5 A;  4JEP A;  4A2A A;  1ESV A;  4CZI A;  4DV2 K;  3NGZ A;  4FW2 A;  3KTQ A;  1WSF A;  1RTI A;  2UYT A;  4ISG A;  2AA4 A;  2B4J A;  4NCB A;  2P9K B;  3NGI A;  5BPM A;  1ZBL A;  3H1Q A;  3KLI A;  3V9U A;  1G99 A;  2Q97 A;  1BOT O;  1JLB A;  3VQ6 A;  3LDS A;  3O1W A;  1XC3 A;  5AQO A;  2YNG A;  5AQQ A;  2OAN A;  4M3R A;  4LH4 A;  1QZ5 A;  1RDB A;  1X9M A;  3HK2 A;  1RT3 A;  3T1Y K;  1X9J A;  3MXI A;  4IDH A;  5JVG L;  3VQD A;  4CEZ A;  4CZH A;  1HLU A;  3ULE A;  4KB1 A;  3PIP L;  5CHI A;  2HOE A;  4LFC K;  4LSL A;  2CGJ A;  4YDU C;  2F8T A;  5AZJ A;  2QWO A;  3ZT0 A;  3OYF A;  1ZBF A;  3SMP A;  4AHC A;  4AH9 A;  1VQK N;  4KHS A;  2V52 B;  2OZS A;  4JN4 A;  3RR8 A;  4QS8 A;  4HHT A;  4NLB A;  4LD0 A;  1WUA A;  3ID8 A;  3AVA A;  3L2U A;  3TAQ A;  3WXJ A;  3VF4 A;  1T6D A;  5BRE A;  4DS5 A;  4H0Y B;  4CHZ A;  1VQ5 N;  1UAX A;  2WC9 A;  1RT6 A;  3O80 A;  4IOX A;  4BGB A;  3G25 A;  3TI0 A;  4Y0W A;  4BRP A;  3NE6 A;  2VWJ A;  3ENB A;  2KKZ A;  4CHP A;  1T8E A;  4LF5 K;  5HL7 L;  3A8Y A;  1NGE A;  5TKY A;  2KFN A;  1C6V A;  4OVL A;  4NB4 A;  2UU9 K;  4KTW A;  4R5P A;  1YIT N;  3MCA B;  5CZ2 A;  4CBW A;  4F4K A;  1BI4 A;  3T1A A;  5F1X A;  1JL1 A;  4IEI A;  1LW0 A;  4FOI A;  3O3H A;  1ZBH A;  3TWH A;  3KJV A;  1IG9 A;  1RNH A;  2ASP A;  4CJP A;  1XMQ K;  2E2O A;  4DSJ A;  1A5W A;  3M8S A;  3PO4 A;  3HI0 A;  1NGB A;  4UY8 O;  1RDU A;  2UUC K;  2FC0 A;  3MX2 A;  1K8A O;  3BZC A;  2YHA A;  3AAQ A;  2B5J A;  4F3T A;  4CZE A;  3VEX A;  3VQ7 A;  3ZX3 A;  2UUA K;  4CZL A;  3TTD A;  2P5O A;  4CGI A;  3QNN A;  2GX9 A;  3KZB A;  1KQS M;  4B9T A;  4CK2 A;  4ZHR A;  2G8F A;  1S5J A;  3R1X A;  4BRD A;  3VQC A;  3DRP A;  1ATS A;  4LF7 K;  3NVK A;  4B1Z A;  2D0P A;  1R0A A;  1TAU A;  4IXC A;  2O8E A;  5AQF A;  4CF1 A;  2FF3 B;  3LM9 A;  3R6M A;  2B6A A;  1QSY A;  1IKW A;  1A5V A;  3SQ4 A;  4DR7 K;  3MED A;  4DQI A;  3E01 A;  3VQA A;  3THW B;  3QEP A;  4HVJ A;  5AFU H;  2ZJP L;  3UE5 A;  3CCM N;  2P51 A;  4C1N K;  1NKC A;  2XHB A;  1LV5 A;  1TYQ B;  4E1N A;  2I5J A;  1JKH A;  1FKP A;  4MO5 A;  4DU1 A;  3CMA N;  4IO8 A;  4JI4 K;  3VOV A;  4EZ9 A;  4KV8 A;  3M8P A;  3DI6 A;  4BRA A;  5FPE A;  5CYQ A;  4KI4 A;  3V1R A;  3LDO A;  5EVZ A;  1YF5 L;  1HJO A;  2FSN A;  2E5L K;  5IWA K;  3MK6 A;  4FLZ A;  4DLE A;  4YDU A;  1BHL A;  5CYM A;  3LAN A;  1BDG A;  1EET A;  2A41 A;  2PZS A;  1ZXO A;  5HRS A;  1IH7 A;  2FBV A;  3S9H A;  3EYZ A;  4KH4 A;  2P9U B;  1N8R O;  2A40 A;  2BH1 A;  1IBK K;  4DSL A;  2D0C A;  2GEM A;  3OVN A;  3PUF A;  3E66 A;  3ID6 A;  1KD1 O;  4J2E A;  4JD2 B;  3QIO A;  5AQU A;  3K9K A;  2PYL A;  4Z4H A;  5C15 A;  3G4S N;  1VK0 A;  3GG4 A;  2FLO A;  4A5A A;  3VTI A;  3I55 N;  3G71 N;  3SUN A;  4IG3 A;  4BR4 A;  3THY A;  4HCB A;  4G1Q A;  4A5B A;  4JD2 A;  1J5O A;  1NK6 A;  3D2F B;  4CZM A;  4CFB A;  4BE0 A; 
#chains in the Genus database with same CATH homology
 3LAM A;  3O3F A;  3OYK A;  1LWE A;  2IGI A;  3ZSX A;  1DLO A;  4CE9 A;  3RTV A;  1TKD A;  2G8K A;  1U47 A;  3KLG A;  4C8K A;  5JS1 A;  4BWM A;  2HND A;  4QCL A;  4CF9 A;  4JRP A;  4OGC A;  3OS0 A;  1ZBI A;  3ISN C;  4CFD A;  4FM1 A;  1TGO A;  2DTU A;  3TAR A;  4E7J A;  3NF8 A;  3G0Z A;  4JS5 A;  1BQN A;  3IAY A;  4M42 A;  3NH1 A;  3OYI A;  1RTH A;  2BDP A;  1D9D A;  4O0I A;  1QHT A;  3THV A;  3AA2 A;  1FK9 A;  4C8O A;  2DFF A;  3AVF A;  3SV3 A;  4FJN A;  2Z1J A;  1SUQ A;  4KHU A;  5KI6 A;  4UQG A;  3VQP A;  3K59 A;  3VQ8 A;  4I2Q A;  4DWI A;  1RCH A;  1RBR A;  2Z1H A;  4GW6 A;  1UOC A;  5EU7 A;  4OKE A;  4CJW A;  5C24 A;  1TKT A;  1C0U A;  4N41 A;  1BL3 A;  1TK8 A;  4KHY A;  1XC9 A;  1BIZ A;  3NGY A;  2QKK A;  4CJL A;  2XY6 A;  3HM9 A;  4PY5 A;  1K6Y A;  5J2Q A;  1NK9 A;  3K5M A;  3AVB A;  2FBX A;  1HMV A;  4KAZ A;  1WSJ A;  1HPZ A;  3DLK A;  3ZSR A;  4DFM A;  3SQ0 A;  1XHX A;  4O0J A;  4RW6 A;  1VSJ A;  4HUG A;  4FM2 A;  2X78 A;  3CFP A;  4RW4 A;  4DFP A;  4OKJ A;  4CJR A;  1W9H A;  3LWL A;  4E1M A;  3DM2 A;  5J2N A;  4FJ8 A;  3MAQ A;  3OYA A;  4DF8 A;  3DLR A;  3QEI A;  2VWK A;  2P1J A;  3ZT3 A;  2ITG A;  3JYT A;  3O3G A;  4E7H A;  1HQE A;  1YTA A;  1FXX A;  2OA8 A;  4CES A;  4CHO A;  1RTD A;  4H4M A;  5FRM A;  1N5Y A;  4B9V A;  1G15 A;  3WNH A;  4J2D A;  5KRT A;  1SV5 A;  4E0D A;  4M3Y A;  1BIU A;  3HJF A;  4IFV A;  3V1O A;  2Z1G A;  3MXJ A;  4PA1 A;  3IRX A;  4FZZ A;  4RW7 A;  4CK1 A;  2O4G A;  1NK7 A;  1TK0 A;  2ATQ A;  4DF4 A;  1EKE A;  4GMJ B;  1RBV A;  4FJL A;  2D5R A;  2IC3 A;  4CEB A;  1KLM A;  1XI1 A;  1KVA A;  4B8C A;  2OPP A;  2ZQB A;  1WAJ A;  1KFS A;  1ASV A;  3K58 A;  1B92 A;  3DRR A;  3LZJ A;  4ZTJ A;  3AVL A;  3QO9 A;  4F2R A;  1SL0 A;  4FLV A;  2RPI A;  1S1W A;  1U04 A;  1U48 A;  4CJE A;  4DQR A;  2IS3 A;  3CFO A;  1CLQ A;  1HQU A;  3RRH A;  1WN7 A;  3AVG A;  1ASW A;  3AVN A;  2HHX A;  3V4I A;  4MQ3 A;  1L5U A;  3HO1 A;  3SYZ A;  2AJQ A;  2RN2 A;  3AVM A;  3HPO A;  3ZT2 A;  2QKB A;  1GOC A;  1CZB A;  3NFA A;  1ITG A;  1JLC A;  2EX3 A;  1JLG A;  3EZ5 A;  3NAE A;  1X9S A;  1NJW A;  4C8M A;  4FJ5 A;  4E19 A;  1VSM A;  4DTP A;  5HRN A;  1A5X A;  3CG7 A;  3I8D A;  3NF6 A;  4Q5V A;  3LPT A;  4FLU A;  3DOK A;  3LAL A;  3AVH A;  4GVM A;  4B8A B;  2A1S A;  4LY7 A;  1KVC A;  4FYD A;  1VRU A;  5J2M A;  5C25 A;  1KCF A;  3KK2 A;  3VA0 A;  4DSI A;  3SI6 A;  5FDL A;  3V1Q A;  3AA5 X;  5I3U A;  1RT1 A;  1JLE A;  1X1P A;  4CGJ A;  5HP1 A;  3KD5 E;  1RT4 A;  4W5R A;  3KK3 A;  4CIG A;  1BQM A;  2HHU A;  2KFZ A;  3EY1 A;  2HHV A;  4CJK A;  3S3N A;  2VG5 A;  1X9W A;  4NYN A;  2ZD1 A;  4B9S A;  1UA1 A;  4KTZ A;  3SJJ A;  1CXQ A;  4DFK A;  2IOC A;  4J2B A;  1TVR A;  4LSN A;  2G8U A;  5C42 A;  3HXM A;  1KLN A;  5DK5 A;  2HHS A;  2YNH A;  1S9E A;  1C0T A;  5HBM A;  3M8R A;  4CJS A;  1VSD A;  3P83 D;  1JL2 A;  2YNF A;  4CER A;  4HUE A;  4B08 A;  3TAM A;  1YT3 A;  4CGD A;  1HJR A;  1GOB A;  3DYA A;  4XIU A;  3IS9 A;  4E7K A;  4DTS A;  3NHG A;  1WSI A;  3QLH A;  3AO2 A;  3KKS A;  1NJZ A;  3V6D A;  4ID5 A;  4CJF A;  5HRP A;  3H08 A;  4KHN A;  4CCH A;  3AA3 A;  1S1X A;  2OPQ A;  3G10 A;  4J2A A;  4CF2 A;  1Z26 A;  3VQB A;  2HNZ A;  4Z4E A;  1JXB A;  3WNE A;  4ELT A;  1LWC A;  4WE1 A;  1NK8 A;  4CJU A;  3PX4 A;  3ASM A;  4M3T A;  3QNO A;  1RT2 A;  1B9F A;  4RW9 A;  5CZ1 A;  1L3T A;  1RBU A;  4CJQ A;  5E41 A;  3V9Z A;  3SCX A;  2Y1J A;  3LWM A;  1C0M A;  1XHZ A;  3CM6 A;  3DLG A;  1NK5 A;  4M45 A;  1BCO A;  4K8X A;  2XRI A;  3P1G A;  4DMN A;  3QEX A;  1QQC A;  2XY8 A;  1VSF A;  1WLJ A;  4KHQ A;  1LWF A;  3T19 A;  4I9L A;  4N5S A;  4W5O A;  3K5L A;  4CHQ A;  3QET A;  2FBY A;  2NUB A;  3OS2 A;  4M3U A;  3PY8 A;  4N56 A;  3SUP A;  4M3W A;  3AVI A;  3D0P A;  2OYQ A;  3TAP A;  1WSH A;  4ELU A;  4FLT A;  1RIL A;  1REV A;  2G8W A;  1NK4 A;  4PWD A;  1WNS A;  1XWL A;  3HL8 A;  1FKO A;  4O44 A;  3ZT1 A;  1NOZ A;  3NH0 A;  4RW8 A;  4DLG A;  3V9X A;  4FJM A;  4PUO A;  5FRO A;  4H8K A;  4FJX A;  4CGF A;  4EP4 A;  2G8I A;  3LP2 A;  4CF0 A;  3ZSZ A;  3OJU A;  2IDO A;  3O4Q A;  2HHW A;  3HST B;  3AVJ A;  4W5N A;  1HYZ A;  4BDP A;  4OPJ A;  1Y97 A;  1YVU A;  1W0H A;  4E7I A;  4B9N A;  1S1V A;  1RDD A;  3S3O A;  4CGH A;  4B9M A;  3V9W A;  2YV0 X;  4CJ4 A;  2GV9 A;  4CEQ A;  4QOZ B;  2KZZ A;  4KO0 A;  3QIP A;  2ZE2 A;  3OYC A;  5CY4 A;  2X6S A;  1TL3 A;  4AHR A;  4F8R A;  4KB0 A;  1YTU A;  4DTM A;  3T3F A;  1EX4 A;  2KQ2 A;  3B6P A;  3V81 A;  1VSI A;  2LSN A;  3OJS A;  3RR7 A;  2KZM A;  3PX0 A;  1RBS A;  2JLE A;  1VSE A;  1SL2 A;  2HVI A;  3LPU A;  2YHB A;  1Q8I A;  1TKX A;  3VQE A;  3SZ2 A;  4N76 A;  4FJ9 A;  3OYD A;  1C1B A;  3LP3 A;  4CJ5 A;  3DLH A;  1QTM A;  3CFR A;  5HRO A;  4DSF A;  2P5G A;  3DMJ A;  4W5Q A;  4KKO A;  4FJH A;  4CEC A;  4FJI A;  2YNI A;  1WAF A;  1TL1 A;  1HNV A;  2HVH A;  3KTQ A;  3NGZ A;  4FW2 A;  1WSF A;  1RTI A;  3C6T A;  2HNY A;  4DU3 A;  2X74 A;  3SUQ A;  4DSE A;  4JRQ A;  4Z4C A;  5J1E A;  4E3S A;  2HMI A;  2B4J A;  4IBN A;  4MFB A;  3VQ9 A;  4BE1 A;  4DFJ A;  3HT3 A;  4NCB A;  4KHW A;  4EP5 A;  3WNF A;  3NGI A;  3C95 A;  3NCI A;  1ZBL A;  1NKB A;  3KLI A;  1VSH A;  3V9U A;  3FFI A;  3LP1 A;  1F21 A;  3RMD A;  3AVC A;  1RDC A;  3QEW A;  3AA4 A;  4LH5 A;  1JLB A;  3AO5 A;  1T03 A;  2KTQ A;  3ALY A;  3VQ6 A;  3LDS A;  1SL1 A;  4HUF A;  2XY7 A;  3V9S A;  1SKR A;  3IG1 A;  4L8R B;  3BDP A;  1RDA A;  2YNG A;  5KRS A;  4HTU A;  4BDY A;  4M3R A;  3K57 A;  4LH4 A;  1RDB A;  4CFC A;  1CXU A;  1BGX T;  4IFY A;  4CFA A;  3KK1 A;  4AHV A;  1X9M A;  3LZI A;  1I3A A;  3OYB A;  3RWU A;  1RT3 A;  3HK2 A;  3TAN A;  3KD1 E;  1D5A A;  4Z0U A;  3MXI A;  5JS2 A;  4DTX A;  4N47 A;  1SKS A;  3VQD A;  5SWM A;  2GUI A;  3U3Y A;  4CEZ A;  5DMR A;  4KB1 A;  2QXF A;  5SZT A;  1LW2 A;  4PQU A;  2PYJ A;  4LSL A;  3NDK A;  2DFE A;  4Z4G A;  3OY9 A;  3OYJ A;  3PO5 A;  1S6Q A;  2F8T A;  3HYF A;  3ZT0 A;  3OYM A;  3OYF A;  1ZYQ A;  1ZBF A;  3AO3 A;  4NCG A;  2DFH A;  3AO1 A;  4QAG A;  4AH9 A;  4AHC A;  1D8Y A;  4KHS A;  5FRN A;  3RMB A;  3QER A;  4FZY A;  4C8L A;  4FLY A;  4FLX A;  1JXE A;  4CIF A;  3RR8 A;  4HHT A;  2OZS A;  1NK0 A;  4O5B A;  4LD0 A;  3CM5 A;  4CEF A;  3BGR A;  3TAG A;  3AVA A;  3L2U A;  1J53 A;  3SQ1 A;  3TAQ A;  2YKN A;  3DOL A;  2G8H A;  3F73 A;  1ASU A;  4RG8 A;  4TSX A;  3MXM A;  4DS5 A;  4EZ6 A;  4CHZ A;  1MU2 A;  4Z4I A;  3L2R A;  1UAX A;  2BAN A;  4OKK A;  1KFD A;  1RT6 A;  3QEV A;  1NOY A;  2HHT A;  4DTR A;  4CED A;  1Z25 A;  3TI0 A;  4FM0 A;  4FJ7 A;  2HHQ A;  3NE6 A;  3RMC A;  2VWJ A;  3MEG A;  4CHP A;  1T8E A;  1Q9Y A;  1VRT A;  3NBP A;  3KIO A;  1N6Q A;  1U45 A;  4Y1C A;  4AHU A;  1WSE A;  1TV6 A;  4FJJ A;  2YKM A;  2KFN A;  3SUO A;  2XY5 A;  4K8Z A;  1IKV A;  1TKZ A;  2X6N A;  4JLH A;  3SQ2 A;  1QSL A;  4F3O A;  4KRE A;  4FJG A;  4C8N A;  1C6V A;  4OVL A;  4Q0B A;  3ZSY A;  2FBT A;  5J2P A;  1L3U A;  3L3V A;  4KTW A;  4R5P A;  5D3G A;  4CHN A;  2PY5 A;  4E89 A;  5CZ2 A;  3DLE A;  3K5N A;  3SPZ A;  1BI4 A;  3T1A A;  4F4K A;  4Z4F A;  3LP0 A;  1HNI A;  1JL1 A;  2E6M A;  3O4N A;  4E7L A;  2RF2 A;  3M8Q A;  1I39 A;  1LAV A;  1LW0 A;  1J9A A;  3O3H A;  2IAJ A;  4HCC A;  2QK9 A;  1ZBH A;  4KPY A;  3TWH A;  4IKF A;  3F9K A;  3ZSQ A;  1RNH A;  3KJV A;  3U6F A;  1IG9 A;  4FVM A;  2O4I A;  4CJP A;  4CEA A;  2OPS A;  4CJ3 A;  3SV4 A;  1B9D A;  4DSJ A;  3A2F A;  1QS4 A;  4IG0 A;  4YFU A;  2OPR A;  3NF7 A;  2R7Y A;  1A5W A;  3AVK A;  3M8S A;  3PO4 A;  4FJK A;  1EXQ A;  4H4O A;  3OYN A;  4OLB A;  2RKI A;  2OZM A;  5KGX A;  3HPH A;  2FC0 A;  3KLF A;  1U4B A;  2JGU A;  4BWJ A;  2YHA A;  4CEE A;  4CEO A;  1RT7 A;  2B5J A;  3K2P A;  3TAE A;  2BGG A;  3NF9 A;  4AHS A;  4F3T A;  3L2V A;  1UWB A;  3K5O A;  3OYH A;  2G8V A;  3VQ7 A;  4ZTF A;  3PX6 A;  2P5O A;  1NJY A;  1S1T A;  4CGI A;  5HRR A;  3HP6 A;  3QNN A;  4B9T A;  1O1W A;  4JS4 A;  4W5T A;  1DTT A;  4CK2 A;  5KGW A;  4YNQ A;  4ZHR A;  4CJT A;  2G8F A;  1KSP A;  1S5J A;  4I7F A;  3AV9 A;  2VG6 A;  4KTQ A;  3VQC A;  4DQQ A;  4KI6 A;  3D45 A;  3DRP A;  4FZX C;  4AIL C;  1L3S A;  2D0A A;  4CJV A;  3L2Q A;  3CQ8 A;  2HW3 A;  2BE2 A;  2D0B A;  4CHY A;  4AHT A;  1KVB A;  2KW4 A;  3CYM A;  2XO7 A;  1R0A A;  4CF1 A;  4CF8 A;  4OPK A;  3NH2 A;  1U49 A;  4DQP A;  4FK0 A;  3ZSO A;  3HVR A;  1DTQ A;  1QSY A;  2B6A A;  1IKY A;  4F2S A;  1IKW A;  2ETJ A;  3WNG A;  2A1R A;  1A5V A;  1NKE A;  1EP4 A;  3SQ4 A;  2F8S A;  3MED A;  4DQI A;  1RTJ A;  4OJR A;  5K14 A;  4BDZ A;  3E01 A;  3VQA A;  1HYS A;  3AO4 A;  3DRS A;  3I0R A;  1JLQ A;  3QIN A;  3QEP A;  4HVJ A;  1RT5 A;  3DLB A;  3KKR A;  3VN5 A;  2EHG A;  2P51 A;  4DG1 A;  3SPY A;  3S3M A;  1NKC A;  3HVT A;  2XHB A;  1LV5 A;  3OYL A;  4E1N A;  2I5J A;  1TAU A;  1BCM A;  1JKH A;  1FKP A;  4DQS A;  4DU1 A;  1BI4 B;  1VSL A;  3L2W A;  3RMA A;  1T05 A;  3PV8 A;  4KFB A;  3RRG A;  4FK4 A;  4EZ9 A;  1S1U A;  4CGG A;  3ULD A;  4KV8 A;  4M41 A;  3M8P A;  3TAB A;  1NJX A;  3DI6 A;  1T7P A;  1HYV A;  1BIS A;  2WON A;  5CYQ A;  3ZCM A;  3SNN A;  4KI4 A;  4M3X A;  3V1R A;  2DY4 A;  4ELV A;  1ZBU A;  2VG7 A;  3QES A;  3VQ5 A;  4B9U A;  2WOM A;  3OS1 A;  1VSK A;  5T7B A;  2E4L A;  3HPG A;  4OLA A;  3L8B A;  4FLZ A;  4O4G A;  4DLE A;  4DTN A;  1WSG A;  3HP9 A;  1BHL A;  5CYM A;  2GBZ A;  3LAN A;  3C6U A;  1EET A;  1KRP A;  5HLF A;  2W42 A;  4O55 A;  4DTO A;  2PZS A;  1J54 A;  5HRS A;  3LAK A;  1IH7 A;  2FBV A;  4NYF A;  4DTU A;  3S9H A;  3EYZ A;  3ZSW A;  1CZ9 A;  1TK5 A;  3KLE A;  3TAF A;  2HB5 A;  1UA0 A;  1GOA A;  1D9F A;  4KRF A;  5I42 A;  3P5J A;  4FW1 A;  4FCY A;  1QSS A;  4DSL A;  3TR8 A;  2D0C A;  4NCA A;  3OVN A;  3PUF A;  1C1A A;  3VA3 A;  4DS4 A;  1JLF A;  3ITH A;  4J2E A;  4FK2 A;  1S9G A;  1TAQ A;  4OGE A;  1RBT A;  4CK3 A;  1QE1 A;  3QIO A;  4BAC A;  4FLW A;  3ZT4 A;  1IKX A;  4DSK A;  4IDK A;  2PYL A;  4Z4H A;  4B3O A;  5KTQ A;  1LAW A;  1VK0 A;  4ICL A;  4I2P A;  4ID1 A;  3ZSV A;  1KTQ A;  3VQQ A;  3VQ4 A;  4IG3 A;  4CIE A;  3SUN A;  1C1C A;  3OYG A;  4FXD A;  2F96 A;  2E6L A;  3L3U A;  4HCB A;  4M3Z A;  1HRH A;  1S6P A;  2Y1I A;  3JSM A;  4B9L A;  1Q9X A;  3UIQ A;  4DTJ A;  4G1Q A;  4I9Q A;  1SKW A;  1L3V A;  3B6O A;  4Y1D A;  4DU4 A;  1J5O A;  2Q3S A;  3KLH A;  1IO2 A;  1JLA A;  1NK6 A;  3C94 A;  4BE2 A;  3U3G A;  2Z1I A;  4CFB A;  3OYE A;  3MEE A;  3I0S A;  3MEC A;  4BE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...