2G8VA

B. halodurans rnase h catalytic domain e188a mutant in complex with mg2+ and rna/dna hybrid (reaction product)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGAIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 39
structure length 133
sequence length 133
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8vA00
1BI4B 4KPYA 1A5XA 1RT6A 3C6UA 4F8RA 3NCIA 4JLHA 4E7HA 4CF2A 3O4QA 1U04A 2IC3A 3MEDA 4M3UA 4IG0A 1FKOA 1L3TA 1VSEA 4M45A 4AILC 1SKSA 4PUOA 4FZXC 3B6OA 4DSLA 2VG6A 1VRTA 4NYFA 3AVAA 4OKEA 4DTPA 3T3FA 1NKEA 2BGGA 4BWMA 3CFPA 1ASUA 3ZT1A 4CGJA 4CIEA 3DLKA 3HSTB 3PX6A 3SQ1A 3SQ0A 1NJYA 2X74A 1X1PA 3AO1A 1CZBA 4O44A 2YKMA 4CFAA 3ULDA 3QERA 5SWMA 4CHYA 4DQPA 4ELTA 4NCBA 2VG5A 4ID1A 3C95A 1TV6A 2G8FA 1U4BA 4CF0A 1BIUA 4KTQA 4FJGA 3V1QA 1HJRA 3VQPA 2QKKA 1I39A 3DM2A 2ETJA 5FRMA 2F8SA 4DTJA 2IAJA 3HYFA 3V9SA 3TANA 2YV0X 3DLEA 3OYHA 3U3YA 2ZE2A 3ZSRA 1DTQA 1K6YA 1NK6A 1KFDA 1RCHA 3V6DA 1NOZA 4CJVA 3AO4A 4CK1A 1RBRA 3DLBA 5HP1A 3L2QA 4KI6A 3TWHA 2HHVA 3VQBA 2Y1IA 3AVFA 4GVMA 5I42A 1JLQA 3VN5A 3LWLA 4DSFA 3OS1A 4CEOA 1SL0A 3V9UA 4EZ9A 4IBNA 4F2RA 4GMJB 5FDLA 3U3GA 3SPYA 4DMNA 3V9ZA 2P5GA 3AVCA 1HYZA 1VSHA 3K5MA 1C6VA 4W5RA 1RT3A 2NUBA 3PO5A 1L3UA 3TARA 1CXQA 3NF6A 2QK9A 3DOLA 1NJZA 1HNIA 1BCMA 1KTQA 5KI6A 4DSIA 1VSLA 1WSEA 3PX4A 2HW3A 3OYDA 4J2EA 4TSXA 3LPTA 3I8DA 3QEVA 1IO2A 1S1TA 4O0JA 1JLEA 1VSKA 4KTZA 4Q5VA 2FBTA 2YHAA 4DF4A 1REVA 1UOCA 3L3VA 1KVBA 4CJRA 2KTQA 3TAFA 4KB1A 4J2DA 4B08A 4I9QA 4CEEA 3OYEA 2X6SA 2HNYA 4RW8A 2YNGA 1VRUA 4LH5A 3L2UA 3HVTA 4CGIA 1IH7A 4C8MA 5T7BA 3KTQA 3LPUA 1X9MA 1C0MA 3VQCA 2QKBA 4DWIA 3KKSA 3V1OA 5KGWA 1L5UA 2X6NA 3RMBA 3EY1A 1R0AA 1HNVA 1RTIA 3PUFA 1U49A 3ZSXA 4DTXA 1L3SA 2WONA 3NHGA 3NF8A 2E6LA 1LWFA 2HVHA 4IFYA 1SUQA 4OVLA 3M8QA 3C6TA 3NAEA 1NJXA 3ISNC 2B6AA 4CK3A 3NE6A 3D45A 1BGXT 1QE1A 3HPGA 4OJRA 5J2NA 3QEIA 3AVLA 3SQ2A 3WNEA 2Z1GA 2Y1JA 1JXBA 1NK7A 2DFFA 3DLRA 4F3TA 3CG7A 4GW6A 3K5NA 3SQ4A 2OYQA 4O5BA 4G1QA 2R7YA 5CYMA 1FKPA 3ZSQA 3OJSA 1J54A 1XC9A 1JLCA 5J1EA 1D9FA 1RTHA 4DFJA 3KK2A 1X9WA 3FFIA 4KHNA 1KVAA 4HUEA 4C8OA 1VSDA 4KRFA 3K59A 1WAFA 1U48A 1KRPA 1XHZA 4FJ5A 3AO2A 4CEAA 4Z0UA 3OYIA 1O1WA 5DK5A 2IOCA 2YHBA 4CHQA 3KK3A 4DSKA 4QOZB 4FCYA 3LZIA 3ITHA 1S6PA 5HRRA 4OLAA 3VQEA 1HPZA 4E1NA 1TAUA 3ZT0A 1S9GA 1C1AA 2B5JA 1TL1A 4M3ZA 3QESA 5K14A 1J9AA 2F8TA 1WSFA 1ZBUA 1KLNA 4M3TA 1BCOA 4Z4IA 4JRQA 3SUNA 4KFBA 4AHVA 4BE2A 4FJJA 4CIFA 3VA3A 4PY5A 4ELVA 1JLFA 3K5LA 4Z4EA 1TKZA 4LY7A 1S1WA 1X9SA 1WN7A 4IG3A 3S9HA 4CECA 3VQ5A 5FRNA 1W0HA 2YKNA 3MXJA 4CJ5A 3MEGA 2OPSA 3IRXA 2A1RA 2XY7A 4FVMA 4DQQA 4FJHA 4KHUA 4FZZA 4CEDA 3HJFA 4Q0BA 4O4GA 3HT3A 4I2PA 3AO5A 3B6PA 3T19A 1JKHA 1LWEA 5HRPA 1T7PA 3OYCA 3RRGA 3LZJA 4B8CA 1WSHA 3KLIA 3NH2A 5C24A 1C0TA 3NH1A 3HM9A 4M42A 4B9NA 3ZCMA 4DQRA 2FC0A 4ELUA 1SKWA 4HCBA 5SZTA 1S6QA 3L3UA 3NFAA 4JS4A 3SYZA 4FW1A 2O4IA 4KKOA 4FLWA 2KZZA 2XY5A 3OVNA 1IKVA 1LW2A 4HHTA 1C0UA 4OPKA 1TL3A 2DFEA 4Z4HA 1Q8IA 4FM1A 3NGYA 1QTMA 3DRPA 1UWBA 1YVUA 4HTUA 4DQSA 3K5OA 4CGHA 1TK8A 2RKIA 5E41A 4RW4A 4CFBA 3SNNA 3MAQA 3LP0A 1DLOA 2GBZA 2X78A 3AVNA 1HYSA 3OS0A 2IDOA 3CFRA 3TR8A 5KRTA 3OYAA 1TAQA 3LDSA 1EKEA 1MU2A 2HHWA 1FK9A 4CIGA 1DTTA 4LSNA 5JS1A 3VQDA 1NK0A 1B9DA 4F2SA 1KSPA 4I9LA 4Y1DA 2KFNA 4H4MA 2D0CA 4B3OA 2ZD1A 3BGRA 2FBYA 3WNGA 3AVHA 4BWJA 4R5PA 4O0IA 4FLYA 1XWLA 4Z4GA 4UQGA 1KLMA 2GUIA 5DMRA 4RW9A 4C8NA 4CGDA 1IG9A 1RDCA 4DQIA 4IKFA 1NK8A 2DTUA 4Z4FA 4M41A 1ZBHA 4E7KA 3HO1A 3VQ7A 3OYMA 4YNQA 3HXMA 1SKRA 3DLHA 3OY9A 1N5YA 4FJKA 3ZSZA 4QAGA 4DF8A 1G15A 1IKXA 3JSMA 3OYNA 3SUPA 4CEZA 3G0ZA 3NF9A 3KLGA 3NH0A 4DLEA 1YTAA 4E7IA 1RBSA 1T05A 4K8ZA 4PQUA 1UA0A 1RBUA 4XIUA 2D0AA 4BE1A 1NJWA 1WAJA 1CZ9A 1ITGA 1RDDA 3DRSA 4KHQA 3ZSOA 2DFHA 3QNNA 3OYLA 3V4IA 4CJWA 1TKDA 1Z26A 3OS2A 3L2RA 4FW2A 4EP5A 3F73A 4CHPA 4CFDA 4MFBA 3RMDA 2BANA 3M8SA 3LP3A 3AA3A 2RN2A 4CESA 5HBMA 1SL2A 1N6QA 1TKTA 2EX3A 2B4JA 4CJ4A 4B9MA 3QIOA 3K57A 4M3YA 1NK5A 4CJQA 4KO0A 1CXUA 4EZ6A 2G8UA 4CCHA 4CEQA 5J2MA 1BQMA 2KW4A 4DU3A 3MXMA 3LAKA 4CEFA 1S5JA 3DMJA 4FJMA 4M3XA 3DI6A 1NKCA 4BDPA 4FLTA 4DTMA 4KAZA 1W9HA 1RT1A 4CJEA 4N5SA 1S9EA 2WOMA 2G8KA 1NOYA 1JL1A 4FJLA 1B9FA 3QEWA 1WSIA 2Q3SA 4M3WA 1IKWA 2HHTA 2XY8A 3M8RA 2O4GA 1S1XA 1TK0A 3HP9A 2F96A 2Z1HA 2FBXA 1LAVA 3TAPA 4FK0A 3SV4A 1ZBLA 2BE2A 1WSGA 3WNFA 4CK2A 4KTWA 3KK1A 4K8XA 2HMIA 1FXXA 3VQQA 2P5OA 1WNSA 5KGXA 5HRNA 3U6FA 2XO7A 4W5NA 4CJKA 1T8EA 1L3VA 1EXQA 4BDYA 1RTDA 5C42A 4JRPA 1T03A 3V9WA 4B9SA 1ZBFA 3MEEA 2HHQA 3HVRA 4AHCA 4DS5A 4CJSA 4HVJA 3CFOA 4ID5A 4OKKA 3OYBA 3AA2A 4DFKA 3SPZA 4FJXA 3E01A 4DS4A 4CJFA 3V1RA 3DLGA 4KHYA 3RR7A 3KD5E 3ZT4A 4E7JA 3LAMA 1EX4A 1QSSA 3ZT2A 4ZTJA 3IG1A 3O3FA 1YTUA 4FYDA 4KV8A 1RDAA 2E4LA 4CGGA 3RMAA 1ZYQA 4HUFA 3TAEA 1U47A 4L8RB 2A1SA 3SCXA 2HHXA 4C8KA 1GOBA 4FLVA 1QQCA 1JLBA 1KVCA 2XRIA 3KLHA 4FK4A 4B9UA 3QINA 1RILA 3QLHA 3P83D 2VWJA 3QO9A 2G8HA 1ZBIA 1Y97A 1LW0A 2LSNA 2RF2A 4YFUA 4KB0A 4CHNA 2I5JA 4FLUA 4AHTA 2PZSA 3OYKA 2D5RA 4CJTA 4FLXA 3P5JA 1NK4A 3TAGA 1BHLA 4ICLA 2Z1JA 3C94A 1ASVA 3ZSVA 4CERA 4CF1A 3NGZA 2YNIA 4RW7A 3KKRA 4HUGA 3TAQA 1KFSA 4PWDA 2KFZA 1JLAA 3HP6A 4AHUA 4E89A 1WSJA 2PYLA 5HRSA 1KCFA 1CLQA 4E7LA 4CF9A 4I7FA 4FM2A 1UA1A 4W5TA 1XI1A 3CM6A 3OYGA 1TVRA 3KIOA 1D5AA 1BL3A 3AA5X 1S1VA 3VQ6A 4KHWA 4DU4A 2ITGA 1VSJA 2IGIA 3HPHA 4RG8A 3LWMA 3LP1A 4OPJA 2Z1IA 3ZT3A 4CJLA 3LP2A 1JL2A 4WE1A 3SV3A 1J5OA 3AVMA 4B9VA 3K2PA 3P1GA 4FJ9A 4FJIA 4N76A 4AHSA 1RT4A 3AVKA 2XY6A 2HHUA 4CJUA 3AVJA 1U45A 4FJ7A 1QSLA 2QXFA 3WNHA 3RRHA 1VK0A 4H4OA 4FZYA 1Z25A 3HL8A 4CEBA 2PYJA 3AV9A 3CYMA 1TK5A 4FXDA 4CJPA 3V81A 3AVBA 3O4NA 3MECA 2E6MA 4FM0A 1QHTA 4IDKA 1BQNA 1RNHA 3T1AA 4F3OA 2JLEA 3NDKA 3H08A 3AVGA 2PY5A 4N56A 1VSFA 2BDPA 4NCAA 3ASMA 1F21A 2W42A 4BDZA 1SL1A 4IFVA 1LAWA 2EHGA 3OYJA 3AVIA 3NBPA 3IAYA 1UAXA 1TKXA 3I0RA 4E0DA 1GOCA 1IKYA 1JXEA 3KLEA 5CYQA 3ZSYA 3L8BA 3DRRA 3S3OA 3SUOA 1RTJA 4NCGA 3AO3A 2P1JA 3M8PA 4H8KA 1WLJA 4DLGA 2OPRA 2OZSA 2GV9A 3RWUA 1EETA 4DU1A 2HNDA 5D3GA 4PA1A 2OPQA 3DOKA 5CZ1A 4CGFA 2ATQA 3LANA 3SI6A 3EYZA 3V9XA 2DY4A 2G8IA 3VQAA 5KTQA 4J2BA 3QIPA 1HQEA 2P51A 4LSLA 4CJ3A 4O55A 4B8AB 1C1BA 1C1CA 3SZ2A 3THVA 3UIQA 4FJNA 3O3GA 1J53A 5JS2A 3MXIA 4B9LA 4BE0A 4E3SA 4DSEA 4E1MA 4DFMA 3TABA 3VQ4A 2RPIA 3D0PA 1RBTA 4DTSA 5FROA 3PO4A 4KHSA 1RT7A 4CFCA 2OZMA 3TAMA 4DFPA 3PX0A 3L2WA 1TGOA 1RDBA 3S3NA 1QS4A 3QEXA 4F4KA 5C25A 4OGCA 3L2VA 3OJUA 5HLFA 4NYNA 4M3RA 1RT2A 1RT5A 2D0BA 4EP4A 3S3MA 4DSJA 3OYFA 1HMVA 4KREA 5HROA 1BI4A 1A5VA 4B9TA 4AH9A 3O3HA 2ZQBA 1D8YA 3ALYA 3QEPA 5J2PA 1HYVA 4OLBA 2HVIA 4MQ3A 2OPPA 1BIZA 4BACA 3RTVA 4W5OA 4DTRA 1HQUA 3K58A 3PV8A 2YNHA 3TI0A 3HK2A 4CHZA 4DTOA 3RR8A 5CZ2A 4RW6A 3IS9A 4ZHRA 4DTNA 4CF8A 1QSYA 1JLGA 3NF7A 4W5QA 4JS5A 4N47A 1YT3A 4Z4CA 1NK9A 1LV5A 4N41A 3AA4A 4OGEA 3G10A 4ZTFA 4I2QA 2G8WA 3JYTA 3SUQA 3KLFA 3I0SA 2FBVA 4E19A 3BDPA 1BISA 5J2QA 3KD1E 2OA8A 4KI4A 3ZSWA 1XHXA 2HHSA 2IS3A 4FK2A 2KZMA 1HRHA 1SV5A 5CY4A 1EP4A 3A2FA 3SJJA 1VSIA 5KRSA 4Y1CA 1Q9YA 2HB5A 3VQ8A 3KJVA 1B92A 2KQ2A 3DYAA 1Q9XA 1A5WA 3VQ9A 1RBVA 3F9KA 4CHOA 1ASWA 3NGIA 4AHRA 4J2AA 4QCLA 3PY8A 5EU7A 2VWKA 2VG7A 3LALA 4DG1A 3CQ8A 3HPOA 4DTUA 1LWCA 1NKBA 1GOAA 1I3AA 3EZ5A 4CE9A 4LH4A 3VA0A 2JGUA 2G8VA 3RMCA 2AJQA 5I3UA 2XHBA 1D9DA 1S1UA 4OKJA 4C8LA 4FJ8A 1VSMA 4FLZA 3QETA 3QNOA 4HCCA 3CM5A 2YNFA 2HNZA 4LD0A
chains in the Genus database with same CATH superfamily
1N34K 4F8RA 4JKHA 4JLHA 2YJEA 3U4LA 1N8RO 4M3UA 1L3TA 4PUOA 3B6OA 3HI0A 4DTPA 3T3FA 2NRVA 4LFCK 3CFPA 3C65A 3ZT1A 4CGJA 4CIEA 3HSTB 1X1PA 3ULDA 4ELTA 4CFAA 3CJAA 4ID1A 2G8FA 4CF0A 3IMXA 1HJRA 2IVOA 3VQPA 3SAGA 3G4SN 1HUXA 3V9SA 3TANA 2VWBA 1NK6A 3CCRN 3V6DA 3DLBA 1RBRA 4ISGA 4QS8A 5GAHP 1WB9A 3VQBA 1QQNA 2UXBK 3TTFA 5I42A 3HOSA 1JLQA 3FR0A 3VN5A 4CEOA 2PBDA 3SAFA 3JAMO 2P5GA 1Q81O 1L3UA 3TARA 3DOLA 1HNIA 2BTFA 1KTQA 1VSLA 1WSEA 2HW3A 3OYDA 3VEWA 3JXUA 3I8DA 1IO2A 4BRLA 1JLEA 2E2OA 4KTZA 3VERA 2A41A 2FBTA 4JKFA 3E1YA 4Q5VA 3CCLN 1KVBA 4KB1A 4B08A 4IJAA 4AM6A 2FF3B 1QQMA 3W0LA 3GDQA 3DXMB 2A5XA 4LH5A 1SAZA 1QZ5A 3HVTA 3TPQA 2QKBA 4DWIA 5KGWA 4FWPA 4LF9K 1DT9A 3NVMA 4YOWA 5FPEA 4H0OA 3NHGA 3NF8A 4H5RA 1TUYA 4IFYA 3M8QA 5BPLA 3NAEA 3ISNC 1VQMN 2B6AA 4CK3A 3D45A 4KH5A 1QE1A 2HSTA 3TSQA 4RWTA 1RDUA 3SQ2A 2Z1GA 1NK7A 1JXBA 2DFFA 3AGRA 4BC5A 3A5NC 2W6LA 3TSUA 3SQ4A 4LF4K 1KXPA 5CYMA 3ZSQA 4YDUC 4BR2A 4YY3K 2P9IB 2NRHA 4BRIA 3I8BA 3O4WA 3J8AA 1KRPA 4FJ5A 4CD3A 3AO2A 4Z0UA 1O1WA 5DK5A 2YHBA 4BRAA 2YX6A 4FCYA 1NGIA 1HPZA 1TAUA 2YI1A 4H03B 2B5JA 4I6MB 2A3ZA 1ZBUA 1BCOA 3BEXA 4KFBA 4AHVA 1IBLK 2IVNA 4CIFA 5FPDA 4ELVA 1TKZA 1VQPN 4IG3A 4A2AA 1JCEA 3MXJA 2A1RA 3HJFA 4Z94A 3AO5A 3U9DA 5HOOA 3VGKA 3T19A 5HRPA 4K41A 3FZMA 4B8CA 3Q7BA 3KLIA 4B9NA 3ZCMA 4ELUA 4BC2A 3EKUA 3W3DA 4MO5A 3J7YP 3THYA 3F2KA 4KKOA 4FLWA 3OVNA 2I7PA 3ULEB 4HHTA 1YITN 1Z6RA 1TL3A 1Q8IA 2NLXA 1YVUA 2VYPA 3K5OA 5E41A 3LP0A 1DLOA 2X78A 3AVNA 3CFRA 2IDOA 3PLAA 5KRTA 2HHWA 1TAQA 2HBLA 2YHWA 3VQDA 5AQJA 1IJJA 4J8FA 5AQSA 4JKEA 2FBYA 4JI0K 4BWJA 4O0IA 3ATVA 4CGDA 4IKFA 1RDCA 4DQIA 4M41A 5JVHL 1BU6O 3OYMA 3ENHA 3P38A 3ENBA 3N4PA 3HXMA 5EX5A 2O8DA 1N5YA 3ZSZA 4QAGA 1KC8O 1G15A 1IKXA 3SUPA 3G0ZA 4DLEA 4HTLA 1M90O 4K8ZA 1XNQK 4PQUA 4XIUA 1RDDA 1TUUA 3QNNA 4CZEA 3OYLA 3OS2A 3L2RA 4JKDA 4FW2A 4CFDA 3CCJN 1KQSM 3RMDA 2VCPA 2HHHK 2RN2A 2RHKA 1SL2A 2FSNA 1HJOA 4CJ4A 3QIOA 3K57A 4M3YA 1T3VA 2G8UA 1VQ9N 4A5AA 2KW4A 4O8KA 3CHWA 3MXMA 4WFAL 4EFHA 4M3XA 3DI6A 2P9PA 3C0BA 3O1WA 4N5SA 4FJLA 2G8KA 3TTCA 1NOYA 1B9FA 2Q3SA 3THXA 4M3WA 3CIPA 1W2BM 2O4GA 1S1XA 3HP9A 2F96A 4IXCA 1LAVA 4JNEA 1ZBLA 1Q86O 1HKCA 4K8XA 1FXXA 3MCAB 3WEEA 1WNSA 2XO7A 3CMAN 1HR0K 1RTDA 2FSJA 2QWQA 4FSVA 3V9WA 1WBDA 4B9SA 3MEEA 2V7ZA 5FPNA 2QWLA 5CHIA 4HVJA 1NWKA 2FSKA 4FJXA 4B3MK 4DFKA 4CJFA 3KD5E 4E7JA 3LAMA 1EX4A 4FWOA 4KV8A 3C6HA 3HTVA 4BQLA 2Q2RA 3SCXA 4FLVA 3OTOK 4C8KA 1JLBA 1KVCA 4FK4A 1NGEA 2LSNA 2RF2A 1NGGA 4FPAA 5AQFA 4FLUA 1NK4A 5KPZA 1BHLA 3MK6A 4BR5A 4CERA 1ASVA 3ZSVA 4CF1A 4HUGA 4PWDA 2KFZA 2E8AA 4XH4A 4AHUA 2WC9A 1KCFA 4JD2A 5BR8K 4LF7K 3QB0A 3CM6A 3KIOA 4JKGA 3THWA 1LCUA 3GOIA 5TKYA 4BGBA 3QFPA 3LP1A 3WUHA 4CJLA 3VTHA 4B9VA 3HZ6A 2HHUA 4CJUA 4H4OA 2PYJA 3HL8A 4BR7A 1TK5A 1XMQK 5DM7L 4JEPA 5KQDA 3AVGA 2I7NA 4LFAK 2BDPA 3OYJA 1LAWA 1UAXA 3I0RA 4U7BA 3SUOA 4NCGA 3E9OA 2ZGZA 4FO0A 1WLJA 2P9LB 2A42A 3J7ZO 4PA1A 3D2EA 3LANA 3V9XA 3P39A 3QIPA 1HQEA 1NGJA 2D4WA 3CCSN 3A5LC 4B9LA 3L4IA 2UU9K 4V19S 5TKWA 2RPIA 3D0PA 3E9PA 3ZYYX 3CJ9A 3U9ZA 3PO4A 4CZKA 1TGOA 1U6ZA 2QA4N 1QS4A 3QEXA 3L2VA 4NYNA 3S3MA 2D0BA 4DSJA 3OYFA 1HMVA 3SJHA 5HROA 1BI4A 5F2RA 2E5LK 3NVKA 4AH9A 3A0IX 1BDGA 3M1FA 4CW7B 3L6QA 1N36K 2ZQBA 3LDPA 1HNWK 4FWMA 4CJ7A 4WF9L 2OPPA 1BIZA 4W5OA 1OVYA 3OHRA 4RW6A 3IS9A 4ZHRA 2O8EB 4CF8A 2FF6A 4W5QA 4N47A 4N41A 3AA4A 4OGEA 4I2QA 1SQKA 5AQIA 3SUQA 4IOCL 3I0SA 3BDPA 3KD1E 5C0YA 4CVNE 3KWIA 3LDLA 4BQZA 4KI4A 1XHXA 3A2FA 5LMNK 3D2FA 5BN9A 3VQ8A 1J6ZA 2QWRA 3VQ9A 1YUWA 3NGIA 4QCLA 1ASWA 4AHRA 1DKGD 4DG1A 2JGUA 1Q18A 4DQ8A 1VSMA 4EHTA 5LL6Z 4HCCA 2NRRA 1GLJO 4F9OA 4IZ9A 4KPYA 1A5XA 1RT6A 2QWPA 4L3QA 4E7HA 4CF2A 3O4QA 3MEDA 4IG0A 1FKOA 4M45A 3MWTA 2VG6A 3AVAA 1V4SA 1ASUA 2EWSA 1NJYA 4H5WA 3WQTA 2YKMA 4DQPA 4NCBA 2VG5A 3C95A 1I39A 5JMVA 4BR0A 4DTJA 2IAJA 4FWNA 4PKHA 2ZE2A 1K6YA 1NGDA 4CJVA 3AO4A 4CK1A 3H46O 3L2QA 4KI6A 1VQ8N 4BREA 4DSFA 3KZBA 3V9UA 4IBNA 4GMJB 5FDLA 4DMNA 3V9ZA 5HL7L 3AVCA 1VSHA 1RT3A 4M7XA 5AQLA 1CXQA 3NF6A 1QVGM 1NJZA 5KI6A 2HMPA 3KVGA 3LPTA 3CPWM 3S41A 4JI4K 4CJRA 4J2DA 1ESVA 3MN7A 4A2BA 4H5VA 2HNYA 3L2UA 2BUPA 1X9MA 3V1OA 4JK8A 3EY1A 1HNVA 3PUFA 4BVOA 3MMVA 1EWQA 4CZFA 4DTXA 1L3SA 2WONA 1BWFO 4NO7A 1NJXA 4MDBA 3DJCA 4OJRA 1KAZA 3QEIA 3AVLA 1K73O 3WNEA 4CZLA 4F3TA 3G71N 5AZJA 3CG7A 4GW6A 4M7YA 4WFNL 1YF5L 2OCEA 1FKPA 1XC9A 1D9FA 1GLEG 3FFIA 1VQ6N 1NGFA 3H1QA 3SBGA 1VSDA 3N4QA 1MDUB 4FOEA 3J7AP 3O08A 4K25A 3KK3A 1OH5A 4QOZB 4RCHA 4EIAA 4OLAA 1S6PA 5BN8A 4M3ZA 3ZEUA 3QESA 4YHHK 1J9AA 5JLHA 2UYTA 3SUNA 3VEXA 4PY5A 4GKJK 3QBXA 1WN7A 4BC4A 1BO5O 3S9HA 4CJ5A 3MEGA 3IRXA 3WXLA 4FVMA 3J81O 4FJHA 2V7YA 3KK7A 3CCEN 1LWEA 1BUPA 2ASPA 3OYCA 3LZJA 3CC4N 1WSHA 3NH1A 4NXNK 1T44A 2FC0A 5SZTA 3NFAA 2O4IA 4CZHA 2XY5A 3VTIA 4BY9C 2D0PA 2DFEA 4Z4HA 3NGYA 2ZJPL 5AQZA 3DRPA 5M1FA 1UWBA 4DQSA 4BROA 4PL8A 4RW4A 4GNIA 3SNNA 1HYSA 3OS0A 3OYAA 3LDSA 4X65K 4LSNA 1B9DA 3R1XA 1KSPA 5AR0A 1NGCA 1R59O 3H1VX 3CMEN 3BGRA 3AVHA 4H5NA 5ADXA 4H0VB 3K9KA 4RW9A 1U2VA 1NK8A 2Q1NA 3HO1A 4ISFA 1SKRA 2HBJA 3CJ1A 5GAGP 3NF9A 3EZWA 3VEVA 2W40A 1YTAA 3VGLA 1T05A 2UUAK 2D0AA 2GEMA 4BE1A 1WAJA 4JHDA 1CZ9A 3THYB 2DFHA 4CJWA 1HKGA 3FLCO 1IBMK 3LP3A 2NNWA 4CESA 5HBMA 1N6QA 1TKTA 3CCVN 2EX3A 5KQ8A 4CJQA 4BRNA 5FPMA 3I33A 3DMJA 2QM1A 1NKCA 4KAZA 4FLTA 1IBKK 5GINA 1BA1A 1S9EA 1RGIA 2HHTA 1JL1A 3QEWA 4XEIA 2XY8A 3M8RA 1TK0A 4FK0A 3DWLA 3CCUN 2O8DB 4CK2A 1GLCG 3KK1A 2HMIA 2FLOA 2P5OA 4GV9A 3OBYA 4JI1K 4CJKA 1T8EA 1EXQA 2GX9A 4OO1J 1T03A 3HVRA 3SMPA 4CJSA 4CD1A 3CFOA 4BG8A 4OKKA 5E26A 3SPZA 1OH8A 5CE3A 3V1RA 3DLGA 2VQFK 2E88A 1YTUA 4FYDA 4CGGA 1RDAA 1U47A 4HUFA 1YAGA 3CJBA 2A1SA 3O9UA 2XRIA 3KLHA 1RILA 2G8HA 1ZBIA 3O8MA 5C10A 1Y97A 1LW0A 3MN6A 2PZSA 2D5RA 1E4GT 3OBWA 2JWLA 4CJTA 3NGZA 2Z1JA 3UE5A 3WT0A 1S72N 2YNIA 2CH6A 1SZ2A 2P9PB 5HRSA 1CLQA 1X3MA 4IWVA 3THXB 4CF9A 4FM2A 3OYGA 1TVRA 1D5AA 2HBKA 1K9MO 4IEIA 5LJVA 4DV7K 1S1VA 3VQ6A 4DU4A 3WEEB 2ITGA 2IVPA 2HF3A 2IGIA 3LWMA 5BRHA 2P9NA 3CCQN 4A59A 1JL2A 3C6AA 3SV3A 2D1KA 1MWKA 1J5OA 3K2PA 3P1GA 5FLXO 4AHSA 1RT4A 2XY6A 3VF4A 1U45A 4FJ7A 1VK0A 2F7TA 4CEBA 3AV9A 2O8CA 1M1KO 4FXDA 3V81A 2QW9A 4DV3K 2E6MA 4JV5K 4IDKA 1BQNA 3T1AA 1VQ7N 2W41A 3ASMA 4JI7K 1SL1A 3EKSA 4IFVA 4JYAK 3EEQA 1Y64A 4H5TA 5KPRA 4RTFD 5F1XA 1JXEA 3KLEA 5GIPA 3ZSYA 3L8BA 3DRRA 3S3OA 2P1JA 2O8FA 2OZSA 4JD2B 3VMFB 2HNDA 5D3GA 4CGFA 1GLAG 2QXLA 5JLFA 4JKGB 3EYZA 3THWB 4A57A 2P51A 2E2QA 4LSLA 4CJ3A 5AQWA 4FJNA 1YXQA 2VGNA 4E3SA 4DFMA 3TABA 1RBTA 1QQOA 2F9WA 4KHSA 1RT7A 4CFCA 2OZMA 4AF1A 3TAMA 1RDBA 5C12A 4F4KA 2QWMA 4OGCA 5HLFA 2ZJQL 1A5VA 4B9TA 5C2DA 2Q36A 3QICA 1ATSA 3ALYA 3QEPA 4MQ3A 3Q7CA 3LM9A 4BACA 3RTVA 3PV8A 3TI0A 3HK2A 3F9MA 4DV2K 1JLGA 3NF7A 4JS5A 4Z4CA 4ZTFA 2G8WA 2JWKA 2OA8A 2HBMA 3O9SA 2UUBK 3D2EB 5C2FA 3K0SA 1HRHA 1EP4A 1VSIA 3TTDA 4DCHA 2QEXN 2KQ2A 3IKMA 1XQSC 3M5RA 3DYAA 1Q9XA 3AGKA 1RBVA 2CGKA 3F9KA 2VG7A 3LALA 1NKBA 4KH6A 1LWCA 4A5BA 4BRHA 4CE9A 1VQON 2AJQA 1S1UA 4FJ8A 4FLZA 1JCGA 3TAQA 1BI4B 3C6UA 4JK7A 4WQ5A 1EQYA 3HSCA 1C0GA 3FE1A 4KBOA 1VSEA 4AILC 1SKSA 4C1NI 4DSLA 4OKEA 3EL2A 4NYFA 5EVZA 4DUZK 2BGGA 4BWMA 2UUCK 3SQ0A 4IEEA 3PX6A 4BR9A 1CZBA 3PSFA 3QERA 3D6RA 3VF6A 3G25A 2ASOA 1U4BA 1FW6A 4KTQA 3V1QA 1X9JA 2ETJA 5FRMA 2F8SA 1FJGK 1HX1A 1NLVA 3DLEA 3OYHA 3U3YA 3EE8A 5JICA 5BRFA 1KFDA 1RCHA 2GUPA 1NOZA 4IOAL 3O9RA 2HHVA 3TWHA 4FWRA 1W7AA 3D2FB 2Y1IA 5A2QO 4GVMA 3LWLA 1SL0A 3QDKA 5AQXA 5AQMA 1S22A 3UKUA 3U3GA 3GBTA 3OA9A 3K5MA 4W5RA 2NUBA 3PO5A 1BCMA 4DSIA 2A40A 4MLHA 1BOTO 2WFBA 4JKBA 4J2EA 4DR7K 4TSXA 3QEVA 1S1TA 3T1YK 3KHYA 4DF4A 2YHAA 1REVA 1UOCA 2CGLA 2ZJRL 3LM2A 1HNXK 1K8AO 4AM7A 2ZGYA 4RW8A 2YNGA 4BRCA 1VRUA 1IH7A 4MO4A 4C8MA 5T7BA 3LPUA 3KTQA 1C0MA 2X6NA 5GIOA 3RMBA 1R0AA 5M1PA 3ZSXA 4PKGA 2E2PA 1TYQA 2E6LA 3R6MA 1LWFA 5JVGL 5BRDA 4OVLA 2P9SA 4YOUA 4DKWA 3NE6A 1BGXT 2Q31A 4CZIA 3R9PA 2Y1JA 1Q82O 2VQEK 1N32K 3K5NA 3DXKA 4G1QA 4BRMA 4K0KK 2YHYA 1J54A 3WXIA 3OJSA 1XNRK 5J1EA 4H0PA 1X9WA 3LDNA 3BZCA 2YJFA 2QWNA 4HUEA 4C8OA 3K59A 1U48A 1I94K 1XHZA 4H0TB 2YCHA 4GY2B 3OYIA 2DPNA 4CHQA 4DSKA 3ITHA 5HRRA 3VQEA 4U67L 5K14A 3CQYA 2F8TA 4GV6A 1GLDG 4Z4IA 4JRQA 3VA3A 5I9EB 1JLFA 2NZTA 1S1WA 4DV6K 1V4TA 5FRNA 1VAZA 1W0HA 2Q0RA 2OPSA 3BY5A 4DQQA 4Q0BA 4O4GA 4JI8K 4I2PA 1NGAA 1HLUA 3LDOA 4A61A 1JKHA 1T7PA 2GWJA 3E66A 2Q97A 3NH2A 4M42A 4JK9A 4DV5K 2E1YA 5GADP 4DQRA 3PSIA 4BRGA 5AZJB 1S6QA 3L3UA 4JS4A 3SYZA 3SLCA 1LW2A 2BH1A 3O6WA 1C0UA 4ILJA 3CERA 3ZETA 1QTMA 4UY8O 4HTUA 3MX5A 4BRFA 4CI6A 2RKIA 3A5MC 1GLLO 2GBZA 2GTDA 4DR1K 1ZC6A 3AAQA 1FK9A 4CIGA 2OTLN 1DTTA 1ATNA 3G6EN 4F2SA 3A8YA 2O8BA 4I9LA 4Y1DA 4H4MA 3VOVA 3ZEUB 4B3OA 1DEJA 2ZD1A 3HBTA 4R5PA 3AARA 4FLYA 1NNEA 2ZF5O 1IG9A 1KLMA 5DMRA 4C8NA 1ZBHA 3IUCA 2V51B 3VQ7A 4B9QA 4YNQA 4CBWA 3JSMA 4PL7A 3OYNA 4CEZA 5AQOA 1KAXA 4YOTA 4E7IA 1RBSA 3HM8A 2AP1A 4E1JA 1RBUA 2Q0UA 4FWSA 1ITGA 1OH6A 4B3RK 4O5FA 3V4IA 1TKDA 4DB3A 1VQ5N 4EP5A 3F73A 3BZKA 3D7EO 2UXDK 4CHPA 4MFBA 3M8SA 3AA3A 2E20A 1S3XA 4JN4A 3T1HK 1NK5A 4EZ6A 1CXUA 5IT9O 3DLLL 1YVNA 4CCHA 5AFUH 5J2MA 4DU3A 3BUZB 5BPMA 3F5TA 3LAKA 1ZBSA 4CEFA 4FJMA 4JI2K 4DTMA 2OTJN 5EY4A 1W9HA 2WBNA 4A62A 2WUSA 3VPZA 1U2VB 1IKWA 1EWRA 3H6EA 4DUYK 1O13A 4FWKA 2FBXA 3SV4A 3CPEA 2BE2A 4LFBK 3WQUA 5AQHA 5HRNA 2P9KA 3AAPA 1L3VA 3QFUA 4JRPA 3ZX0A 2NRZA 5M1OA 4JHDB 3OYBA 3T7ZA 3AA2A 2E1ZA 4KHYA 4ZTJA 3HRGA 2P9UB 3IG1A 3RVCA 3E9LA 3O3FA 1K8KA 1ZYQA 2E4LA 3RMAA 1OH7A 3TAEA 2HHXA 4YORA 3FGUA 5AQUA 5AFUA 3QINA 4KB0A 1WOQA 3OYKA 4IJNA 4FLXA 3P5JA 4ICLA 2VWJA 4QS9A 4JAXA 1JLAA 1YJ9N 4R79A 4E89A 4BRQA 3H3OB 3RSEB 4I7FA 3AY9A 4W5TA 4ISEA 1NU0A 1XI1A 4B3TK 3H3NO 3AA5X 3ZX2A 4KHWA 5BPNA 4WQ5C 3HPHA 5AQGA 5CR4A 4EHUA 4OPJA 3ZT3A 3CJCA 3LP2A 4NLBA 4CBUA 1NBWA 4BGAA 4FJ9A 3AVKA 3AVJA 4CBXA 1QSLA 2QXFA 3UKRA 1Z25A 1YJNN 3AVBA 3O1BA 3MECA 5B8HA 4FM0A 1RNHA 4F3OA 3NDKA 1WBBA 3H08A 2PY5A 2PFUA 2NRXA 1F21A 2W42A 4BDZA 3NBPA 4H0YB 4WYBA 1TKXA 1LOTB 4E0DA 1GOCA 1IKYA 2QI2A 1MA9B 3H45C 1XUPO 3M8PA 3C7NB 3GE1A 4DLGA 2OPRA 2GV9A 3RWUA 4FOIA 5M1QA 2P9UA 3VEOA 1JCFA 3SI6A 2G8IA 3VQAA 3M3ZA 3T69A 4X62K 4B8AB 1C1BA 1C1CA 3IDHA 4XH1A 4ILGB 2P9NB 5JS2A 5IWAK 1EO1A 5BR9A 4G9ZA 3EN9A 4DFPA 3PX0A 3L2WA 3S3NA 3K9JA 5C25A 1YJWN 4FVUA 3VEZA 1RT2A 1RT5A 3CI5A 4KREA 3RSEA 2A6AA 2O8CB 2FXUA 1E4FT 4DHYA 3O3HA 5J2PA 1HYVA 4C23A 4OLBA 2HVIA 4DR3K 4CZGA 4DTRA 1HQUA 2YNHA 5EOYA 3KWGA 3P4IA 5CZ2A 3WXKA 1YT3A 1LV5A 1QZ6A 3JYTA 4DR6K 2O8FB 1BISA 5LY3A 1NJIO 4K43A 5CY4A 2ASMA 3SJJA 3VF2A 4Y1CA 4WFBL 2KKZA 2YHXA 3CF5L 3KJVA 1B92A 1XC3A 4J2AA 3PY8A 3CQ8A 1I3AA 2G8VA 2XHBA 4C8LA 4FWQA 1VQNN 3C7NA 4EAHD 3QNOA 1VQ4N 4LF8K 2YNFA 4BR4A 4LD0A 3OW2M 3NCIA 4OX9K 1U04A 2IC3A 3O9TA 3O5BA 4FZXC 3SK3A 2ZWHA 1VRTA 1NKEA 3DXMA 3SQ1A 3DLKA 2X74A 3AO1A 4O44A 5SWMA 1BG3A 2KHOA 4CHYA 4YOXA 1TV6A 1BIUA 4FJGA 2QKKA 3DM2A 4B1ZA 3HYFA 2YV0X 1XMOK 3ZSRA 1DTQA 3VENA 1P90A 4B1YB 3VETA 5LJWA 3PIOL 3UB5A 5HP1A 1NMNA 4BRPA 3AVFA 3OS1A 4EZ9A 4WQ4A 4NB4A 4F2RA 5H1SQ 3SPYA 4DR5K 1HYZA 1C6VA 4C1NK 2ITMA 2QK9A 2P9IA 3PX4A 4IFEA 1SS6A 3WXMB 3VESA 4O0JA 3J80O 4OPHA 1VSKA 3FZHA 4BC3A 4Y0WA 3L3VA 3SBTA 2KTQA 3TAFA 4I9QA 4CEEA 3OYEA 4DR4K 2X6SA 4B3SK 4CGIA 3VQCA 4I6MA 3KKSA 1L5UA 3CXCM 1RTIA 1U49A 1ATRA 3QBWA 4IO9L 4BG9A 2HVHA 1SUQA 2H3GX 3C6TA 2F9TA 3R8EA 3HPGA 5C15A 5J2NA 4CZMA 4DR2K 3QMLA 5BREA 1Q7YO 3TU5A 3DLRA 3UKUB 2OYQA 4O5BA 1HPMA 2R7YA 4H0XB 5KPTA 1JLCA 3ULEA 1RTHA 4DFJA 3KK2A 5AQYA 3IFRA 4KHNA 4JI6K 1KVAA 4IOXA 4KRFA 1WAFA 5AJ3K 3I55N 5AQNA 1VQLN 2CGJA 5DM6L 4CEAA 2IOCA 3LZIA 1G99A 2NRWA 1RFQA 4E1NA 1MWMA 2CH5A 3ZT0A 1S9GA 1C1AA 1TL1A 4MDAA 4B1VA 1WSFA 1KLNA 4M3TA 4BE2A 4FJJA 2PAVA 3K5LA 4Z4EA 4LY7A 1X9SA 1TYQB 4JI3K 4DV4K 4CECA 3VQ5A 4LF5K 2YKNA 2P9SB 4CZJA 2NRTA 1VHXA 2XY7A 4KHUA 4FZZA 4CEDA 3HT3A 3B6PA 3ZX3A 3MN5A 5LMUK 4BRKA 2AA4A 1QHAA 3RRGA 3HM9A 5C24A 1C0TA 4PHTX 1SKWA 4HCBA 3CJ7A 1E3MA 1T6CA 3DXKB 4FW1A 4DV1K 2KZZA 2QTDA 1IKVA 3M6GA 3O80A 4OPKA 3L0QA 4XH5A 4FM1A 1NGHA 1KAYA 4NLCA 4IDHA 4CGHA 1TK8A 4CFBA 4B1XB 3MAQA 4B1WB 1IG8A 3TR8A 1YIJN 3GL1A 1EKEA 1MU2A 5JS1A 1NK0A 2KFNA 3CQXA 2D0CA 3BP8A 2HOEA 3ENOA 3I56N 4WCEL 1DGKN 3WNGA 1XWLA 4Z4GA 2W6KA 1HKBA 4UQGA 1KD1O 2GUIA 4M63C 2DTUA 4Z4FA 4E7KA 4GKKK 2KLAA 3SMSA 1GLBG 2QWOA 4B1UB 3DLHA 3OY9A 4FJKA 4DF8A 3R3LA 4IO8A 5AQPA 5M1KA 3ID6A 3MX2A 1YHQN 3CETA 3KLGA 3NH0A 1UA0A 3FFKB 1NJWA 3DRSA 4KHQA 3ZSOA 5M1NA 1W97L 1Z26A 5GAEP 3ZETB 5MLCQ 5E84A 4GVEA 2BANA 3MCPA 3L4QA 2J4RA 2F4VK 2B4JA 4B9MA 3MWPA 4KO0A 4CEQA 1BQMA 2ZM6K 2O8BB 3CCMN 1S5JA 3NMUA 4YDUA 3P31A 4BDPA 3CC7N 1RT1A 4CJEA 2WOMA 1WSIA 2WTUA 5ELZA 3TAPA 2Z1HA 1WSGA 3WNFA 4KTWA 5AZIB 2D0OA 3VQQA 2E2NA 5KGXA 3U6FA 4W5NA 4BDYA 5C42A 5AQTA 3EO3A 3ID8A 1ZBFA 2HHQA 4KH4A 4AHCA 4DS5A 3BF3A 4ID5A 1J5EK 3E01A 4YOYA 4FWLA 4DS4A 3MDQA 3RR7A 3ZT4A 1QSSA 3ZT2A 4L8RB 4BRDA 3LDQA 1GOBA 1QQCA 4B9UA 3QLHA 4MLEA 4OPAA 3P83D 3QO9A 3MN9A 4YFUA 1JJ2M 4CHNA 2I5JA 1P8ZA 4AHTA 1YI2N 3SAHA 3TAGA 3C94A 4NXMK 4JKAA 2RE2A 4RW7A 3KKRA 1KFSA 1OKJA 3HP6A 4DV0K 1WSJA 2PYLA 3U8XA 1ILYA 1NM1A 2P9LA 4E7LA 1UA1A 1RDWX 1BL3A 4K42A 1NG9A 4LF6K 3CD6N 1VSJA 1C0FA 4RG8A 2P9KB 2Z1IA 4QS7A 4WE1A 3AVMA 3CC2N 3BF1A 4FJIA 4N76A 5AQVA 2OANA 4PKIA 3WNHA 3RRHA 4FZYA 2IIRA 1NMDA 4JI5K 3CYMA 3ZLJA 1Z05A 1K8KB 4CJPA 3O4NA 1IV0A 1QHTA 2JLEA 5AZIA 4N56A 1VSFA 4NCAA 3LL3A 5AQRA 2EHGA 3JS6A 3AVIA 4JKCA 2O8EA 2UXCK 3PIPL 3IAYA 4FPBA 4WQ4C 5CYQA 4X66K 3HOTA 1RTJA 1H1VA 3AO3A 3FZKA 4H8KA 3VEYA 4HWIA 1EETA 4DU1A 2OPQA 3DOKA 5CZ1A 2ATQA 2DY4A 4J2BA 5KTQA 5EXWA 2GELA 2HF4A 4KHPK 4BVPA 4O55A 3THVA 3UIQA 3SZ2A 1D4XA 3A5OC 3O3GA 1GLFO 1J53A 3MXIA 4BE0A 4DSEA 4E1MA 4FL9A 3VQ4A 4X64K 4DTSA 5AQQA 5FROA 3EE9A 1HNZK 3OJUA 4M3RA 4EP4A 3UKRB 1CZAN 3GG4A 3VGMA 3FZLA 1D8YA 3B8AX 3DAWA 3FZFA 1BA0A 5AQKA 4YOVA 1ZXOA 2VGMA 3K58A 4CHZA 4DTOA 3RR8A 4DTNA 1QSYA 4GV3A 1NK9A 1NGBA 4LC9B 3G10A 3KLFA 2FBVA 4E19A 4AQYK 5J2QA 1QVFM 3ZSWA 2HHSA 2KZMA 2IS3A 4FK2A 3O9QA 1SV5A 3WXJA 1OVQA 5KRSA 2V52B 1Q9YA 2HB5A 3TSPA 1T6DA 2GWKA 1A5WA 4CHOA 4O8UA 5EU7A 2VWKA 4DTUA 3HPOA 1GOAA 1WUAA 1X3NA 5F0XA 3EZ5A 1VQKN 4LH4A 3VA0A 3RMCA 5I3UA 1D9DA 4OKJA 5ADXH 3QETA 4ILHA 3CM5A 1N33K 2HNZA 3ATUA
chains in the Genus database with same CATH topology
1BI4B 4KPYA 1A5XA 1RT6A 3C6UA 4F8RA 3NCIA 4JLHA 4E7HA 4CF2A 3O4QA 1U04A 2IC3A 3MEDA 4M3UA 4IG0A 1FKOA 1L3TA 1VSEA 4M45A 4AILC 1SKSA 4PUOA 4FZXC 3B6OA 4DSLA 2VG6A 1VRTA 4NYFA 3AVAA 4OKEA 4DTPA 3T3FA 1NKEA 2BGGA 4BWMA 3CFPA 1ASUA 3ZT1A 4CGJA 4CIEA 3DLKA 3HSTB 3PX6A 3SQ1A 3SQ0A 1NJYA 2X74A 1X1PA 3AO1A 1CZBA 4O44A 2YKMA 4CFAA 3ULDA 3QERA 5SWMA 4CHYA 4DQPA 4ELTA 4NCBA 2VG5A 4ID1A 3C95A 1TV6A 2G8FA 1U4BA 4CF0A 1BIUA 4KTQA 4FJGA 3V1QA 1HJRA 3VQPA 2QKKA 1I39A 3DM2A 2ETJA 5FRMA 2F8SA 4DTJA 2IAJA 3HYFA 3V9SA 3TANA 2YV0X 3DLEA 3OYHA 3U3YA 2ZE2A 3ZSRA 1DTQA 1K6YA 1NK6A 1KFDA 1RCHA 3V6DA 1NOZA 4CJVA 3AO4A 4CK1A 1RBRA 3DLBA 5HP1A 3L2QA 4KI6A 3TWHA 2HHVA 3VQBA 2Y1IA 3AVFA 4GVMA 5I42A 1JLQA 3VN5A 3LWLA 4DSFA 3OS1A 4CEOA 1SL0A 3V9UA 4EZ9A 4IBNA 4F2RA 4GMJB 5FDLA 3U3GA 3SPYA 4DMNA 3V9ZA 2P5GA 3AVCA 1HYZA 1VSHA 3K5MA 1C6VA 4W5RA 1RT3A 2NUBA 3PO5A 1L3UA 3TARA 1CXQA 3NF6A 2QK9A 3DOLA 1NJZA 1HNIA 1BCMA 1KTQA 5KI6A 4DSIA 1VSLA 1WSEA 3PX4A 2HW3A 3OYDA 4J2EA 4TSXA 3LPTA 3I8DA 3QEVA 1IO2A 1S1TA 4O0JA 1JLEA 1VSKA 4KTZA 4Q5VA 2FBTA 2YHAA 4DF4A 1REVA 1UOCA 3L3VA 1KVBA 4CJRA 2KTQA 3TAFA 4KB1A 4J2DA 4B08A 4I9QA 4CEEA 3OYEA 2X6SA 2HNYA 4RW8A 2YNGA 1VRUA 4LH5A 3L2UA 3HVTA 4CGIA 1IH7A 4C8MA 5T7BA 3KTQA 3LPUA 1X9MA 1C0MA 3VQCA 2QKBA 4DWIA 3KKSA 3V1OA 5KGWA 1L5UA 2X6NA 3RMBA 3EY1A 1R0AA 1HNVA 1RTIA 3PUFA 1U49A 3ZSXA 4DTXA 1L3SA 2WONA 3NHGA 3NF8A 2E6LA 1LWFA 2HVHA 4IFYA 1SUQA 4OVLA 3M8QA 3C6TA 3NAEA 1NJXA 3ISNC 2B6AA 4CK3A 3NE6A 3D45A 1BGXT 1QE1A 3HPGA 4OJRA 5J2NA 3QEIA 3AVLA 3SQ2A 3WNEA 2Z1GA 2Y1JA 1JXBA 1NK7A 2DFFA 3DLRA 4F3TA 3CG7A 4GW6A 3K5NA 3SQ4A 2OYQA 4O5BA 4G1QA 2R7YA 5CYMA 1FKPA 3ZSQA 3OJSA 1J54A 1XC9A 1JLCA 5J1EA 1D9FA 1RTHA 4DFJA 3KK2A 1X9WA 3FFIA 4KHNA 1KVAA 4HUEA 4C8OA 1VSDA 4KRFA 3K59A 1WAFA 1U48A 1KRPA 1XHZA 4FJ5A 3AO2A 4CEAA 4Z0UA 3OYIA 1O1WA 5DK5A 2IOCA 2YHBA 4CHQA 3KK3A 4DSKA 4QOZB 4FCYA 3LZIA 3ITHA 1S6PA 5HRRA 4OLAA 3VQEA 1HPZA 4E1NA 1TAUA 3ZT0A 1S9GA 1C1AA 2B5JA 1TL1A 4M3ZA 3QESA 5K14A 1J9AA 2F8TA 1WSFA 1ZBUA 1KLNA 4M3TA 1BCOA 4Z4IA 4JRQA 3SUNA 4KFBA 4AHVA 4BE2A 4FJJA 4CIFA 3VA3A 4PY5A 4ELVA 1JLFA 3K5LA 4Z4EA 1TKZA 4LY7A 1S1WA 1X9SA 1WN7A 4IG3A 3S9HA 4CECA 3VQ5A 5FRNA 1W0HA 2YKNA 3MXJA 4CJ5A 3MEGA 2OPSA 3IRXA 2A1RA 2XY7A 4FVMA 4DQQA 4FJHA 4KHUA 4FZZA 4CEDA 3HJFA 4Q0BA 4O4GA 3HT3A 4I2PA 3AO5A 3B6PA 3T19A 1JKHA 1LWEA 5HRPA 1T7PA 3OYCA 3RRGA 3LZJA 4B8CA 1WSHA 3KLIA 3NH2A 5C24A 1C0TA 3NH1A 3HM9A 4M42A 4B9NA 3ZCMA 4DQRA 2FC0A 4ELUA 1SKWA 4HCBA 5SZTA 1S6QA 3L3UA 3NFAA 4JS4A 3SYZA 4FW1A 2O4IA 4KKOA 4FLWA 2KZZA 2XY5A 3OVNA 1IKVA 1LW2A 4HHTA 1C0UA 4OPKA 1TL3A 2DFEA 4Z4HA 1Q8IA 4FM1A 3NGYA 1QTMA 3DRPA 1UWBA 1YVUA 4HTUA 4DQSA 3K5OA 4CGHA 1TK8A 2RKIA 5E41A 4RW4A 4CFBA 3SNNA 3MAQA 3LP0A 1DLOA 2GBZA 2X78A 3AVNA 1HYSA 3OS0A 2IDOA 3CFRA 3TR8A 5KRTA 3OYAA 1TAQA 3LDSA 1EKEA 1MU2A 2HHWA 1FK9A 4CIGA 1DTTA 4LSNA 5JS1A 3VQDA 1NK0A 1B9DA 4F2SA 1KSPA 4I9LA 4Y1DA 2KFNA 4H4MA 2D0CA 4B3OA 2ZD1A 3BGRA 2FBYA 3WNGA 3AVHA 4BWJA 4R5PA 4O0IA 4FLYA 1XWLA 4Z4GA 4UQGA 1KLMA 2GUIA 5DMRA 4RW9A 4C8NA 4CGDA 1IG9A 1RDCA 4DQIA 4IKFA 1NK8A 2DTUA 4Z4FA 4M41A 1ZBHA 4E7KA 3HO1A 3VQ7A 3OYMA 4YNQA 3HXMA 1SKRA 3DLHA 3OY9A 1N5YA 4FJKA 3ZSZA 4QAGA 4DF8A 1G15A 1IKXA 3JSMA 3OYNA 3SUPA 4CEZA 3G0ZA 3NF9A 3KLGA 3NH0A 4DLEA 1YTAA 4E7IA 1RBSA 1T05A 4K8ZA 4PQUA 1UA0A 1RBUA 4XIUA 2D0AA 4BE1A 1NJWA 1WAJA 1CZ9A 1ITGA 1RDDA 3DRSA 4KHQA 3ZSOA 2DFHA 3QNNA 3OYLA 3V4IA 4CJWA 1TKDA 1Z26A 3OS2A 3L2RA 4FW2A 4EP5A 3F73A 4CHPA 4CFDA 4MFBA 3RMDA 2BANA 3M8SA 3LP3A 3AA3A 2RN2A 4CESA 5HBMA 1SL2A 1N6QA 1TKTA 2EX3A 2B4JA 4CJ4A 4B9MA 3QIOA 3K57A 4M3YA 1NK5A 4CJQA 4KO0A 1CXUA 4EZ6A 2G8UA 4CCHA 4CEQA 5J2MA 1BQMA 2KW4A 4DU3A 3MXMA 3LAKA 4CEFA 1S5JA 3DMJA 4FJMA 4M3XA 3DI6A 1NKCA 4BDPA 4FLTA 4DTMA 4KAZA 1W9HA 1RT1A 4CJEA 4N5SA 1S9EA 2WOMA 2G8KA 1NOYA 1JL1A 4FJLA 1B9FA 3QEWA 1WSIA 2Q3SA 4M3WA 1IKWA 2HHTA 2XY8A 3M8RA 2O4GA 1S1XA 1TK0A 3HP9A 2F96A 2Z1HA 2FBXA 1LAVA 3TAPA 4FK0A 3SV4A 1ZBLA 2BE2A 1WSGA 3WNFA 4CK2A 4KTWA 3KK1A 4K8XA 2HMIA 1FXXA 3VQQA 2P5OA 1WNSA 5KGXA 5HRNA 3U6FA 2XO7A 4W5NA 4CJKA 1T8EA 1L3VA 1EXQA 4BDYA 1RTDA 5C42A 4JRPA 1T03A 3V9WA 4B9SA 1ZBFA 3MEEA 2HHQA 3HVRA 4AHCA 4DS5A 4CJSA 4HVJA 3CFOA 4ID5A 4OKKA 3OYBA 3AA2A 4DFKA 3SPZA 4FJXA 3E01A 4DS4A 4CJFA 3V1RA 3DLGA 4KHYA 3RR7A 3KD5E 3ZT4A 4E7JA 3LAMA 1EX4A 1QSSA 3ZT2A 4ZTJA 3IG1A 3O3FA 1YTUA 4FYDA 4KV8A 1RDAA 2E4LA 4CGGA 3RMAA 1ZYQA 4HUFA 3TAEA 1U47A 4L8RB 2A1SA 3SCXA 2HHXA 4C8KA 1GOBA 4FLVA 1QQCA 1JLBA 1KVCA 2XRIA 3KLHA 4FK4A 4B9UA 3QINA 1RILA 3QLHA 3P83D 2VWJA 3QO9A 2G8HA 1ZBIA 1Y97A 1LW0A 2LSNA 2RF2A 4YFUA 4KB0A 4CHNA 2I5JA 4FLUA 4AHTA 2PZSA 3OYKA 2D5RA 4CJTA 4FLXA 3P5JA 1NK4A 3TAGA 1BHLA 4ICLA 2Z1JA 3C94A 1ASVA 3ZSVA 4CERA 4CF1A 3NGZA 2YNIA 4RW7A 3KKRA 4HUGA 3TAQA 1KFSA 4PWDA 2KFZA 1JLAA 3HP6A 4AHUA 4E89A 1WSJA 2PYLA 5HRSA 1KCFA 1CLQA 4E7LA 4CF9A 4I7FA 4FM2A 1UA1A 4W5TA 1XI1A 3CM6A 3OYGA 1TVRA 3KIOA 1D5AA 1BL3A 3AA5X 1S1VA 3VQ6A 4KHWA 4DU4A 2ITGA 1VSJA 2IGIA 3HPHA 4RG8A 3LWMA 3LP1A 4OPJA 2Z1IA 3ZT3A 4CJLA 3LP2A 1JL2A 4WE1A 3SV3A 1J5OA 3AVMA 4B9VA 3K2PA 3P1GA 4FJ9A 4FJIA 4N76A 4AHSA 1RT4A 3AVKA 2XY6A 2HHUA 4CJUA 3AVJA 1U45A 4FJ7A 1QSLA 2QXFA 3WNHA 3RRHA 1VK0A 4H4OA 4FZYA 1Z25A 3HL8A 4CEBA 2PYJA 3AV9A 3CYMA 1TK5A 4FXDA 4CJPA 3V81A 3AVBA 3O4NA 3MECA 2E6MA 4FM0A 1QHTA 4IDKA 1BQNA 1RNHA 3T1AA 4F3OA 2JLEA 3NDKA 3H08A 3AVGA 2PY5A 4N56A 1VSFA 2BDPA 4NCAA 3ASMA 1F21A 2W42A 4BDZA 1SL1A 4IFVA 1LAWA 2EHGA 3OYJA 3AVIA 3NBPA 3IAYA 1UAXA 1TKXA 3I0RA 4E0DA 1GOCA 1IKYA 1JXEA 3KLEA 5CYQA 3ZSYA 3L8BA 3DRRA 3S3OA 3SUOA 1RTJA 4NCGA 3AO3A 2P1JA 3M8PA 4H8KA 1WLJA 4DLGA 2OPRA 2OZSA 2GV9A 3RWUA 1EETA 4DU1A 2HNDA 5D3GA 4PA1A 2OPQA 3DOKA 5CZ1A 4CGFA 2ATQA 3LANA 3SI6A 3EYZA 3V9XA 2DY4A 2G8IA 3VQAA 5KTQA 4J2BA 3QIPA 1HQEA 2P51A 4LSLA 4CJ3A 4O55A 4B8AB 1C1BA 1C1CA 3SZ2A 3THVA 3UIQA 4FJNA 3O3GA 1J53A 5JS2A 3MXIA 4B9LA 4BE0A 4E3SA 4DSEA 4E1MA 4DFMA 3TABA 3VQ4A 2RPIA 3D0PA 1RBTA 4DTSA 5FROA 3PO4A 4KHSA 1RT7A 4CFCA 2OZMA 3TAMA 4DFPA 3PX0A 3L2WA 1TGOA 1RDBA 3S3NA 1QS4A 3QEXA 4F4KA 5C25A 4OGCA 3L2VA 3OJUA 5HLFA 4NYNA 4M3RA 1RT2A 1RT5A 2D0BA 4EP4A 3S3MA 4DSJA 3OYFA 1HMVA 4KREA 5HROA 1BI4A 1A5VA 4B9TA 4AH9A 3O3HA 2ZQBA 1D8YA 3ALYA 3QEPA 5J2PA 1HYVA 4OLBA 2HVIA 4MQ3A 2OPPA 1BIZA 4BACA 3RTVA 4W5OA 4DTRA 1HQUA 3K58A 3PV8A 2YNHA 3TI0A 3HK2A 4CHZA 4DTOA 3RR8A 5CZ2A 4RW6A 3IS9A 4ZHRA 4DTNA 4CF8A 1QSYA 1JLGA 3NF7A 4W5QA 4JS5A 4N47A 1YT3A 4Z4CA 1NK9A 1LV5A 4N41A 3AA4A 4OGEA 3G10A 4ZTFA 4I2QA 2G8WA 3JYTA 3SUQA 3KLFA 3I0SA 2FBVA 4E19A 3BDPA 1BISA 5J2QA 3KD1E 2OA8A 4KI4A 3ZSWA 1XHXA 2HHSA 2IS3A 4FK2A 2KZMA 1HRHA 1SV5A 5CY4A 1EP4A 3A2FA 3SJJA 1VSIA 5KRSA 4Y1CA 1Q9YA 2HB5A 3VQ8A 3KJVA 1B92A 2KQ2A 3DYAA 1Q9XA 1A5WA 3VQ9A 1RBVA 3F9KA 4CHOA 1ASWA 3NGIA 4AHRA 4J2AA 4QCLA 3PY8A 5EU7A 2VWKA 2VG7A 3LALA 4DG1A 3CQ8A 3HPOA 4DTUA 1LWCA 1NKBA 1GOAA 1I3AA 3EZ5A 4CE9A 4LH4A 3VA0A 2JGUA 2G8VA 3RMCA 2AJQA 5I3UA 2XHBA 1D9DA 1S1UA 4OKJA 4C8LA 4FJ8A 1VSMA 4FLZA 3QETA 3QNOA 4HCCA 3CM5A 2YNFA 2HNZA 4LD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI4 B;  4KPY A;  1A5X A;  1RT6 A;  3C6U A;  4F8R A;  3NCI A;  4JLH A;  4E7H A;  4CF2 A;  3O4Q A;  1U04 A;  2IC3 A;  3MED A;  4M3U A;  4IG0 A;  1FKO A;  1L3T A;  1VSE A;  4M45 A;  4AIL C;  1SKS A;  4PUO A;  4FZX C;  3B6O A;  4DSL A;  2VG6 A;  1VRT A;  4NYF A;  3AVA A;  4OKE A;  4DTP A;  3T3F A;  1NKE A;  2BGG A;  4BWM A;  3CFP A;  1ASU A;  3ZT1 A;  4CGJ A;  4CIE A;  3DLK A;  3HST B;  3PX6 A;  3SQ1 A;  3SQ0 A;  1NJY A;  2X74 A;  1X1P A;  3AO1 A;  1CZB A;  4O44 A;  2YKM A;  4CFA A;  3ULD A;  3QER A;  5SWM A;  4CHY A;  4DQP A;  4ELT A;  4NCB A;  2VG5 A;  4ID1 A;  3C95 A;  1TV6 A;  2G8F A;  1U4B A;  4CF0 A;  1BIU A;  4KTQ A;  4FJG A;  3V1Q A;  1HJR A;  3VQP A;  2QKK A;  1I39 A;  3DM2 A;  2ETJ A;  5FRM A;  2F8S A;  4DTJ A;  2IAJ A;  3HYF A;  3V9S A;  3TAN A;  2YV0 X;  3DLE A;  3OYH A;  3U3Y A;  2ZE2 A;  3ZSR A;  1DTQ A;  1K6Y A;  1NK6 A;  1KFD A;  1RCH A;  3V6D A;  1NOZ A;  4CJV A;  3AO4 A;  4CK1 A;  1RBR A;  3DLB A;  5HP1 A;  3L2Q A;  4KI6 A;  3TWH A;  2HHV A;  3VQB A;  2Y1I A;  3AVF A;  4GVM A;  5I42 A;  1JLQ A;  3VN5 A;  3LWL A;  4DSF A;  3OS1 A;  4CEO A;  1SL0 A;  3V9U A;  4EZ9 A;  4IBN A;  4F2R A;  4GMJ B;  5FDL A;  3U3G A;  3SPY A;  4DMN A;  3V9Z A;  2P5G A;  3AVC A;  1HYZ A;  1VSH A;  3K5M A;  1C6V A;  4W5R A;  1RT3 A;  2NUB A;  3PO5 A;  1L3U A;  3TAR A;  1CXQ A;  3NF6 A;  2QK9 A;  3DOL A;  1NJZ A;  1HNI A;  1BCM A;  1KTQ A;  5KI6 A;  4DSI A;  1VSL A;  1WSE A;  3PX4 A;  2HW3 A;  3OYD A;  4J2E A;  4TSX A;  3LPT A;  3I8D A;  3QEV A;  1IO2 A;  1S1T A;  4O0J A;  1JLE A;  1VSK A;  4KTZ A;  4Q5V A;  2FBT A;  2YHA A;  4DF4 A;  1REV A;  1UOC A;  3L3V A;  1KVB A;  4CJR A;  2KTQ A;  3TAF A;  4KB1 A;  4J2D A;  4B08 A;  4I9Q A;  4CEE A;  3OYE A;  2X6S A;  2HNY A;  4RW8 A;  2YNG A;  1VRU A;  4LH5 A;  3L2U A;  3HVT A;  4CGI A;  1IH7 A;  4C8M A;  5T7B A;  3KTQ A;  3LPU A;  1X9M A;  1C0M A;  3VQC A;  2QKB A;  4DWI A;  3KKS A;  3V1O A;  5KGW A;  1L5U A;  2X6N A;  3RMB A;  3EY1 A;  1R0A A;  1HNV A;  1RTI A;  3PUF A;  1U49 A;  3ZSX A;  4DTX A;  1L3S A;  2WON A;  3NHG A;  3NF8 A;  2E6L A;  1LWF A;  2HVH A;  4IFY A;  1SUQ A;  4OVL A;  3M8Q A;  3C6T A;  3NAE A;  1NJX A;  3ISN C;  2B6A A;  4CK3 A;  3NE6 A;  3D45 A;  1BGX T;  1QE1 A;  3HPG A;  4OJR A;  5J2N A;  3QEI A;  3AVL A;  3SQ2 A;  3WNE A;  2Z1G A;  2Y1J A;  1JXB A;  1NK7 A;  2DFF A;  3DLR A;  4F3T A;  3CG7 A;  4GW6 A;  3K5N A;  3SQ4 A;  2OYQ A;  4O5B A;  4G1Q A;  2R7Y A;  5CYM A;  1FKP A;  3ZSQ A;  3OJS A;  1J54 A;  1XC9 A;  1JLC A;  5J1E A;  1D9F A;  1RTH A;  4DFJ A;  3KK2 A;  1X9W A;  3FFI A;  4KHN A;  1KVA A;  4HUE A;  4C8O A;  1VSD A;  4KRF A;  3K59 A;  1WAF A;  1U48 A;  1KRP A;  1XHZ A;  4FJ5 A;  3AO2 A;  4CEA A;  4Z0U A;  3OYI A;  1O1W A;  5DK5 A;  2IOC A;  2YHB A;  4CHQ A;  3KK3 A;  4DSK A;  4QOZ B;  4FCY A;  3LZI A;  3ITH A;  1S6P A;  5HRR A;  4OLA A;  3VQE A;  1HPZ A;  4E1N A;  1TAU A;  3ZT0 A;  1S9G A;  1C1A A;  2B5J A;  1TL1 A;  4M3Z A;  3QES A;  5K14 A;  1J9A A;  2F8T A;  1WSF A;  1ZBU A;  1KLN A;  4M3T A;  1BCO A;  4Z4I A;  4JRQ A;  3SUN A;  4KFB A;  4AHV A;  4BE2 A;  4FJJ A;  4CIF A;  3VA3 A;  4PY5 A;  4ELV A;  1JLF A;  3K5L A;  4Z4E A;  1TKZ A;  4LY7 A;  1S1W A;  1X9S A;  1WN7 A;  4IG3 A;  3S9H A;  4CEC A;  3VQ5 A;  5FRN A;  1W0H A;  2YKN A;  3MXJ A;  4CJ5 A;  3MEG A;  2OPS A;  3IRX A;  2A1R A;  2XY7 A;  4FVM A;  4DQQ A;  4FJH A;  4KHU A;  4FZZ A;  4CED A;  3HJF A;  4Q0B A;  4O4G A;  3HT3 A;  4I2P A;  3AO5 A;  3B6P A;  3T19 A;  1JKH A;  1LWE A;  5HRP A;  1T7P A;  3OYC A;  3RRG A;  3LZJ A;  4B8C A;  1WSH A;  3KLI A;  3NH2 A;  5C24 A;  1C0T A;  3NH1 A;  3HM9 A;  4M42 A;  4B9N A;  3ZCM A;  4DQR A;  2FC0 A;  4ELU A;  1SKW A;  4HCB A;  5SZT A;  1S6Q A;  3L3U A;  3NFA A;  4JS4 A;  3SYZ A;  4FW1 A;  2O4I A;  4KKO A;  4FLW A;  2KZZ A;  2XY5 A;  3OVN A;  1IKV A;  1LW2 A;  4HHT A;  1C0U A;  4OPK A;  1TL3 A;  2DFE A;  4Z4H A;  1Q8I A;  4FM1 A;  3NGY A;  1QTM A;  3DRP A;  1UWB A;  1YVU A;  4HTU A;  4DQS A;  3K5O A;  4CGH A;  1TK8 A;  2RKI A;  5E41 A;  4RW4 A;  4CFB A;  3SNN A;  3MAQ A;  3LP0 A;  1DLO A;  2GBZ A;  2X78 A;  3AVN A;  1HYS A;  3OS0 A;  2IDO A;  3CFR A;  3TR8 A;  5KRT A;  3OYA A;  1TAQ A;  3LDS A;  1EKE A;  1MU2 A;  2HHW A;  1FK9 A;  4CIG A;  1DTT A;  4LSN A;  5JS1 A;  3VQD A;  1NK0 A;  1B9D A;  4F2S A;  1KSP A;  4I9L A;  4Y1D A;  2KFN A;  4H4M A;  2D0C A;  4B3O A;  2ZD1 A;  3BGR A;  2FBY A;  3WNG A;  3AVH A;  4BWJ A;  4R5P A;  4O0I A;  4FLY A;  1XWL A;  4Z4G A;  4UQG A;  1KLM A;  2GUI A;  5DMR A;  4RW9 A;  4C8N A;  4CGD A;  1IG9 A;  1RDC A;  4DQI A;  4IKF A;  1NK8 A;  2DTU A;  4Z4F A;  4M41 A;  1ZBH A;  4E7K A;  3HO1 A;  3VQ7 A;  3OYM A;  4YNQ A;  3HXM A;  1SKR A;  3DLH A;  3OY9 A;  1N5Y A;  4FJK A;  3ZSZ A;  4QAG A;  4DF8 A;  1G15 A;  1IKX A;  3JSM A;  3OYN A;  3SUP A;  4CEZ A;  3G0Z A;  3NF9 A;  3KLG A;  3NH0 A;  4DLE A;  1YTA A;  4E7I A;  1RBS A;  1T05 A;  4K8Z A;  4PQU A;  1UA0 A;  1RBU A;  4XIU A;  2D0A A;  4BE1 A;  1NJW A;  1WAJ A;  1CZ9 A;  1ITG A;  1RDD A;  3DRS A;  4KHQ A;  3ZSO A;  2DFH A;  3QNN A;  3OYL A;  3V4I A;  4CJW A;  1TKD A;  1Z26 A;  3OS2 A;  3L2R A;  4FW2 A;  4EP5 A;  3F73 A;  4CHP A;  4CFD A;  4MFB A;  3RMD A;  2BAN A;  3M8S A;  3LP3 A;  3AA3 A;  2RN2 A;  4CES A;  5HBM A;  1SL2 A;  1N6Q A;  1TKT A;  2EX3 A;  2B4J A;  4CJ4 A;  4B9M A;  3QIO A;  3K57 A;  4M3Y A;  1NK5 A;  4CJQ A;  4KO0 A;  1CXU A;  4EZ6 A;  2G8U A;  4CCH A;  4CEQ A;  5J2M A;  1BQM A;  2KW4 A;  4DU3 A;  3MXM A;  3LAK A;  4CEF A;  1S5J A;  3DMJ A;  4FJM A;  4M3X A;  3DI6 A;  1NKC A;  4BDP A;  4FLT A;  4DTM A;  4KAZ A;  1W9H A;  1RT1 A;  4CJE A;  4N5S A;  1S9E A;  2WOM A;  2G8K A;  1NOY A;  1JL1 A;  4FJL A;  1B9F A;  3QEW A;  1WSI A;  2Q3S A;  4M3W A;  1IKW A;  2HHT A;  2XY8 A;  3M8R A;  2O4G A;  1S1X A;  1TK0 A;  3HP9 A;  2F96 A;  2Z1H A;  2FBX A;  1LAV A;  3TAP A;  4FK0 A;  3SV4 A;  1ZBL A;  2BE2 A;  1WSG A;  3WNF A;  4CK2 A;  4KTW A;  3KK1 A;  4K8X A;  2HMI A;  1FXX A;  3VQQ A;  2P5O A;  1WNS A;  5KGX A;  5HRN A;  3U6F A;  2XO7 A;  4W5N A;  4CJK A;  1T8E A;  1L3V A;  1EXQ A;  4BDY A;  1RTD A;  5C42 A;  4JRP A;  1T03 A;  3V9W A;  4B9S A;  1ZBF A;  3MEE A;  2HHQ A;  3HVR A;  4AHC A;  4DS5 A;  4CJS A;  4HVJ A;  3CFO A;  4ID5 A;  4OKK A;  3OYB A;  3AA2 A;  4DFK A;  3SPZ A;  4FJX A;  3E01 A;  4DS4 A;  4CJF A;  3V1R A;  3DLG A;  4KHY A;  3RR7 A;  3KD5 E;  3ZT4 A;  4E7J A;  3LAM A;  1EX4 A;  1QSS A;  3ZT2 A;  4ZTJ A;  3IG1 A;  3O3F A;  1YTU A;  4FYD A;  4KV8 A;  1RDA A;  2E4L A;  4CGG A;  3RMA A;  1ZYQ A;  4HUF A;  3TAE A;  1U47 A;  4L8R B;  2A1S A;  3SCX A;  2HHX A;  4C8K A;  1GOB A;  4FLV A;  1QQC A;  1JLB A;  1KVC A;  2XRI A;  3KLH A;  4FK4 A;  4B9U A;  3QIN A;  1RIL A;  3QLH A;  3P83 D;  2VWJ A;  3QO9 A;  2G8H A;  1ZBI A;  1Y97 A;  1LW0 A;  2LSN A;  2RF2 A;  4YFU A;  4KB0 A;  4CHN A;  2I5J A;  4FLU A;  4AHT A;  2PZS A;  3OYK A;  2D5R A;  4CJT A;  4FLX A;  3P5J A;  1NK4 A;  3TAG A;  1BHL A;  4ICL A;  2Z1J A;  3C94 A;  1ASV A;  3ZSV A;  4CER A;  4CF1 A;  3NGZ A;  2YNI A;  4RW7 A;  3KKR A;  4HUG A;  3TAQ A;  1KFS A;  4PWD A;  2KFZ A;  1JLA A;  3HP6 A;  4AHU A;  4E89 A;  1WSJ A;  2PYL A;  5HRS A;  1KCF A;  1CLQ A;  4E7L A;  4CF9 A;  4I7F A;  4FM2 A;  1UA1 A;  4W5T A;  1XI1 A;  3CM6 A;  3OYG A;  1TVR A;  3KIO A;  1D5A A;  1BL3 A;  3AA5 X;  1S1V A;  3VQ6 A;  4KHW A;  4DU4 A;  2ITG A;  1VSJ A;  2IGI A;  3HPH A;  4RG8 A;  3LWM A;  3LP1 A;  4OPJ A;  2Z1I A;  3ZT3 A;  4CJL A;  3LP2 A;  1JL2 A;  4WE1 A;  3SV3 A;  1J5O A;  3AVM A;  4B9V A;  3K2P A;  3P1G A;  4FJ9 A;  4FJI A;  4N76 A;  4AHS A;  1RT4 A;  3AVK A;  2XY6 A;  2HHU A;  4CJU A;  3AVJ A;  1U45 A;  4FJ7 A;  1QSL A;  2QXF A;  3WNH A;  3RRH A;  1VK0 A;  4H4O A;  4FZY A;  1Z25 A;  3HL8 A;  4CEB A;  2PYJ A;  3AV9 A;  3CYM A;  1TK5 A;  4FXD A;  4CJP A;  3V81 A;  3AVB A;  3O4N A;  3MEC A;  2E6M A;  4FM0 A;  1QHT A;  4IDK A;  1BQN A;  1RNH A;  3T1A A;  4F3O A;  2JLE A;  3NDK A;  3H08 A;  3AVG A;  2PY5 A;  4N56 A;  1VSF A;  2BDP A;  4NCA A;  3ASM A;  1F21 A;  2W42 A;  4BDZ A;  1SL1 A;  4IFV A;  1LAW A;  2EHG A;  3OYJ A;  3AVI A;  3NBP A;  3IAY A;  1UAX A;  1TKX A;  3I0R A;  4E0D A;  1GOC A;  1IKY A;  1JXE A;  3KLE A;  5CYQ A;  3ZSY A;  3L8B A;  3DRR A;  3S3O A;  3SUO A;  1RTJ A;  4NCG A;  3AO3 A;  2P1J A;  3M8P A;  4H8K A;  1WLJ A;  4DLG A;  2OPR A;  2OZS A;  2GV9 A;  3RWU A;  1EET A;  4DU1 A;  2HND A;  5D3G A;  4PA1 A;  2OPQ A;  3DOK A;  5CZ1 A;  4CGF A;  2ATQ A;  3LAN A;  3SI6 A;  3EYZ A;  3V9X A;  2DY4 A;  2G8I A;  3VQA A;  5KTQ A;  4J2B A;  3QIP A;  1HQE A;  2P51 A;  4LSL A;  4CJ3 A;  4O55 A;  4B8A B;  1C1B A;  1C1C A;  3SZ2 A;  3THV A;  3UIQ A;  4FJN A;  3O3G A;  1J53 A;  5JS2 A;  3MXI A;  4B9L A;  4BE0 A;  4E3S A;  4DSE A;  4E1M A;  4DFM A;  3TAB A;  3VQ4 A;  2RPI A;  3D0P A;  1RBT A;  4DTS A;  5FRO A;  3PO4 A;  4KHS A;  1RT7 A;  4CFC A;  2OZM A;  3TAM A;  4DFP A;  3PX0 A;  3L2W A;  1TGO A;  1RDB A;  3S3N A;  1QS4 A;  3QEX A;  4F4K A;  5C25 A;  4OGC A;  3L2V A;  3OJU A;  5HLF A;  4NYN A;  4M3R A;  1RT2 A;  1RT5 A;  2D0B A;  4EP4 A;  3S3M A;  4DSJ A;  3OYF A;  1HMV A;  4KRE A;  5HRO A;  1BI4 A;  1A5V A;  4B9T A;  4AH9 A;  3O3H A;  2ZQB A;  1D8Y A;  3ALY A;  3QEP A;  5J2P A;  1HYV A;  4OLB A;  2HVI A;  4MQ3 A;  2OPP A;  1BIZ A;  4BAC A;  3RTV A;  4W5O A;  4DTR A;  1HQU A;  3K58 A;  3PV8 A;  2YNH A;  3TI0 A;  3HK2 A;  4CHZ A;  4DTO A;  3RR8 A;  5CZ2 A;  4RW6 A;  3IS9 A;  4ZHR A;  4DTN A;  4CF8 A;  1QSY A;  1JLG A;  3NF7 A;  4W5Q A;  4JS5 A;  4N47 A;  1YT3 A;  4Z4C A;  1NK9 A;  1LV5 A;  4N41 A;  3AA4 A;  4OGE A;  3G10 A;  4ZTF A;  4I2Q A;  2G8W A;  3JYT A;  3SUQ A;  3KLF A;  3I0S A;  2FBV A;  4E19 A;  3BDP A;  1BIS A;  5J2Q A;  3KD1 E;  2OA8 A;  4KI4 A;  3ZSW A;  1XHX A;  2HHS A;  2IS3 A;  4FK2 A;  2KZM A;  1HRH A;  1SV5 A;  5CY4 A;  1EP4 A;  3A2F A;  3SJJ A;  1VSI A;  5KRS A;  4Y1C A;  1Q9Y A;  2HB5 A;  3VQ8 A;  3KJV A;  1B92 A;  2KQ2 A;  3DYA A;  1Q9X A;  1A5W A;  3VQ9 A;  1RBV A;  3F9K A;  4CHO A;  1ASW A;  3NGI A;  4AHR A;  4J2A A;  4QCL A;  3PY8 A;  5EU7 A;  2VWK A;  2VG7 A;  3LAL A;  4DG1 A;  3CQ8 A;  3HPO A;  4DTU A;  1LWC A;  1NKB A;  1GOA A;  1I3A A;  3EZ5 A;  4CE9 A;  4LH4 A;  3VA0 A;  2JGU A;  2G8V A;  3RMC A;  2AJQ A;  5I3U A;  2XHB A;  1D9D A;  1S1U A;  4OKJ A;  4C8L A;  4FJ8 A;  1VSM A;  4FLZ A;  3QET A;  3QNO A;  4HCC A;  3CM5 A;  2YNF A;  2HNZ A;  4LD0 A; 
#chains in the Genus database with same CATH topology
 1N34 K;  4F8R A;  4JKH A;  4JLH A;  2YJE A;  3U4L A;  1N8R O;  4M3U A;  1L3T A;  4PUO A;  3B6O A;  3HI0 A;  4DTP A;  3T3F A;  2NRV A;  4LFC K;  3CFP A;  3C65 A;  3ZT1 A;  4CGJ A;  4CIE A;  3HST B;  1X1P A;  3ULD A;  4ELT A;  4CFA A;  3CJA A;  4ID1 A;  2G8F A;  4CF0 A;  3IMX A;  1HJR A;  2IVO A;  3VQP A;  3SAG A;  3G4S N;  1HUX A;  3V9S A;  3TAN A;  2VWB A;  1NK6 A;  3CCR N;  3V6D A;  3DLB A;  1RBR A;  4ISG A;  4QS8 A;  5GAH P;  1WB9 A;  3VQB A;  1QQN A;  2UXB K;  3TTF A;  5I42 A;  3HOS A;  1JLQ A;  3FR0 A;  3VN5 A;  4CEO A;  2PBD A;  3SAF A;  3JAM O;  2P5G A;  1Q81 O;  1L3U A;  3TAR A;  3DOL A;  1HNI A;  2BTF A;  1KTQ A;  1VSL A;  1WSE A;  2HW3 A;  3OYD A;  3VEW A;  3JXU A;  3I8D A;  1IO2 A;  4BRL A;  1JLE A;  2E2O A;  4KTZ A;  3VER A;  2A41 A;  2FBT A;  4JKF A;  3E1Y A;  4Q5V A;  3CCL N;  1KVB A;  4KB1 A;  4B08 A;  4IJA A;  4AM6 A;  2FF3 B;  1QQM A;  3W0L A;  3GDQ A;  3DXM B;  2A5X A;  4LH5 A;  1SAZ A;  1QZ5 A;  3HVT A;  3TPQ A;  2QKB A;  4DWI A;  5KGW A;  4FWP A;  4LF9 K;  1DT9 A;  3NVM A;  4YOW A;  5FPE A;  4H0O A;  3NHG A;  3NF8 A;  4H5R A;  1TUY A;  4IFY A;  3M8Q A;  5BPL A;  3NAE A;  3ISN C;  1VQM N;  2B6A A;  4CK3 A;  3D45 A;  4KH5 A;  1QE1 A;  2HST A;  3TSQ A;  4RWT A;  1RDU A;  3SQ2 A;  2Z1G A;  1NK7 A;  1JXB A;  2DFF A;  3AGR A;  4BC5 A;  3A5N C;  2W6L A;  3TSU A;  3SQ4 A;  4LF4 K;  1KXP A;  5CYM A;  3ZSQ A;  4YDU C;  4BR2 A;  4YY3 K;  2P9I B;  2NRH A;  4BRI A;  3I8B A;  3O4W A;  3J8A A;  1KRP A;  4FJ5 A;  4CD3 A;  3AO2 A;  4Z0U A;  1O1W A;  5DK5 A;  2YHB A;  4BRA A;  2YX6 A;  4FCY A;  1NGI A;  1HPZ A;  1TAU A;  2YI1 A;  4H03 B;  2B5J A;  4I6M B;  2A3Z A;  1ZBU A;  1BCO A;  3BEX A;  4KFB A;  4AHV A;  1IBL K;  2IVN A;  4CIF A;  5FPD A;  4ELV A;  1TKZ A;  1VQP N;  4IG3 A;  4A2A A;  1JCE A;  3MXJ A;  2A1R A;  3HJF A;  4Z94 A;  3AO5 A;  3U9D A;  5HOO A;  3VGK A;  3T19 A;  5HRP A;  4K41 A;  3FZM A;  4B8C A;  3Q7B A;  3KLI A;  4B9N A;  3ZCM A;  4ELU A;  4BC2 A;  3EKU A;  3W3D A;  4MO5 A;  3J7Y P;  3THY A;  3F2K A;  4KKO A;  4FLW A;  3OVN A;  2I7P A;  3ULE B;  4HHT A;  1YIT N;  1Z6R A;  1TL3 A;  1Q8I A;  2NLX A;  1YVU A;  2VYP A;  3K5O A;  5E41 A;  3LP0 A;  1DLO A;  2X78 A;  3AVN A;  3CFR A;  2IDO A;  3PLA A;  5KRT A;  2HHW A;  1TAQ A;  2HBL A;  2YHW A;  3VQD A;  5AQJ A;  1IJJ A;  4J8F A;  5AQS A;  4JKE A;  2FBY A;  4JI0 K;  4BWJ A;  4O0I A;  3ATV A;  4CGD A;  4IKF A;  1RDC A;  4DQI A;  4M41 A;  5JVH L;  1BU6 O;  3OYM A;  3ENH A;  3P38 A;  3ENB A;  3N4P A;  3HXM A;  5EX5 A;  2O8D A;  1N5Y A;  3ZSZ A;  4QAG A;  1KC8 O;  1G15 A;  1IKX A;  3SUP A;  3G0Z A;  4DLE A;  4HTL A;  1M90 O;  4K8Z A;  1XNQ K;  4PQU A;  4XIU A;  1RDD A;  1TUU A;  3QNN A;  4CZE A;  3OYL A;  3OS2 A;  3L2R A;  4JKD A;  4FW2 A;  4CFD A;  3CCJ N;  1KQS M;  3RMD A;  2VCP A;  2HHH K;  2RN2 A;  2RHK A;  1SL2 A;  2FSN A;  1HJO A;  4CJ4 A;  3QIO A;  3K57 A;  4M3Y A;  1T3V A;  2G8U A;  1VQ9 N;  4A5A A;  2KW4 A;  4O8K A;  3CHW A;  3MXM A;  4WFA L;  4EFH A;  4M3X A;  3DI6 A;  2P9P A;  3C0B A;  3O1W A;  4N5S A;  4FJL A;  2G8K A;  3TTC A;  1NOY A;  1B9F A;  2Q3S A;  3THX A;  4M3W A;  3CIP A;  1W2B M;  2O4G A;  1S1X A;  3HP9 A;  2F96 A;  4IXC A;  1LAV A;  4JNE A;  1ZBL A;  1Q86 O;  1HKC A;  4K8X A;  1FXX A;  3MCA B;  3WEE A;  1WNS A;  2XO7 A;  3CMA N;  1HR0 K;  1RTD A;  2FSJ A;  2QWQ A;  4FSV A;  3V9W A;  1WBD A;  4B9S A;  3MEE A;  2V7Z A;  5FPN A;  2QWL A;  5CHI A;  4HVJ A;  1NWK A;  2FSK A;  4FJX A;  4B3M K;  4DFK A;  4CJF A;  3KD5 E;  4E7J A;  3LAM A;  1EX4 A;  4FWO A;  4KV8 A;  3C6H A;  3HTV A;  4BQL A;  2Q2R A;  3SCX A;  4FLV A;  3OTO K;  4C8K A;  1JLB A;  1KVC A;  4FK4 A;  1NGE A;  2LSN A;  2RF2 A;  1NGG A;  4FPA A;  5AQF A;  4FLU A;  1NK4 A;  5KPZ A;  1BHL A;  3MK6 A;  4BR5 A;  4CER A;  1ASV A;  3ZSV A;  4CF1 A;  4HUG A;  4PWD A;  2KFZ A;  2E8A A;  4XH4 A;  4AHU A;  2WC9 A;  1KCF A;  4JD2 A;  5BR8 K;  4LF7 K;  3QB0 A;  3CM6 A;  3KIO A;  4JKG A;  3THW A;  1LCU A;  3GOI A;  5TKY A;  4BGB A;  3QFP A;  3LP1 A;  3WUH A;  4CJL A;  3VTH A;  4B9V A;  3HZ6 A;  2HHU A;  4CJU A;  4H4O A;  2PYJ A;  3HL8 A;  4BR7 A;  1TK5 A;  1XMQ K;  5DM7 L;  4JEP A;  5KQD A;  3AVG A;  2I7N A;  4LFA K;  2BDP A;  3OYJ A;  1LAW A;  1UAX A;  3I0R A;  4U7B A;  3SUO A;  4NCG A;  3E9O A;  2ZGZ A;  4FO0 A;  1WLJ A;  2P9L B;  2A42 A;  3J7Z O;  4PA1 A;  3D2E A;  3LAN A;  3V9X A;  3P39 A;  3QIP A;  1HQE A;  1NGJ A;  2D4W A;  3CCS N;  3A5L C;  4B9L A;  3L4I A;  2UU9 K;  4V19 S;  5TKW A;  2RPI A;  3D0P A;  3E9P A;  3ZYY X;  3CJ9 A;  3U9Z A;  3PO4 A;  4CZK A;  1TGO A;  1U6Z A;  2QA4 N;  1QS4 A;  3QEX A;  3L2V A;  4NYN A;  3S3M A;  2D0B A;  4DSJ A;  3OYF A;  1HMV A;  3SJH A;  5HRO A;  1BI4 A;  5F2R A;  2E5L K;  3NVK A;  4AH9 A;  3A0I X;  1BDG A;  3M1F A;  4CW7 B;  3L6Q A;  1N36 K;  2ZQB A;  3LDP A;  1HNW K;  4FWM A;  4CJ7 A;  4WF9 L;  2OPP A;  1BIZ A;  4W5O A;  1OVY A;  3OHR A;  4RW6 A;  3IS9 A;  4ZHR A;  2O8E B;  4CF8 A;  2FF6 A;  4W5Q A;  4N47 A;  4N41 A;  3AA4 A;  4OGE A;  4I2Q A;  1SQK A;  5AQI A;  3SUQ A;  4IOC L;  3I0S A;  3BDP A;  3KD1 E;  5C0Y A;  4CVN E;  3KWI A;  3LDL A;  4BQZ A;  4KI4 A;  1XHX A;  3A2F A;  5LMN K;  3D2F A;  5BN9 A;  3VQ8 A;  1J6Z A;  2QWR A;  3VQ9 A;  1YUW A;  3NGI A;  4QCL A;  1ASW A;  4AHR A;  1DKG D;  4DG1 A;  2JGU A;  1Q18 A;  4DQ8 A;  1VSM A;  4EHT A;  5LL6 Z;  4HCC A;  2NRR A;  1GLJ O;  4F9O A;  4IZ9 A;  4KPY A;  1A5X A;  1RT6 A;  2QWP A;  4L3Q A;  4E7H A;  4CF2 A;  3O4Q A;  3MED A;  4IG0 A;  1FKO A;  4M45 A;  3MWT A;  2VG6 A;  3AVA A;  1V4S A;  1ASU A;  2EWS A;  1NJY A;  4H5W A;  3WQT A;  2YKM A;  4DQP A;  4NCB A;  2VG5 A;  3C95 A;  1I39 A;  5JMV A;  4BR0 A;  4DTJ A;  2IAJ A;  4FWN A;  4PKH A;  2ZE2 A;  1K6Y A;  1NGD A;  4CJV A;  3AO4 A;  4CK1 A;  3H46 O;  3L2Q A;  4KI6 A;  1VQ8 N;  4BRE A;  4DSF A;  3KZB A;  3V9U A;  4IBN A;  4GMJ B;  5FDL A;  4DMN A;  3V9Z A;  5HL7 L;  3AVC A;  1VSH A;  1RT3 A;  4M7X A;  5AQL A;  1CXQ A;  3NF6 A;  1QVG M;  1NJZ A;  5KI6 A;  2HMP A;  3KVG A;  3LPT A;  3CPW M;  3S41 A;  4JI4 K;  4CJR A;  4J2D A;  1ESV A;  3MN7 A;  4A2B A;  4H5V A;  2HNY A;  3L2U A;  2BUP A;  1X9M A;  3V1O A;  4JK8 A;  3EY1 A;  1HNV A;  3PUF A;  4BVO A;  3MMV A;  1EWQ A;  4CZF A;  4DTX A;  1L3S A;  2WON A;  1BWF O;  4NO7 A;  1NJX A;  4MDB A;  3DJC A;  4OJR A;  1KAZ A;  3QEI A;  3AVL A;  1K73 O;  3WNE A;  4CZL A;  4F3T A;  3G71 N;  5AZJ A;  3CG7 A;  4GW6 A;  4M7Y A;  4WFN L;  1YF5 L;  2OCE A;  1FKP A;  1XC9 A;  1D9F A;  1GLE G;  3FFI A;  1VQ6 N;  1NGF A;  3H1Q A;  3SBG A;  1VSD A;  3N4Q A;  1MDU B;  4FOE A;  3J7A P;  3O08 A;  4K25 A;  3KK3 A;  1OH5 A;  4QOZ B;  4RCH A;  4EIA A;  4OLA A;  1S6P A;  5BN8 A;  4M3Z A;  3ZEU A;  3QES A;  4YHH K;  1J9A A;  5JLH A;  2UYT A;  3SUN A;  3VEX A;  4PY5 A;  4GKJ K;  3QBX A;  1WN7 A;  4BC4 A;  1BO5 O;  3S9H A;  4CJ5 A;  3MEG A;  3IRX A;  3WXL A;  4FVM A;  3J81 O;  4FJH A;  2V7Y A;  3KK7 A;  3CCE N;  1LWE A;  1BUP A;  2ASP A;  3OYC A;  3LZJ A;  3CC4 N;  1WSH A;  3NH1 A;  4NXN K;  1T44 A;  2FC0 A;  5SZT A;  3NFA A;  2O4I A;  4CZH A;  2XY5 A;  3VTI A;  4BY9 C;  2D0P A;  2DFE A;  4Z4H A;  3NGY A;  2ZJP L;  5AQZ A;  3DRP A;  5M1F A;  1UWB A;  4DQS A;  4BRO A;  4PL8 A;  4RW4 A;  4GNI A;  3SNN A;  1HYS A;  3OS0 A;  3OYA A;  3LDS A;  4X65 K;  4LSN A;  1B9D A;  3R1X A;  1KSP A;  5AR0 A;  1NGC A;  1R59 O;  3H1V X;  3CME N;  3BGR A;  3AVH A;  4H5N A;  5ADX A;  4H0V B;  3K9K A;  4RW9 A;  1U2V A;  1NK8 A;  2Q1N A;  3HO1 A;  4ISF A;  1SKR A;  2HBJ A;  3CJ1 A;  5GAG P;  3NF9 A;  3EZW A;  3VEV A;  2W40 A;  1YTA A;  3VGL A;  1T05 A;  2UUA K;  2D0A A;  2GEM A;  4BE1 A;  1WAJ A;  4JHD A;  1CZ9 A;  3THY B;  2DFH A;  4CJW A;  1HKG A;  3FLC O;  1IBM K;  3LP3 A;  2NNW A;  4CES A;  5HBM A;  1N6Q A;  1TKT A;  3CCV N;  2EX3 A;  5KQ8 A;  4CJQ A;  4BRN A;  5FPM A;  3I33 A;  3DMJ A;  2QM1 A;  1NKC A;  4KAZ A;  4FLT A;  1IBK K;  5GIN A;  1BA1 A;  1S9E A;  1RGI A;  2HHT A;  1JL1 A;  3QEW A;  4XEI A;  2XY8 A;  3M8R A;  1TK0 A;  4FK0 A;  3DWL A;  3CCU N;  2O8D B;  4CK2 A;  1GLC G;  3KK1 A;  2HMI A;  2FLO A;  2P5O A;  4GV9 A;  3OBY A;  4JI1 K;  4CJK A;  1T8E A;  1EXQ A;  2GX9 A;  4OO1 J;  1T03 A;  3HVR A;  3SMP A;  4CJS A;  4CD1 A;  3CFO A;  4BG8 A;  4OKK A;  5E26 A;  3SPZ A;  1OH8 A;  5CE3 A;  3V1R A;  3DLG A;  2VQF K;  2E88 A;  1YTU A;  4FYD A;  4CGG A;  1RDA A;  1U47 A;  4HUF A;  1YAG A;  3CJB A;  2A1S A;  3O9U A;  2XRI A;  3KLH A;  1RIL A;  2G8H A;  1ZBI A;  3O8M A;  5C10 A;  1Y97 A;  1LW0 A;  3MN6 A;  2PZS A;  2D5R A;  1E4G T;  3OBW A;  2JWL A;  4CJT A;  3NGZ A;  2Z1J A;  3UE5 A;  3WT0 A;  1S72 N;  2YNI A;  2CH6 A;  1SZ2 A;  2P9P B;  5HRS A;  1CLQ A;  1X3M A;  4IWV A;  3THX B;  4CF9 A;  4FM2 A;  3OYG A;  1TVR A;  1D5A A;  2HBK A;  1K9M O;  4IEI A;  5LJV A;  4DV7 K;  1S1V A;  3VQ6 A;  4DU4 A;  3WEE B;  2ITG A;  2IVP A;  2HF3 A;  2IGI A;  3LWM A;  5BRH A;  2P9N A;  3CCQ N;  4A59 A;  1JL2 A;  3C6A A;  3SV3 A;  2D1K A;  1MWK A;  1J5O A;  3K2P A;  3P1G A;  5FLX O;  4AHS A;  1RT4 A;  2XY6 A;  3VF4 A;  1U45 A;  4FJ7 A;  1VK0 A;  2F7T A;  4CEB A;  3AV9 A;  2O8C A;  1M1K O;  4FXD A;  3V81 A;  2QW9 A;  4DV3 K;  2E6M A;  4JV5 K;  4IDK A;  1BQN A;  3T1A A;  1VQ7 N;  2W41 A;  3ASM A;  4JI7 K;  1SL1 A;  3EKS A;  4IFV A;  4JYA K;  3EEQ A;  1Y64 A;  4H5T A;  5KPR A;  4RTF D;  5F1X A;  1JXE A;  3KLE A;  5GIP A;  3ZSY A;  3L8B A;  3DRR A;  3S3O A;  2P1J A;  2O8F A;  2OZS A;  4JD2 B;  3VMF B;  2HND A;  5D3G A;  4CGF A;  1GLA G;  2QXL A;  5JLF A;  4JKG B;  3EYZ A;  3THW B;  4A57 A;  2P51 A;  2E2Q A;  4LSL A;  4CJ3 A;  5AQW A;  4FJN A;  1YXQ A;  2VGN A;  4E3S A;  4DFM A;  3TAB A;  1RBT A;  1QQO A;  2F9W A;  4KHS A;  1RT7 A;  4CFC A;  2OZM A;  4AF1 A;  3TAM A;  1RDB A;  5C12 A;  4F4K A;  2QWM A;  4OGC A;  5HLF A;  2ZJQ L;  1A5V A;  4B9T A;  5C2D A;  2Q36 A;  3QIC A;  1ATS A;  3ALY A;  3QEP A;  4MQ3 A;  3Q7C A;  3LM9 A;  4BAC A;  3RTV A;  3PV8 A;  3TI0 A;  3HK2 A;  3F9M A;  4DV2 K;  1JLG A;  3NF7 A;  4JS5 A;  4Z4C A;  4ZTF A;  2G8W A;  2JWK A;  2OA8 A;  2HBM A;  3O9S A;  2UUB K;  3D2E B;  5C2F A;  3K0S A;  1HRH A;  1EP4 A;  1VSI A;  3TTD A;  4DCH A;  2QEX N;  2KQ2 A;  3IKM A;  1XQS C;  3M5R A;  3DYA A;  1Q9X A;  3AGK A;  1RBV A;  2CGK A;  3F9K A;  2VG7 A;  3LAL A;  1NKB A;  4KH6 A;  1LWC A;  4A5B A;  4BRH A;  4CE9 A;  1VQO N;  2AJQ A;  1S1U A;  4FJ8 A;  4FLZ A;  1JCG A;  3TAQ A;  1BI4 B;  3C6U A;  4JK7 A;  4WQ5 A;  1EQY A;  3HSC A;  1C0G A;  3FE1 A;  4KBO A;  1VSE A;  4AIL C;  1SKS A;  4C1N I;  4DSL A;  4OKE A;  3EL2 A;  4NYF A;  5EVZ A;  4DUZ K;  2BGG A;  4BWM A;  2UUC K;  3SQ0 A;  4IEE A;  3PX6 A;  4BR9 A;  1CZB A;  3PSF A;  3QER A;  3D6R A;  3VF6 A;  3G25 A;  2ASO A;  1U4B A;  1FW6 A;  4KTQ A;  3V1Q A;  1X9J A;  2ETJ A;  5FRM A;  2F8S A;  1FJG K;  1HX1 A;  1NLV A;  3DLE A;  3OYH A;  3U3Y A;  3EE8 A;  5JIC A;  5BRF A;  1KFD A;  1RCH A;  2GUP A;  1NOZ A;  4IOA L;  3O9R A;  2HHV A;  3TWH A;  4FWR A;  1W7A A;  3D2F B;  2Y1I A;  5A2Q O;  4GVM A;  3LWL A;  1SL0 A;  3QDK A;  5AQX A;  5AQM A;  1S22 A;  3UKU A;  3U3G A;  3GBT A;  3OA9 A;  3K5M A;  4W5R A;  2NUB A;  3PO5 A;  1BCM A;  4DSI A;  2A40 A;  4MLH A;  1BOT O;  2WFB A;  4JKB A;  4J2E A;  4DR7 K;  4TSX A;  3QEV A;  1S1T A;  3T1Y K;  3KHY A;  4DF4 A;  2YHA A;  1REV A;  1UOC A;  2CGL A;  2ZJR L;  3LM2 A;  1HNX K;  1K8A O;  4AM7 A;  2ZGY A;  4RW8 A;  2YNG A;  4BRC A;  1VRU A;  1IH7 A;  4MO4 A;  4C8M A;  5T7B A;  3LPU A;  3KTQ A;  1C0M A;  2X6N A;  5GIO A;  3RMB A;  1R0A A;  5M1P A;  3ZSX A;  4PKG A;  2E2P A;  1TYQ A;  2E6L A;  3R6M A;  1LWF A;  5JVG L;  5BRD A;  4OVL A;  2P9S A;  4YOU A;  4DKW A;  3NE6 A;  1BGX T;  2Q31 A;  4CZI A;  3R9P A;  2Y1J A;  1Q82 O;  2VQE K;  1N32 K;  3K5N A;  3DXK A;  4G1Q A;  4BRM A;  4K0K K;  2YHY A;  1J54 A;  3WXI A;  3OJS A;  1XNR K;  5J1E A;  4H0P A;  1X9W A;  3LDN A;  3BZC A;  2YJF A;  2QWN A;  4HUE A;  4C8O A;  3K59 A;  1U48 A;  1I94 K;  1XHZ A;  4H0T B;  2YCH A;  4GY2 B;  3OYI A;  2DPN A;  4CHQ A;  4DSK A;  3ITH A;  5HRR A;  3VQE A;  4U67 L;  5K14 A;  3CQY A;  2F8T A;  4GV6 A;  1GLD G;  4Z4I A;  4JRQ A;  3VA3 A;  5I9E B;  1JLF A;  2NZT A;  1S1W A;  4DV6 K;  1V4T A;  5FRN A;  1VAZ A;  1W0H A;  2Q0R A;  2OPS A;  3BY5 A;  4DQQ A;  4Q0B A;  4O4G A;  4JI8 K;  4I2P A;  1NGA A;  1HLU A;  3LDO A;  4A61 A;  1JKH A;  1T7P A;  2GWJ A;  3E66 A;  2Q97 A;  3NH2 A;  4M42 A;  4JK9 A;  4DV5 K;  2E1Y A;  5GAD P;  4DQR A;  3PSI A;  4BRG A;  5AZJ B;  1S6Q A;  3L3U A;  4JS4 A;  3SYZ A;  3SLC A;  1LW2 A;  2BH1 A;  3O6W A;  1C0U A;  4ILJ A;  3CER A;  3ZET A;  1QTM A;  4UY8 O;  4HTU A;  3MX5 A;  4BRF A;  4CI6 A;  2RKI A;  3A5M C;  1GLL O;  2GBZ A;  2GTD A;  4DR1 K;  1ZC6 A;  3AAQ A;  1FK9 A;  4CIG A;  2OTL N;  1DTT A;  1ATN A;  3G6E N;  4F2S A;  3A8Y A;  2O8B A;  4I9L A;  4Y1D A;  4H4M A;  3VOV A;  3ZEU B;  4B3O A;  1DEJ A;  2ZD1 A;  3HBT A;  4R5P A;  3AAR A;  4FLY A;  1NNE A;  2ZF5 O;  1IG9 A;  1KLM A;  5DMR A;  4C8N A;  1ZBH A;  3IUC A;  2V51 B;  3VQ7 A;  4B9Q A;  4YNQ A;  4CBW A;  3JSM A;  4PL7 A;  3OYN A;  4CEZ A;  5AQO A;  1KAX A;  4YOT A;  4E7I A;  1RBS A;  3HM8 A;  2AP1 A;  4E1J A;  1RBU A;  2Q0U A;  4FWS A;  1ITG A;  1OH6 A;  4B3R K;  4O5F A;  3V4I A;  1TKD A;  4DB3 A;  1VQ5 N;  4EP5 A;  3F73 A;  3BZK A;  3D7E O;  2UXD K;  4CHP A;  4MFB A;  3M8S A;  3AA3 A;  2E20 A;  1S3X A;  4JN4 A;  3T1H K;  1NK5 A;  4EZ6 A;  1CXU A;  5IT9 O;  3DLL L;  1YVN A;  4CCH A;  5AFU H;  5J2M A;  4DU3 A;  3BUZ B;  5BPM A;  3F5T A;  3LAK A;  1ZBS A;  4CEF A;  4FJM A;  4JI2 K;  4DTM A;  2OTJ N;  5EY4 A;  1W9H A;  2WBN A;  4A62 A;  2WUS A;  3VPZ A;  1U2V B;  1IKW A;  1EWR A;  3H6E A;  4DUY K;  1O13 A;  4FWK A;  2FBX A;  3SV4 A;  3CPE A;  2BE2 A;  4LFB K;  3WQU A;  5AQH A;  5HRN A;  2P9K A;  3AAP A;  1L3V A;  3QFU A;  4JRP A;  3ZX0 A;  2NRZ A;  5M1O A;  4JHD B;  3OYB A;  3T7Z A;  3AA2 A;  2E1Z A;  4KHY A;  4ZTJ A;  3HRG A;  2P9U B;  3IG1 A;  3RVC A;  3E9L A;  3O3F A;  1K8K A;  1ZYQ A;  2E4L A;  3RMA A;  1OH7 A;  3TAE A;  2HHX A;  4YOR A;  3FGU A;  5AQU A;  5AFU A;  3QIN A;  4KB0 A;  1WOQ A;  3OYK A;  4IJN A;  4FLX A;  3P5J A;  4ICL A;  2VWJ A;  4QS9 A;  4JAX A;  1JLA A;  1YJ9 N;  4R79 A;  4E89 A;  4BRQ A;  3H3O B;  3RSE B;  4I7F A;  3AY9 A;  4W5T A;  4ISE A;  1NU0 A;  1XI1 A;  4B3T K;  3H3N O;  3AA5 X;  3ZX2 A;  4KHW A;  5BPN A;  4WQ5 C;  3HPH A;  5AQG A;  5CR4 A;  4EHU A;  4OPJ A;  3ZT3 A;  3CJC A;  3LP2 A;  4NLB A;  4CBU A;  1NBW A;  4BGA A;  4FJ9 A;  3AVK A;  3AVJ A;  4CBX A;  1QSL A;  2QXF A;  3UKR A;  1Z25 A;  1YJN N;  3AVB A;  3O1B A;  3MEC A;  5B8H A;  4FM0 A;  1RNH A;  4F3O A;  3NDK A;  1WBB A;  3H08 A;  2PY5 A;  2PFU A;  2NRX A;  1F21 A;  2W42 A;  4BDZ A;  3NBP A;  4H0Y B;  4WYB A;  1TKX A;  1LOT B;  4E0D A;  1GOC A;  1IKY A;  2QI2 A;  1MA9 B;  3H45 C;  1XUP O;  3M8P A;  3C7N B;  3GE1 A;  4DLG A;  2OPR A;  2GV9 A;  3RWU A;  4FOI A;  5M1Q A;  2P9U A;  3VEO A;  1JCF A;  3SI6 A;  2G8I A;  3VQA A;  3M3Z A;  3T69 A;  4X62 K;  4B8A B;  1C1B A;  1C1C A;  3IDH A;  4XH1 A;  4ILG B;  2P9N B;  5JS2 A;  5IWA K;  1EO1 A;  5BR9 A;  4G9Z A;  3EN9 A;  4DFP A;  3PX0 A;  3L2W A;  3S3N A;  3K9J A;  5C25 A;  1YJW N;  4FVU A;  3VEZ A;  1RT2 A;  1RT5 A;  3CI5 A;  4KRE A;  3RSE A;  2A6A A;  2O8C B;  2FXU A;  1E4F T;  4DHY A;  3O3H A;  5J2P A;  1HYV A;  4C23 A;  4OLB A;  2HVI A;  4DR3 K;  4CZG A;  4DTR A;  1HQU A;  2YNH A;  5EOY A;  3KWG A;  3P4I A;  5CZ2 A;  3WXK A;  1YT3 A;  1LV5 A;  1QZ6 A;  3JYT A;  4DR6 K;  2O8F B;  1BIS A;  5LY3 A;  1NJI O;  4K43 A;  5CY4 A;  2ASM A;  3SJJ A;  3VF2 A;  4Y1C A;  4WFB L;  2KKZ A;  2YHX A;  3CF5 L;  3KJV A;  1B92 A;  1XC3 A;  4J2A A;  3PY8 A;  3CQ8 A;  1I3A A;  2G8V A;  2XHB A;  4C8L A;  4FWQ A;  1VQN N;  3C7N A;  4EAH D;  3QNO A;  1VQ4 N;  4LF8 K;  2YNF A;  4BR4 A;  4LD0 A;  3OW2 M;  3NCI A;  4OX9 K;  1U04 A;  2IC3 A;  3O9T A;  3O5B A;  4FZX C;  3SK3 A;  2ZWH A;  1VRT A;  1NKE A;  3DXM A;  3SQ1 A;  3DLK A;  2X74 A;  3AO1 A;  4O44 A;  5SWM A;  1BG3 A;  2KHO A;  4CHY A;  4YOX A;  1TV6 A;  1BIU A;  4FJG A;  2QKK A;  3DM2 A;  4B1Z A;  3HYF A;  2YV0 X;  1XMO K;  3ZSR A;  1DTQ A;  3VEN A;  1P90 A;  4B1Y B;  3VET A;  5LJW A;  3PIO L;  3UB5 A;  5HP1 A;  1NMN A;  4BRP A;  3AVF A;  3OS1 A;  4EZ9 A;  4WQ4 A;  4NB4 A;  4F2R A;  5H1S Q;  3SPY A;  4DR5 K;  1HYZ A;  1C6V A;  4C1N K;  2ITM A;  2QK9 A;  2P9I A;  3PX4 A;  4IFE A;  1SS6 A;  3WXM B;  3VES A;  4O0J A;  3J80 O;  4OPH A;  1VSK A;  3FZH A;  4BC3 A;  4Y0W A;  3L3V A;  3SBT A;  2KTQ A;  3TAF A;  4I9Q A;  4CEE A;  3OYE A;  4DR4 K;  2X6S A;  4B3S K;  4CGI A;  3VQC A;  4I6M A;  3KKS A;  1L5U A;  3CXC M;  1RTI A;  1U49 A;  1ATR A;  3QBW A;  4IO9 L;  4BG9 A;  2HVH A;  1SUQ A;  2H3G X;  3C6T A;  2F9T A;  3R8E A;  3HPG A;  5C15 A;  5J2N A;  4CZM A;  4DR2 K;  3QML A;  5BRE A;  1Q7Y O;  3TU5 A;  3DLR A;  3UKU B;  2OYQ A;  4O5B A;  1HPM A;  2R7Y A;  4H0X B;  5KPT A;  1JLC A;  3ULE A;  1RTH A;  4DFJ A;  3KK2 A;  5AQY A;  3IFR A;  4KHN A;  4JI6 K;  1KVA A;  4IOX A;  4KRF A;  1WAF A;  5AJ3 K;  3I55 N;  5AQN A;  1VQL N;  2CGJ A;  5DM6 L;  4CEA A;  2IOC A;  3LZI A;  1G99 A;  2NRW A;  1RFQ A;  4E1N A;  1MWM A;  2CH5 A;  3ZT0 A;  1S9G A;  1C1A A;  1TL1 A;  4MDA A;  4B1V A;  1WSF A;  1KLN A;  4M3T A;  4BE2 A;  4FJJ A;  2PAV A;  3K5L A;  4Z4E A;  4LY7 A;  1X9S A;  1TYQ B;  4JI3 K;  4DV4 K;  4CEC A;  3VQ5 A;  4LF5 K;  2YKN A;  2P9S B;  4CZJ A;  2NRT A;  1VHX A;  2XY7 A;  4KHU A;  4FZZ A;  4CED A;  3HT3 A;  3B6P A;  3ZX3 A;  3MN5 A;  5LMU K;  4BRK A;  2AA4 A;  1QHA A;  3RRG A;  3HM9 A;  5C24 A;  1C0T A;  4PHT X;  1SKW A;  4HCB A;  3CJ7 A;  1E3M A;  1T6C A;  3DXK B;  4FW1 A;  4DV1 K;  2KZZ A;  2QTD A;  1IKV A;  3M6G A;  3O80 A;  4OPK A;  3L0Q A;  4XH5 A;  4FM1 A;  1NGH A;  1KAY A;  4NLC A;  4IDH A;  4CGH A;  1TK8 A;  4CFB A;  4B1X B;  3MAQ A;  4B1W B;  1IG8 A;  3TR8 A;  1YIJ N;  3GL1 A;  1EKE A;  1MU2 A;  5JS1 A;  1NK0 A;  2KFN A;  3CQX A;  2D0C A;  3BP8 A;  2HOE A;  3ENO A;  3I56 N;  4WCE L;  1DGK N;  3WNG A;  1XWL A;  4Z4G A;  2W6K A;  1HKB A;  4UQG A;  1KD1 O;  2GUI A;  4M63 C;  2DTU A;  4Z4F A;  4E7K A;  4GKK K;  2KLA A;  3SMS A;  1GLB G;  2QWO A;  4B1U B;  3DLH A;  3OY9 A;  4FJK A;  4DF8 A;  3R3L A;  4IO8 A;  5AQP A;  5M1K A;  3ID6 A;  3MX2 A;  1YHQ N;  3CET A;  3KLG A;  3NH0 A;  1UA0 A;  3FFK B;  1NJW A;  3DRS A;  4KHQ A;  3ZSO A;  5M1N A;  1W97 L;  1Z26 A;  5GAE P;  3ZET B;  5MLC Q;  5E84 A;  4GVE A;  2BAN A;  3MCP A;  3L4Q A;  2J4R A;  2F4V K;  2B4J A;  4B9M A;  3MWP A;  4KO0 A;  4CEQ A;  1BQM A;  2ZM6 K;  2O8B B;  3CCM N;  1S5J A;  3NMU A;  4YDU A;  3P31 A;  4BDP A;  3CC7 N;  1RT1 A;  4CJE A;  2WOM A;  1WSI A;  2WTU A;  5ELZ A;  3TAP A;  2Z1H A;  1WSG A;  3WNF A;  4KTW A;  5AZI B;  2D0O A;  3VQQ A;  2E2N A;  5KGX A;  3U6F A;  4W5N A;  4BDY A;  5C42 A;  5AQT A;  3EO3 A;  3ID8 A;  1ZBF A;  2HHQ A;  4KH4 A;  4AHC A;  4DS5 A;  3BF3 A;  4ID5 A;  1J5E K;  3E01 A;  4YOY A;  4FWL A;  4DS4 A;  3MDQ A;  3RR7 A;  3ZT4 A;  1QSS A;  3ZT2 A;  4L8R B;  4BRD A;  3LDQ A;  1GOB A;  1QQC A;  4B9U A;  3QLH A;  4MLE A;  4OPA A;  3P83 D;  3QO9 A;  3MN9 A;  4YFU A;  1JJ2 M;  4CHN A;  2I5J A;  1P8Z A;  4AHT A;  1YI2 N;  3SAH A;  3TAG A;  3C94 A;  4NXM K;  4JKA A;  2RE2 A;  4RW7 A;  3KKR A;  1KFS A;  1OKJ A;  3HP6 A;  4DV0 K;  1WSJ A;  2PYL A;  3U8X A;  1ILY A;  1NM1 A;  2P9L A;  4E7L A;  1UA1 A;  1RDW X;  1BL3 A;  4K42 A;  1NG9 A;  4LF6 K;  3CD6 N;  1VSJ A;  1C0F A;  4RG8 A;  2P9K B;  2Z1I A;  4QS7 A;  4WE1 A;  3AVM A;  3CC2 N;  3BF1 A;  4FJI A;  4N76 A;  5AQV A;  2OAN A;  4PKI A;  3WNH A;  3RRH A;  4FZY A;  2IIR A;  1NMD A;  4JI5 K;  3CYM A;  3ZLJ A;  1Z05 A;  1K8K B;  4CJP A;  3O4N A;  1IV0 A;  1QHT A;  2JLE A;  5AZI A;  4N56 A;  1VSF A;  4NCA A;  3LL3 A;  5AQR A;  2EHG A;  3JS6 A;  3AVI A;  4JKC A;  2O8E A;  2UXC K;  3PIP L;  3IAY A;  4FPB A;  4WQ4 C;  5CYQ A;  4X66 K;  3HOT A;  1RTJ A;  1H1V A;  3AO3 A;  3FZK A;  4H8K A;  3VEY A;  4HWI A;  1EET A;  4DU1 A;  2OPQ A;  3DOK A;  5CZ1 A;  2ATQ A;  2DY4 A;  4J2B A;  5KTQ A;  5EXW A;  2GEL A;  2HF4 A;  4KHP K;  4BVP A;  4O55 A;  3THV A;  3UIQ A;  3SZ2 A;  1D4X A;  3A5O C;  3O3G A;  1GLF O;  1J53 A;  3MXI A;  4BE0 A;  4DSE A;  4E1M A;  4FL9 A;  3VQ4 A;  4X64 K;  4DTS A;  5AQQ A;  5FRO A;  3EE9 A;  1HNZ K;  3OJU A;  4M3R A;  4EP4 A;  3UKR B;  1CZA N;  3GG4 A;  3VGM A;  3FZL A;  1D8Y A;  3B8A X;  3DAW A;  3FZF A;  1BA0 A;  5AQK A;  4YOV A;  1ZXO A;  2VGM A;  3K58 A;  4CHZ A;  4DTO A;  3RR8 A;  4DTN A;  1QSY A;  4GV3 A;  1NK9 A;  1NGB A;  4LC9 B;  3G10 A;  3KLF A;  2FBV A;  4E19 A;  4AQY K;  5J2Q A;  1QVF M;  3ZSW A;  2HHS A;  2KZM A;  2IS3 A;  4FK2 A;  3O9Q A;  1SV5 A;  3WXJ A;  1OVQ A;  5KRS A;  2V52 B;  1Q9Y A;  2HB5 A;  3TSP A;  1T6D A;  2GWK A;  1A5W A;  4CHO A;  4O8U A;  5EU7 A;  2VWK A;  4DTU A;  3HPO A;  1GOA A;  1WUA A;  1X3N A;  5F0X A;  3EZ5 A;  1VQK N;  4LH4 A;  3VA0 A;  3RMC A;  5I3U A;  1D9D A;  4OKJ A;  5ADX H;  3QET A;  4ILH A;  3CM5 A;  1N33 K;  2HNZ A;  3ATU A; 
#chains in the Genus database with same CATH homology
 1BI4 B;  4KPY A;  1A5X A;  1RT6 A;  3C6U A;  4F8R A;  3NCI A;  4JLH A;  4E7H A;  4CF2 A;  3O4Q A;  1U04 A;  2IC3 A;  3MED A;  4M3U A;  4IG0 A;  1FKO A;  1L3T A;  1VSE A;  4M45 A;  4AIL C;  1SKS A;  4PUO A;  4FZX C;  3B6O A;  4DSL A;  2VG6 A;  1VRT A;  4NYF A;  3AVA A;  4OKE A;  4DTP A;  3T3F A;  1NKE A;  2BGG A;  4BWM A;  3CFP A;  1ASU A;  3ZT1 A;  4CGJ A;  4CIE A;  3DLK A;  3HST B;  3PX6 A;  3SQ1 A;  3SQ0 A;  1NJY A;  2X74 A;  1X1P A;  3AO1 A;  1CZB A;  4O44 A;  2YKM A;  4CFA A;  3ULD A;  3QER A;  5SWM A;  4CHY A;  4DQP A;  4ELT A;  4NCB A;  2VG5 A;  4ID1 A;  3C95 A;  1TV6 A;  2G8F A;  1U4B A;  4CF0 A;  1BIU A;  4KTQ A;  4FJG A;  3V1Q A;  1HJR A;  3VQP A;  2QKK A;  1I39 A;  3DM2 A;  2ETJ A;  5FRM A;  2F8S A;  4DTJ A;  2IAJ A;  3HYF A;  3V9S A;  3TAN A;  2YV0 X;  3DLE A;  3OYH A;  3U3Y A;  2ZE2 A;  3ZSR A;  1DTQ A;  1K6Y A;  1NK6 A;  1KFD A;  1RCH A;  3V6D A;  1NOZ A;  4CJV A;  3AO4 A;  4CK1 A;  1RBR A;  3DLB A;  5HP1 A;  3L2Q A;  4KI6 A;  3TWH A;  2HHV A;  3VQB A;  2Y1I A;  3AVF A;  4GVM A;  5I42 A;  1JLQ A;  3VN5 A;  3LWL A;  4DSF A;  3OS1 A;  4CEO A;  1SL0 A;  3V9U A;  4EZ9 A;  4IBN A;  4F2R A;  4GMJ B;  5FDL A;  3U3G A;  3SPY A;  4DMN A;  3V9Z A;  2P5G A;  3AVC A;  1HYZ A;  1VSH A;  3K5M A;  1C6V A;  4W5R A;  1RT3 A;  2NUB A;  3PO5 A;  1L3U A;  3TAR A;  1CXQ A;  3NF6 A;  2QK9 A;  3DOL A;  1NJZ A;  1HNI A;  1BCM A;  1KTQ A;  5KI6 A;  4DSI A;  1VSL A;  1WSE A;  3PX4 A;  2HW3 A;  3OYD A;  4J2E A;  4TSX A;  3LPT A;  3I8D A;  3QEV A;  1IO2 A;  1S1T A;  4O0J A;  1JLE A;  1VSK A;  4KTZ A;  4Q5V A;  2FBT A;  2YHA A;  4DF4 A;  1REV A;  1UOC A;  3L3V A;  1KVB A;  4CJR A;  2KTQ A;  3TAF A;  4KB1 A;  4J2D A;  4B08 A;  4I9Q A;  4CEE A;  3OYE A;  2X6S A;  2HNY A;  4RW8 A;  2YNG A;  1VRU A;  4LH5 A;  3L2U A;  3HVT A;  4CGI A;  1IH7 A;  4C8M A;  5T7B A;  3KTQ A;  3LPU A;  1X9M A;  1C0M A;  3VQC A;  2QKB A;  4DWI A;  3KKS A;  3V1O A;  5KGW A;  1L5U A;  2X6N A;  3RMB A;  3EY1 A;  1R0A A;  1HNV A;  1RTI A;  3PUF A;  1U49 A;  3ZSX A;  4DTX A;  1L3S A;  2WON A;  3NHG A;  3NF8 A;  2E6L A;  1LWF A;  2HVH A;  4IFY A;  1SUQ A;  4OVL A;  3M8Q A;  3C6T A;  3NAE A;  1NJX A;  3ISN C;  2B6A A;  4CK3 A;  3NE6 A;  3D45 A;  1BGX T;  1QE1 A;  3HPG A;  4OJR A;  5J2N A;  3QEI A;  3AVL A;  3SQ2 A;  3WNE A;  2Z1G A;  2Y1J A;  1JXB A;  1NK7 A;  2DFF A;  3DLR A;  4F3T A;  3CG7 A;  4GW6 A;  3K5N A;  3SQ4 A;  2OYQ A;  4O5B A;  4G1Q A;  2R7Y A;  5CYM A;  1FKP A;  3ZSQ A;  3OJS A;  1J54 A;  1XC9 A;  1JLC A;  5J1E A;  1D9F A;  1RTH A;  4DFJ A;  3KK2 A;  1X9W A;  3FFI A;  4KHN A;  1KVA A;  4HUE A;  4C8O A;  1VSD A;  4KRF A;  3K59 A;  1WAF A;  1U48 A;  1KRP A;  1XHZ A;  4FJ5 A;  3AO2 A;  4CEA A;  4Z0U A;  3OYI A;  1O1W A;  5DK5 A;  2IOC A;  2YHB A;  4CHQ A;  3KK3 A;  4DSK A;  4QOZ B;  4FCY A;  3LZI A;  3ITH A;  1S6P A;  5HRR A;  4OLA A;  3VQE A;  1HPZ A;  4E1N A;  1TAU A;  3ZT0 A;  1S9G A;  1C1A A;  2B5J A;  1TL1 A;  4M3Z A;  3QES A;  5K14 A;  1J9A A;  2F8T A;  1WSF A;  1ZBU A;  1KLN A;  4M3T A;  1BCO A;  4Z4I A;  4JRQ A;  3SUN A;  4KFB A;  4AHV A;  4BE2 A;  4FJJ A;  4CIF A;  3VA3 A;  4PY5 A;  4ELV A;  1JLF A;  3K5L A;  4Z4E A;  1TKZ A;  4LY7 A;  1S1W A;  1X9S A;  1WN7 A;  4IG3 A;  3S9H A;  4CEC A;  3VQ5 A;  5FRN A;  1W0H A;  2YKN A;  3MXJ A;  4CJ5 A;  3MEG A;  2OPS A;  3IRX A;  2A1R A;  2XY7 A;  4FVM A;  4DQQ A;  4FJH A;  4KHU A;  4FZZ A;  4CED A;  3HJF A;  4Q0B A;  4O4G A;  3HT3 A;  4I2P A;  3AO5 A;  3B6P A;  3T19 A;  1JKH A;  1LWE A;  5HRP A;  1T7P A;  3OYC A;  3RRG A;  3LZJ A;  4B8C A;  1WSH A;  3KLI A;  3NH2 A;  5C24 A;  1C0T A;  3NH1 A;  3HM9 A;  4M42 A;  4B9N A;  3ZCM A;  4DQR A;  2FC0 A;  4ELU A;  1SKW A;  4HCB A;  5SZT A;  1S6Q A;  3L3U A;  3NFA A;  4JS4 A;  3SYZ A;  4FW1 A;  2O4I A;  4KKO A;  4FLW A;  2KZZ A;  2XY5 A;  3OVN A;  1IKV A;  1LW2 A;  4HHT A;  1C0U A;  4OPK A;  1TL3 A;  2DFE A;  4Z4H A;  1Q8I A;  4FM1 A;  3NGY A;  1QTM A;  3DRP A;  1UWB A;  1YVU A;  4HTU A;  4DQS A;  3K5O A;  4CGH A;  1TK8 A;  2RKI A;  5E41 A;  4RW4 A;  4CFB A;  3SNN A;  3MAQ A;  3LP0 A;  1DLO A;  2GBZ A;  2X78 A;  3AVN A;  1HYS A;  3OS0 A;  2IDO A;  3CFR A;  3TR8 A;  5KRT A;  3OYA A;  1TAQ A;  3LDS A;  1EKE A;  1MU2 A;  2HHW A;  1FK9 A;  4CIG A;  1DTT A;  4LSN A;  5JS1 A;  3VQD A;  1NK0 A;  1B9D A;  4F2S A;  1KSP A;  4I9L A;  4Y1D A;  2KFN A;  4H4M A;  2D0C A;  4B3O A;  2ZD1 A;  3BGR A;  2FBY A;  3WNG A;  3AVH A;  4BWJ A;  4R5P A;  4O0I A;  4FLY A;  1XWL A;  4Z4G A;  4UQG A;  1KLM A;  2GUI A;  5DMR A;  4RW9 A;  4C8N A;  4CGD A;  1IG9 A;  1RDC A;  4DQI A;  4IKF A;  1NK8 A;  2DTU A;  4Z4F A;  4M41 A;  1ZBH A;  4E7K A;  3HO1 A;  3VQ7 A;  3OYM A;  4YNQ A;  3HXM A;  1SKR A;  3DLH A;  3OY9 A;  1N5Y A;  4FJK A;  3ZSZ A;  4QAG A;  4DF8 A;  1G15 A;  1IKX A;  3JSM A;  3OYN A;  3SUP A;  4CEZ A;  3G0Z A;  3NF9 A;  3KLG A;  3NH0 A;  4DLE A;  1YTA A;  4E7I A;  1RBS A;  1T05 A;  4K8Z A;  4PQU A;  1UA0 A;  1RBU A;  4XIU A;  2D0A A;  4BE1 A;  1NJW A;  1WAJ A;  1CZ9 A;  1ITG A;  1RDD A;  3DRS A;  4KHQ A;  3ZSO A;  2DFH A;  3QNN A;  3OYL A;  3V4I A;  4CJW A;  1TKD A;  1Z26 A;  3OS2 A;  3L2R A;  4FW2 A;  4EP5 A;  3F73 A;  4CHP A;  4CFD A;  4MFB A;  3RMD A;  2BAN A;  3M8S A;  3LP3 A;  3AA3 A;  2RN2 A;  4CES A;  5HBM A;  1SL2 A;  1N6Q A;  1TKT A;  2EX3 A;  2B4J A;  4CJ4 A;  4B9M A;  3QIO A;  3K57 A;  4M3Y A;  1NK5 A;  4CJQ A;  4KO0 A;  1CXU A;  4EZ6 A;  2G8U A;  4CCH A;  4CEQ A;  5J2M A;  1BQM A;  2KW4 A;  4DU3 A;  3MXM A;  3LAK A;  4CEF A;  1S5J A;  3DMJ A;  4FJM A;  4M3X A;  3DI6 A;  1NKC A;  4BDP A;  4FLT A;  4DTM A;  4KAZ A;  1W9H A;  1RT1 A;  4CJE A;  4N5S A;  1S9E A;  2WOM A;  2G8K A;  1NOY A;  1JL1 A;  4FJL A;  1B9F A;  3QEW A;  1WSI A;  2Q3S A;  4M3W A;  1IKW A;  2HHT A;  2XY8 A;  3M8R A;  2O4G A;  1S1X A;  1TK0 A;  3HP9 A;  2F96 A;  2Z1H A;  2FBX A;  1LAV A;  3TAP A;  4FK0 A;  3SV4 A;  1ZBL A;  2BE2 A;  1WSG A;  3WNF A;  4CK2 A;  4KTW A;  3KK1 A;  4K8X A;  2HMI A;  1FXX A;  3VQQ A;  2P5O A;  1WNS A;  5KGX A;  5HRN A;  3U6F A;  2XO7 A;  4W5N A;  4CJK A;  1T8E A;  1L3V A;  1EXQ A;  4BDY A;  1RTD A;  5C42 A;  4JRP A;  1T03 A;  3V9W A;  4B9S A;  1ZBF A;  3MEE A;  2HHQ A;  3HVR A;  4AHC A;  4DS5 A;  4CJS A;  4HVJ A;  3CFO A;  4ID5 A;  4OKK A;  3OYB A;  3AA2 A;  4DFK A;  3SPZ A;  4FJX A;  3E01 A;  4DS4 A;  4CJF A;  3V1R A;  3DLG A;  4KHY A;  3RR7 A;  3KD5 E;  3ZT4 A;  4E7J A;  3LAM A;  1EX4 A;  1QSS A;  3ZT2 A;  4ZTJ A;  3IG1 A;  3O3F A;  1YTU A;  4FYD A;  4KV8 A;  1RDA A;  2E4L A;  4CGG A;  3RMA A;  1ZYQ A;  4HUF A;  3TAE A;  1U47 A;  4L8R B;  2A1S A;  3SCX A;  2HHX A;  4C8K A;  1GOB A;  4FLV A;  1QQC A;  1JLB A;  1KVC A;  2XRI A;  3KLH A;  4FK4 A;  4B9U A;  3QIN A;  1RIL A;  3QLH A;  3P83 D;  2VWJ A;  3QO9 A;  2G8H A;  1ZBI A;  1Y97 A;  1LW0 A;  2LSN A;  2RF2 A;  4YFU A;  4KB0 A;  4CHN A;  2I5J A;  4FLU A;  4AHT A;  2PZS A;  3OYK A;  2D5R A;  4CJT A;  4FLX A;  3P5J A;  1NK4 A;  3TAG A;  1BHL A;  4ICL A;  2Z1J A;  3C94 A;  1ASV A;  3ZSV A;  4CER A;  4CF1 A;  3NGZ A;  2YNI A;  4RW7 A;  3KKR A;  4HUG A;  3TAQ A;  1KFS A;  4PWD A;  2KFZ A;  1JLA A;  3HP6 A;  4AHU A;  4E89 A;  1WSJ A;  2PYL A;  5HRS A;  1KCF A;  1CLQ A;  4E7L A;  4CF9 A;  4I7F A;  4FM2 A;  1UA1 A;  4W5T A;  1XI1 A;  3CM6 A;  3OYG A;  1TVR A;  3KIO A;  1D5A A;  1BL3 A;  3AA5 X;  1S1V A;  3VQ6 A;  4KHW A;  4DU4 A;  2ITG A;  1VSJ A;  2IGI A;  3HPH A;  4RG8 A;  3LWM A;  3LP1 A;  4OPJ A;  2Z1I A;  3ZT3 A;  4CJL A;  3LP2 A;  1JL2 A;  4WE1 A;  3SV3 A;  1J5O A;  3AVM A;  4B9V A;  3K2P A;  3P1G A;  4FJ9 A;  4FJI A;  4N76 A;  4AHS A;  1RT4 A;  3AVK A;  2XY6 A;  2HHU A;  4CJU A;  3AVJ A;  1U45 A;  4FJ7 A;  1QSL A;  2QXF A;  3WNH A;  3RRH A;  1VK0 A;  4H4O A;  4FZY A;  1Z25 A;  3HL8 A;  4CEB A;  2PYJ A;  3AV9 A;  3CYM A;  1TK5 A;  4FXD A;  4CJP A;  3V81 A;  3AVB A;  3O4N A;  3MEC A;  2E6M A;  4FM0 A;  1QHT A;  4IDK A;  1BQN A;  1RNH A;  3T1A A;  4F3O A;  2JLE A;  3NDK A;  3H08 A;  3AVG A;  2PY5 A;  4N56 A;  1VSF A;  2BDP A;  4NCA A;  3ASM A;  1F21 A;  2W42 A;  4BDZ A;  1SL1 A;  4IFV A;  1LAW A;  2EHG A;  3OYJ A;  3AVI A;  3NBP A;  3IAY A;  1UAX A;  1TKX A;  3I0R A;  4E0D A;  1GOC A;  1IKY A;  1JXE A;  3KLE A;  5CYQ A;  3ZSY A;  3L8B A;  3DRR A;  3S3O A;  3SUO A;  1RTJ A;  4NCG A;  3AO3 A;  2P1J A;  3M8P A;  4H8K A;  1WLJ A;  4DLG A;  2OPR A;  2OZS A;  2GV9 A;  3RWU A;  1EET A;  4DU1 A;  2HND A;  5D3G A;  4PA1 A;  2OPQ A;  3DOK A;  5CZ1 A;  4CGF A;  2ATQ A;  3LAN A;  3SI6 A;  3EYZ A;  3V9X A;  2DY4 A;  2G8I A;  3VQA A;  5KTQ A;  4J2B A;  3QIP A;  1HQE A;  2P51 A;  4LSL A;  4CJ3 A;  4O55 A;  4B8A B;  1C1B A;  1C1C A;  3SZ2 A;  3THV A;  3UIQ A;  4FJN A;  3O3G A;  1J53 A;  5JS2 A;  3MXI A;  4B9L A;  4BE0 A;  4E3S A;  4DSE A;  4E1M A;  4DFM A;  3TAB A;  3VQ4 A;  2RPI A;  3D0P A;  1RBT A;  4DTS A;  5FRO A;  3PO4 A;  4KHS A;  1RT7 A;  4CFC A;  2OZM A;  3TAM A;  4DFP A;  3PX0 A;  3L2W A;  1TGO A;  1RDB A;  3S3N A;  1QS4 A;  3QEX A;  4F4K A;  5C25 A;  4OGC A;  3L2V A;  3OJU A;  5HLF A;  4NYN A;  4M3R A;  1RT2 A;  1RT5 A;  2D0B A;  4EP4 A;  3S3M A;  4DSJ A;  3OYF A;  1HMV A;  4KRE A;  5HRO A;  1BI4 A;  1A5V A;  4B9T A;  4AH9 A;  3O3H A;  2ZQB A;  1D8Y A;  3ALY A;  3QEP A;  5J2P A;  1HYV A;  4OLB A;  2HVI A;  4MQ3 A;  2OPP A;  1BIZ A;  4BAC A;  3RTV A;  4W5O A;  4DTR A;  1HQU A;  3K58 A;  3PV8 A;  2YNH A;  3TI0 A;  3HK2 A;  4CHZ A;  4DTO A;  3RR8 A;  5CZ2 A;  4RW6 A;  3IS9 A;  4ZHR A;  4DTN A;  4CF8 A;  1QSY A;  1JLG A;  3NF7 A;  4W5Q A;  4JS5 A;  4N47 A;  1YT3 A;  4Z4C A;  1NK9 A;  1LV5 A;  4N41 A;  3AA4 A;  4OGE A;  3G10 A;  4ZTF A;  4I2Q A;  2G8W A;  3JYT A;  3SUQ A;  3KLF A;  3I0S A;  2FBV A;  4E19 A;  3BDP A;  1BIS A;  5J2Q A;  3KD1 E;  2OA8 A;  4KI4 A;  3ZSW A;  1XHX A;  2HHS A;  2IS3 A;  4FK2 A;  2KZM A;  1HRH A;  1SV5 A;  5CY4 A;  1EP4 A;  3A2F A;  3SJJ A;  1VSI A;  5KRS A;  4Y1C A;  1Q9Y A;  2HB5 A;  3VQ8 A;  3KJV A;  1B92 A;  2KQ2 A;  3DYA A;  1Q9X A;  1A5W A;  3VQ9 A;  1RBV A;  3F9K A;  4CHO A;  1ASW A;  3NGI A;  4AHR A;  4J2A A;  4QCL A;  3PY8 A;  5EU7 A;  2VWK A;  2VG7 A;  3LAL A;  4DG1 A;  3CQ8 A;  3HPO A;  4DTU A;  1LWC A;  1NKB A;  1GOA A;  1I3A A;  3EZ5 A;  4CE9 A;  4LH4 A;  3VA0 A;  2JGU A;  2G8V A;  3RMC A;  2AJQ A;  5I3U A;  2XHB A;  1D9D A;  1S1U A;  4OKJ A;  4C8L A;  4FJ8 A;  1VSM A;  4FLZ A;  3QET A;  3QNO A;  4HCC A;  3CM5 A;  2YNF A;  2HNZ A;  4LD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...