2G8VA

B. halodurans rnase h catalytic domain e188a mutant in complex with mg2+ and rna/dna hybrid (reaction product)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGAIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 39
structure length 133
sequence length 133
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8vA00
3G10A 4GVMA 4DTUA 1U48A 3AVMA 1LV5A 2O4IA 4E7KA 4YNQA 3T1AA 3SYZA 3ZSXA 1HPZA 4FZZA 2X74A 3KIOA 1QSSA 4M42A 4M3YA 1S1TA 2FBTA 4CERA 5CYQA 3WNFA 2Z1HA 3L2WA 4LSNA 3RMBA 3LZIA 1A5VA 4CFAA 1SL2A 4M3XA 4FK4A 4OLAA 4CGDA 4FLTA 3U3YA 3ALYA 3DLGA 4GMJB 4CHZA 3MXMA 1QTMA 1LAWA 1D9DA 2PY5A 3PO4A 4I9QA 3TABA 4IBNA 3S9HA 2VG6A 4FLVA 4CEFA 1SV5A 4OGCA 3TAEA 1TK0A 1VRUA 1VSFA 3QNOA 2F8TA 4DFJA 1RBUA 4BWMA 4DSKA 2X6NA 1L5UA 3DLBA 4IDKA 3BGRA 4CJKA 1BL3A 3WNGA 3L2RA 1HQUA 3ZT3A 1R0AA 1UAXA 4IFVA 4HTUA 1RCHA 3DLRA 3AO2A 3U6FA 4JS5A 2DY4A 1SKRA 1T03A 2RN2A 4O0IA 4Z4FA 2YNFA 2G8IA 1RDCA 4B9LA 3VQ6A 1CZBA 5C25A 4M3RA 4OKJA 5HRSA 1BCOA 2G8VA 3MEGA 3HPHA 4E19A 2OA8A 2OPQA 3NFAA 4AH9A 1NKEA 4DTOA 4CJWA 1ZBLA 4M3ZA 4OKEA 4HUFA 3ULDA 1S1XA 4CIEA 2XY6A 4KHQA 1D8YA 3AVNA 3QEVA 1A5XA 2DFFA 2IS3A 1JLCA 4O55A 3SQ1A 3F73A 1X9WA 4CF8A 1QSLA 2QKKA 4B9NA 4M3WA 3C6TA 3AVIA 4FJIA 3F9KA 4FK0A 1X1PA 2KZZA 3L2UA 2ATQA 1ZBHA 4M45A 4OGEA 1VSDA 4W5QA 1SKSA 4B3OA 1O1WA 3DRSA 4LY7A 1JLFA 2EHGA 2HHQA 4CJVA 3S3MA 4MQ3A 3OYDA 1X9MA 3OJUA 3L2QA 3M8RA 4N41A 1B9DA 3LDSA 3DLKA 1ZBFA 4DQQA 2BE2A 3O3GA 5I42A 3ZSQA 1VSHA 2F96A 4RW6A 4K8XA 3LANA 4KFBA 1FXXA 3QLHA 4KHNA 2Z1GA 1RTDA 3LP3A 3O4NA 3KLGA 1BIUA 3QIOA 3OYLA 4E7LA 3SPYA 4KPYA 4KB0A 3OJSA 4EP4A 1RBSA 3CM5A 3I0SA 3RMAA 3AO4A 4CGFA 1ASWA 4Y1DA 4DQRA 3HO1A 1YVUA 4O44A 4FK2A 2XO7A 4MFBA 4B9UA 4PWDA 4DSIA 3LAMA 1NK4A 3KK2A 3L8BA 1JKHA 4CK3A 4B8CA 3OY9A 3KJVA 2JGUA 1C0TA 1D9FA 1BQMA 3C94A 2G8FA 4F3TA 1S9EA 3V1RA 3VQCA 1W0HA 4AILC 3ZSRA 3T3FA 4CEEA 1S1UA 3MEEA 3O4QA 4I2PA 1T05A 3L3VA 1EKEA 4FJJA 4KKOA 4DTPA 3TAMA 3AVCA 1JXEA 3PV8A 4BACA 1L3SA 1LWEA 5I3UA 1BISA 1CXUA 1HRHA 1HJRA 1XHXA 2E6LA 3CG7A 4CESA 1XI1A 4DSEA 2GBZA 3AO5A 3QO9A 2Y1IA 3AVFA 2IC3A 4CEAA 1X9SA 3I0RA 2D0BA 4CJTA 4EP5A 3RTVA 3JYTA 4DTRA 3QNNA 4Q0BA 2P5OA 1RT3A 3AV9A 3P83D 3NAEA 2ZQBA 3DOLA 4IG3A 4JS4A 3ZSOA 4DS5A 1WLJA 3V81A 4H4MA 3V9XA 3MAQA 2HHTA 1TAQA 3VQEA 2HHSA 4ID5A 2YKMA 1DTQA 1XWLA 1L3UA 4CF1A 3DOKA 4KO0A 1BGXT 3NDKA 3ZT2A 3CQ8A 5D3GA 1C1AA 2IDOA 2R7YA 1C1CA 5KI6A 4KHSA 3D45A 1JLEA 4H8KA 1SL0A 4E7JA 1VSMA 3ISNC 4FLUA 1NK6A 4HVJA 3EZ5A 3LAKA 2HHVA 4B9SA 4KTQA 4C8KA 4DMNA 3K59A 3LZJA 1FKOA 4ZTFA 4CJFA 1IKVA 1NJXA 3ZSVA 2RKIA 3C95A 1KLMA 1DLOA 1A5WA 3ZSZA 4FM1A 3RMCA 1FK9A 1Q9XA 4J2AA 1BI4A 1EX4A 3L2VA 5HRNA 1JLAA 3CFRA 1CXQA 1C0MA 4FLWA 3RRHA 2A1RA 1NOZA 2D5RA 4NYNA 4CHNA 3OYGA 4DU4A 1S1VA 1S6PA 3KLEA 3V9UA 4CEBA 1BQNA 1NJWA 3HT3A 2WOMA 1EETA 4JRPA 1QS4A 3V6DA 2G8WA 5KRSA 2PZSA 4BWJA 2YKNA 4N5SA 3OS0A 1BCMA 3QETA 3LPUA 4KI6A 3AA3A 2XHBA 1KSPA 1Y97A 5HP1A 3ASMA 5DMRA 4KTWA 3DLHA 5CZ2A 4QAGA 3VQ5A 3A2FA 3HJFA 1RTJA 2ZD1A 4Y1CA 5J1EA 5JS1A 1JXBA 1YT3A 4M41A 1I3AA 3WNHA 4KTZA 1VSIA 2XRIA 3B6PA 1RDAA 3V9SA 3HVTA 4OPKA 2XY7A 1LAVA 1TGOA 1HYVA 4FM0A 4DF8A 1IH7A 2HNZA 3ZT0A 4CFDA 4AHCA 4CGGA 1C0UA 3KK3A 3VN5A 3M8PA 1IKXA 4CHPA 3SUOA 4FM2A 1UA0A 2OZMA 3T19A 1S5JA 3M8QA 4FYDA 4O0JA 2OPRA 5FRMA 1BHLA 1TL3A 1RILA 2XY8A 4FVMA 4AHUA 4FJ8A 3WNEA 2PYLA 3OS1A 4BDPA 3UIQA 3OYNA 4E89A 3RMDA 1RBVA 4DQSA 1JLQA 5KGWA 4DS4A 4FJNA 1VRTA 1ITGA 1IKYA 1RT7A 3O3FA 5HBMA 4CJ5A 3PX6A 4NCAA 1RT5A 4ZHRA 1TVRA 1KFDA 4CJ4A 4YFUA 3EY1A 4CJEA 3NE6A 3VQDA 3ZT1A 4FJKA 1WSEA 4HCBA 1FKPA 4BDYA 1KRPA 4LSLA 1MU2A 3AVJA 5SZTA 3HP6A 1N6QA 3NHGA 2P51A 4J2DA 2GUIA 1U04A 4FW2A 4N47A 3SUPA 4IG0A 3FFIA 2O4GA 3NF8A 4CE9A 2Y1JA 2HW3A 3CM6A 3SV3A 3AA5X 4TSXA 4JRQA 1TAUA 2B4JA 2IGIA 3QIPA 3OYFA 4CJUA 1Q8IA 4DQIA 3ITHA 4CF2A 4DTXA 4E3SA 1ASUA 4IFYA 4JLHA 2XY5A 3QEIA 4Z4IA 4H4OA 1TKTA 5SWMA 3TAFA 4I9LA 5T7BA 4FJMA 4I7FA 2Z1IA 4CECA 3TARA 2AJQA 3H08A 1U47A 4IKFA 1LWFA 1JL1A 4CJPA 3SQ4A 1J5OA 2HVIA 1VSKA 1S6QA 3HYFA 3NH2A 1RT2A 3OYKA 4CK1A 3EYZA 4DTNA 5J2NA 1HQEA 1GOAA 4C8MA 4FJGA 4O5BA 1ASVA 4KHUA 4BE0A 2ZE2A 4DU1A 2YHAA 1RDBA 4DF4A 2RF2A 1NK8A 2BGGA 4CJQA 1TL1A 2DFEA 1BIZA 3DLEA 2HB5A 4CEZA 2JLEA 2X6SA 4AHVA 4Z4EA 4J2BA 4J2EA 3CFPA 1UA1A 1IO2A 3P5JA 4L8RB 4PUOA 4KB1A 5CYMA 3VQ8A 1TK8A 1KLNA 3QEPA 2OYQA 3SQ0A 1NJYA 3IRXA 1ZBIA 4CIFA 3NGZA 4CGJA 2B5JA 1SUQA 3VA3A 1RTIA 1HNVA 3PUFA 4CGHA 3HVRA 1IKWA 3C6UA 4ELTA 4GW6A 3K5MA 4N56A 4PY5A 1T8EA 2P5GA 4F2SA 3THVA 2HHXA 3HSTB 1UWBA 2B6AA 4I2QA 3AVAA 3RR8A 4RW9A 4OKKA 5FROA 2KZMA 2E4LA 1I39A 1RT1A 3AVLA 4Z4HA 1N5YA 4CHOA 3TR8A 5C42A 1KVBA 1WSFA 2X78A 2QKBA 2F8SA 3K57A 3OVNA 3LWLA 3V4IA 5DK5A 1WSGA 4DTJA 4DWIA 4FW1A 1QQCA 4PA1A 5HROA 4C8NA 4FJXA 1VSJA 1J9AA 3VQ9A 5CZ1A 3SI6A 3MXIA 4CK2A 4NCGA 1S1WA 5J2QA 4HUEA 4DU3A 1WSHA 5HLFA 3B6OA 1C6VA 4CIGA 1CZ9A 3LALA 3LWMA 1RDDA 4C8OA 3NGYA 3VQAA 1NKBA 4AHTA 4UQGA 3TAGA 5FRNA 2YV0X 4AHRA 4FLZA 3SPZA 3VQ7A 1U4BA 4F8RA 4E7IA 3OYMA 3SV4A 3U3GA 4XIUA 3NF6A 3IAYA 4Q5VA 2FBXA 3M8SA 4DFPA 3RRGA 3TAPA 4BE1A 1WAJA 4FJ7A 3SQ2A 4CHQA 4DQPA 1TKZA 3VQBA 2KFNA 1JLBA 4ICLA 3AA4A 3AVKA 4AHSA 2YNHA 1UOCA 3HP9A 4FJHA 2G8UA 1GOCA 4DFMA 1B92A 4CCHA 2G8HA 2IOCA 4KI4A 1YTUA 2D0CA 3OYEA 3HL8A 1IG9A 4FZXC 3K5NA 2I5JA 2VWKA 4FLXA 3HM9A 1EXQA 4B08A 1KCFA 1TKXA 2OPSA 2Q3SA 3HPGA 1T7PA 3KKSA 2G8KA 3L3UA 4RW8A 4NCBA 2VWJA 1LW2A 1J53A 1DTTA 3IS9A 4G1QA 4KAZA 1RT4A 1HMVA 4CGIA 4DG1A 3ZSYA 2OPPA 3NCIA 5K14A 3DI6A 3KK1A 3S3NA 4W5OA 3MEDA 1NK5A 2HHUA 3VA0A 5E41A 1U49A 1F21A 1Z25A 4OJRA 1S9GA 2DFHA 1QHTA 1ZBUA 3KKRA 3SZ2A 2E6MA 4BE2A 2HMIA 1WSIA 4KV8A 3QEXA 1K6YA 2KFZA 3P1GA 2ETJA 3OYBA 4CF9A 3KLIA 1VK0A 4CF0A 4N76A 1KFSA 3K58A 4OLBA 3K2PA 3PO5A 1SKWA 3VQQA 4E1NA 4DTSA 3ZCMA 4Z0UA 2LSNA 3TWHA 5KRTA 2P1JA 1GOBA 3RR7A 3SNNA 3CFOA 1RNHA 1VSEA 3V1OA 3OYAA 3TI0A 1G15A 1NJZA 5C24A 2PYJA 4RG8A 2KTQA 3KD5E 3AO3A 4CEQA 5CY4A 4F4KA 3QEWA 1QE1A 4KRFA 3KLFA 2W42A 3S3OA 4QCLA 1HYZA 2KW4A 5HRPA 5KTQA 3V9ZA 1ZYQA 3PX4A 3K5OA 4FLYA 4ELVA 4KREA 1WN7A 3HK2A 4NYFA 1KVAA 3NBPA 2HNYA 2KQ2A 4W5TA 3PY8A 3G0ZA 2HHWA 5HRRA 1SL1A 3QERA 3HPOA 4DLGA 3LP1A 3MXJA 2QK9A 1YTAA 1Q9YA 4M3UA 4RW7A 2BDPA 2OZSA 1WSJA 3OYCA 1LWCA 3V9WA 1CLQA 4DSLA 3VQ4A 3SUQA 4WE1A 4CFCA 1U45A 4B9VA 1TKDA 5J2MA 4DLEA 3RWUA 3NF7A 4BDZA 2QXFA 4CEDA 3KLHA 4CHYA 3TAQA 3VQPA 1TV6A 1HNIA 4CJLA 4E7HA 1XC9A 3CYMA 3SJJA 1RBTA 3AA2A 3AVGA 3TANA 4B8AB 3D0PA 4FZYA 4C8LA 4OPJA 1BI4B 2FBVA 2VG5A 3LPTA 5J2PA 1XHZA 3PX0A 3QESA 1NKCA 4CFBA 4HHTA 3MECA 3OYIA 1TK5A 4FJLA 4DSJA 4LD0A 1KVCA 1L3TA 3V1QA 3KTQA 4PQUA 1RBRA 1VSLA 4CJRA 1REVA 3OS2A 1KTQA 2YNGA 5EU7A 4OVLA 2ITGA 4W5RA 3ZSWA 1WAFA 1D5AA 3QINA 1C1BA 4ID1A 4FCYA 3DM2A 3SCXA 3ZT4A 4CEOA 4QOZB 3OYJA 3NH0A 1Z26A 4F3OA 3KD1E 1J54A 3AO1A 4RW4A 2DTUA 3NF9A 4CJ3A 3OYHA 3SUNA 1WNSA 3NH1A 1NK0A 1JLGA 3DRRA 5JS2A 4LH5A 1JL2A 1RT6A 2YHBA 1W9HA 5FDLA 2YNIA 1NOYA 4FJ5A 4Z4CA 1NK9A 4ZTJA 4EZ6A 4B9MA 3DMJA 4FJ9A 4F2RA 4HCCA 1B9FA 4DFKA 1RTHA 4E0DA 2HVHA 3IG1A 3I8DA 4FXDA 4LH4A 5KGXA 3LP0A 1LW0A 4DSFA 2Z1JA 1EP4A 1QSYA 2HNDA 4KHYA 2EX3A 3DRPA 2IAJA 4E1MA 4EZ9A 4HUGA 2FBYA 4O4GA 1NK7A 3AVHA 4K8ZA 4M3TA 3AVBA 3JSMA 2NUBA 3DYAA 2VG7A 2BANA 4Z4GA 4CJSA 1HYSA 3NGIA 1L3VA 3HXMA 2D0AA 4ELUA 3O3HA 2A1SA 3E01A 4B9TA 2FC0A 4DTMA 2WONA 3BDPA 3LP2A 3K5LA 4KHWA 2GV9A 2RPIA 4R5PA 4W5NA
chains in the Genus database with same CATH superfamily
4GVMA 3A5MC 3B8AX 4BVPA 3VEYA 5C0YA 3ZSXA 4FZZA 2X74A 1HJOA 4NB4A 4CERA 2ZJQL 2UU9K 1IBLK 5B8HA 3WT0A 3CJ9A 4LSNA 3L2WA 4M3XA 4IO8A 4CHZA 2PY5A 3SMSA 3PO4A 2VG6A 4IZ9A 4CEFA 5M1PA 2QXLA 3TAEA 2OTJN 4JK7A 1TK0A 1ATNA 3VF2A 1VSFA 4JK9A 4JKDA 4B9QA 1L5UA 4IDKA 4JKHA 1O13A 1BL3A 3WNGA 3ZX2A 3OBWA 5AQJA 1UAXA 4FWQA 1GLFO 4A59A 2P9IB 4JS5A 1SKRA 2O8BA 1QZ6A 3GE1A 4C23A 2G8VA 3MEGA 3HPHA 2OA8A 1NKEA 2P9SB 4B1YB 4U7BA 4O55A 4A5AA 5MLCQ 1QSLA 4B9NA 4FJIA 4M7YA 4BQZA 1VHXA 2ATQA 4OGEA 1VSDA 5E84A 4W5QA 1JLFA 3S3MA 1X9MA 3OYDA 3L2QA 3M8RA 2NRTA 2W6KA 3O3GA 4JKBA 2HOEA 3ZSQA 3ATUA 3CCSN 1FXXA 3CI5A 3QLHA 3LP3A 3O4NA 3OYLA 4BVOA 2O8EB 3HRGA 2Q31A 4JHDB 3AO4A 4CZFA 3CJ7A 4FK2A 4MFBA 4JNEA 1NNEA 3CJBA 2QWPA 1JCGA 4CBUA 4JKCA 1E4FT 4CK3A 2JGUA 1S9EA 4JI7K 1W7AA 4CEEA 4I2PA 2NRHA 4FJJA 1EKEA 4LFCK 1JXEA 4BACA 1L3SA 1BISA 1XHXA 1HJRA 3CG7A 1VQON 4DV4K 5LMNK 5GIPA 3QO9A 5AR0A 3AVFA 1X9SA 5LL6Z 4DTRA 4Q0BA 3IDHA 3ZSOA 1WLJA 2HHTA 4ID5A 1L3UA 1OVQA 4KO0A 5AQNA 3CQ8A 4IJNA 5D3GA 2IDOA 5KI6A 4E7JA 1BUPA 4B1WB 3W3DA 2HHVA 4B9SA 4NXNK 3IKMA 3C95A 3ZSZA 4FM1A 2A5XA 5H1SQ 1FK9A 1GLLO 3SAFA 1Q9XA 2A6AA 3L2VA 1JLAA 3RRHA 2A42A 4H0XB 4CHNA 4O8KA 3RVCA 3CQYA 3HT3A 2WOMA 3V6DA 2PZSA 4N5SA 3LPUA 3AA3A 3WXJA 5HP1A 3DLHA 3DXKB 4JEPA 5JS1A 3THXB 5AQLA 1NGIA 4M41A 5AQVA 1IBMK 3WNHA 4KTZA 3V9SA 4IOAL 3UB5A 3L4IA 5M1QA 1HYVA 4DF8A 3R9PA 2XY7A 4CD1A 3VN5A 1IKXA 2JWLA 3T19A 3M8QA 4FYDA 4O0JA 2FXUA 5F2RA 3CMAN 1NGEA 1BHLA 1TL3A 1VQ5N 3I56N 1U6ZA 4H0PA 3WNEA 4BDPA 1QHAA 3OYNA 3RMDA 3LDOA 4FJNA 1ITGA 3J80O 1IKYA 4KH4A 4CJ5A 1RT5A 3A5NC 4OX9K 4CJEA 3VQDA 3J8AA 1WSEA 1KRPA 1MU2A 3NHGA 2GUIA 4LF9K 3FFIA 2Y1JA 2HW3A 1XUPO 3AA5X 1FJGK 3LDNA 3VEOA 3VF4A 4E3SA 5C12A 4IFYA 4FWLA 4JLHA 1M90O 3TARA 3SBTA 3SQ4A 1GLCG 4CJPA 2ZJRL 1DT9A 3NH2A 4CK1A 2YCHA 4H5NA 4BE0A 4DF4A 4DU1A 3MX2A 5JICA 4M7XA 2DFEA 2FSKA 4B3SK 5F0XA 3CQXA 3EE9A 3FZKA 4Z4EA 1UA1A 4KB1A 5CYMA 3GL1A 4I6MB 3SQ0A 4FPBA 3EEQA 4LC9B 2B5JA 4BRDA 4H0YB 3O08A 4CW7B 3HVRA 5BN9A 4ELTA 4N56A 4PY5A 3CC2N 2E1ZA 2B6AA 1N36K 4RW9A 4B3RK 3WEEA 5FROA 1VQMN 1RT1A 3AVLA 3E9PA 5C42A 2QKBA 2F8SA 3OVNA 2W40A 4DTJA 4DWIA 4PA1A 5C10A 5HROA 2PAVA 4FJXA 5BRHA 1VSJA 1J9AA 3VQ9A 3MXIA 4CK2A 1NWKA 4NCGA 1S1WA 1ZBSA 4DU3A 5AQQA 2HF3A 3J7YP 1C6VA 3LALA 3FFKB 2NZTA 2NNWA 2QW9A 3SPZA 3VQ7A 1Q86O 5CR4A 5BR8K 3A5LC 3M8SA 4DFPA 3C0BA 3TAPA 3OW2M 1WAJA 1HNZK 3R3LA 3VQBA 2OCEA 1JLBA 4BRGA 3AA4A 3R1XA 3AVKA 4AHSA 4FJHA 1MA9B 2QI2A 1B92A 4MDBA 3J81O 3SAGA 5AZIB 1HKGA 3HL8A 1IG9A 1ILYA 4B08A 3HPGA 4X64K 2YX6A 4NCBA 1NGBA 2NRVA 1J53A 4G1QA 1HMVA 4A5BA 3ZSYA 5AFUA 5E41A 1U49A 3KKRA 3SZ2A 2E6MA 3DWLA 3VEXA 3W0LA 2ETJA 3OYBA 2P9PA 3KLIA 1I94K 1C0GA 3LDQA 3U8XA 4OLBA 3A0IX 4UY8O 4DKWA 3C7NB 3A5OC 5KRTA 3TWHA 4PL8A 4CZKA 4YHHK 3SNNA 3V1OA 1RNHA 3TI0A 5JLHA 1NJZA 2PYJA 2YJEA 3AO3A 3BZCA 3DXMA 5CY4A 3KD5E 4F4KA 4BR2A 2KW4A 1ZYQA 3PX4A 1NGCA 1WN7A 4NO7A 4Y0WA 2P9LA 3FZHA 1SL1A 3QERA 2QK9A 4DUYK 4M3UA 2OZSA 4DV5K 3OYCA 3CHWA 1LWCA 3P38A 4DSLA 3SAHA 3SUQA 1U45A 2E2QA 3RWUA 3NF7A 3U9DA 2QXFA 3KLHA 1TV6A 3VEWA 3CYMA 3TANA 1RBTA 4LF8K 3KHYA 3D0PA 1BI4B 2P9NA 3G4SN 2FBVA 2VG5A 1XHZA 3PX0A 3HM8A 3QESA 1NKCA 1TK5A 3OYIA 4LD0A 3KTQA 2QM1A 4JI0K 2QWOA 5EU7A 2V52B 2ITGA 4W5RA 3MDQA 2P9UA 4EHUA 4RW4A 4O8UA 1M1KO 1HKBA 3O9QA 1K8AO 4YY3K 2YNIA 3GBTA 2HVHA 4DFKA 3IG1A 4FXDA 2WUSA 5KGXA 2BUPA 2HNDA 3DRPA 4DV6K 5FLXO 2FBYA 1HNWK 3AVHA 3JSMA 1RDUA 4FWPA 1HYSA 3NGIA 1P8ZA 3HXMA 4ELUA 2A1SA 4B1ZA 4NXMK 2BTFA 2O8CB 3G10A 4BRAA 1LV5A 4E7KA 4YNQA 3T1AA 3SYZA 2CGKA 4AM6A 5AQKA 2FBTA 2NRXA 3CCQN 4K25A 4JD2B 4AF1A 4RCHA 3RMBA 3CCMN 3LZIA 4L3QA 4OLAA 4FLTA 3ALYA 3DLGA 3E1YA 1LAWA 4I9QA 4LF4K 3TABA 4ILHA 4CI6A 1NGFA 3QNOA 4IWVA 1RBUA 3O1WA 5EVZA 3FLCO 4DSKA 3O1BA 2HMPA 1BO5O 4CJKA 1YF5L 3L2RA 2F9WA 1U2VA 4M63C 4HTUA 2GELA 2E2NA 1T03A 1YIJN 2G8IA 1NBWA 2HSTA 3CCLN 1CZBA 5CE3A 4E19A 3ULEB 2OPQA 1TYQB 1ZXOA 1S1XA 2XY6A 4KHQA 1D8YA 4GVEA 4BRFA 4LFBK 2IS3A 3KZBA 3ZX3A 3TPQA 3F73A 1X9WA 2QKKA 2JWKA 2KZZA 1X1PA 1ZBHA 2O8DB 4B3OA 1O1WA 3DRSA 2HHQA 4MQ3A 2FLOA 1B9DA 1J5EK 3DLKA 4BR4A 2QA4N 3WXLA 1OVYA 5I42A 4RW6A 4KFBA 3HI0A 3CC7N 4K41A 1H1VA 3CCVN 3FZFA 4DB3A 3OJSA 4KB0A 2WBNA 3CM5A 2Q2RA 3I0SA 4CGFA 4DQRA 3HO1A 5EX5A 4BR5A 4MLEA 3L8BA 2AP1A 3KJVA 2E8AA 4R79A 3C94A 2G8FA 3V1RA 2D1KA 3SJHA 4AILC 3FZLA 4CZMA 3NVKA 2O8FB 3L3VA 3WUHA 2QWQA 4KKOA 1HUXA 4BR0A 4FWKA 3R6MA 4C1NK 4BGBA 2E6LA 3AO5A 3HBTA 4CJTA 3JYTA 2HBJA 3CCEN 2P5OA 4IG3A 3DOLA 4DR3K 4H4MA 3V9XA 1TAQA 5AQWA 1DTQA 4EAHD 4YDUA 1YAGA 5F1XA 4DR5K 1DEJA 1C1CA 3Q7CA 2A41A 3EKSA 3ZYYX 5M1OA 5IWAK 1VSMA 4FLUA 4CZJA 3DLLL 4H0OA 5KQ8A 2HBKA 3K59A 4CJFA 3M1FA 1KLMA 4J2AA 3RMCA 4JV5K 4DR1K 1EX4A 5BREA 2ZGZA 4WF9L 2NRWA 4FLWA 2A1RA 4FWNA 3V9UA 5E26A 4CEBA 5FPMA 2G8WA 1EETA 3M6GA 5ADXH 5LJWA 5KRSA 2YKNA 3IFRA 1Y97A 5EXWA 3VQ5A 1KC8O 5J1EA 4H5TA 4ISEA 1WOQA 3WQTA 3U4LA 1VQ8N 3HVTA 2D0PA 1LAVA 1TGOA 4FM0A 1IH7A 1NGJA 3AARA 2VCPA 1S5JA 1Z05A 1XMOK 5KPRA 4FVMA 2YI1A 3VF6A 4FJ8A 2GUPA 3THYA 3CIPA 4X66K 3OS1A 4KH6A 2Q0UA 4E89A 4DV2K 5KGWA 4DS4A 1VRTA 4OO1J 3PX6A 4NCAA 1K8KA 4ZHRA 1YXQA 4CJ4A 4AQYK 1FKPA 4G9ZA 1IG8A 4LSLA 1MDUB 5SZTA 3HP6A 4FW2A 3SUPA 2E88A 2O4GA 3F5TA 4CE9A 4QS8A 5AQZA 1Q81O 2B4JA 2IGIA 3H46O 3OYFA 4PHTX 1Q8IA 3SMPA 1E3MA 4JKGB 1ASUA 3QEIA 4JI4K 5SWMA 1ATSA 3TU5A 4FJMA 4A2AA 4CECA 2AJQA 4V19S 3T69A 4DTNA 1RT2A 4DV1K 3G71N 2HBLA 1HQEA 4C8MA 1RDBA 3S41A 1TL1A 5I9EB 4CEZA 1E4GT 4J2EA 1KLNA 2KLAA 3NGZA 3VA3A 2QTDA 4EHTA 1YITN 1SS6A 4GW6A 1QVFM 5AQUA 5M1NA 3HSTB 5AQSA 2E1YA 3TR8A 1WSFA 3RSEB 4CBXA 5DK5A 1QQCA 5AQFA 3SI6A 1YJNN 4JHDA 5HLFA 3E9LA 4WFBL 1GLEG 3LWMA 2D0OA 5GIOA 4YOXA 1NGHA 4UQGA 3TAGA 5FRNA 4AHRA 1U4BA 3PSFA 3D2EA 2NRZA 3BY5A 3U3GA 4BY9C 4XIUA 3NF6A 3IAYA 2FBXA 4FJ7A 3E66A 3SQ2A 4CHQA 3HZ6A 4DQPA 2KFNA 2NLXA 1UOCA 3EN9A 4DFMA 3JAMO 4CCHA 1RFQA 2IOCA 1VAZA 3HOTA 1YTUA 4CZEA 3OYEA 4BRMA 2UUAK 3K5NA 2VWKA 1LW2A 4JKFA 3T1HK 4KAZA 1RT4A 4BG9A 4CGIA 3BF3A 1XNQK 2OPPA 5K14A 3F2KA 3S3NA 4IXCA 4W5OA 3MEDA 1F21A 1SAZA 4MDAA 2OTLN 3LDLA 2HMIA 2FSJA 1KAYA 3P1GA 3F9MA 4CF9A 1KFSA 3K58A 3K2PA 1QVGM 1SKWA 4Z0UA 1Q7YO 1GOBA 1XC3A 3CFOA 1D4XA 1G15A 5C24A 4RG8A 5LY3A 2QWNA 1QE1A 2VGMA 4QCLA 1HYZA 3V9ZA 2ASPA 4FLYA 4ELVA 3DXKA 4KREA 1KAXA 3NBPA 2WC9A 4W5TA 3THXA 3PY8A 2HHWA 3LP1A 3MXJA 1Q9YA 5BPLA 3WEEB 2ZJPL 3Q7BA 3V9WA 4CFCA 1TKDA 1Y64A 3TAQA 1XC9A 2QWRA 4NLBA 2GTDA 2UUBK 4XH1A 5J2PA 4PKIA 3K9KA 4DSJA 1L3TA 5AQRA 1VQ6N 1RBRA 4CJRA 2YNGA 2FF3B 3CCRN 4OVLA 5GINA 3WXKA 4ID1A 3DM2A 3SCXA 3J7AP 3OYJA 2ZWHA 3NH0A 3MCAB 3T1YK 3KD1E 3AO1A 1T44A 4XH5A 2DTUA 3ZETB 4CJ3A 4DV0K 3NH1A 4RWTA 1NK0A 3DRRA 5AQPA 1W97L 1RT6A 1K73O 3HOSA 4Z4CA 4ZTJA 3KWGA 3CETA 4EZ6A 4B9MA 2CGJA 4FJ9A 4F2RA 3ATVA 4H03B 3I8DA 2Z1JA 1EP4A 1QSYA 3K0SA 4KHYA 4E1MA 4EZ9A 2GWJA 4K8ZA 4BR9A 4M3TA 5AQTA 4B3TK 2NUBA 3MN5A 3DYAA 2W6LA 2D0AA 3O3HA 3E01A 2WONA 3MX5A 3LP2A 2RPIA 4DV3K 2P9PB 1Z6RA 1U48A 3AVMA 4H5WA 1HLUA 4JKAA 5A2QO 2Q1NA 1VQ4N 3JS6A 3KIOA 3G6EN 1QSSA 3C65A 4M3YA 1NU0A 2GWKA 4JN4A 5CYQA 1HR0K 2VWBA 2Z1HA 5KQDA 1SL2A 3DXMB 3VGKA 1BU6O 3U3YA 1N33K 4GMJB 1D9DA 3EKUA 4FLVA 1SV5A 4OGCA 4K0KK 5JVHL 4DFJA 4BWMA 3DLBA 1QQOA 3PIOL 3VEZA 3N4QA 4LF5K 4IFVA 3LDPA 3DLRA 3AO2A 1BA0A 3ZLJA 3BP8A 3U6FA 3MK6A 2NRRA 3TTDA 2RN2A 4O0IA 4BRQA 4JK8A 1RDCA 4X65K 5C25A 4LF7K 2P9NB 1BCOA 3SBGA 3QMLA 4CVNE 1X3MA 4M3ZA 4OKEA 1DKGD 4HUFA 3P39A 4CIEA 3ULDA 3AVNA 4IOCL 3VESA 3SQ1A 2BH1A 4CF8A 3PLAA 1YJ9N 4FK0A 5AZJA 3CCJN 3L2UA 4M45A 1LOTB 1SKSA 3AAPA 1N32K 4CJVA 5AZIA 4N41A 2CH5A 3CPWM 1ZBFA 4DQQA 3CD6N 2BE2A 2F96A 1S3XA 4K8XA 3R8EA 2CGLA 3KLGA 4E7LA 1BIUA 3QIOA 3SPYA 1KXPA 1RBSA 4DV7K 4QS7A 1GLDG 1YVUA 5IT9O 1Q82O 2XO7A 4JKEA 4B9UA 3LAMA 1NK4A 3KK2A 1IBKK 3UKUB 3OY9A 1C0TA 1D9FA 1BQMA 4EIAA 3ZSRA 3MEEA 3O4QA 1T05A 4A57A 4BR7A 3JXUA 4DTPA 2Q36A 3C7NA 3TAMA 5GAHP 5I3UA 5HOOA 1CXUA 1HRHA 1V4TA 1XI1A 4DSEA 2Y1IA 4KH5A 3HSCA 4CEAA 3I0RA 3RTVA 4J8FA 3SK3A 4JS4A 3NAEA 3P83D 3V81A 2V7YA 1TUYA 4XH4A 3VQEA 5ADXA 4CF1A 4JAXA 1NLVA 1BGXT 3NDKA 1C1AA 2R7YA 4E1JA 1EO1A 3VOVA 4H8KA 5AQIA 1NMNA 4WQ4C 3GG4A 1T6CA 3LAKA 1QQNA 4KTQA 4C8KA 4DMNA 4ZTFA 1FKOA 4WQ5A 1NJXA 1IKVA 1DLOA 1A5WA 3P4IA 1BI4A 3L4QA 5HRNA 1CXQA 2D5RA 4K42A 3KLEA 3THWB 1NJWA 3TSQA 4JRPA 1QS4A 3T7ZA 4BWJA 3D2FA 1LCUA 2E20A 4KTWA 1S72N 5CZ2A 2ZD1A 1P90A 4FWOA 4AM7A 1YHQN 1JXBA 1YT3A 3FZMA 4DHYA 1NGAA 2HNZA 3ZT0A 4CFDA 4AHCA 4CGGA 4BC3A 3TSPA 3M8PA 2OZMA 2J4RA 3PIPL 4B3MK 4PKHA 5FRMA 2XY8A 3DJCA 1RILA 2KHOA 4WCEL 4JI2K 5BR9A 3O4WA 5GAGP 1FW6A 4FVUA 5HBMA 4EFHA 3KK7A 1TVRA 3EY1A 2O8CA 3ZT1A 5KPTA 4HCBA 1Q18A 4BDYA 2UUCK 3AVJA 1HPMA 1N6QA 2P51A 3VETA 4J2DA 1U04A 4IG0A 4JD2A 3NF8A 3MMVA 3QFUA 4GKJK 1OKJA 3SV3A 4TSXA 1HX1A 3M3ZA 5BRDA 3CC4N 3SLCA 1TAUA 3QIPA 4CJUA 4CF2A 4DTXA 4H0VB 2ITMA 4BC5A 4CBWA 4Z4IA 5M1KA 3NMUA 1TKTA 2IVPA 4B1XB 5DM6L 3VTIA 4I9LA 2GX9A 2P9KB 3EO3A 3H08A 4IKFA 1J5OA 3AGKA 1S6QA 3HYFA 5J2NA 3OYKA 3ZEUB 1OH5A 4BC2A 2RE2A 1GOAA 2ASMA 4KHUA 2YHAA 2RF2A 4JI1K 3GOIA 3I55N 1BIZA 2HB5A 2JLEA 2X6SA 3VMFB 4BRHA 1T6DA 1IO2A 4H0TB 4QS9A 4L8RB 4IFEA 1DGKN 3FE1A 2OYQA 3QEPA 4CIFA 4CGJA 1SUQA 1RTIA 1HNVA 4CGHA 2ZF5O 1IKWA 1BWFO 3C6UA 4CJ7A 1X3NA 2P5GA 3THVA 3RR8A 4A2BA 3ENHA 3CJ1A 2O8DA 4OKKA 2KZMA 4IEIA 3FR0A 3ENBA 3CCUN 2X78A 4BREA 3LWLA 4BGAA 4OPHA 4C8NA 3AAQA 4IDHA 4MLHA 5J2QA 5AQHA 2O8BB 4C8OA 1CZ9A 4HTLA 3NGYA 3VQAA 3THYB 4AHTA 2FF6A 2HBMA 3EL2A 2D4WA 4E7IA 2V51B 3D6RA 2WFBA 3QFPA 4Q5VA 1K9MO 4B1UB 4ICLA 4BRIA 4BRLA 2YNHA 4DR2K 2G8HA 4YOVA 2E2PA 1WUAA 4FWSA 3TTFA 1EXQA 5CHIA 3HM9A 1TKXA 4FLXA 2UXCK 1T7PA 3KKSA 2G8KA 3L3UA 4RW8A 2VWJA 3UKRA 1DTTA 3A8YA 4CZGA 4DG1A 1ESVA 4BRPA 3NCIA 1XQSC 5JMVA 1S9GA 1QHTA 4ILJA 3BUZB 4BE2A 2I7NA 4KV8A 1K6YA 1C0FA 3C6HA 2DPNA 4FPAA 1VK0A 4IO9L 2UXBK 1R59O 3VQQA 2VGNA 4CZLA 2LSNA 1VQLN 3M5RA 2P1JA 3D7EO 4XEIA 3OYAA 1NJIO 3ZX0A 3QEWA 4PL7A 3KLFA 3S3OA 4RTFD 5HRPA 5KTQA 1KAZA 3CJAA 1NG9A 3HK2A 1KVAA 3G0ZA 5HRRA 5AJ3K 1QQMA 4RW7A 3CXCM 3BF1A 4GKKK 5J2MA 4DLEA 4BDZA 2P9IA 2QWMA 4CHYA 4CJLA 4E7HA 4FZYA 2WTUA 5BPNA 4OPJA 3ENOA 4BROA 3PSIA 4PQUA 2P9SA 1KVCA 3V1QA 1OH6A 5AQXA 1EWQA 1REVA 3OS2A 1KTQA 3QDKA 2UXDK 3D2EB 1WAFA 3ZT4A 4CEOA 4WYBA 4DQ8A 1J54A 4MO4A 4H5RA 3OYHA 1WNSA 1JLGA 3U9ZA 3CERA 3H6EA 1JL2A 3OTOK 5FDLA 5AQOA 4GV3A 4FJ5A 1NK9A 2HHHK 4HCCA 1RTHA 1SZ2A 2O8EA 4JKGA 4LH4A 3LP0A 4DSFA 2IAJA 4YORA 1VQPN 2BANA 4Z4GA 2E2OA 4MO5A 3H45C 1L3VA 1WBDA 1GLAG 4JI6K 4DTMA 3BDPA 4U67L 2GV9A 3K9JA 4R5PA 1HKCA 4DTUA 2O4IA 1VQNN 1HPZA 4WFAL 5TKYA 4M42A 1RGIA 1S1TA 3O9UA 4JI8K 5KPZA 4BC4A 3WNFA 4BRKA 1TUUA 1A5VA 4CFAA 4FK4A 1YVNA 4CGDA 3MXMA 1QTMA 4IBNA 3S9HA 1BG3A 3ID8A 4A62A 1VRUA 2A3ZA 4B1VA 2F8TA 3RSEA 2ZM6K 2X6NA 5FPEA 3BGRA 3H1QA 1HQUA 3ZT3A 1R0AA 1RCHA 4F9OA 2YHXA 2DY4A 2VQEK 3QBWA 5BN8A 4Z4FA 2YNFA 5FPNA 3CMEN 4B9LA 3VQ6A 4M3RA 4OKJA 5HRSA 1VQ9N 3NFAA 4BRCA 4AH9A 4DTOA 4CJWA 1ZBLA 4BRNA 3H3OB 3QEVA 5LJVA 1A5XA 2DFFA 2CH6A 1JLCA 3I33A 4M3WA 3C6TA 3AVIA 3F9KA 3KVGA 1JCEA 4FWMA 1CZAN 1HNXK 2QEXN 4BG8A 4LY7A 2EHGA 3OJUA 4KBOA 3LDSA 1NMDA 4DUZK 1S22A 1VSHA 3LANA 4KHNA 2Z1GA 1RTDA 4KPYA 1GLBG 4EP4A 3RMAA 1ASWA 4Y1DA 4O44A 2QWLA 2EWSA 2KKZA 4DSIA 4PWDA 1JKHA 3CPEA 3O9SA 4B8CA 4FO0A 4F3TA 3VQCA 4C1NI 4GV9A 1MWKA 1W0HA 4DCHA 3TSUA 3T3FA 3J7ZO 1S1UA 2AA4A 2UYTA 5TKWA 2H3GX 3AVCA 3PV8A 3EZWA 1LWEA 2F9TA 5LMUK 4Z94A 5BRFA 4CESA 2FSNA 2GBZA 1VQ7N 2IC3A 4EP5A 2D0BA 3QNNA 4FSVA 5C2FA 3MCPA 4LF6K 1RT3A 3AV9A 4YOYA 2ZQBA 5JLFA 4FOIA 4DS5A 3MAQA 1OH8A 2HHSA 2YKMA 1XWLA 3GDQA 3O5BA 3DOKA 4FL9A 3IMXA 3ZT2A 4A61A 3MN9A 4KHSA 3UE5A 3D45A 1JLEA 2IVNA 1SL0A 3ISNC 3O9RA 1NK6A 4HVJA 3EZ5A 5M1FA 3LZJA 3P31A 2PFUA 3ZSVA 2RKIA 1BA1A 4JI3K 3CFRA 3WQUA 1C0MA 1IV0A 1NOZA 4NYNA 1NGDA 3OYGA 4DU4A 1S1VA 1S6PA 4I6MA 1BQNA 4YOWA 2GEMA 3OS0A 3QBXA 1BCMA 4KI6A 3DAWA 3O8MA 4ILGB 2XHBA 1KSPA 3ASMA 5DMRA 3HJFA 4QAGA 3A2FA 3ZETA 1RTJA 4Y1CA 3IUCA 4ISFA 2P9LB 4LFAK 4WQ5C 5AZJB 1I3AA 1VSIA 2XRIA 4H5VA 5EOYA 3B6PA 1RDAA 4OPKA 2Q0RA 1C0UA 3KK3A 4YOUA 4CHPA 4FM2A 3SUOA 1UA0A 2OPRA 3AY9A 4AHUA 4FWRA 4IEEA 5EY4A 2PYLA 3WXMB 2YHYA 1EQYA 3UIQA 1RBVA 4DQSA 1JLQA 3OBYA 1RT7A 3VENA 3O3FA 1KFDA 4YFUA 3NE6A 3L6QA 4FJKA 4GY2B 2P9UB 2ASOA 2F7TA 3HTVA 5GADP 4GV6A 3ID6A 4N47A 4DR4K 4ISGA 3CM6A 3KWIA 2I7PA 2V7ZA 4JRQA 3O9TA 4DQIA 3ITHA 3VEVA 5C2DA 3EE8A 1G99A 2XY5A 4H4OA 3TAFA 5T7BA 4I7FA 2Z1IA 1U47A 2HVIA 1LWFA 1JL1A 5DM7L 1VSKA 3TTCA 3QETA 3EYZA 1YI2N 4FJGA 3QICA 4O5BA 1ASVA 2ZE2A 2BGGA 1NK8A 1J6ZA 2HF4A 4CJQA 3DLEA 4AHVA 3C6AA 4J2BA 3CFPA 3BZKA 3P5JA 4PUOA 1TK8A 3VQ8A 4OPAA 2VQFK 1NJYA 4DR7K 3IRXA 4IJAA 1ZBIA 2Q97A 1N8RO 3PUFA 3D2FB 2W41A 3K5MA 3LM9A 1T8EA 4F2SA 2HHXA 1UWBA 4I2QA 3AVAA 3VPZA 2PBDA 2E4LA 1I39A 4Z4HA 1N5YA 4CHOA 1KVBA 3AGRA 3LM2A 3MWPA 3K57A 3I8BA 3V4IA 1WSGA 4FW1A 1KD1O 1U2VB 1JJ2M 5CZ1A 4CZHA 4HUEA 1WSHA 2IVOA 3B6OA 5HL7L 3O80A 4CIGA 1RDDA 2RHKA 4JI5K 1W2BM 1NKBA 2VYPA 2F4VK 2YV0X 4FLZA 4YDUC 3UKUA 4F8RA 3OYMA 3SV4A 3CJCA 3RRGA 4BE1A 4JYAK 5ELZA 4CD3A 1EWRA 1TKZA 2A40A 5GAEP 4GNIA 1RDWX 1IJJA 1NM1A 3HP9A 2G8UA 1GOCA 5BPMA 4KI4A 2D0CA 4BQLA 1ATRA 1XMQK 4FZXC 2I5JA 1NGGA 5FPDA 1KCFA 2OPSA 2Q3SA 3IS9A 4NLCA 1QZ5A 4PKGA 1SQKA 3DI6A 3KK1A 1NK5A 3E9OA 3VA0A 2HHUA 1Z25A 1V4SA 4OJRA 2DFHA 1ZBUA 1WB9A 3G25A 3H1VX 1WSIA 3QEXA 4YOTA 2KFZA 5AQMA 2YHWA 4CF0A 4N76A 3PO5A 2YJFA 4DR6K 1GLJO 4E1NA 4DTSA 3VGMA 3ZCMA 3RR7A 3THWA 1VSEA 3BEXA 1X9JA 2KTQA 5AQYA 4CEQA 3MN6A 1WBBA 2W42A 1YUWA 4KRFA 5AFUH 3K5OA 4NYFA 3L0QA 5AQGA 2HNYA 2KQ2A 1XNRK 3HPOA 4DLGA 1YTAA 2OANA 3LL3A 2BDPA 1WSJA 2IIRA 3N4PA 3OA9A 3NVMA 1CLQA 3VQ4A 4WE1A 3CF5L 4B9VA 3MWTA 4CEDA 3VQPA 1HNIA 3SJJA 3AA2A 3AVGA 4B8AB 4C8LA 2E5LK 3LPTA 3ULEA 4CFBA 4HHTA 3MECA 3H3NO 4FJLA 1OH7A 1TYQA 1VSLA 1JCFA 4KHPK 3ZSWA 1D5AA 3QINA 1C1BA 3VERA 4FCYA 4QOZB 4F3OA 1Z26A 3VGLA 3NF9A 1YJWN 3SUNA 5JS2A 1ZC6A 4WQ4A 4LH5A 2YHBA 3VTHA 1W9HA 3OHRA 4IOXA 3QB0A 3O6WA 1NOYA 1KQSM 3DMJA 1B9FA 4E0DA 1BDGA 4K43A 3WXIA 3MN7A 5JVGL 1LW0A 1T3VA 1N34K 2EX3A 1BOTO 4HUGA 3UKRB 4O4GA 4O5FA 1NK7A 2P9KA 4X62K 3AVBA 2VG7A 4FOEA 3ZEUA 1VQKN 4CJSA 4CZIA 3FGUA 1MWMA 2O8FA 4WFNL 4B9TA 2FC0A 2ZGYA 4HWIA 1K8KB 3K5LA 4KHWA 5C15A 4W5NA
chains in the Genus database with same CATH topology
3G10A 4GVMA 4DTUA 1U48A 3AVMA 1LV5A 2O4IA 4E7KA 4YNQA 3T1AA 3SYZA 3ZSXA 1HPZA 4FZZA 2X74A 3KIOA 1QSSA 4M42A 4M3YA 1S1TA 2FBTA 4CERA 5CYQA 3WNFA 2Z1HA 3L2WA 4LSNA 3RMBA 3LZIA 1A5VA 4CFAA 1SL2A 4M3XA 4FK4A 4OLAA 4CGDA 4FLTA 3U3YA 3ALYA 3DLGA 4GMJB 4CHZA 3MXMA 1QTMA 1LAWA 1D9DA 2PY5A 3PO4A 4I9QA 3TABA 4IBNA 3S9HA 2VG6A 4FLVA 4CEFA 1SV5A 4OGCA 3TAEA 1TK0A 1VRUA 1VSFA 3QNOA 2F8TA 4DFJA 1RBUA 4BWMA 4DSKA 2X6NA 1L5UA 3DLBA 4IDKA 3BGRA 4CJKA 1BL3A 3WNGA 3L2RA 1HQUA 3ZT3A 1R0AA 1UAXA 4IFVA 4HTUA 1RCHA 3DLRA 3AO2A 3U6FA 4JS5A 2DY4A 1SKRA 1T03A 2RN2A 4O0IA 4Z4FA 2YNFA 2G8IA 1RDCA 4B9LA 3VQ6A 1CZBA 5C25A 4M3RA 4OKJA 5HRSA 1BCOA 2G8VA 3MEGA 3HPHA 4E19A 2OA8A 2OPQA 3NFAA 4AH9A 1NKEA 4DTOA 4CJWA 1ZBLA 4M3ZA 4OKEA 4HUFA 3ULDA 1S1XA 4CIEA 2XY6A 4KHQA 1D8YA 3AVNA 3QEVA 1A5XA 2DFFA 2IS3A 1JLCA 4O55A 3SQ1A 3F73A 1X9WA 4CF8A 1QSLA 2QKKA 4B9NA 4M3WA 3C6TA 3AVIA 4FJIA 3F9KA 4FK0A 1X1PA 2KZZA 3L2UA 2ATQA 1ZBHA 4M45A 4OGEA 1VSDA 4W5QA 1SKSA 4B3OA 1O1WA 3DRSA 4LY7A 1JLFA 2EHGA 2HHQA 4CJVA 3S3MA 4MQ3A 3OYDA 1X9MA 3OJUA 3L2QA 3M8RA 4N41A 1B9DA 3LDSA 3DLKA 1ZBFA 4DQQA 2BE2A 3O3GA 5I42A 3ZSQA 1VSHA 2F96A 4RW6A 4K8XA 3LANA 4KFBA 1FXXA 3QLHA 4KHNA 2Z1GA 1RTDA 3LP3A 3O4NA 3KLGA 1BIUA 3QIOA 3OYLA 4E7LA 3SPYA 4KPYA 4KB0A 3OJSA 4EP4A 1RBSA 3CM5A 3I0SA 3RMAA 3AO4A 4CGFA 1ASWA 4Y1DA 4DQRA 3HO1A 1YVUA 4O44A 4FK2A 2XO7A 4MFBA 4B9UA 4PWDA 4DSIA 3LAMA 1NK4A 3KK2A 3L8BA 1JKHA 4CK3A 4B8CA 3OY9A 3KJVA 2JGUA 1C0TA 1D9FA 1BQMA 3C94A 2G8FA 4F3TA 1S9EA 3V1RA 3VQCA 1W0HA 4AILC 3ZSRA 3T3FA 4CEEA 1S1UA 3MEEA 3O4QA 4I2PA 1T05A 3L3VA 1EKEA 4FJJA 4KKOA 4DTPA 3TAMA 3AVCA 1JXEA 3PV8A 4BACA 1L3SA 1LWEA 5I3UA 1BISA 1CXUA 1HRHA 1HJRA 1XHXA 2E6LA 3CG7A 4CESA 1XI1A 4DSEA 2GBZA 3AO5A 3QO9A 2Y1IA 3AVFA 2IC3A 4CEAA 1X9SA 3I0RA 2D0BA 4CJTA 4EP5A 3RTVA 3JYTA 4DTRA 3QNNA 4Q0BA 2P5OA 1RT3A 3AV9A 3P83D 3NAEA 2ZQBA 3DOLA 4IG3A 4JS4A 3ZSOA 4DS5A 1WLJA 3V81A 4H4MA 3V9XA 3MAQA 2HHTA 1TAQA 3VQEA 2HHSA 4ID5A 2YKMA 1DTQA 1XWLA 1L3UA 4CF1A 3DOKA 4KO0A 1BGXT 3NDKA 3ZT2A 3CQ8A 5D3GA 1C1AA 2IDOA 2R7YA 1C1CA 5KI6A 4KHSA 3D45A 1JLEA 4H8KA 1SL0A 4E7JA 1VSMA 3ISNC 4FLUA 1NK6A 4HVJA 3EZ5A 3LAKA 2HHVA 4B9SA 4KTQA 4C8KA 4DMNA 3K59A 3LZJA 1FKOA 4ZTFA 4CJFA 1IKVA 1NJXA 3ZSVA 2RKIA 3C95A 1KLMA 1DLOA 1A5WA 3ZSZA 4FM1A 3RMCA 1FK9A 1Q9XA 4J2AA 1BI4A 1EX4A 3L2VA 5HRNA 1JLAA 3CFRA 1CXQA 1C0MA 4FLWA 3RRHA 2A1RA 1NOZA 2D5RA 4NYNA 4CHNA 3OYGA 4DU4A 1S1VA 1S6PA 3KLEA 3V9UA 4CEBA 1BQNA 1NJWA 3HT3A 2WOMA 1EETA 4JRPA 1QS4A 3V6DA 2G8WA 5KRSA 2PZSA 4BWJA 2YKNA 4N5SA 3OS0A 1BCMA 3QETA 3LPUA 4KI6A 3AA3A 2XHBA 1KSPA 1Y97A 5HP1A 3ASMA 5DMRA 4KTWA 3DLHA 5CZ2A 4QAGA 3VQ5A 3A2FA 3HJFA 1RTJA 2ZD1A 4Y1CA 5J1EA 5JS1A 1JXBA 1YT3A 4M41A 1I3AA 3WNHA 4KTZA 1VSIA 2XRIA 3B6PA 1RDAA 3V9SA 3HVTA 4OPKA 2XY7A 1LAVA 1TGOA 1HYVA 4FM0A 4DF8A 1IH7A 2HNZA 3ZT0A 4CFDA 4AHCA 4CGGA 1C0UA 3KK3A 3VN5A 3M8PA 1IKXA 4CHPA 3SUOA 4FM2A 1UA0A 2OZMA 3T19A 1S5JA 3M8QA 4FYDA 4O0JA 2OPRA 5FRMA 1BHLA 1TL3A 1RILA 2XY8A 4FVMA 4AHUA 4FJ8A 3WNEA 2PYLA 3OS1A 4BDPA 3UIQA 3OYNA 4E89A 3RMDA 1RBVA 4DQSA 1JLQA 5KGWA 4DS4A 4FJNA 1VRTA 1ITGA 1IKYA 1RT7A 3O3FA 5HBMA 4CJ5A 3PX6A 4NCAA 1RT5A 4ZHRA 1TVRA 1KFDA 4CJ4A 4YFUA 3EY1A 4CJEA 3NE6A 3VQDA 3ZT1A 4FJKA 1WSEA 4HCBA 1FKPA 4BDYA 1KRPA 4LSLA 1MU2A 3AVJA 5SZTA 3HP6A 1N6QA 3NHGA 2P51A 4J2DA 2GUIA 1U04A 4FW2A 4N47A 3SUPA 4IG0A 3FFIA 2O4GA 3NF8A 4CE9A 2Y1JA 2HW3A 3CM6A 3SV3A 3AA5X 4TSXA 4JRQA 1TAUA 2B4JA 2IGIA 3QIPA 3OYFA 4CJUA 1Q8IA 4DQIA 3ITHA 4CF2A 4DTXA 4E3SA 1ASUA 4IFYA 4JLHA 2XY5A 3QEIA 4Z4IA 4H4OA 1TKTA 5SWMA 3TAFA 4I9LA 5T7BA 4FJMA 4I7FA 2Z1IA 4CECA 3TARA 2AJQA 3H08A 1U47A 4IKFA 1LWFA 1JL1A 4CJPA 3SQ4A 1J5OA 2HVIA 1VSKA 1S6QA 3HYFA 3NH2A 1RT2A 3OYKA 4CK1A 3EYZA 4DTNA 5J2NA 1HQEA 1GOAA 4C8MA 4FJGA 4O5BA 1ASVA 4KHUA 4BE0A 2ZE2A 4DU1A 2YHAA 1RDBA 4DF4A 2RF2A 1NK8A 2BGGA 4CJQA 1TL1A 2DFEA 1BIZA 3DLEA 2HB5A 4CEZA 2JLEA 2X6SA 4AHVA 4Z4EA 4J2BA 4J2EA 3CFPA 1UA1A 1IO2A 3P5JA 4L8RB 4PUOA 4KB1A 5CYMA 3VQ8A 1TK8A 1KLNA 3QEPA 2OYQA 3SQ0A 1NJYA 3IRXA 1ZBIA 4CIFA 3NGZA 4CGJA 2B5JA 1SUQA 3VA3A 1RTIA 1HNVA 3PUFA 4CGHA 3HVRA 1IKWA 3C6UA 4ELTA 4GW6A 3K5MA 4N56A 4PY5A 1T8EA 2P5GA 4F2SA 3THVA 2HHXA 3HSTB 1UWBA 2B6AA 4I2QA 3AVAA 3RR8A 4RW9A 4OKKA 5FROA 2KZMA 2E4LA 1I39A 1RT1A 3AVLA 4Z4HA 1N5YA 4CHOA 3TR8A 5C42A 1KVBA 1WSFA 2X78A 2QKBA 2F8SA 3K57A 3OVNA 3LWLA 3V4IA 5DK5A 1WSGA 4DTJA 4DWIA 4FW1A 1QQCA 4PA1A 5HROA 4C8NA 4FJXA 1VSJA 1J9AA 3VQ9A 5CZ1A 3SI6A 3MXIA 4CK2A 4NCGA 1S1WA 5J2QA 4HUEA 4DU3A 1WSHA 5HLFA 3B6OA 1C6VA 4CIGA 1CZ9A 3LALA 3LWMA 1RDDA 4C8OA 3NGYA 3VQAA 1NKBA 4AHTA 4UQGA 3TAGA 5FRNA 2YV0X 4AHRA 4FLZA 3SPZA 3VQ7A 1U4BA 4F8RA 4E7IA 3OYMA 3SV4A 3U3GA 4XIUA 3NF6A 3IAYA 4Q5VA 2FBXA 3M8SA 4DFPA 3RRGA 3TAPA 4BE1A 1WAJA 4FJ7A 3SQ2A 4CHQA 4DQPA 1TKZA 3VQBA 2KFNA 1JLBA 4ICLA 3AA4A 3AVKA 4AHSA 2YNHA 1UOCA 3HP9A 4FJHA 2G8UA 1GOCA 4DFMA 1B92A 4CCHA 2G8HA 2IOCA 4KI4A 1YTUA 2D0CA 3OYEA 3HL8A 1IG9A 4FZXC 3K5NA 2I5JA 2VWKA 4FLXA 3HM9A 1EXQA 4B08A 1KCFA 1TKXA 2OPSA 2Q3SA 3HPGA 1T7PA 3KKSA 2G8KA 3L3UA 4RW8A 4NCBA 2VWJA 1LW2A 1J53A 1DTTA 3IS9A 4G1QA 4KAZA 1RT4A 1HMVA 4CGIA 4DG1A 3ZSYA 2OPPA 3NCIA 5K14A 3DI6A 3KK1A 3S3NA 4W5OA 3MEDA 1NK5A 2HHUA 3VA0A 5E41A 1U49A 1F21A 1Z25A 4OJRA 1S9GA 2DFHA 1QHTA 1ZBUA 3KKRA 3SZ2A 2E6MA 4BE2A 2HMIA 1WSIA 4KV8A 3QEXA 1K6YA 2KFZA 3P1GA 2ETJA 3OYBA 4CF9A 3KLIA 1VK0A 4CF0A 4N76A 1KFSA 3K58A 4OLBA 3K2PA 3PO5A 1SKWA 3VQQA 4E1NA 4DTSA 3ZCMA 4Z0UA 2LSNA 3TWHA 5KRTA 2P1JA 1GOBA 3RR7A 3SNNA 3CFOA 1RNHA 1VSEA 3V1OA 3OYAA 3TI0A 1G15A 1NJZA 5C24A 2PYJA 4RG8A 2KTQA 3KD5E 3AO3A 4CEQA 5CY4A 4F4KA 3QEWA 1QE1A 4KRFA 3KLFA 2W42A 3S3OA 4QCLA 1HYZA 2KW4A 5HRPA 5KTQA 3V9ZA 1ZYQA 3PX4A 3K5OA 4FLYA 4ELVA 4KREA 1WN7A 3HK2A 4NYFA 1KVAA 3NBPA 2HNYA 2KQ2A 4W5TA 3PY8A 3G0ZA 2HHWA 5HRRA 1SL1A 3QERA 3HPOA 4DLGA 3LP1A 3MXJA 2QK9A 1YTAA 1Q9YA 4M3UA 4RW7A 2BDPA 2OZSA 1WSJA 3OYCA 1LWCA 3V9WA 1CLQA 4DSLA 3VQ4A 3SUQA 4WE1A 4CFCA 1U45A 4B9VA 1TKDA 5J2MA 4DLEA 3RWUA 3NF7A 4BDZA 2QXFA 4CEDA 3KLHA 4CHYA 3TAQA 3VQPA 1TV6A 1HNIA 4CJLA 4E7HA 1XC9A 3CYMA 3SJJA 1RBTA 3AA2A 3AVGA 3TANA 4B8AB 3D0PA 4FZYA 4C8LA 4OPJA 1BI4B 2FBVA 2VG5A 3LPTA 5J2PA 1XHZA 3PX0A 3QESA 1NKCA 4CFBA 4HHTA 3MECA 3OYIA 1TK5A 4FJLA 4DSJA 4LD0A 1KVCA 1L3TA 3V1QA 3KTQA 4PQUA 1RBRA 1VSLA 4CJRA 1REVA 3OS2A 1KTQA 2YNGA 5EU7A 4OVLA 2ITGA 4W5RA 3ZSWA 1WAFA 1D5AA 3QINA 1C1BA 4ID1A 4FCYA 3DM2A 3SCXA 3ZT4A 4CEOA 4QOZB 3OYJA 3NH0A 1Z26A 4F3OA 3KD1E 1J54A 3AO1A 4RW4A 2DTUA 3NF9A 4CJ3A 3OYHA 3SUNA 1WNSA 3NH1A 1NK0A 1JLGA 3DRRA 5JS2A 4LH5A 1JL2A 1RT6A 2YHBA 1W9HA 5FDLA 2YNIA 1NOYA 4FJ5A 4Z4CA 1NK9A 4ZTJA 4EZ6A 4B9MA 3DMJA 4FJ9A 4F2RA 4HCCA 1B9FA 4DFKA 1RTHA 4E0DA 2HVHA 3IG1A 3I8DA 4FXDA 4LH4A 5KGXA 3LP0A 1LW0A 4DSFA 2Z1JA 1EP4A 1QSYA 2HNDA 4KHYA 2EX3A 3DRPA 2IAJA 4E1MA 4EZ9A 4HUGA 2FBYA 4O4GA 1NK7A 3AVHA 4K8ZA 4M3TA 3AVBA 3JSMA 2NUBA 3DYAA 2VG7A 2BANA 4Z4GA 4CJSA 1HYSA 3NGIA 1L3VA 3HXMA 2D0AA 4ELUA 3O3HA 2A1SA 3E01A 4B9TA 2FC0A 4DTMA 2WONA 3BDPA 3LP2A 3K5LA 4KHWA 2GV9A 2RPIA 4R5PA 4W5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G10 A;  4GVM A;  4DTU A;  1U48 A;  3AVM A;  1LV5 A;  2O4I A;  4E7K A;  4YNQ A;  3T1A A;  3SYZ A;  3ZSX A;  1HPZ A;  4FZZ A;  2X74 A;  3KIO A;  1QSS A;  4M42 A;  4M3Y A;  1S1T A;  2FBT A;  4CER A;  5CYQ A;  3WNF A;  2Z1H A;  3L2W A;  4LSN A;  3RMB A;  3LZI A;  1A5V A;  4CFA A;  1SL2 A;  4M3X A;  4FK4 A;  4OLA A;  4CGD A;  4FLT A;  3U3Y A;  3ALY A;  3DLG A;  4GMJ B;  4CHZ A;  3MXM A;  1QTM A;  1LAW A;  1D9D A;  2PY5 A;  3PO4 A;  4I9Q A;  3TAB A;  4IBN A;  3S9H A;  2VG6 A;  4FLV A;  4CEF A;  1SV5 A;  4OGC A;  3TAE A;  1TK0 A;  1VRU A;  1VSF A;  3QNO A;  2F8T A;  4DFJ A;  1RBU A;  4BWM A;  4DSK A;  2X6N A;  1L5U A;  3DLB A;  4IDK A;  3BGR A;  4CJK A;  1BL3 A;  3WNG A;  3L2R A;  1HQU A;  3ZT3 A;  1R0A A;  1UAX A;  4IFV A;  4HTU A;  1RCH A;  3DLR A;  3AO2 A;  3U6F A;  4JS5 A;  2DY4 A;  1SKR A;  1T03 A;  2RN2 A;  4O0I A;  4Z4F A;  2YNF A;  2G8I A;  1RDC A;  4B9L A;  3VQ6 A;  1CZB A;  5C25 A;  4M3R A;  4OKJ A;  5HRS A;  1BCO A;  2G8V A;  3MEG A;  3HPH A;  4E19 A;  2OA8 A;  2OPQ A;  3NFA A;  4AH9 A;  1NKE A;  4DTO A;  4CJW A;  1ZBL A;  4M3Z A;  4OKE A;  4HUF A;  3ULD A;  1S1X A;  4CIE A;  2XY6 A;  4KHQ A;  1D8Y A;  3AVN A;  3QEV A;  1A5X A;  2DFF A;  2IS3 A;  1JLC A;  4O55 A;  3SQ1 A;  3F73 A;  1X9W A;  4CF8 A;  1QSL A;  2QKK A;  4B9N A;  4M3W A;  3C6T A;  3AVI A;  4FJI A;  3F9K A;  4FK0 A;  1X1P A;  2KZZ A;  3L2U A;  2ATQ A;  1ZBH A;  4M45 A;  4OGE A;  1VSD A;  4W5Q A;  1SKS A;  4B3O A;  1O1W A;  3DRS A;  4LY7 A;  1JLF A;  2EHG A;  2HHQ A;  4CJV A;  3S3M A;  4MQ3 A;  3OYD A;  1X9M A;  3OJU A;  3L2Q A;  3M8R A;  4N41 A;  1B9D A;  3LDS A;  3DLK A;  1ZBF A;  4DQQ A;  2BE2 A;  3O3G A;  5I42 A;  3ZSQ A;  1VSH A;  2F96 A;  4RW6 A;  4K8X A;  3LAN A;  4KFB A;  1FXX A;  3QLH A;  4KHN A;  2Z1G A;  1RTD A;  3LP3 A;  3O4N A;  3KLG A;  1BIU A;  3QIO A;  3OYL A;  4E7L A;  3SPY A;  4KPY A;  4KB0 A;  3OJS A;  4EP4 A;  1RBS A;  3CM5 A;  3I0S A;  3RMA A;  3AO4 A;  4CGF A;  1ASW A;  4Y1D A;  4DQR A;  3HO1 A;  1YVU A;  4O44 A;  4FK2 A;  2XO7 A;  4MFB A;  4B9U A;  4PWD A;  4DSI A;  3LAM A;  1NK4 A;  3KK2 A;  3L8B A;  1JKH A;  4CK3 A;  4B8C A;  3OY9 A;  3KJV A;  2JGU A;  1C0T A;  1D9F A;  1BQM A;  3C94 A;  2G8F A;  4F3T A;  1S9E A;  3V1R A;  3VQC A;  1W0H A;  4AIL C;  3ZSR A;  3T3F A;  4CEE A;  1S1U A;  3MEE A;  3O4Q A;  4I2P A;  1T05 A;  3L3V A;  1EKE A;  4FJJ A;  4KKO A;  4DTP A;  3TAM A;  3AVC A;  1JXE A;  3PV8 A;  4BAC A;  1L3S A;  1LWE A;  5I3U A;  1BIS A;  1CXU A;  1HRH A;  1HJR A;  1XHX A;  2E6L A;  3CG7 A;  4CES A;  1XI1 A;  4DSE A;  2GBZ A;  3AO5 A;  3QO9 A;  2Y1I A;  3AVF A;  2IC3 A;  4CEA A;  1X9S A;  3I0R A;  2D0B A;  4CJT A;  4EP5 A;  3RTV A;  3JYT A;  4DTR A;  3QNN A;  4Q0B A;  2P5O A;  1RT3 A;  3AV9 A;  3P83 D;  3NAE A;  2ZQB A;  3DOL A;  4IG3 A;  4JS4 A;  3ZSO A;  4DS5 A;  1WLJ A;  3V81 A;  4H4M A;  3V9X A;  3MAQ A;  2HHT A;  1TAQ A;  3VQE A;  2HHS A;  4ID5 A;  2YKM A;  1DTQ A;  1XWL A;  1L3U A;  4CF1 A;  3DOK A;  4KO0 A;  1BGX T;  3NDK A;  3ZT2 A;  3CQ8 A;  5D3G A;  1C1A A;  2IDO A;  2R7Y A;  1C1C A;  5KI6 A;  4KHS A;  3D45 A;  1JLE A;  4H8K A;  1SL0 A;  4E7J A;  1VSM A;  3ISN C;  4FLU A;  1NK6 A;  4HVJ A;  3EZ5 A;  3LAK A;  2HHV A;  4B9S A;  4KTQ A;  4C8K A;  4DMN A;  3K59 A;  3LZJ A;  1FKO A;  4ZTF A;  4CJF A;  1IKV A;  1NJX A;  3ZSV A;  2RKI A;  3C95 A;  1KLM A;  1DLO A;  1A5W A;  3ZSZ A;  4FM1 A;  3RMC A;  1FK9 A;  1Q9X A;  4J2A A;  1BI4 A;  1EX4 A;  3L2V A;  5HRN A;  1JLA A;  3CFR A;  1CXQ A;  1C0M A;  4FLW A;  3RRH A;  2A1R A;  1NOZ A;  2D5R A;  4NYN A;  4CHN A;  3OYG A;  4DU4 A;  1S1V A;  1S6P A;  3KLE A;  3V9U A;  4CEB A;  1BQN A;  1NJW A;  3HT3 A;  2WOM A;  1EET A;  4JRP A;  1QS4 A;  3V6D A;  2G8W A;  5KRS A;  2PZS A;  4BWJ A;  2YKN A;  4N5S A;  3OS0 A;  1BCM A;  3QET A;  3LPU A;  4KI6 A;  3AA3 A;  2XHB A;  1KSP A;  1Y97 A;  5HP1 A;  3ASM A;  5DMR A;  4KTW A;  3DLH A;  5CZ2 A;  4QAG A;  3VQ5 A;  3A2F A;  3HJF A;  1RTJ A;  2ZD1 A;  4Y1C A;  5J1E A;  5JS1 A;  1JXB A;  1YT3 A;  4M41 A;  1I3A A;  3WNH A;  4KTZ A;  1VSI A;  2XRI A;  3B6P A;  1RDA A;  3V9S A;  3HVT A;  4OPK A;  2XY7 A;  1LAV A;  1TGO A;  1HYV A;  4FM0 A;  4DF8 A;  1IH7 A;  2HNZ A;  3ZT0 A;  4CFD A;  4AHC A;  4CGG A;  1C0U A;  3KK3 A;  3VN5 A;  3M8P A;  1IKX A;  4CHP A;  3SUO A;  4FM2 A;  1UA0 A;  2OZM A;  3T19 A;  1S5J A;  3M8Q A;  4FYD A;  4O0J A;  2OPR A;  5FRM A;  1BHL A;  1TL3 A;  1RIL A;  2XY8 A;  4FVM A;  4AHU A;  4FJ8 A;  3WNE A;  2PYL A;  3OS1 A;  4BDP A;  3UIQ A;  3OYN A;  4E89 A;  3RMD A;  1RBV A;  4DQS A;  1JLQ A;  5KGW A;  4DS4 A;  4FJN A;  1VRT A;  1ITG A;  1IKY A;  1RT7 A;  3O3F A;  5HBM A;  4CJ5 A;  3PX6 A;  4NCA A;  1RT5 A;  4ZHR A;  1TVR A;  1KFD A;  4CJ4 A;  4YFU A;  3EY1 A;  4CJE A;  3NE6 A;  3VQD A;  3ZT1 A;  4FJK A;  1WSE A;  4HCB A;  1FKP A;  4BDY A;  1KRP A;  4LSL A;  1MU2 A;  3AVJ A;  5SZT A;  3HP6 A;  1N6Q A;  3NHG A;  2P51 A;  4J2D A;  2GUI A;  1U04 A;  4FW2 A;  4N47 A;  3SUP A;  4IG0 A;  3FFI A;  2O4G A;  3NF8 A;  4CE9 A;  2Y1J A;  2HW3 A;  3CM6 A;  3SV3 A;  3AA5 X;  4TSX A;  4JRQ A;  1TAU A;  2B4J A;  2IGI A;  3QIP A;  3OYF A;  4CJU A;  1Q8I A;  4DQI A;  3ITH A;  4CF2 A;  4DTX A;  4E3S A;  1ASU A;  4IFY A;  4JLH A;  2XY5 A;  3QEI A;  4Z4I A;  4H4O A;  1TKT A;  5SWM A;  3TAF A;  4I9L A;  5T7B A;  4FJM A;  4I7F A;  2Z1I A;  4CEC A;  3TAR A;  2AJQ A;  3H08 A;  1U47 A;  4IKF A;  1LWF A;  1JL1 A;  4CJP A;  3SQ4 A;  1J5O A;  2HVI A;  1VSK A;  1S6Q A;  3HYF A;  3NH2 A;  1RT2 A;  3OYK A;  4CK1 A;  3EYZ A;  4DTN A;  5J2N A;  1HQE A;  1GOA A;  4C8M A;  4FJG A;  4O5B A;  1ASV A;  4KHU A;  4BE0 A;  2ZE2 A;  4DU1 A;  2YHA A;  1RDB A;  4DF4 A;  2RF2 A;  1NK8 A;  2BGG A;  4CJQ A;  1TL1 A;  2DFE A;  1BIZ A;  3DLE A;  2HB5 A;  4CEZ A;  2JLE A;  2X6S A;  4AHV A;  4Z4E A;  4J2B A;  4J2E A;  3CFP A;  1UA1 A;  1IO2 A;  3P5J A;  4L8R B;  4PUO A;  4KB1 A;  5CYM A;  3VQ8 A;  1TK8 A;  1KLN A;  3QEP A;  2OYQ A;  3SQ0 A;  1NJY A;  3IRX A;  1ZBI A;  4CIF A;  3NGZ A;  4CGJ A;  2B5J A;  1SUQ A;  3VA3 A;  1RTI A;  1HNV A;  3PUF A;  4CGH A;  3HVR A;  1IKW A;  3C6U A;  4ELT A;  4GW6 A;  3K5M A;  4N56 A;  4PY5 A;  1T8E A;  2P5G A;  4F2S A;  3THV A;  2HHX A;  3HST B;  1UWB A;  2B6A A;  4I2Q A;  3AVA A;  3RR8 A;  4RW9 A;  4OKK A;  5FRO A;  2KZM A;  2E4L A;  1I39 A;  1RT1 A;  3AVL A;  4Z4H A;  1N5Y A;  4CHO A;  3TR8 A;  5C42 A;  1KVB A;  1WSF A;  2X78 A;  2QKB A;  2F8S A;  3K57 A;  3OVN A;  3LWL A;  3V4I A;  5DK5 A;  1WSG A;  4DTJ A;  4DWI A;  4FW1 A;  1QQC A;  4PA1 A;  5HRO A;  4C8N A;  4FJX A;  1VSJ A;  1J9A A;  3VQ9 A;  5CZ1 A;  3SI6 A;  3MXI A;  4CK2 A;  4NCG A;  1S1W A;  5J2Q A;  4HUE A;  4DU3 A;  1WSH A;  5HLF A;  3B6O A;  1C6V A;  4CIG A;  1CZ9 A;  3LAL A;  3LWM A;  1RDD A;  4C8O A;  3NGY A;  3VQA A;  1NKB A;  4AHT A;  4UQG A;  3TAG A;  5FRN A;  2YV0 X;  4AHR A;  4FLZ A;  3SPZ A;  3VQ7 A;  1U4B A;  4F8R A;  4E7I A;  3OYM A;  3SV4 A;  3U3G A;  4XIU A;  3NF6 A;  3IAY A;  4Q5V A;  2FBX A;  3M8S A;  4DFP A;  3RRG A;  3TAP A;  4BE1 A;  1WAJ A;  4FJ7 A;  3SQ2 A;  4CHQ A;  4DQP A;  1TKZ A;  3VQB A;  2KFN A;  1JLB A;  4ICL A;  3AA4 A;  3AVK A;  4AHS A;  2YNH A;  1UOC A;  3HP9 A;  4FJH A;  2G8U A;  1GOC A;  4DFM A;  1B92 A;  4CCH A;  2G8H A;  2IOC A;  4KI4 A;  1YTU A;  2D0C A;  3OYE A;  3HL8 A;  1IG9 A;  4FZX C;  3K5N A;  2I5J A;  2VWK A;  4FLX A;  3HM9 A;  1EXQ A;  4B08 A;  1KCF A;  1TKX A;  2OPS A;  2Q3S A;  3HPG A;  1T7P A;  3KKS A;  2G8K A;  3L3U A;  4RW8 A;  4NCB A;  2VWJ A;  1LW2 A;  1J53 A;  1DTT A;  3IS9 A;  4G1Q A;  4KAZ A;  1RT4 A;  1HMV A;  4CGI A;  4DG1 A;  3ZSY A;  2OPP A;  3NCI A;  5K14 A;  3DI6 A;  3KK1 A;  3S3N A;  4W5O A;  3MED A;  1NK5 A;  2HHU A;  3VA0 A;  5E41 A;  1U49 A;  1F21 A;  1Z25 A;  4OJR A;  1S9G A;  2DFH A;  1QHT A;  1ZBU A;  3KKR A;  3SZ2 A;  2E6M A;  4BE2 A;  2HMI A;  1WSI A;  4KV8 A;  3QEX A;  1K6Y A;  2KFZ A;  3P1G A;  2ETJ A;  3OYB A;  4CF9 A;  3KLI A;  1VK0 A;  4CF0 A;  4N76 A;  1KFS A;  3K58 A;  4OLB A;  3K2P A;  3PO5 A;  1SKW A;  3VQQ A;  4E1N A;  4DTS A;  3ZCM A;  4Z0U A;  2LSN A;  3TWH A;  5KRT A;  2P1J A;  1GOB A;  3RR7 A;  3SNN A;  3CFO A;  1RNH A;  1VSE A;  3V1O A;  3OYA A;  3TI0 A;  1G15 A;  1NJZ A;  5C24 A;  2PYJ A;  4RG8 A;  2KTQ A;  3KD5 E;  3AO3 A;  4CEQ A;  5CY4 A;  4F4K A;  3QEW A;  1QE1 A;  4KRF A;  3KLF A;  2W42 A;  3S3O A;  4QCL A;  1HYZ A;  2KW4 A;  5HRP A;  5KTQ A;  3V9Z A;  1ZYQ A;  3PX4 A;  3K5O A;  4FLY A;  4ELV A;  4KRE A;  1WN7 A;  3HK2 A;  4NYF A;  1KVA A;  3NBP A;  2HNY A;  2KQ2 A;  4W5T A;  3PY8 A;  3G0Z A;  2HHW A;  5HRR A;  1SL1 A;  3QER A;  3HPO A;  4DLG A;  3LP1 A;  3MXJ A;  2QK9 A;  1YTA A;  1Q9Y A;  4M3U A;  4RW7 A;  2BDP A;  2OZS A;  1WSJ A;  3OYC A;  1LWC A;  3V9W A;  1CLQ A;  4DSL A;  3VQ4 A;  3SUQ A;  4WE1 A;  4CFC A;  1U45 A;  4B9V A;  1TKD A;  5J2M A;  4DLE A;  3RWU A;  3NF7 A;  4BDZ A;  2QXF A;  4CED A;  3KLH A;  4CHY A;  3TAQ A;  3VQP A;  1TV6 A;  1HNI A;  4CJL A;  4E7H A;  1XC9 A;  3CYM A;  3SJJ A;  1RBT A;  3AA2 A;  3AVG A;  3TAN A;  4B8A B;  3D0P A;  4FZY A;  4C8L A;  4OPJ A;  1BI4 B;  2FBV A;  2VG5 A;  3LPT A;  5J2P A;  1XHZ A;  3PX0 A;  3QES A;  1NKC A;  4CFB A;  4HHT A;  3MEC A;  3OYI A;  1TK5 A;  4FJL A;  4DSJ A;  4LD0 A;  1KVC A;  1L3T A;  3V1Q A;  3KTQ A;  4PQU A;  1RBR A;  1VSL A;  4CJR A;  1REV A;  3OS2 A;  1KTQ A;  2YNG A;  5EU7 A;  4OVL A;  2ITG A;  4W5R A;  3ZSW A;  1WAF A;  1D5A A;  3QIN A;  1C1B A;  4ID1 A;  4FCY A;  3DM2 A;  3SCX A;  3ZT4 A;  4CEO A;  4QOZ B;  3OYJ A;  3NH0 A;  1Z26 A;  4F3O A;  3KD1 E;  1J54 A;  3AO1 A;  4RW4 A;  2DTU A;  3NF9 A;  4CJ3 A;  3OYH A;  3SUN A;  1WNS A;  3NH1 A;  1NK0 A;  1JLG A;  3DRR A;  5JS2 A;  4LH5 A;  1JL2 A;  1RT6 A;  2YHB A;  1W9H A;  5FDL A;  2YNI A;  1NOY A;  4FJ5 A;  4Z4C A;  1NK9 A;  4ZTJ A;  4EZ6 A;  4B9M A;  3DMJ A;  4FJ9 A;  4F2R A;  4HCC A;  1B9F A;  4DFK A;  1RTH A;  4E0D A;  2HVH A;  3IG1 A;  3I8D A;  4FXD A;  4LH4 A;  5KGX A;  3LP0 A;  1LW0 A;  4DSF A;  2Z1J A;  1EP4 A;  1QSY A;  2HND A;  4KHY A;  2EX3 A;  3DRP A;  2IAJ A;  4E1M A;  4EZ9 A;  4HUG A;  2FBY A;  4O4G A;  1NK7 A;  3AVH A;  4K8Z A;  4M3T A;  3AVB A;  3JSM A;  2NUB A;  3DYA A;  2VG7 A;  2BAN A;  4Z4G A;  4CJS A;  1HYS A;  3NGI A;  1L3V A;  3HXM A;  2D0A A;  4ELU A;  3O3H A;  2A1S A;  3E01 A;  4B9T A;  2FC0 A;  4DTM A;  2WON A;  3BDP A;  3LP2 A;  3K5L A;  4KHW A;  2GV9 A;  2RPI A;  4R5P A;  4W5N A; 
#chains in the Genus database with same CATH topology
 4GVM A;  3A5M C;  3B8A X;  4BVP A;  3VEY A;  5C0Y A;  3ZSX A;  4FZZ A;  2X74 A;  1HJO A;  4NB4 A;  4CER A;  2ZJQ L;  2UU9 K;  1IBL K;  5B8H A;  3WT0 A;  3CJ9 A;  4LSN A;  3L2W A;  4M3X A;  4IO8 A;  4CHZ A;  2PY5 A;  3SMS A;  3PO4 A;  2VG6 A;  4IZ9 A;  4CEF A;  5M1P A;  2QXL A;  3TAE A;  2OTJ N;  4JK7 A;  1TK0 A;  1ATN A;  3VF2 A;  1VSF A;  4JK9 A;  4JKD A;  4B9Q A;  1L5U A;  4IDK A;  4JKH A;  1O13 A;  1BL3 A;  3WNG A;  3ZX2 A;  3OBW A;  5AQJ A;  1UAX A;  4FWQ A;  1GLF O;  4A59 A;  2P9I B;  4JS5 A;  1SKR A;  2O8B A;  1QZ6 A;  3GE1 A;  4C23 A;  2G8V A;  3MEG A;  3HPH A;  2OA8 A;  1NKE A;  2P9S B;  4B1Y B;  4U7B A;  4O55 A;  4A5A A;  5MLC Q;  1QSL A;  4B9N A;  4FJI A;  4M7Y A;  4BQZ A;  1VHX A;  2ATQ A;  4OGE A;  1VSD A;  5E84 A;  4W5Q A;  1JLF A;  3S3M A;  1X9M A;  3OYD A;  3L2Q A;  3M8R A;  2NRT A;  2W6K A;  3O3G A;  4JKB A;  2HOE A;  3ZSQ A;  3ATU A;  3CCS N;  1FXX A;  3CI5 A;  3QLH A;  3LP3 A;  3O4N A;  3OYL A;  4BVO A;  2O8E B;  3HRG A;  2Q31 A;  4JHD B;  3AO4 A;  4CZF A;  3CJ7 A;  4FK2 A;  4MFB A;  4JNE A;  1NNE A;  3CJB A;  2QWP A;  1JCG A;  4CBU A;  4JKC A;  1E4F T;  4CK3 A;  2JGU A;  1S9E A;  4JI7 K;  1W7A A;  4CEE A;  4I2P A;  2NRH A;  4FJJ A;  1EKE A;  4LFC K;  1JXE A;  4BAC A;  1L3S A;  1BIS A;  1XHX A;  1HJR A;  3CG7 A;  1VQO N;  4DV4 K;  5LMN K;  5GIP A;  3QO9 A;  5AR0 A;  3AVF A;  1X9S A;  5LL6 Z;  4DTR A;  4Q0B A;  3IDH A;  3ZSO A;  1WLJ A;  2HHT A;  4ID5 A;  1L3U A;  1OVQ A;  4KO0 A;  5AQN A;  3CQ8 A;  4IJN A;  5D3G A;  2IDO A;  5KI6 A;  4E7J A;  1BUP A;  4B1W B;  3W3D A;  2HHV A;  4B9S A;  4NXN K;  3IKM A;  3C95 A;  3ZSZ A;  4FM1 A;  2A5X A;  5H1S Q;  1FK9 A;  1GLL O;  3SAF A;  1Q9X A;  2A6A A;  3L2V A;  1JLA A;  3RRH A;  2A42 A;  4H0X B;  4CHN A;  4O8K A;  3RVC A;  3CQY A;  3HT3 A;  2WOM A;  3V6D A;  2PZS A;  4N5S A;  3LPU A;  3AA3 A;  3WXJ A;  5HP1 A;  3DLH A;  3DXK B;  4JEP A;  5JS1 A;  3THX B;  5AQL A;  1NGI A;  4M41 A;  5AQV A;  1IBM K;  3WNH A;  4KTZ A;  3V9S A;  4IOA L;  3UB5 A;  3L4I A;  5M1Q A;  1HYV A;  4DF8 A;  3R9P A;  2XY7 A;  4CD1 A;  3VN5 A;  1IKX A;  2JWL A;  3T19 A;  3M8Q A;  4FYD A;  4O0J A;  2FXU A;  5F2R A;  3CMA N;  1NGE A;  1BHL A;  1TL3 A;  1VQ5 N;  3I56 N;  1U6Z A;  4H0P A;  3WNE A;  4BDP A;  1QHA A;  3OYN A;  3RMD A;  3LDO A;  4FJN A;  1ITG A;  3J80 O;  1IKY A;  4KH4 A;  4CJ5 A;  1RT5 A;  3A5N C;  4OX9 K;  4CJE A;  3VQD A;  3J8A A;  1WSE A;  1KRP A;  1MU2 A;  3NHG A;  2GUI A;  4LF9 K;  3FFI A;  2Y1J A;  2HW3 A;  1XUP O;  3AA5 X;  1FJG K;  3LDN A;  3VEO A;  3VF4 A;  4E3S A;  5C12 A;  4IFY A;  4FWL A;  4JLH A;  1M90 O;  3TAR A;  3SBT A;  3SQ4 A;  1GLC G;  4CJP A;  2ZJR L;  1DT9 A;  3NH2 A;  4CK1 A;  2YCH A;  4H5N A;  4BE0 A;  4DF4 A;  4DU1 A;  3MX2 A;  5JIC A;  4M7X A;  2DFE A;  2FSK A;  4B3S K;  5F0X A;  3CQX A;  3EE9 A;  3FZK A;  4Z4E A;  1UA1 A;  4KB1 A;  5CYM A;  3GL1 A;  4I6M B;  3SQ0 A;  4FPB A;  3EEQ A;  4LC9 B;  2B5J A;  4BRD A;  4H0Y B;  3O08 A;  4CW7 B;  3HVR A;  5BN9 A;  4ELT A;  4N56 A;  4PY5 A;  3CC2 N;  2E1Z A;  2B6A A;  1N36 K;  4RW9 A;  4B3R K;  3WEE A;  5FRO A;  1VQM N;  1RT1 A;  3AVL A;  3E9P A;  5C42 A;  2QKB A;  2F8S A;  3OVN A;  2W40 A;  4DTJ A;  4DWI A;  4PA1 A;  5C10 A;  5HRO A;  2PAV A;  4FJX A;  5BRH A;  1VSJ A;  1J9A A;  3VQ9 A;  3MXI A;  4CK2 A;  1NWK A;  4NCG A;  1S1W A;  1ZBS A;  4DU3 A;  5AQQ A;  2HF3 A;  3J7Y P;  1C6V A;  3LAL A;  3FFK B;  2NZT A;  2NNW A;  2QW9 A;  3SPZ A;  3VQ7 A;  1Q86 O;  5CR4 A;  5BR8 K;  3A5L C;  3M8S A;  4DFP A;  3C0B A;  3TAP A;  3OW2 M;  1WAJ A;  1HNZ K;  3R3L A;  3VQB A;  2OCE A;  1JLB A;  4BRG A;  3AA4 A;  3R1X A;  3AVK A;  4AHS A;  4FJH A;  1MA9 B;  2QI2 A;  1B92 A;  4MDB A;  3J81 O;  3SAG A;  5AZI B;  1HKG A;  3HL8 A;  1IG9 A;  1ILY A;  4B08 A;  3HPG A;  4X64 K;  2YX6 A;  4NCB A;  1NGB A;  2NRV A;  1J53 A;  4G1Q A;  1HMV A;  4A5B A;  3ZSY A;  5AFU A;  5E41 A;  1U49 A;  3KKR A;  3SZ2 A;  2E6M A;  3DWL A;  3VEX A;  3W0L A;  2ETJ A;  3OYB A;  2P9P A;  3KLI A;  1I94 K;  1C0G A;  3LDQ A;  3U8X A;  4OLB A;  3A0I X;  4UY8 O;  4DKW A;  3C7N B;  3A5O C;  5KRT A;  3TWH A;  4PL8 A;  4CZK A;  4YHH K;  3SNN A;  3V1O A;  1RNH A;  3TI0 A;  5JLH A;  1NJZ A;  2PYJ A;  2YJE A;  3AO3 A;  3BZC A;  3DXM A;  5CY4 A;  3KD5 E;  4F4K A;  4BR2 A;  2KW4 A;  1ZYQ A;  3PX4 A;  1NGC A;  1WN7 A;  4NO7 A;  4Y0W A;  2P9L A;  3FZH A;  1SL1 A;  3QER A;  2QK9 A;  4DUY K;  4M3U A;  2OZS A;  4DV5 K;  3OYC A;  3CHW A;  1LWC A;  3P38 A;  4DSL A;  3SAH A;  3SUQ A;  1U45 A;  2E2Q A;  3RWU A;  3NF7 A;  3U9D A;  2QXF A;  3KLH A;  1TV6 A;  3VEW A;  3CYM A;  3TAN A;  1RBT A;  4LF8 K;  3KHY A;  3D0P A;  1BI4 B;  2P9N A;  3G4S N;  2FBV A;  2VG5 A;  1XHZ A;  3PX0 A;  3HM8 A;  3QES A;  1NKC A;  1TK5 A;  3OYI A;  4LD0 A;  3KTQ A;  2QM1 A;  4JI0 K;  2QWO A;  5EU7 A;  2V52 B;  2ITG A;  4W5R A;  3MDQ A;  2P9U A;  4EHU A;  4RW4 A;  4O8U A;  1M1K O;  1HKB A;  3O9Q A;  1K8A O;  4YY3 K;  2YNI A;  3GBT A;  2HVH A;  4DFK A;  3IG1 A;  4FXD A;  2WUS A;  5KGX A;  2BUP A;  2HND A;  3DRP A;  4DV6 K;  5FLX O;  2FBY A;  1HNW K;  3AVH A;  3JSM A;  1RDU A;  4FWP A;  1HYS A;  3NGI A;  1P8Z A;  3HXM A;  4ELU A;  2A1S A;  4B1Z A;  4NXM K;  2BTF A;  2O8C B;  3G10 A;  4BRA A;  1LV5 A;  4E7K A;  4YNQ A;  3T1A A;  3SYZ A;  2CGK A;  4AM6 A;  5AQK A;  2FBT A;  2NRX A;  3CCQ N;  4K25 A;  4JD2 B;  4AF1 A;  4RCH A;  3RMB A;  3CCM N;  3LZI A;  4L3Q A;  4OLA A;  4FLT A;  3ALY A;  3DLG A;  3E1Y A;  1LAW A;  4I9Q A;  4LF4 K;  3TAB A;  4ILH A;  4CI6 A;  1NGF A;  3QNO A;  4IWV A;  1RBU A;  3O1W A;  5EVZ A;  3FLC O;  4DSK A;  3O1B A;  2HMP A;  1BO5 O;  4CJK A;  1YF5 L;  3L2R A;  2F9W A;  1U2V A;  4M63 C;  4HTU A;  2GEL A;  2E2N A;  1T03 A;  1YIJ N;  2G8I A;  1NBW A;  2HST A;  3CCL N;  1CZB A;  5CE3 A;  4E19 A;  3ULE B;  2OPQ A;  1TYQ B;  1ZXO A;  1S1X A;  2XY6 A;  4KHQ A;  1D8Y A;  4GVE A;  4BRF A;  4LFB K;  2IS3 A;  3KZB A;  3ZX3 A;  3TPQ A;  3F73 A;  1X9W A;  2QKK A;  2JWK A;  2KZZ A;  1X1P A;  1ZBH A;  2O8D B;  4B3O A;  1O1W A;  3DRS A;  2HHQ A;  4MQ3 A;  2FLO A;  1B9D A;  1J5E K;  3DLK A;  4BR4 A;  2QA4 N;  3WXL A;  1OVY A;  5I42 A;  4RW6 A;  4KFB A;  3HI0 A;  3CC7 N;  4K41 A;  1H1V A;  3CCV N;  3FZF A;  4DB3 A;  3OJS A;  4KB0 A;  2WBN A;  3CM5 A;  2Q2R A;  3I0S A;  4CGF A;  4DQR A;  3HO1 A;  5EX5 A;  4BR5 A;  4MLE A;  3L8B A;  2AP1 A;  3KJV A;  2E8A A;  4R79 A;  3C94 A;  2G8F A;  3V1R A;  2D1K A;  3SJH A;  4AIL C;  3FZL A;  4CZM A;  3NVK A;  2O8F B;  3L3V A;  3WUH A;  2QWQ A;  4KKO A;  1HUX A;  4BR0 A;  4FWK A;  3R6M A;  4C1N K;  4BGB A;  2E6L A;  3AO5 A;  3HBT A;  4CJT A;  3JYT A;  2HBJ A;  3CCE N;  2P5O A;  4IG3 A;  3DOL A;  4DR3 K;  4H4M A;  3V9X A;  1TAQ A;  5AQW A;  1DTQ A;  4EAH D;  4YDU A;  1YAG A;  5F1X A;  4DR5 K;  1DEJ A;  1C1C A;  3Q7C A;  2A41 A;  3EKS A;  3ZYY X;  5M1O A;  5IWA K;  1VSM A;  4FLU A;  4CZJ A;  3DLL L;  4H0O A;  5KQ8 A;  2HBK A;  3K59 A;  4CJF A;  3M1F A;  1KLM A;  4J2A A;  3RMC A;  4JV5 K;  4DR1 K;  1EX4 A;  5BRE A;  2ZGZ A;  4WF9 L;  2NRW A;  4FLW A;  2A1R A;  4FWN A;  3V9U A;  5E26 A;  4CEB A;  5FPM A;  2G8W A;  1EET A;  3M6G A;  5ADX H;  5LJW A;  5KRS A;  2YKN A;  3IFR A;  1Y97 A;  5EXW A;  3VQ5 A;  1KC8 O;  5J1E A;  4H5T A;  4ISE A;  1WOQ A;  3WQT A;  3U4L A;  1VQ8 N;  3HVT A;  2D0P A;  1LAV A;  1TGO A;  4FM0 A;  1IH7 A;  1NGJ A;  3AAR A;  2VCP A;  1S5J A;  1Z05 A;  1XMO K;  5KPR A;  4FVM A;  2YI1 A;  3VF6 A;  4FJ8 A;  2GUP A;  3THY A;  3CIP A;  4X66 K;  3OS1 A;  4KH6 A;  2Q0U A;  4E89 A;  4DV2 K;  5KGW A;  4DS4 A;  1VRT A;  4OO1 J;  3PX6 A;  4NCA A;  1K8K A;  4ZHR A;  1YXQ A;  4CJ4 A;  4AQY K;  1FKP A;  4G9Z A;  1IG8 A;  4LSL A;  1MDU B;  5SZT A;  3HP6 A;  4FW2 A;  3SUP A;  2E88 A;  2O4G A;  3F5T A;  4CE9 A;  4QS8 A;  5AQZ A;  1Q81 O;  2B4J A;  2IGI A;  3H46 O;  3OYF A;  4PHT X;  1Q8I A;  3SMP A;  1E3M A;  4JKG B;  1ASU A;  3QEI A;  4JI4 K;  5SWM A;  1ATS A;  3TU5 A;  4FJM A;  4A2A A;  4CEC A;  2AJQ A;  4V19 S;  3T69 A;  4DTN A;  1RT2 A;  4DV1 K;  3G71 N;  2HBL A;  1HQE A;  4C8M A;  1RDB A;  3S41 A;  1TL1 A;  5I9E B;  4CEZ A;  1E4G T;  4J2E A;  1KLN A;  2KLA A;  3NGZ A;  3VA3 A;  2QTD A;  4EHT A;  1YIT N;  1SS6 A;  4GW6 A;  1QVF M;  5AQU A;  5M1N A;  3HST B;  5AQS A;  2E1Y A;  3TR8 A;  1WSF A;  3RSE B;  4CBX A;  5DK5 A;  1QQC A;  5AQF A;  3SI6 A;  1YJN N;  4JHD A;  5HLF A;  3E9L A;  4WFB L;  1GLE G;  3LWM A;  2D0O A;  5GIO A;  4YOX A;  1NGH A;  4UQG A;  3TAG A;  5FRN A;  4AHR A;  1U4B A;  3PSF A;  3D2E A;  2NRZ A;  3BY5 A;  3U3G A;  4BY9 C;  4XIU A;  3NF6 A;  3IAY A;  2FBX A;  4FJ7 A;  3E66 A;  3SQ2 A;  4CHQ A;  3HZ6 A;  4DQP A;  2KFN A;  2NLX A;  1UOC A;  3EN9 A;  4DFM A;  3JAM O;  4CCH A;  1RFQ A;  2IOC A;  1VAZ A;  3HOT A;  1YTU A;  4CZE A;  3OYE A;  4BRM A;  2UUA K;  3K5N A;  2VWK A;  1LW2 A;  4JKF A;  3T1H K;  4KAZ A;  1RT4 A;  4BG9 A;  4CGI A;  3BF3 A;  1XNQ K;  2OPP A;  5K14 A;  3F2K A;  3S3N A;  4IXC A;  4W5O A;  3MED A;  1F21 A;  1SAZ A;  4MDA A;  2OTL N;  3LDL A;  2HMI A;  2FSJ A;  1KAY A;  3P1G A;  3F9M A;  4CF9 A;  1KFS A;  3K58 A;  3K2P A;  1QVG M;  1SKW A;  4Z0U A;  1Q7Y O;  1GOB A;  1XC3 A;  3CFO A;  1D4X A;  1G15 A;  5C24 A;  4RG8 A;  5LY3 A;  2QWN A;  1QE1 A;  2VGM A;  4QCL A;  1HYZ A;  3V9Z A;  2ASP A;  4FLY A;  4ELV A;  3DXK A;  4KRE A;  1KAX A;  3NBP A;  2WC9 A;  4W5T A;  3THX A;  3PY8 A;  2HHW A;  3LP1 A;  3MXJ A;  1Q9Y A;  5BPL A;  3WEE B;  2ZJP L;  3Q7B A;  3V9W A;  4CFC A;  1TKD A;  1Y64 A;  3TAQ A;  1XC9 A;  2QWR A;  4NLB A;  2GTD A;  2UUB K;  4XH1 A;  5J2P A;  4PKI A;  3K9K A;  4DSJ A;  1L3T A;  5AQR A;  1VQ6 N;  1RBR A;  4CJR A;  2YNG A;  2FF3 B;  3CCR N;  4OVL A;  5GIN A;  3WXK A;  4ID1 A;  3DM2 A;  3SCX A;  3J7A P;  3OYJ A;  2ZWH A;  3NH0 A;  3MCA B;  3T1Y K;  3KD1 E;  3AO1 A;  1T44 A;  4XH5 A;  2DTU A;  3ZET B;  4CJ3 A;  4DV0 K;  3NH1 A;  4RWT A;  1NK0 A;  3DRR A;  5AQP A;  1W97 L;  1RT6 A;  1K73 O;  3HOS A;  4Z4C A;  4ZTJ A;  3KWG A;  3CET A;  4EZ6 A;  4B9M A;  2CGJ A;  4FJ9 A;  4F2R A;  3ATV A;  4H03 B;  3I8D A;  2Z1J A;  1EP4 A;  1QSY A;  3K0S A;  4KHY A;  4E1M A;  4EZ9 A;  2GWJ A;  4K8Z A;  4BR9 A;  4M3T A;  5AQT A;  4B3T K;  2NUB A;  3MN5 A;  3DYA A;  2W6L A;  2D0A A;  3O3H A;  3E01 A;  2WON A;  3MX5 A;  3LP2 A;  2RPI A;  4DV3 K;  2P9P B;  1Z6R A;  1U48 A;  3AVM A;  4H5W A;  1HLU A;  4JKA A;  5A2Q O;  2Q1N A;  1VQ4 N;  3JS6 A;  3KIO A;  3G6E N;  1QSS A;  3C65 A;  4M3Y A;  1NU0 A;  2GWK A;  4JN4 A;  5CYQ A;  1HR0 K;  2VWB A;  2Z1H A;  5KQD A;  1SL2 A;  3DXM B;  3VGK A;  1BU6 O;  3U3Y A;  1N33 K;  4GMJ B;  1D9D A;  3EKU A;  4FLV A;  1SV5 A;  4OGC A;  4K0K K;  5JVH L;  4DFJ A;  4BWM A;  3DLB A;  1QQO A;  3PIO L;  3VEZ A;  3N4Q A;  4LF5 K;  4IFV A;  3LDP A;  3DLR A;  3AO2 A;  1BA0 A;  3ZLJ A;  3BP8 A;  3U6F A;  3MK6 A;  2NRR A;  3TTD A;  2RN2 A;  4O0I A;  4BRQ A;  4JK8 A;  1RDC A;  4X65 K;  5C25 A;  4LF7 K;  2P9N B;  1BCO A;  3SBG A;  3QML A;  4CVN E;  1X3M A;  4M3Z A;  4OKE A;  1DKG D;  4HUF A;  3P39 A;  4CIE A;  3ULD A;  3AVN A;  4IOC L;  3VES A;  3SQ1 A;  2BH1 A;  4CF8 A;  3PLA A;  1YJ9 N;  4FK0 A;  5AZJ A;  3CCJ N;  3L2U A;  4M45 A;  1LOT B;  1SKS A;  3AAP A;  1N32 K;  4CJV A;  5AZI A;  4N41 A;  2CH5 A;  3CPW M;  1ZBF A;  4DQQ A;  3CD6 N;  2BE2 A;  2F96 A;  1S3X A;  4K8X A;  3R8E A;  2CGL A;  3KLG A;  4E7L A;  1BIU A;  3QIO A;  3SPY A;  1KXP A;  1RBS A;  4DV7 K;  4QS7 A;  1GLD G;  1YVU A;  5IT9 O;  1Q82 O;  2XO7 A;  4JKE A;  4B9U A;  3LAM A;  1NK4 A;  3KK2 A;  1IBK K;  3UKU B;  3OY9 A;  1C0T A;  1D9F A;  1BQM A;  4EIA A;  3ZSR A;  3MEE A;  3O4Q A;  1T05 A;  4A57 A;  4BR7 A;  3JXU A;  4DTP A;  2Q36 A;  3C7N A;  3TAM A;  5GAH P;  5I3U A;  5HOO A;  1CXU A;  1HRH A;  1V4T A;  1XI1 A;  4DSE A;  2Y1I A;  4KH5 A;  3HSC A;  4CEA A;  3I0R A;  3RTV A;  4J8F A;  3SK3 A;  4JS4 A;  3NAE A;  3P83 D;  3V81 A;  2V7Y A;  1TUY A;  4XH4 A;  3VQE A;  5ADX A;  4CF1 A;  4JAX A;  1NLV A;  1BGX T;  3NDK A;  1C1A A;  2R7Y A;  4E1J A;  1EO1 A;  3VOV A;  4H8K A;  5AQI A;  1NMN A;  4WQ4 C;  3GG4 A;  1T6C A;  3LAK A;  1QQN A;  4KTQ A;  4C8K A;  4DMN A;  4ZTF A;  1FKO A;  4WQ5 A;  1NJX A;  1IKV A;  1DLO A;  1A5W A;  3P4I A;  1BI4 A;  3L4Q A;  5HRN A;  1CXQ A;  2D5R A;  4K42 A;  3KLE A;  3THW B;  1NJW A;  3TSQ A;  4JRP A;  1QS4 A;  3T7Z A;  4BWJ A;  3D2F A;  1LCU A;  2E20 A;  4KTW A;  1S72 N;  5CZ2 A;  2ZD1 A;  1P90 A;  4FWO A;  4AM7 A;  1YHQ N;  1JXB A;  1YT3 A;  3FZM A;  4DHY A;  1NGA A;  2HNZ A;  3ZT0 A;  4CFD A;  4AHC A;  4CGG A;  4BC3 A;  3TSP A;  3M8P A;  2OZM A;  2J4R A;  3PIP L;  4B3M K;  4PKH A;  5FRM A;  2XY8 A;  3DJC A;  1RIL A;  2KHO A;  4WCE L;  4JI2 K;  5BR9 A;  3O4W A;  5GAG P;  1FW6 A;  4FVU A;  5HBM A;  4EFH A;  3KK7 A;  1TVR A;  3EY1 A;  2O8C A;  3ZT1 A;  5KPT A;  4HCB A;  1Q18 A;  4BDY A;  2UUC K;  3AVJ A;  1HPM A;  1N6Q A;  2P51 A;  3VET A;  4J2D A;  1U04 A;  4IG0 A;  4JD2 A;  3NF8 A;  3MMV A;  3QFU A;  4GKJ K;  1OKJ A;  3SV3 A;  4TSX A;  1HX1 A;  3M3Z A;  5BRD A;  3CC4 N;  3SLC A;  1TAU A;  3QIP A;  4CJU A;  4CF2 A;  4DTX A;  4H0V B;  2ITM A;  4BC5 A;  4CBW A;  4Z4I A;  5M1K A;  3NMU A;  1TKT A;  2IVP A;  4B1X B;  5DM6 L;  3VTI A;  4I9L A;  2GX9 A;  2P9K B;  3EO3 A;  3H08 A;  4IKF A;  1J5O A;  3AGK A;  1S6Q A;  3HYF A;  5J2N A;  3OYK A;  3ZEU B;  1OH5 A;  4BC2 A;  2RE2 A;  1GOA A;  2ASM A;  4KHU A;  2YHA A;  2RF2 A;  4JI1 K;  3GOI A;  3I55 N;  1BIZ A;  2HB5 A;  2JLE A;  2X6S A;  3VMF B;  4BRH A;  1T6D A;  1IO2 A;  4H0T B;  4QS9 A;  4L8R B;  4IFE A;  1DGK N;  3FE1 A;  2OYQ A;  3QEP A;  4CIF A;  4CGJ A;  1SUQ A;  1RTI A;  1HNV A;  4CGH A;  2ZF5 O;  1IKW A;  1BWF O;  3C6U A;  4CJ7 A;  1X3N A;  2P5G A;  3THV A;  3RR8 A;  4A2B A;  3ENH A;  3CJ1 A;  2O8D A;  4OKK A;  2KZM A;  4IEI A;  3FR0 A;  3ENB A;  3CCU N;  2X78 A;  4BRE A;  3LWL A;  4BGA A;  4OPH A;  4C8N A;  3AAQ A;  4IDH A;  4MLH A;  5J2Q A;  5AQH A;  2O8B B;  4C8O A;  1CZ9 A;  4HTL A;  3NGY A;  3VQA A;  3THY B;  4AHT A;  2FF6 A;  2HBM A;  3EL2 A;  2D4W A;  4E7I A;  2V51 B;  3D6R A;  2WFB A;  3QFP A;  4Q5V A;  1K9M O;  4B1U B;  4ICL A;  4BRI A;  4BRL A;  2YNH A;  4DR2 K;  2G8H A;  4YOV A;  2E2P A;  1WUA A;  4FWS A;  3TTF A;  1EXQ A;  5CHI A;  3HM9 A;  1TKX A;  4FLX A;  2UXC K;  1T7P A;  3KKS A;  2G8K A;  3L3U A;  4RW8 A;  2VWJ A;  3UKR A;  1DTT A;  3A8Y A;  4CZG A;  4DG1 A;  1ESV A;  4BRP A;  3NCI A;  1XQS C;  5JMV A;  1S9G A;  1QHT A;  4ILJ A;  3BUZ B;  4BE2 A;  2I7N A;  4KV8 A;  1K6Y A;  1C0F A;  3C6H A;  2DPN A;  4FPA A;  1VK0 A;  4IO9 L;  2UXB K;  1R59 O;  3VQQ A;  2VGN A;  4CZL A;  2LSN A;  1VQL N;  3M5R A;  2P1J A;  3D7E O;  4XEI A;  3OYA A;  1NJI O;  3ZX0 A;  3QEW A;  4PL7 A;  3KLF A;  3S3O A;  4RTF D;  5HRP A;  5KTQ A;  1KAZ A;  3CJA A;  1NG9 A;  3HK2 A;  1KVA A;  3G0Z A;  5HRR A;  5AJ3 K;  1QQM A;  4RW7 A;  3CXC M;  3BF1 A;  4GKK K;  5J2M A;  4DLE A;  4BDZ A;  2P9I A;  2QWM A;  4CHY A;  4CJL A;  4E7H A;  4FZY A;  2WTU A;  5BPN A;  4OPJ A;  3ENO A;  4BRO A;  3PSI A;  4PQU A;  2P9S A;  1KVC A;  3V1Q A;  1OH6 A;  5AQX A;  1EWQ A;  1REV A;  3OS2 A;  1KTQ A;  3QDK A;  2UXD K;  3D2E B;  1WAF A;  3ZT4 A;  4CEO A;  4WYB A;  4DQ8 A;  1J54 A;  4MO4 A;  4H5R A;  3OYH A;  1WNS A;  1JLG A;  3U9Z A;  3CER A;  3H6E A;  1JL2 A;  3OTO K;  5FDL A;  5AQO A;  4GV3 A;  4FJ5 A;  1NK9 A;  2HHH K;  4HCC A;  1RTH A;  1SZ2 A;  2O8E A;  4JKG A;  4LH4 A;  3LP0 A;  4DSF A;  2IAJ A;  4YOR A;  1VQP N;  2BAN A;  4Z4G A;  2E2O A;  4MO5 A;  3H45 C;  1L3V A;  1WBD A;  1GLA G;  4JI6 K;  4DTM A;  3BDP A;  4U67 L;  2GV9 A;  3K9J A;  4R5P A;  1HKC A;  4DTU A;  2O4I A;  1VQN N;  1HPZ A;  4WFA L;  5TKY A;  4M42 A;  1RGI A;  1S1T A;  3O9U A;  4JI8 K;  5KPZ A;  4BC4 A;  3WNF A;  4BRK A;  1TUU A;  1A5V A;  4CFA A;  4FK4 A;  1YVN A;  4CGD A;  3MXM A;  1QTM A;  4IBN A;  3S9H A;  1BG3 A;  3ID8 A;  4A62 A;  1VRU A;  2A3Z A;  4B1V A;  2F8T A;  3RSE A;  2ZM6 K;  2X6N A;  5FPE A;  3BGR A;  3H1Q A;  1HQU A;  3ZT3 A;  1R0A A;  1RCH A;  4F9O A;  2YHX A;  2DY4 A;  2VQE K;  3QBW A;  5BN8 A;  4Z4F A;  2YNF A;  5FPN A;  3CME N;  4B9L A;  3VQ6 A;  4M3R A;  4OKJ A;  5HRS A;  1VQ9 N;  3NFA A;  4BRC A;  4AH9 A;  4DTO A;  4CJW A;  1ZBL A;  4BRN A;  3H3O B;  3QEV A;  5LJV A;  1A5X A;  2DFF A;  2CH6 A;  1JLC A;  3I33 A;  4M3W A;  3C6T A;  3AVI A;  3F9K A;  3KVG A;  1JCE A;  4FWM A;  1CZA N;  1HNX K;  2QEX N;  4BG8 A;  4LY7 A;  2EHG A;  3OJU A;  4KBO A;  3LDS A;  1NMD A;  4DUZ K;  1S22 A;  1VSH A;  3LAN A;  4KHN A;  2Z1G A;  1RTD A;  4KPY A;  1GLB G;  4EP4 A;  3RMA A;  1ASW A;  4Y1D A;  4O44 A;  2QWL A;  2EWS A;  2KKZ A;  4DSI A;  4PWD A;  1JKH A;  3CPE A;  3O9S A;  4B8C A;  4FO0 A;  4F3T A;  3VQC A;  4C1N I;  4GV9 A;  1MWK A;  1W0H A;  4DCH A;  3TSU A;  3T3F A;  3J7Z O;  1S1U A;  2AA4 A;  2UYT A;  5TKW A;  2H3G X;  3AVC A;  3PV8 A;  3EZW A;  1LWE A;  2F9T A;  5LMU K;  4Z94 A;  5BRF A;  4CES A;  2FSN A;  2GBZ A;  1VQ7 N;  2IC3 A;  4EP5 A;  2D0B A;  3QNN A;  4FSV A;  5C2F A;  3MCP A;  4LF6 K;  1RT3 A;  3AV9 A;  4YOY A;  2ZQB A;  5JLF A;  4FOI A;  4DS5 A;  3MAQ A;  1OH8 A;  2HHS A;  2YKM A;  1XWL A;  3GDQ A;  3O5B A;  3DOK A;  4FL9 A;  3IMX A;  3ZT2 A;  4A61 A;  3MN9 A;  4KHS A;  3UE5 A;  3D45 A;  1JLE A;  2IVN A;  1SL0 A;  3ISN C;  3O9R A;  1NK6 A;  4HVJ A;  3EZ5 A;  5M1F A;  3LZJ A;  3P31 A;  2PFU A;  3ZSV A;  2RKI A;  1BA1 A;  4JI3 K;  3CFR A;  3WQU A;  1C0M A;  1IV0 A;  1NOZ A;  4NYN A;  1NGD A;  3OYG A;  4DU4 A;  1S1V A;  1S6P A;  4I6M A;  1BQN A;  4YOW A;  2GEM A;  3OS0 A;  3QBX A;  1BCM A;  4KI6 A;  3DAW A;  3O8M A;  4ILG B;  2XHB A;  1KSP A;  3ASM A;  5DMR A;  3HJF A;  4QAG A;  3A2F A;  3ZET A;  1RTJ A;  4Y1C A;  3IUC A;  4ISF A;  2P9L B;  4LFA K;  4WQ5 C;  5AZJ B;  1I3A A;  1VSI A;  2XRI A;  4H5V A;  5EOY A;  3B6P A;  1RDA A;  4OPK A;  2Q0R A;  1C0U A;  3KK3 A;  4YOU A;  4CHP A;  4FM2 A;  3SUO A;  1UA0 A;  2OPR A;  3AY9 A;  4AHU A;  4FWR A;  4IEE A;  5EY4 A;  2PYL A;  3WXM B;  2YHY A;  1EQY A;  3UIQ A;  1RBV A;  4DQS A;  1JLQ A;  3OBY A;  1RT7 A;  3VEN A;  3O3F A;  1KFD A;  4YFU A;  3NE6 A;  3L6Q A;  4FJK A;  4GY2 B;  2P9U B;  2ASO A;  2F7T A;  3HTV A;  5GAD P;  4GV6 A;  3ID6 A;  4N47 A;  4DR4 K;  4ISG A;  3CM6 A;  3KWI A;  2I7P A;  2V7Z A;  4JRQ A;  3O9T A;  4DQI A;  3ITH A;  3VEV A;  5C2D A;  3EE8 A;  1G99 A;  2XY5 A;  4H4O A;  3TAF A;  5T7B A;  4I7F A;  2Z1I A;  1U47 A;  2HVI A;  1LWF A;  1JL1 A;  5DM7 L;  1VSK A;  3TTC A;  3QET A;  3EYZ A;  1YI2 N;  4FJG A;  3QIC A;  4O5B A;  1ASV A;  2ZE2 A;  2BGG A;  1NK8 A;  1J6Z A;  2HF4 A;  4CJQ A;  3DLE A;  4AHV A;  3C6A A;  4J2B A;  3CFP A;  3BZK A;  3P5J A;  4PUO A;  1TK8 A;  3VQ8 A;  4OPA A;  2VQF K;  1NJY A;  4DR7 K;  3IRX A;  4IJA A;  1ZBI A;  2Q97 A;  1N8R O;  3PUF A;  3D2F B;  2W41 A;  3K5M A;  3LM9 A;  1T8E A;  4F2S A;  2HHX A;  1UWB A;  4I2Q A;  3AVA A;  3VPZ A;  2PBD A;  2E4L A;  1I39 A;  4Z4H A;  1N5Y A;  4CHO A;  1KVB A;  3AGR A;  3LM2 A;  3MWP A;  3K57 A;  3I8B A;  3V4I A;  1WSG A;  4FW1 A;  1KD1 O;  1U2V B;  1JJ2 M;  5CZ1 A;  4CZH A;  4HUE A;  1WSH A;  2IVO A;  3B6O A;  5HL7 L;  3O80 A;  4CIG A;  1RDD A;  2RHK A;  4JI5 K;  1W2B M;  1NKB A;  2VYP A;  2F4V K;  2YV0 X;  4FLZ A;  4YDU C;  3UKU A;  4F8R A;  3OYM A;  3SV4 A;  3CJC A;  3RRG A;  4BE1 A;  4JYA K;  5ELZ A;  4CD3 A;  1EWR A;  1TKZ A;  2A40 A;  5GAE P;  4GNI A;  1RDW X;  1IJJ A;  1NM1 A;  3HP9 A;  2G8U A;  1GOC A;  5BPM A;  4KI4 A;  2D0C A;  4BQL A;  1ATR A;  1XMQ K;  4FZX C;  2I5J A;  1NGG A;  5FPD A;  1KCF A;  2OPS A;  2Q3S A;  3IS9 A;  4NLC A;  1QZ5 A;  4PKG A;  1SQK A;  3DI6 A;  3KK1 A;  1NK5 A;  3E9O A;  3VA0 A;  2HHU A;  1Z25 A;  1V4S A;  4OJR A;  2DFH A;  1ZBU A;  1WB9 A;  3G25 A;  3H1V X;  1WSI A;  3QEX A;  4YOT A;  2KFZ A;  5AQM A;  2YHW A;  4CF0 A;  4N76 A;  3PO5 A;  2YJF A;  4DR6 K;  1GLJ O;  4E1N A;  4DTS A;  3VGM A;  3ZCM A;  3RR7 A;  3THW A;  1VSE A;  3BEX A;  1X9J A;  2KTQ A;  5AQY A;  4CEQ A;  3MN6 A;  1WBB A;  2W42 A;  1YUW A;  4KRF A;  5AFU H;  3K5O A;  4NYF A;  3L0Q A;  5AQG A;  2HNY A;  2KQ2 A;  1XNR K;  3HPO A;  4DLG A;  1YTA A;  2OAN A;  3LL3 A;  2BDP A;  1WSJ A;  2IIR A;  3N4P A;  3OA9 A;  3NVM A;  1CLQ A;  3VQ4 A;  4WE1 A;  3CF5 L;  4B9V A;  3MWT A;  4CED A;  3VQP A;  1HNI A;  3SJJ A;  3AA2 A;  3AVG A;  4B8A B;  4C8L A;  2E5L K;  3LPT A;  3ULE A;  4CFB A;  4HHT A;  3MEC A;  3H3N O;  4FJL A;  1OH7 A;  1TYQ A;  1VSL A;  1JCF A;  4KHP K;  3ZSW A;  1D5A A;  3QIN A;  1C1B A;  3VER A;  4FCY A;  4QOZ B;  4F3O A;  1Z26 A;  3VGL A;  3NF9 A;  1YJW N;  3SUN A;  5JS2 A;  1ZC6 A;  4WQ4 A;  4LH5 A;  2YHB A;  3VTH A;  1W9H A;  3OHR A;  4IOX A;  3QB0 A;  3O6W A;  1NOY A;  1KQS M;  3DMJ A;  1B9F A;  4E0D A;  1BDG A;  4K43 A;  3WXI A;  3MN7 A;  5JVG L;  1LW0 A;  1T3V A;  1N34 K;  2EX3 A;  1BOT O;  4HUG A;  3UKR B;  4O4G A;  4O5F A;  1NK7 A;  2P9K A;  4X62 K;  3AVB A;  2VG7 A;  4FOE A;  3ZEU A;  1VQK N;  4CJS A;  4CZI A;  3FGU A;  1MWM A;  2O8F A;  4WFN L;  4B9T A;  2FC0 A;  2ZGY A;  4HWI A;  1K8K B;  3K5L A;  4KHW A;  5C15 A;  4W5N A; 
#chains in the Genus database with same CATH homology
 3G10 A;  4GVM A;  4DTU A;  1U48 A;  3AVM A;  1LV5 A;  2O4I A;  4E7K A;  4YNQ A;  3T1A A;  3SYZ A;  3ZSX A;  1HPZ A;  4FZZ A;  2X74 A;  3KIO A;  1QSS A;  4M42 A;  4M3Y A;  1S1T A;  2FBT A;  4CER A;  5CYQ A;  3WNF A;  2Z1H A;  3L2W A;  4LSN A;  3RMB A;  3LZI A;  1A5V A;  4CFA A;  1SL2 A;  4M3X A;  4FK4 A;  4OLA A;  4CGD A;  4FLT A;  3U3Y A;  3ALY A;  3DLG A;  4GMJ B;  4CHZ A;  3MXM A;  1QTM A;  1LAW A;  1D9D A;  2PY5 A;  3PO4 A;  4I9Q A;  3TAB A;  4IBN A;  3S9H A;  2VG6 A;  4FLV A;  4CEF A;  1SV5 A;  4OGC A;  3TAE A;  1TK0 A;  1VRU A;  1VSF A;  3QNO A;  2F8T A;  4DFJ A;  1RBU A;  4BWM A;  4DSK A;  2X6N A;  1L5U A;  3DLB A;  4IDK A;  3BGR A;  4CJK A;  1BL3 A;  3WNG A;  3L2R A;  1HQU A;  3ZT3 A;  1R0A A;  1UAX A;  4IFV A;  4HTU A;  1RCH A;  3DLR A;  3AO2 A;  3U6F A;  4JS5 A;  2DY4 A;  1SKR A;  1T03 A;  2RN2 A;  4O0I A;  4Z4F A;  2YNF A;  2G8I A;  1RDC A;  4B9L A;  3VQ6 A;  1CZB A;  5C25 A;  4M3R A;  4OKJ A;  5HRS A;  1BCO A;  2G8V A;  3MEG A;  3HPH A;  4E19 A;  2OA8 A;  2OPQ A;  3NFA A;  4AH9 A;  1NKE A;  4DTO A;  4CJW A;  1ZBL A;  4M3Z A;  4OKE A;  4HUF A;  3ULD A;  1S1X A;  4CIE A;  2XY6 A;  4KHQ A;  1D8Y A;  3AVN A;  3QEV A;  1A5X A;  2DFF A;  2IS3 A;  1JLC A;  4O55 A;  3SQ1 A;  3F73 A;  1X9W A;  4CF8 A;  1QSL A;  2QKK A;  4B9N A;  4M3W A;  3C6T A;  3AVI A;  4FJI A;  3F9K A;  4FK0 A;  1X1P A;  2KZZ A;  3L2U A;  2ATQ A;  1ZBH A;  4M45 A;  4OGE A;  1VSD A;  4W5Q A;  1SKS A;  4B3O A;  1O1W A;  3DRS A;  4LY7 A;  1JLF A;  2EHG A;  2HHQ A;  4CJV A;  3S3M A;  4MQ3 A;  3OYD A;  1X9M A;  3OJU A;  3L2Q A;  3M8R A;  4N41 A;  1B9D A;  3LDS A;  3DLK A;  1ZBF A;  4DQQ A;  2BE2 A;  3O3G A;  5I42 A;  3ZSQ A;  1VSH A;  2F96 A;  4RW6 A;  4K8X A;  3LAN A;  4KFB A;  1FXX A;  3QLH A;  4KHN A;  2Z1G A;  1RTD A;  3LP3 A;  3O4N A;  3KLG A;  1BIU A;  3QIO A;  3OYL A;  4E7L A;  3SPY A;  4KPY A;  4KB0 A;  3OJS A;  4EP4 A;  1RBS A;  3CM5 A;  3I0S A;  3RMA A;  3AO4 A;  4CGF A;  1ASW A;  4Y1D A;  4DQR A;  3HO1 A;  1YVU A;  4O44 A;  4FK2 A;  2XO7 A;  4MFB A;  4B9U A;  4PWD A;  4DSI A;  3LAM A;  1NK4 A;  3KK2 A;  3L8B A;  1JKH A;  4CK3 A;  4B8C A;  3OY9 A;  3KJV A;  2JGU A;  1C0T A;  1D9F A;  1BQM A;  3C94 A;  2G8F A;  4F3T A;  1S9E A;  3V1R A;  3VQC A;  1W0H A;  4AIL C;  3ZSR A;  3T3F A;  4CEE A;  1S1U A;  3MEE A;  3O4Q A;  4I2P A;  1T05 A;  3L3V A;  1EKE A;  4FJJ A;  4KKO A;  4DTP A;  3TAM A;  3AVC A;  1JXE A;  3PV8 A;  4BAC A;  1L3S A;  1LWE A;  5I3U A;  1BIS A;  1CXU A;  1HRH A;  1HJR A;  1XHX A;  2E6L A;  3CG7 A;  4CES A;  1XI1 A;  4DSE A;  2GBZ A;  3AO5 A;  3QO9 A;  2Y1I A;  3AVF A;  2IC3 A;  4CEA A;  1X9S A;  3I0R A;  2D0B A;  4CJT A;  4EP5 A;  3RTV A;  3JYT A;  4DTR A;  3QNN A;  4Q0B A;  2P5O A;  1RT3 A;  3AV9 A;  3P83 D;  3NAE A;  2ZQB A;  3DOL A;  4IG3 A;  4JS4 A;  3ZSO A;  4DS5 A;  1WLJ A;  3V81 A;  4H4M A;  3V9X A;  3MAQ A;  2HHT A;  1TAQ A;  3VQE A;  2HHS A;  4ID5 A;  2YKM A;  1DTQ A;  1XWL A;  1L3U A;  4CF1 A;  3DOK A;  4KO0 A;  1BGX T;  3NDK A;  3ZT2 A;  3CQ8 A;  5D3G A;  1C1A A;  2IDO A;  2R7Y A;  1C1C A;  5KI6 A;  4KHS A;  3D45 A;  1JLE A;  4H8K A;  1SL0 A;  4E7J A;  1VSM A;  3ISN C;  4FLU A;  1NK6 A;  4HVJ A;  3EZ5 A;  3LAK A;  2HHV A;  4B9S A;  4KTQ A;  4C8K A;  4DMN A;  3K59 A;  3LZJ A;  1FKO A;  4ZTF A;  4CJF A;  1IKV A;  1NJX A;  3ZSV A;  2RKI A;  3C95 A;  1KLM A;  1DLO A;  1A5W A;  3ZSZ A;  4FM1 A;  3RMC A;  1FK9 A;  1Q9X A;  4J2A A;  1BI4 A;  1EX4 A;  3L2V A;  5HRN A;  1JLA A;  3CFR A;  1CXQ A;  1C0M A;  4FLW A;  3RRH A;  2A1R A;  1NOZ A;  2D5R A;  4NYN A;  4CHN A;  3OYG A;  4DU4 A;  1S1V A;  1S6P A;  3KLE A;  3V9U A;  4CEB A;  1BQN A;  1NJW A;  3HT3 A;  2WOM A;  1EET A;  4JRP A;  1QS4 A;  3V6D A;  2G8W A;  5KRS A;  2PZS A;  4BWJ A;  2YKN A;  4N5S A;  3OS0 A;  1BCM A;  3QET A;  3LPU A;  4KI6 A;  3AA3 A;  2XHB A;  1KSP A;  1Y97 A;  5HP1 A;  3ASM A;  5DMR A;  4KTW A;  3DLH A;  5CZ2 A;  4QAG A;  3VQ5 A;  3A2F A;  3HJF A;  1RTJ A;  2ZD1 A;  4Y1C A;  5J1E A;  5JS1 A;  1JXB A;  1YT3 A;  4M41 A;  1I3A A;  3WNH A;  4KTZ A;  1VSI A;  2XRI A;  3B6P A;  1RDA A;  3V9S A;  3HVT A;  4OPK A;  2XY7 A;  1LAV A;  1TGO A;  1HYV A;  4FM0 A;  4DF8 A;  1IH7 A;  2HNZ A;  3ZT0 A;  4CFD A;  4AHC A;  4CGG A;  1C0U A;  3KK3 A;  3VN5 A;  3M8P A;  1IKX A;  4CHP A;  3SUO A;  4FM2 A;  1UA0 A;  2OZM A;  3T19 A;  1S5J A;  3M8Q A;  4FYD A;  4O0J A;  2OPR A;  5FRM A;  1BHL A;  1TL3 A;  1RIL A;  2XY8 A;  4FVM A;  4AHU A;  4FJ8 A;  3WNE A;  2PYL A;  3OS1 A;  4BDP A;  3UIQ A;  3OYN A;  4E89 A;  3RMD A;  1RBV A;  4DQS A;  1JLQ A;  5KGW A;  4DS4 A;  4FJN A;  1VRT A;  1ITG A;  1IKY A;  1RT7 A;  3O3F A;  5HBM A;  4CJ5 A;  3PX6 A;  4NCA A;  1RT5 A;  4ZHR A;  1TVR A;  1KFD A;  4CJ4 A;  4YFU A;  3EY1 A;  4CJE A;  3NE6 A;  3VQD A;  3ZT1 A;  4FJK A;  1WSE A;  4HCB A;  1FKP A;  4BDY A;  1KRP A;  4LSL A;  1MU2 A;  3AVJ A;  5SZT A;  3HP6 A;  1N6Q A;  3NHG A;  2P51 A;  4J2D A;  2GUI A;  1U04 A;  4FW2 A;  4N47 A;  3SUP A;  4IG0 A;  3FFI A;  2O4G A;  3NF8 A;  4CE9 A;  2Y1J A;  2HW3 A;  3CM6 A;  3SV3 A;  3AA5 X;  4TSX A;  4JRQ A;  1TAU A;  2B4J A;  2IGI A;  3QIP A;  3OYF A;  4CJU A;  1Q8I A;  4DQI A;  3ITH A;  4CF2 A;  4DTX A;  4E3S A;  1ASU A;  4IFY A;  4JLH A;  2XY5 A;  3QEI A;  4Z4I A;  4H4O A;  1TKT A;  5SWM A;  3TAF A;  4I9L A;  5T7B A;  4FJM A;  4I7F A;  2Z1I A;  4CEC A;  3TAR A;  2AJQ A;  3H08 A;  1U47 A;  4IKF A;  1LWF A;  1JL1 A;  4CJP A;  3SQ4 A;  1J5O A;  2HVI A;  1VSK A;  1S6Q A;  3HYF A;  3NH2 A;  1RT2 A;  3OYK A;  4CK1 A;  3EYZ A;  4DTN A;  5J2N A;  1HQE A;  1GOA A;  4C8M A;  4FJG A;  4O5B A;  1ASV A;  4KHU A;  4BE0 A;  2ZE2 A;  4DU1 A;  2YHA A;  1RDB A;  4DF4 A;  2RF2 A;  1NK8 A;  2BGG A;  4CJQ A;  1TL1 A;  2DFE A;  1BIZ A;  3DLE A;  2HB5 A;  4CEZ A;  2JLE A;  2X6S A;  4AHV A;  4Z4E A;  4J2B A;  4J2E A;  3CFP A;  1UA1 A;  1IO2 A;  3P5J A;  4L8R B;  4PUO A;  4KB1 A;  5CYM A;  3VQ8 A;  1TK8 A;  1KLN A;  3QEP A;  2OYQ A;  3SQ0 A;  1NJY A;  3IRX A;  1ZBI A;  4CIF A;  3NGZ A;  4CGJ A;  2B5J A;  1SUQ A;  3VA3 A;  1RTI A;  1HNV A;  3PUF A;  4CGH A;  3HVR A;  1IKW A;  3C6U A;  4ELT A;  4GW6 A;  3K5M A;  4N56 A;  4PY5 A;  1T8E A;  2P5G A;  4F2S A;  3THV A;  2HHX A;  3HST B;  1UWB A;  2B6A A;  4I2Q A;  3AVA A;  3RR8 A;  4RW9 A;  4OKK A;  5FRO A;  2KZM A;  2E4L A;  1I39 A;  1RT1 A;  3AVL A;  4Z4H A;  1N5Y A;  4CHO A;  3TR8 A;  5C42 A;  1KVB A;  1WSF A;  2X78 A;  2QKB A;  2F8S A;  3K57 A;  3OVN A;  3LWL A;  3V4I A;  5DK5 A;  1WSG A;  4DTJ A;  4DWI A;  4FW1 A;  1QQC A;  4PA1 A;  5HRO A;  4C8N A;  4FJX A;  1VSJ A;  1J9A A;  3VQ9 A;  5CZ1 A;  3SI6 A;  3MXI A;  4CK2 A;  4NCG A;  1S1W A;  5J2Q A;  4HUE A;  4DU3 A;  1WSH A;  5HLF A;  3B6O A;  1C6V A;  4CIG A;  1CZ9 A;  3LAL A;  3LWM A;  1RDD A;  4C8O A;  3NGY A;  3VQA A;  1NKB A;  4AHT A;  4UQG A;  3TAG A;  5FRN A;  2YV0 X;  4AHR A;  4FLZ A;  3SPZ A;  3VQ7 A;  1U4B A;  4F8R A;  4E7I A;  3OYM A;  3SV4 A;  3U3G A;  4XIU A;  3NF6 A;  3IAY A;  4Q5V A;  2FBX A;  3M8S A;  4DFP A;  3RRG A;  3TAP A;  4BE1 A;  1WAJ A;  4FJ7 A;  3SQ2 A;  4CHQ A;  4DQP A;  1TKZ A;  3VQB A;  2KFN A;  1JLB A;  4ICL A;  3AA4 A;  3AVK A;  4AHS A;  2YNH A;  1UOC A;  3HP9 A;  4FJH A;  2G8U A;  1GOC A;  4DFM A;  1B92 A;  4CCH A;  2G8H A;  2IOC A;  4KI4 A;  1YTU A;  2D0C A;  3OYE A;  3HL8 A;  1IG9 A;  4FZX C;  3K5N A;  2I5J A;  2VWK A;  4FLX A;  3HM9 A;  1EXQ A;  4B08 A;  1KCF A;  1TKX A;  2OPS A;  2Q3S A;  3HPG A;  1T7P A;  3KKS A;  2G8K A;  3L3U A;  4RW8 A;  4NCB A;  2VWJ A;  1LW2 A;  1J53 A;  1DTT A;  3IS9 A;  4G1Q A;  4KAZ A;  1RT4 A;  1HMV A;  4CGI A;  4DG1 A;  3ZSY A;  2OPP A;  3NCI A;  5K14 A;  3DI6 A;  3KK1 A;  3S3N A;  4W5O A;  3MED A;  1NK5 A;  2HHU A;  3VA0 A;  5E41 A;  1U49 A;  1F21 A;  1Z25 A;  4OJR A;  1S9G A;  2DFH A;  1QHT A;  1ZBU A;  3KKR A;  3SZ2 A;  2E6M A;  4BE2 A;  2HMI A;  1WSI A;  4KV8 A;  3QEX A;  1K6Y A;  2KFZ A;  3P1G A;  2ETJ A;  3OYB A;  4CF9 A;  3KLI A;  1VK0 A;  4CF0 A;  4N76 A;  1KFS A;  3K58 A;  4OLB A;  3K2P A;  3PO5 A;  1SKW A;  3VQQ A;  4E1N A;  4DTS A;  3ZCM A;  4Z0U A;  2LSN A;  3TWH A;  5KRT A;  2P1J A;  1GOB A;  3RR7 A;  3SNN A;  3CFO A;  1RNH A;  1VSE A;  3V1O A;  3OYA A;  3TI0 A;  1G15 A;  1NJZ A;  5C24 A;  2PYJ A;  4RG8 A;  2KTQ A;  3KD5 E;  3AO3 A;  4CEQ A;  5CY4 A;  4F4K A;  3QEW A;  1QE1 A;  4KRF A;  3KLF A;  2W42 A;  3S3O A;  4QCL A;  1HYZ A;  2KW4 A;  5HRP A;  5KTQ A;  3V9Z A;  1ZYQ A;  3PX4 A;  3K5O A;  4FLY A;  4ELV A;  4KRE A;  1WN7 A;  3HK2 A;  4NYF A;  1KVA A;  3NBP A;  2HNY A;  2KQ2 A;  4W5T A;  3PY8 A;  3G0Z A;  2HHW A;  5HRR A;  1SL1 A;  3QER A;  3HPO A;  4DLG A;  3LP1 A;  3MXJ A;  2QK9 A;  1YTA A;  1Q9Y A;  4M3U A;  4RW7 A;  2BDP A;  2OZS A;  1WSJ A;  3OYC A;  1LWC A;  3V9W A;  1CLQ A;  4DSL A;  3VQ4 A;  3SUQ A;  4WE1 A;  4CFC A;  1U45 A;  4B9V A;  1TKD A;  5J2M A;  4DLE A;  3RWU A;  3NF7 A;  4BDZ A;  2QXF A;  4CED A;  3KLH A;  4CHY A;  3TAQ A;  3VQP A;  1TV6 A;  1HNI A;  4CJL A;  4E7H A;  1XC9 A;  3CYM A;  3SJJ A;  1RBT A;  3AA2 A;  3AVG A;  3TAN A;  4B8A B;  3D0P A;  4FZY A;  4C8L A;  4OPJ A;  1BI4 B;  2FBV A;  2VG5 A;  3LPT A;  5J2P A;  1XHZ A;  3PX0 A;  3QES A;  1NKC A;  4CFB A;  4HHT A;  3MEC A;  3OYI A;  1TK5 A;  4FJL A;  4DSJ A;  4LD0 A;  1KVC A;  1L3T A;  3V1Q A;  3KTQ A;  4PQU A;  1RBR A;  1VSL A;  4CJR A;  1REV A;  3OS2 A;  1KTQ A;  2YNG A;  5EU7 A;  4OVL A;  2ITG A;  4W5R A;  3ZSW A;  1WAF A;  1D5A A;  3QIN A;  1C1B A;  4ID1 A;  4FCY A;  3DM2 A;  3SCX A;  3ZT4 A;  4CEO A;  4QOZ B;  3OYJ A;  3NH0 A;  1Z26 A;  4F3O A;  3KD1 E;  1J54 A;  3AO1 A;  4RW4 A;  2DTU A;  3NF9 A;  4CJ3 A;  3OYH A;  3SUN A;  1WNS A;  3NH1 A;  1NK0 A;  1JLG A;  3DRR A;  5JS2 A;  4LH5 A;  1JL2 A;  1RT6 A;  2YHB A;  1W9H A;  5FDL A;  2YNI A;  1NOY A;  4FJ5 A;  4Z4C A;  1NK9 A;  4ZTJ A;  4EZ6 A;  4B9M A;  3DMJ A;  4FJ9 A;  4F2R A;  4HCC A;  1B9F A;  4DFK A;  1RTH A;  4E0D A;  2HVH A;  3IG1 A;  3I8D A;  4FXD A;  4LH4 A;  5KGX A;  3LP0 A;  1LW0 A;  4DSF A;  2Z1J A;  1EP4 A;  1QSY A;  2HND A;  4KHY A;  2EX3 A;  3DRP A;  2IAJ A;  4E1M A;  4EZ9 A;  4HUG A;  2FBY A;  4O4G A;  1NK7 A;  3AVH A;  4K8Z A;  4M3T A;  3AVB A;  3JSM A;  2NUB A;  3DYA A;  2VG7 A;  2BAN A;  4Z4G A;  4CJS A;  1HYS A;  3NGI A;  1L3V A;  3HXM A;  2D0A A;  4ELU A;  3O3H A;  2A1S A;  3E01 A;  4B9T A;  2FC0 A;  4DTM A;  2WON A;  3BDP A;  3LP2 A;  3K5L A;  4KHW A;  2GV9 A;  2RPI A;  4R5P A;  4W5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...