2G8ZA

Crystal structure of the ternary complex of signalling protein from sheep (sps-40) with trimer and designed peptide at 2.5a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the ternary complex of signalling protein from sheep (SPS-40) with trimer and designed peptide at 2.5A resolution
rcsb
molecule tags Signaling protein
total genus 118
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2g8zA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2g8zA01
3I3DA 4MDOA 5HOSA 1UZ1A 2QF8A 1OGGA 1IZKA 4H2CA 2WC4A 3CZKA 1H0IA 2JALA 3RILA 4AD0A 1UR4A 1XD1A 4AW7A 2PBOA 2G8ZA 2Y24A 5CQ1A 3UR8A 3A6OA 1LF1A 3AHVA 1FA2A 1ISVA 1NP0A 2YOCA 5EMYA 1K9EA 2WNWA 4ATDA 1UD6A 1V0NA 4UQAA 3LPGA 1V0MA 3VKKA 3BCDA 4Z2IA 2J7EA 4DUVA 1GVYA 3OA5A 1UR0A 3MSGA 1W9BM 3UESA 1J11A 1V6YA 1JZ5A 3GH5A 1CGUA 1WAWA 1QHZA 1H5VA 3UCQA 4MAZA 4P8WA 3TOPA 1BHGA 2YL8A 1QBAA 1E0XA 4UFHA 4IPLA 3EYPA 1GNXA 2VRQA 1E40A 1AQMA 1W3KA 4MNMA 3K46A 1J0IA 5BRQA 3VNZA 3SCWA 1N82A 2D0FA 1XSJA 4XZBA 1KCLA 3VDAA 3AICA 1CECA 1HNYA 1I75A 1O6IA 3AROA 1QHOA 1KXVA 1BYBA 3VD4A 1L0PA 1H41A 2VQTA 1DWAM 2UY5A 1UD2A 3RDKA 2BHZA 1FP8A 1CDGA 1ZJBA 4CN6A 3PTKA 3WMBA 2WMKA 1EH9A 1QW8A 2ZWZA 3EMCA 4UNIA 2VMFA 4AZCB 4JKLA 3BCFA 4F79A 4PMQA 4D6JA 1PX3A 3KE0A 4B16A 1ZBCA 1VAHA 5A6BA 4J3WA 2EO7A 2V5DA 3K4DA 3D3AA 3B9EA 1U30A 1KXHA 3W26A 1GQLA 3EDEA 3HMCA 1LLOA 4JAWA 2CKSA 1UH4A 2WC3A 3DECA 4W93A 3T09A 1EDTA 3SIMA 4AZCA 3UG4A 1WDQA 4D6CA 1E5NA 1QI4A 2A3AA 1BVZA 4GI6A 4PTWA 4MB4A 3L4ZA 4PMOA 4GIAA 1UQYA 1JFXA 1W3HA 2YA2A 4LPCA 1CGYA 1V0LA 1UUQA 1E15A 4QDMA 2DT0A 1OT1A 4E4PA 5CJ5A 3RM8A 4PCSA 2G4FA 3GNOA 5BYWA 4CCEA 1JD7A 1NOFA 5I77A 3WD3A 2PWFA 4JFWA 1TCMA 2XWEA 4GO8A 5D9OA 2CITA 2VCCA 2E8YA 4CCCA 2JF6A 4LYRA 3HN3A 2VX4A 1V3LA 2GDVA 3VGFA 1BLIA 1UH3A 1JF6A 1ZBVA 5D8WA 2X1IA 4CKQA 1F4AA 4HOXA 5A3HA 3WDIA 3VNYA 1XCXA 3POCA 1HKJA 1E71M 2XIIA 5DFAA 3AISA 3WQ8A 1J12A 2WSKA 3OB8A 4IPNB 2PBGA 2WKGA 3VM5A 3VMNA 2EPLX 5A8NA 4Q22A 3AYSA 4AZBA 5E09A 3UERA 2BY2A 1OIFA 3E1F1 1WZMA 2VX6A 2WCSA 5KZ6A 3BSHA 4H8HA 4X9YA 4PMDA 5A2AA 2VVNA 1WCGA 3WEZA 1EQCA 2BNJA 2VI0A 2JE8A 3TTYA 2AOSA 4TVUA 4AIEA 2QMJA 2XGBA 1Q4NX 3K8KA 3WD1A 4Y7EA 3PZ9A 4NF7A 2QLYA 1UH2A 1WP6A 1XGZA 4WKHA 2HVMA 5HPOA 4GZJA 2WB5A 4JHOA 4BF7A 3AS0A 2V38A 1KQYA 4JHZA 4CUCA 3L4YA 4PMZA 4LXFA 3WD2A 2GJXB 4B9ZA 3VIKA 2VZUA 2XVPA 1GORA 3APGA 1SMAA 1E9LA 1QNRA 4N0RA 3SEPA 1FP9A 3NIYA 2V3FA 1DWIM 1B3ZA 4AXNA 4AD4A 2BY3A 1C8YA 3G6MA 5LA0A 1NOWA 4UQCA 1HX0A 3PZMA 4PUEA 4AWEA 1NWSA 1UD4A 2VTFA 1GW1A 4OBSA 3GXFA 4WKAA 3SCRA 2WVVB 4GO9A 3VDCA 3OLEA 3SCVA 2Z1SA 4RL3A 4BQ2A 1KXQA 2ZXQA 3KL0A 3SURA 1UHVA 5E6YA 1MQQA 3ZO9A 2O92A 3IJ9A 3B9AA 1ZL1A 2TAAA 3ZSTA 1QOXA 5CG0A 1OGSA 3WY1A 2WVVA 4NZCA 5KEZA 2E8ZA 2OWWA 3DHPA 2WCGA 2WAGA 5I5RA 5EB8A 1AVAA 5DEZA 1CXFA 4HPHA 5I3DA 3WFZA 4UOZA 3WUFA 5ABFB 1IT0A 4W8LA 3WUEA 2WXDM 1XSIA 4PMXA 1W32A 3CUIA 1E70M 4HZ8A 2B31A 3WQ6A 1UD5A 3AI0A 1X6LA 3ARUA 5JBEA 1UZ4A 1J01A 4TVCA 2D0HA 5AC4A 3MKKA 2BHUA 2ZUWA 2YDQA 3VU2A 1JZ3A 4D6EA 4AD1A 3W53A 1LL7A 1C91A 2UWFA 3OZPA 1E6ZA 4F9JA 3VD9A 2OWCA 4U3CA 1VEMA 3I3EA 3GYCA 5EFDA 4AISA 2IXUA 1XH2A 1E3ZA 1HKIA 1HN1A 5I79A 1DP0A 1DHKA 5CZKA 4V28A 4UOJA 5I23A 3EDDA 1ISXA 1LL6A 1JYVA 1HJWA 2ZUVA 3U7BA 3BLPX 4GKLA 2WHLA 1CGWA 2JIEA 1GOIA 4TVDA 1LWHA 2XVNA 2DH2A 1JI1A 3NYDA 1GOKA 4PRWA 5GNYA 2FGZA 2WMHA 4DUWA 3AHTA 2BXYA 1UKQA 5A6BD 4H41A 3WNLA 3W24A 4BZYA 1E1FA 1CXEA 3NSNA 3AMCA 3AIEA 1JIBA 2W92A 2UY2A 4P7OA 3MUIA 1HJUA 3PBGA 2ESCA 1VIWA 1OINA 1CLVA 1QHPA 2WM0A 4HPGA 1GPFA 4J3XA 1KXTA 4PMVA 4QCFA 2WK2A 1BG4A 1BFNA 4UCFA 1VB9A 1QNOA 3WUGA 2GFTA 3FAXA 4CCDA 1GOWA 3B8SA 3CMJA 1M01A 2Y2WA 1ISZA 4AD5A 1JF5A 4PMNA 3FXYA 2WYSA 3W0KA 2WKLA 2CHOA 2Y8VA 2CHNA 3T0DA 1JXJA 3SCTA 4XB3A 4CVUA 5CLWA 2GSJA 3NJ3A 4JCLA 3N11A 2F2HA 2D23A 3EDFA 3M46A 3WDQA 4ZEPA 3AMGA 1W1TA 1QI2A 2JF7A 5M17A 1UWRA 9CGTA 3IAQA 3CUHA 3WSUA 3PHAA 2CBIA 3T0AA 2YL9A 5E70A 4FMVA 4PUDA 2GK1B 4PYSA 5M03A 7A3HA 3VDHA 4MNJA 2VZOA 1ISYA 2GUYA 1KGXA 4H8VA 4M82A 1ITCA 3WN6A 4W7WA 4BQ3A 3B9DA 1R8LA 1LL4A 3CZ8A 1HVXA 2YA1A 1R85A 4WSKA 1K9TA 5HDRA 4HA3A 2BXZA 1CYGA 3KL3A 4AZIA 1BF2A 1I1WA 3SCSA 1MWOA 1GQIA 1CNVA 1WB0A 3IJ8A 4GI9A 2DSWA 4WIWA 3EDJA 1MXGA 4HZ6A 4MB1A 1WPCA 4Z2KA 3VGGA 3AZRA 2YBUA 1V02E 2WPGA 4JIEA 1M03A 4TX8A 1AQ0A 4Z2GA 2VRKA 1E4MM 2XVLA 1X1NA 1MXDA 1Q6CA 4P7RA 3VD3A 1UKSA 4K68A 1Q6FA 2EPKX 2GJRA 4A3YA 1F4HA 1UWSA 3BLKA 5C71A 3F5JA 2J8FA 1Q6DA 4KMQA 5GNXA 3OGSA 1JZ6A 1M7XA 2D24A 1CBGA 1XSKA 4HA4A 3GBEA 1HXJA 4QFUA 3WH6A 3PZTA 4EAMA 4M8UA 1J18A 4OJYA 5LYRA 2FH6A 5E6ZA 4J28A 2J7BA 2ZX8A 4D1IA 3LPOA 3TTQA 3WDPP 4UQ9A 1ZB5A 1P6WA 1QPKA 3L4TA 1SFSA 1UA7A 3MMDA 2D1ZA 5BXRA 3WF2A 5HNNA 1FH7A 4B9YA 1JFHA 2WHMA 1FFRA 4OUEA 3W81A 2VCAA 1U2YA 4QLKA 3KL5A 3AIVA 2J78A 4U5KA 3THDA 3SUVA 5BROA 3QOKA 1RPKA 2E40A 3W6LA 3WQ4A 1NQ6A 4EE9A 4D6DA 1EA9C 4UZUA 2J7DA 3TONA 1NWTA 1CIUA 1B3VA 3IK2A 3UR7A 5A6AA 4FF5A 3WH9A 4AZHA 2WWCA 2VZTA 2F61A 2YL5A 3RIKA 4J3TA 1UQZA 1UR9A 3VVGA 5EBAA 1JD9A 3I3BA 4AZ5A 3THCA 1H2JA 2PI6A 2WVUA 2E9BA 1E4NA 5HBFA 3NDYA 3VIOA 1GVIA 3SUTA 2ZUNA 4B3LA 1EDGA 3U5UA 4AEEA 3K4AA 1O7AA 4MAVA 2WW5A 4ATLA 3VIPA 4NI3A 1BYDA 4MADA 3AIWA 3MMUA 1LG1A 1QVBA 2X0YA 2WCAA 1GHRA 1UA3A 1NWRA 2A3BA 3SUWA 3WL1A 1LJYA 3BH4A 2YKKA 4BQ5A 3RM9A 5AC5A 4J3SA 2ZE0A 3WNNA 1JNDA 3ARXA 4C7GA 4CD7A 4RE4A 2XJ7A 3F5KA 5D4YA 4CU6A 1KFWA 1HF6A 3WD0A 3ZR5A 2PF0A 3AMDA 3WQVA 2DIJA 2YLLA 2D3LA 3GXIA 1E0VA 2VRJA 4W8BA 4YHGA 2WVSA 2XHYA 2GJPA 4TOQA 1R7OA 6A3HA 3VIHA 4ML4A 1QNSA 2QPUA 1B31A 2WBKA 1KR0A 2VR5A 3CBWA 4QAWA 4WKFA 4OOZA 3N17A 3MUAA 3WDRA 5A8PA 1JAKA 5E9AA 1HJVA 5M5DA 1CGVA 4W87A 2ZIDA 2FDMA 1VJSA 5E0FA 2C0HA 1UR8A 4TXEA 5JIWA 4AZ6A 2JFEX 2CBUA 3TTSA 2QHAA 1DWFM 2DIEA 2C7FA 4UQBA 1CXHA 1W9PA 3WQWA 2EJ1A 4XX6A 4E8DA 1HJSA 4MB5A 3HU7A 2NW0A 3VGBA 2X05A 3RMEA 2WMJA 3TP4A 3OIHA 5JBFA 1HP5A 3LPFA 1QNQA 3F5LA 1KBKA 1MW0A 1US2A 3ALGA 3QHMA 4JFVA 4JKMA 1MYRA 2CESA 3O2LA 4DUXA 4C7FA 4FLOA 3CPUA 2QPSA 4PSPA 1OWQA 1BGGA 1OD8A 1IV8A 1OM0A 4AY1A 2C8NA 3L2LA 3AHXA 4AD3A 5CGMA 3MS8A 4M81A 4JFUA 1TVPA 3SCOA 3DYOA 2PWHA 4W85A 3VGEA 6CGTA 3PZUA 4U3AA 3VILA 2PC8A 5BXPA 5ABHA 1W2PA 2W62A 1M53A 4OKDA 4UQEA 1MFUA 1TMQA 5A94A 3BAIA 3EDKA 2V3GA 2X0HA 1C7SA 2PWDA 5CXPA 1W1PA 1EO5A 3M07A 1B0IA 2WLYA 1PPIA 3BAXA 3M6DA 4ACYA 1J0ZA 5FL1A 2O9TA 3T2QA 1V0KA 1PIGA 1E56A 2J77A 2J8GA 4A4AA 5AY7A 1JAEA 2VZSA 3AYRA 5BXSA 1B1YA 5CPQA 4ZXOA 4HOWA 1BG9A 1C3FA 3AXXA 3WBAA 3AMKA 1J0HA 3ZMRA 3QHNA 3VMOA 3WBEA 4P7QA 4E8CA 1DTUA 5CSYA 5JBDA 4S3KA 4CU7A 2WANA 1NARA 2OYLA 2GJXA 1H49A 1UR2A 4GQQA 1HKMA 2IXVA 3WQ5A 3II1A 1WNOA 1XH1A 1V3IA 5IDIA 2ZXBA 2WMIB 3L2MA 2WC7A 4U5IA 1LWJA 3N1AA 3KEHA 5FCZA 3PZVA 4RE3A 1CXLA 3ARTA 3LPPA 1GONA 1UKPA 4X0NA 1ECEA 1HKKA 4FLRA 4F9DA 4U31A 2V3DA 3VGHA 1OT2A 1G5AA 3ARVA 1BVNP 1BYAA 3DYMA 3ZT7A 1G9HA 1V02A 2E9MA 3MUZ1 1UWIA 1ODUA 5GPRA 1R7AA 3WF1A 1EHNA 1OBAA 5AYIA 3CZJA 3J7HA 1JDAA 3VD5A 4NSBA 3MO4A 1NM9A 4D6GA 1BQCA 4NRSA 1VFMA 3CMGA 3AHZA 1WE5A 3ARRA 5ABFA 5CPSA 1KGWA 4U2YA 2J62A 1E6XM 1PZ3A 2G41A 1G01A 2ZX6A 3WL0A 2DT2A 5A2BA 5A1AA 1W9XA 4ZFMA 4W84A 1ZBWA 1E0WA 2YJQA 5C8BB 3NDZA 1PAMA 4F8XA 1V3MA 1KCKA 1E72M 1W91A 3ZIZA 2G3IA 2VX7A 1J0YA 4BQ4A 5A6SA 2NSXA 3GZAA 3OLGA 3OLIA 3O6AA 3UEQA 2A3CA 3CZGA 4PN2A 2EBNA 2XGIA 1EOMA 1GHSA 1QNPA 1EOKA 1QW9A 1XCWA 3ALFA 3MV11 2CCRA 4GPNA 5E0CA 1J0JA 3CGTA 3IJ7A 3PTMA 3VINA 1WZKA 2Y8KA 2XVKA 3SCPA 3VMPA 4HA1A 2V3EA 5A6MA 1TFVA 3FW6A 5EFFA 1CXKA 1VFOA 3NCOA 3WMCA 4DWSB 4D72A 1US3A 4H8UA 4MJ2A 1HL8A 2G3MA 2W61A 5I6SA 1GJWA 3EBVA 4NRRA 3WF4A 3A47A 3AIUA 2BV9A 3FNDA 4MJ4A 1X6NA 2DSZA 2AAAA 4AIOA 2PB1A 3BC9A 1B2YA 3VIJA 1C7TA 2ZXAA 3N13A 1KBBA 5M3WA 2O9OA 4C7DA 8CGTA 1B30A 3QOMA 1QBBA 3AXHA 1E6NA 4N42A 4Z2JA 1G0CA 3W29A 3S2CA 1CXIA 4CVWA 4PSRA 1EQPA 2A3EA 1MW3A 3WDHA 2F8QA 3WF0A 3U5YA 1YQ2A 3OGRA 1EGZA 2DDXA 2DT3A 4HTYA 1UKOA 2VO5A 3WF3A 5DMYA 4PMRA 2BHYA 2FGLA 3QGVA 3RPMA 5I0DA 1KWKA 1FFQA 1JGIA 1MW2A 1E6PA 4IISA 2G3JA 3W4RA 3UG3A 4W86A 2CKRA 2RGLA 2ZUMA 1GJUA 1W1YA 1CTNA 1E3XA 2BVDA 4IUGA 3N9KA 3K8MA 4KGJA 3K8LA 1BTCA 1E6QM 7CGTA 2GK1A 1W3JA 2XSBA 4YN5A 2OYKA 4P8VA 2J47A 1KR1A 1PX8A 1XD0A 2OSXA 3W28A 3CZEA 3FY1A 2W5FA 4PTVA 1A3HA 3VIFA 3CIVA 3GH7A 4WLCA 4PMYA 5JIPA 5FL0A 1BSIA 3PZQA 1UWUA 1XV8A 4JCMA 3GTNA 5A95A 4PTMA 3SCUA 2RGMA 2PWEA 3VTRA 1WDSA 4A3HA 3CHEA 3N12A 4JFTA 2FH8A 3JUGA 2CYGA 1FOBA 1JNEA 3CH9A 2J25A 5D9NA 1DWGM 3T08A 3ZJ8A 3RJYA 5IFPA 3GXMA 3PTQA 4URIA 1WDPA 1E6RA 3CHFA 1H1NA 2Q8XA 4V27A 1JL8A 4ZE5A 4AEFA 4UQDA 4OZOA 5C70A 3AS2A 4WJXA 1B90A 5ABGA 1D2KA 2YL6A 3VX0A 2WBGA 3PZGA 3U7VA 2Y4SA 3N18A 4UR9A 3ARPA 3BMWA 3QR3A 2D0GA 2CPUA 1H3GA 2J7FA 4M29A 3LMYA 3WKZA 2WZIA 1J0KA 1PZ2A 1H0GA 3W37A 1B3XA 1XYZA 1CZ1A 1BYCA 2UY4A 2VC9A 4PBGA 1VFUA 4M1RA 2OSWA 1JYNA 1CLXA 3AHYA 3T2PA 4Z2HA 1R86A 4HOZA 1YHTA 4PMUA 2YDSA 3CZLA 4UOQA 1SR0A 1U33A 4CD5A 4HZ7A 3VOCA 4D6IA 4UZSA 2VL4A 1J10A 2EPMX 1CPUA 5FD0A 3ZR6A 3WH8A 2VUYA 5LA1A 4MTVA 1PBGA 3WDJA 5CGTA 2FHCA 5I24A 1ODZA 2W4XA 4MDPA 1W1VA 2CERA 3GH4A 4M80A 1B9ZA 3A4XA 3EMQA 1E55A 3BMVA 1C8XA 4ZE4A 3GBDA 2AMGA 3ZJKA 5A69A 4GZIA 2WZHA 1WKYA 2O9RA 1ITXA 3AS1A 1FHLA 3UETA 1ZBKA 4W7VA 1Q6EA 3VIGA 3W6MA 4KGLA 4CD8A 3MUY1 5I2UA 3KZSA 5JUVA 3ARQA 1XRVA 3SCQA 1JZ7A 1K6AA 4X0VA 5TD4A 4ZXLA 3M7SA 1G94A 1SYTA 4ATWA 5DF0A 3U57A 1IZJA 2XFFA 1V03A 4WSJA 1DWHM 1VEPA 4LYQA 1OCQA 1OB0A 2ZWYA 4L4PA 4R27A 4Q7NA 1MW1A 2VX5A 4J3VA 3WH7A 2OWXA 5GQBA 1HP4A 4UFIA 3ZT5A 2VVSA 1K9FA 1ESWA 3CLWA 3CUJA 2DGAA 1KQZA 1XHGA 4CD6A 4GZEA 3T0BA 2BFGA 2D20A 4WF7A 2EPOA 3OZOA 4UFMA 1JZ8A 3N04A 5FIPA 1C90A 3FN9A 2CEQA 1NOUA 4PCTA 3PZOA 2CXGA 1G1YA 2MANA 2PWGA 1H11A 3TA9A 4DWSC 1TZ7A 2EXOA 1VBRA 1D3CA 1OIMA 3ARWA 3UG5A 2ZUTA 1UOKA 3BAWA 5A6KA 3BAKA 5A6JA 4TUFA 1RH9A 3IAPA 4TTGA 5DT5A 4M56A 4Z2LA 1OGBA 4MNLA 1TUXA 4W89A 2YIHA 1JZ4A 2WHJA 4FLQA 4XUYA 1UD3A 1EHAA 3ZM8A 2J79A 4JL2A 5ABEA 1V6WA 2X8RA 5DO8A 1GOOA 2EPNA 4DWSD 1HL9A 3CUGA 5IHSA 4S3JA 3OG2A 4CN1A 3N15A 5A8OA 4QP0A 3IANA 1VBUA 5IFTA 2DEPA 4P8XA 4EK7A 2DH3A 3O9NA 2XPKA 2DPEA 1CGTA 2J7CA 3ZJ6A 1E43A 1AMYA 3FHAA 2XM2A 1PIFA 1I1XA 5DT7A 1GQKA 1V6XA 3D5HA 3PZNA 4W88A 1EDQA 1LG2A 1OSEA 5I78A 4JFSA 3AIQA 1H4PA 4W5UA 3L4XA 5D8ZA 4F66A 4LQ1A 3GM8A 3ZOAA 1QI0A 4FLSA 4UFLA 3S6TA 2E9LA 2FHFA 2J7HA 1JI2A 1VJZA 1VRXA 4MB3A 5HPCA 2WZEA 4AD2A 2D22A 4W7UA 3OBAA 3BGAA 1WZLA 1R87A 1TVNA 2NT0A 1PEZA 2XFRA 3WEMA 3F4VA 2YDRA 1ZU8A 2W91A 1RP9A 2VJXA 1NH6A 2BVTA 3WNOA 3CO4A 4KRUA 2DT1A 1MQRA 4J3UA 1PJ9A 5F7UA 1E1EA 5JH8A 2WWDA 2WMGA 2DSUA 4L4OA 1UG6A 3WUBA 3WNMA 1UWTA 5GNZA 4P7NA 1HVQA 1GZJA 4OOUA 1RD6A 4D6FA 1CEOA 4WK9A 5BRPA 3WENA 1J9YA 4MNKA 2FHBA 4H7VA 5A2CA 2X09A 4AYSA 4LX4A 2BY1A 3AQUA 3AFBA 1BGAA 6TAAA 8A3HA 1D7FA 2BY0A 4J27A 4GI8A 3VPLA 4U33A 2E0PA 1E73M 3AS3A 3ECQA 1W3LA 1XYFA 3VIIA 1V08A 1TR1A 3BAJA 3AJ7A 4JKKA 1GUVA 3SUUA 3QHOA 4HMCA 4D71A 4YPJA 2A3HA 2WVTA 5A8QA 4TTUA 1WO2A 3AIRA 4J7RA 2OLHA 2DQXA 1XH0A 1BAGA 1UWQA 4GXPA 2Y5EA 1GOQA 3NSMA 1MQPA 1HJXA 2W66A 1W2VA 3L4UA 5CLTA 3CHCA 2WMIA 3GDBA 4AMCA 5FKYA 3FAWA 4BCEA 3L4VA 4MPKA 4HMEA 1Z32X 1GQJA 4UFJA 2VNCA 1W9DM 1FH9A 1B3YA 3GXDA 3W25A 2WLZA 4CU8A 4AZGA 3MV01 2EEXA 4JZ5A 4PEEA 2W63A 1UKTA 3NSXA 3ZSSA 4DM2A 2VZVA 1HIZA 4D6HA 1WDRA 4KWUA 3DC0A 4QCEA 1JDDA 2J75A 2NT1A 2YBTA 3AIBA 1K9DA 4KRTA 3SCNA 3WNKA 2E3ZA 7TAAA 4AIUA 2XVGA 3RCNA 1FH8A 3W38A 5ECUA 2JIWA 2VR4A 4ZENA 1CGXA 4P8UA 1QI3A 2CNCA 3A4AA 2BS9A 2DSVA 1MVYA 2UY3A 1PX4A 4E2OA 3PZIA 2O9PA 4KH2A 2ZICA 1KGUA 4BS0A 2XWDA 3T2OA 3WNPA 4HU8A 1TA3B 3A4WA 4XZWA 1CWYA 2YA0A 3CTTA 4IM4A 1L8NA 3VM7A 2GVYA 1UR1A 4W5ZA 3WELA 3WH5A 1M04A 5IHRA 4RE2A 1KB3A 2VQUA 3WEOA 1W9UA 3FHQA 2WSPA 1C92A 4CD4A 3WFLA 1VENA 1E5JA 3CHDA 4UTFA 3GNPA 3BXWA 1JG9A 5D9PA 4M24A 2XYLA 1TA3A 4AC1X 3AXIA 2BVYA 2VCBA 2EQDA 1NP2A 1QI5A 1W9VA 1JXKA 3VX1A 1V6UA 2XTKA 2XFYA 1UYQA 1MFVA 3ARSA 3MANA 1TG7A 4LGXA 2DSKA 3VD7A 4CN4A 3W82A 3EMZA 4HMDA 1Y7VA 1FHDA 2WMFA 2YLAA 4DWSA 2J7GA 2ZUUA 3POHA 3OGVA 3L4WA 2J4GA 2ZUSA 1GCYA 4U2ZA 3VUPA 5BXTA 1A47A 3A3HA 1HJQA 2Z1KA 3W27A 4OBRA 2VOTA 1H09A 1S46A 5A6LA 1V6VA 3WIJA 1DEDA 1HT6A 4PTXA 5CSUA 2D3NA 4DM1A 3AMLA 1UD8A 1C8QA 1JYWA 4GINA 1KWGA 2J74A 1LQ0A 3WD4A 3DHUA 2QV4A 1TE1A 1ISWA 1JZ2A 5A8MA 4BA0A 3RM4A 2XUCA 4ACZB 3PN8A 1WZAA 2XIBA 1EIBA 1ZS2A 1VEOA 3KWXA 2X2YA 3WMSA 3ARZA 2E4TA 1CENA 1Q6GA 3VIMA 2ZOXA 5LA2A 4OIFA 1E4LA 5CPTA 5IXEA 4AZ7A 5AYBA 3ZJ7A 4FK9A 2QMKA 4B3KA 4D1JA 2VURA 4R5EA 1GOMA 4ACZA 3VO0A 1OD0A 2W67A 1EXPA 1B3WA 3OLDA 3AZTA 1VFFA 3MMWA 2G3NA 1BPLB 3CUFA 2ZX9A 2JEQA 2ZX5A 3AOFA 3AZSA 4QLLA 5HXMA 2ZX7A 4UFKA 3GNRA 1E4IA 2CIPA 2ZXDA 2CBVA 3MU7A 4CGTA 1C93A 2D2OA 4EANA 3BAYA 1JDCA 3NUKA 3TTOA 3ARYA 5BCAA 3RO8A 4JL1A 1V3KA 3DYPA 1EO7A 5BWFA 2CBJA 1ZJAA 2V5CA 1V3JA 3K1DA 4W8AA 2XG9A 4GQRA 4HP5A 3G6LA 2IUZA 1VF8A 1JYXA 2OSYA 2WHKA 4H04A 4QLJA 4LYPA 2VT0A 5D9MA 1AQHA 3VGDA 1SMDA 2HISA 3HJEA 4HU0A 2XSAA 3MSDA 3VDBA 4B15A 4P7LA 4V2XA 3ZT6A 4XV0A 1RP8A 3RJXA 4TX6A 1DWJM 3BSGA 1XC6A 2XM1A 3ZQ9A 4YHEA 1E6SM 1V3HA 2CETA 2JEPA 5FOOA 2GDUA 4EKJA 1NWUA 2OYMA 3SUSA
chains in the Genus database with same CATH superfamily
5HOSA 1UZ1A 1O94A 4H00A 4H2CA 2WC4A 4PCFA 3FSUA 3CZKA 1XD1A 4YTTA 1I6NA 2G8ZA 5CQ1A 3QV6A 3UR8A 1LF1A 2E25A 1FA2A 5G4HC 3D47A 3FOKA 4UQAA 3LPGA 2HVOA 3GDKA 2J7EA 2I1OA 3RR1A 1QASA 3N6HA 1J11A 4RNJA 4S23A 2BWGA 4AFYA 3E5PA 3HOJA 4DQWA 1JZ5A 1GK8A 1CGUA 2X1RA 3PBUA 1WAWA 1H5VA 3UCQA 2RAGA 2YL8A 4Y9OA 3DKJA 3E74A 4IPLA 2TSYA 1PB0A 3IIVA 1GNXA 1E40A 1FWGC 2DV0A 3M0ZA 2C16A 3K46A 3P5ZA 5CCZA 1J0IA 4WZHA 2GQAA 3KTXA 2BVWA 4J40A 1N82A 1OX4A 4XZBA 3WQGA 1LM1A 1CECA 1O6IA 1LRNA 1AJZA 3NI6A 1QHOA 6REQA 4IGNA 5EMMA 3VD4A 4ODLA 1SR9A 4PFMA 4IT4A 2Y63A 2DZPA 5HATA 1ICSA 4XD4A 1FP8A 1CDGA 1P6CA 3IJ6A 3PTKA 3WMBA 1PXGA 1EH9A 3NQDA 1QW8A 3EMCA 1XIJA 4UNIA 2VMFA 4PMQA 3UWZA 4B16A 5K4XA 1D8WA 2C1GA 1ZBCA 1VAHA 2O0TA 1PKNA 4J3WA 3K4DA 1QMLA 3D3AA 3GDMA 3HMCA 4YVPA 3TV8A 4JAWA 4L9YA 2PPNA 3IUDA 1A5OC 2WC3A 3DUGA 3SIMA 3UG4A 4KWVA 2Q3OA 2A3AA 2PPGA 1BVZA 3UR5A 4PMOA 2POTA 2Y78A 4C6DA 1UQYA 5EMUA 2YA2A 4GVIA 4LV4A 1E15A 5CPMA 2DT0A 4JNMA 4O8AA 4Q7BA 2YX0A 3H70A 3GNOA 1Q1CA 4F0MA 2IS7A 5RUBA 3NEHA 1JD7A 1ONWA 3W7IA 4CCEA 3TUUA 1R3YA 3FGCB 3HJZA 3ZR4A 1ZAIA 2V2CA 4C6PA 4CCCA 4B5TA 3HN3A 3MBDA 2OT1A 2GDVA 1BLIA 3QMTA 4RXFA 1F4AA 3W7GA 3THAA 1UBPC 1XCXA 1V7AA 1E71M 5DFAA 3V7PA 2PBGA 4Q22A 3AYSA 1R6WA 2BY2A 3M5ZA 3DDMA 2VX6A 3GG1A 1GW9A 4RNHA 4H8HA 4PMDA 4NQ1A 4MMWA 3LV6A 1J8VA 1WUFA 3PULA 3NQBA 1FKRA 1X8CA 2JE8A 1KCZA 4DWDA 3W7PA 3BZGA 4Y7EA 1Q4NX 3WD1A 4C6KA 1R3QA 3JXVA 2HSAA 2Y8UA 4PR4A 4AX6A 3W23A 4IG2B 1JDEA 1TWSA 4BF7A 2CZEA 3NDOA 1KQYA 4JHZA 4K7VA 1VYSX 4F0SA 5JH1A 4PMZA 1N55A 5IOBA 1B57A 1F07A 4LVAA 3VIKA 4D8AA 3PJTA 1ZCOA 1SMAA 1E9LA 3V3WA 3LTPA 1FP9A 3NIYA 4DBSA 5CBBA 4IQEA 2NSOA 3MP3A 4UQCA 3ITVA 3PZMA 1NWSA 2XP4A 2TODA 2VTFA 4LC6A 4LFYA 1GW1A 3GXFA 4G1NA 1H1ZA 3HG3A 4GO9A 4WJ8A 2Y89A 4JS3A 4W4QA 4KT2A 3SCVA 3ITOA 3CWNA 4RL3A 4BQ2A 2DY3A 1XRFA 2Z27A 4GIEA 3W6YA 2WSQA 3ABXA 1NEYA 2NQHA 4QDWA 1JCNA 1ADOA 3ZO9A 1EJUC 1KLZA 2TAAA 1KM0A 1XINA 1QOXA 5CG0A 2WVVA 4NZCA 1JDFA 3I7SA 3HO8A 1Q6QA 2WAGA 4NL1A 5I3DA 1QWKA 4UOZA 4W8LA 2RUCA 2WXDM 4PMXA 1W32A 2J6XA 1NDVA 1OFOA 1GEQA 3PBMA 4G7FA 3IIZA 1H7PA 3MZ2A 4I5XA 3UI4A 3WQDA 4XKYB 2OGYA 4D6EA 3W53A 1BWKA 1LL7A 3RLGA 4KFPA 2GVJA 2OWCA 3C86A 1BRLA 2CU0A 4AISA 2IXUA 1XH2A 4XZHA 3K5XA 3USBA 1HN1A 5I79A 3S1VA 1EJSC 1DHKA 5AYZA 2REQA 1K7FA 3IVTA 3OTRA 3WLRA 4PMJA 1XGEA 2WHLA 3G1XA 2JIEA 1AA1B 1BKSA 1OK4A 4QG9A 4BI7A 2HCVA 4YVXA 4TVDA 1FWEC 1JI1A 3NYDA 1GOKA 4PRWA 3LS9A 3QKZA 4WDWA 1KM4A 4HU4A 4X2PA 2WMHA 4DUWA 5LXEA 2X0SA 1SSDA 3S9IA 3P82A 3CWOX 4NNRA 3QZ6A 1SFLA 3AMCA 4EF9A 1KFCA 2W92A 4KCVA 3SQLA 2NQJA 3MUIA 3CAWA 1OINA 1CLVA 1VLIA 3S1UA 4J3XA 5AC8A 3HPFA 4PMVA 1BFNA 4M3PA 1XLIA 4UCFA 2OLAA 1UC4A 2GFTA 3V35A 4CCDA 4HBOA 2Y2WA 3NZGA 2KZHA 1JF5A 4PMNA 3FXYA 3W7HA 1T5AA 2CHNA 4R9OA 3FJLA 2GOKA 4LVGA 4UR8A 2PLJA 3NL6A 5CLWA 1VR6A 2YYUA 3EWWA 2GSJA 4NVTA 3M46A 4ZEPA 4PBEA 2BLEA 3L2IA 3KAIA 3PPFA 5M17A 3VKBA 3LCGA 2PP0A 3IAQA 3CUHA 5LZLA 3PHAA 5E70A 1EP3A 4CQDA 2GK1B 5EYWA 5M03A 1EC7A 3BLOA 1ZZMA 1TV5A 4AY7A 3U2EA 2VZOA 3MQTA 4NY2A 4C1KA 2CLHA 4J3ZA 3B9DA 1FKBA 3TXZA 1IWBA 9RUBA 4JNYA 4FALA 1HVXA 1S2AA 1OG6A 2QCHA 1N7KA 1VFLA 1R85A 5HDRA 1K9TA 3LXCA 3UPBA 1ELSA 2BXZA 3M6YA 3NOEA 3KAFA 2INZA 3A13A 2DSWA 4WIWA 1DJZA 4Z2KA 4Q8PA 5T9BG 4JIEA 1V02E 4DBUA 1IR2A 1LUCA 1NTHA 4R3UA 3QV7A 4DT4A 1X1NA 1Q6CA 4P7RA 3VD3A 2BG5A 1Q6FA 4FEZA 4A3YA 1N8IA 3CYVA 2QUVA 1Q6DA 3S1GA 3GU9A 4DZ3A 2D24A 1YBQB 3WH6A 1W0MA 4M8UA 5LYRA 2KAUC 3L5MA 4J28A 4LAZA 2LPVA 3IK8A 2YFNA 4D1IA 1P7TB 3LPOA 5EU9A 3MJYA 3QEZA 1Q6UA 2E6YA 1UA7A 2GUBA 1YIXA 3WF2A 3BOLA 1VCVA 4I9TA 1GT8A 3M0YA 2WHMA 5FEWA 4TV5A 3TIMA 4P2VA 1FFRA 4OUEA 4WXZA 1QZ2A 4UTHA 1SM9A 1U2YA 4QLKA 3N9RA 4Y8EA 1QRQA 1RPKA 3QY7A 3WQ4A 3S9ZA 4EE9A 4D6DA 4HSOA 2ISDA 2DVTA 4RKAA 1FQ0A 3B8TA 2WWCA 3S5ZA 3VFLA 1JNSA 2QF7A 3GFYA 1GEHA 4JNZA 3NZPA 1DQUA 3THCA 2E5BA 1H2JA 1JPDX 1AJ2A 5HBFA 4B3LA 1RY8A 3STGA 2XN0A 4AEEA 5BW6A 4FOKA 4Q4PA 1F2JA 4N9EA 2WW5A 4ATLA 1FX6A 3LN3A 1BYDA 1F3WA 4N2YA 2W3ZA 3A64A 8TIMA 1SZGA 3MYOA 4DF1A 1GHRA 3E3HA 5DCBA 1LJYA 1OVDA 1KFJA 4J3SA 1NELA 2L5HA 3W9ZA 1H50A 3EA1A 4N9BA 3IKGA 4W9TA 1G4TA 5D2TA 4FXSA 4C7GA 4ZR8A 4B91A 3XISA 2VFGA 1KFWA 1JVWA 3FSTA 3G0XA 3GNDA 4GOAA 2OPJA 2VCDA 4QEEA 2YLLA 5K9XA 2E6FA 4ZO8A 2HK0A 2XHYA 3TC3A 4EWJA 2V69A 4TOQA 5HK4A 2VEKA 3U2OA 1QNSA 3HGOA 1FWJC 3CV6A 1FWDC 4OOZA 3MUAA 5E9AA 1QW7A 1Z9AA 4W87A 1O66A 1E0UA 3WLPA 2FDMA 1VYRA 2JFEX 3TTSA 4FHAA 5CPLA 3CPRA 3SIZA 2GWNA 2C7FA 2Z7KA 5D38A 2VWTA 3G22A 1IGWA 4MY1A 5F1VA 2PODA 1HJSA 2HK1A 1LYXA 3OVGA 4XAFA 3DGBA 3P60A 1QPRA 2NW0A 3TCEA 3VGBA 4KWWA 3UPMA 3P7YA 5JBFA 3LPFA 3UD6A 2E1WA 3QHMA 2ZE3A 4JKMA 4DUXA 4C7FA 1F6KA 3BV4A 2QPSA 3FGCA 2G3FA 1BGGA 4KS0A 2CC0A 2C8NA 1BTMA 5CGMA 3MS8A 4MGGA 2YCJA 1OZMA 7TIMA 3GB6A 1GG1A 3SCOA 3PR2A 1OCBA 4B5XA 3PZUA 4J1OA 4O50A 2XP7A 3E2SA 5A5WA 4M6UA 4L4LA 4UQEA 1MFUA 1FWBC 3U9IA 1YX1A 4ES4A 3IVSA 4K37A 1K4HA 3V5CA 2PWDA 5CXPA 3DU0A 1B0IA 1PPIA 4ZO7A 3BAXA 3M6DA 3FX4A 4O53A 2NLIA 1PIGA 1HO4A 1R2TA 1PO9A 2F2KA 2J8GA 4Q4MA 5AY7A 2QZRA 3KRBA 2POZA 3INPA 1B1YA 3WG6A 1VBGA 4HOWA 3RPTA 1KRMA 2YXOA 3GW0A 4Q33A 1HXVA 4AF0A 1FXPA 3W7JA 3HQ1A 4RUBA 2J24A 1FKDA 1GKRA 2Y62A 2J6VA 3SQSA 1DQXA 2BMBA 4P7QA 3F4WA 4ZPVR 1KBIA 5AOUA 4S3KA 4EXQA 4ZVJA 1WX0A 1H49A 1UR2A 4DIPA 5LGXA 3WQ5A 3AWNA 1PHQA 3QQ1A 1LROA 2WMIB 5FEPA 3L2MA 4U5IA 3N1AA 3LPPA 3O0KA 3NXLA 1GONA 1ECEA 4IZGA 4OUIA 2VM8A 4IX2A 4F9DA 4U31A 3R7MA 4L6HA 3V5FA 4PFHA 3MI3A 3AAMA 1TMHA 1XCFA 3W2UA 1BYAA 3TJIA 3MUZ1 3M0MA 1UWIA 1ODUA 5GPRA 3P67A 4FOUA 3WF1A 1EHNA 1Z89A 3TX9A 1JDAA 4NSBA 4NRSA 1W54A 2ATSA 3ARRA 4LB4A 2PD5A 5EMLA 3QC0A 3ZLFA 1OYCA 1G01A 3WL0A 3PY2A 4F2UA 5A1AA 7ENLA 1FHVA 1ZBWA 1W31A 1EJXC 1PAMA 5CC3A 4O16A 3PJXA 4ZPWR 4XKYA 3MI2A 3E0IA 4RR4A 3R8HA 3GZAA 3OLGA 2PRHA 3OLIA 4H9MA 4IJBA 2OFNA 3O6AA 4C6LA 3CZGA 5FESA 4QS6A 3BVJA 1EOMA 3MKVA 1QNPA 1QW9A 3H54A 1XI3A 2PDWA 3AU2A 3OP2A 3WQFA 4YYFA 1WZKA 3VOGA 3G1VA 3VMPA 3V36A 3NGFA 1TPEA 5A6MA 1TFVA 7ODCA 2KO7A 3WMCA 2PDJA 5G4EA 3NQ7A 4D72A 3PUEA 1J96A 1BF6A 3GO2A 2W61A 4ZODA 5LSMA 2O55A 5I6SA 1GJWA 5DMNA 4NRRA 3A47A 5H1WA 4QIBA 2AAAA 4NKCA 2G0WA 3FEMA 2YCEA 1PDYA 2JKPA 5JQ9A 4CNTA 1EYWA 1F6PA 1S5WA 4N42A 1G0CA 4Q4OA 3W29A 1AG1O 3S2CA 1CXIA 4YS1A 4IMDA 1KW1A 1CCWB 1MW3A 3WDHA 5DRIA 3OGRA 4XAZA 1OCNA 3BCJA 1A0DA 2VO5A 3SN1A 3O3RA 2BHYA 5FEXA 2FGLA 3RPMA 5I0DA 3MDUA 1NSGA 1J5SA 4XG1A 3ABSA 4YVVA 3TW9A 3UG3A 2GGHA 1ML1A 4D8LA 1E3XA 1JR1A 3DH7A 3T0TA 3K30A 1Q5MA 3EWZA 3QN3A 4UNLA 4F0RA 3PFRA 2GK1A 3QW3A 2QKFA 4X22A 2A4AA 3WLNA 2OYKA 3ITLA 3CS2A 4ADTA 3WQPA 3FY1A 4PTVA 2XPBA 1A3HA 1I8JA 3SECA 3NQ6A 3SRKA 3FCPA 3NVDA 1DQWA 1F8MA 2VFEA 3RCYA 2RGMA 4GIRA 2W0UA 2P10A 4LRTA 4F2BA 3LX9A 2CYGA 1FOBA 3WZ0E 3BW4A 3W3OA 3V5OA 3CH9A 3GXMA 1E6RA 3CHFA 2E7FA 2Q8XA 4V27A 1JL8A 4LAUA 3PF3A 4S3FA 4O2TA 3C6CA 5C55A 3CGNA 2R14A 3LRKA 2FB2A 4XD6A 2Y4SA 2WNZA 4ZGYA 4G6CA 5CG7A 3NZ1A 2D0GA 1H3GA 2PV1A 4QG6A 3LMYA 4HN8A 4QBXA 2WZIA 4AHPA 1YBQA 3W37A 1XYZA 4ZSTA 3BGJA 3UWUA 1BYCA 2XZ7A 4RV3A 4IIGA 4PBGA 1P7TA 4JR5A 4NJIA 4L9XA 3VNMA 3JR2A 3L7RA 4UOQA 4QISA 2C6QA 2PGWA 4G2PA 2VKZG 1Z69A 2VL4A 1J10A 4KFOA 3JS3A 2VUYA 4I5UA 4E4UA 2BSLA 3WDJA 4ODPA 4GQBA 1A5BA 3BDKA 1ODZA 4MDPA 3H2OA 3OZMA 3GHUA 2M08A 3RLVA 1AQFA 1B9ZA 3PP7A 2I57A 5LIXX 4O0QA 1C8XA 1J5TA 2ZADA 4K36A 5A69A 2A5HA 3HFTA 3UETA 3OQ8A 4XSMA 1M41A 1TYGA 4KGLA 4W9PA 2RJGA 3RHGA 3W02A 2OU4A 3ARQA 1EPVA 3W72A 1JZ7A 1K6AA 3BTNA 2DQWA 1AW2A 1SYTA 3EX1A 3T55A 4ATWA 4N02A 1ADSA 1V03A 1K3UA 1OCQA 1OB0A 1KCXA 4JFJA 4NXSA 2FZDA 1NDYA 3WH7A 2OWXA 2B5UB 4Z1DA 4IPXA 2VVSA 4NJJA 1ESWA 3OIXA 1XLAA 3DN5A 3K1GA 4GZEA 3BJSA 5CPNA 1NVMA 4WF7A 3PPGA 3OZOA 3O5DA 4NUWA 1JZ8A 1JQXA 5FIPA 3N29A 1C90A 3FN9A 1XYMA 4MKVA 3PZOA 3E0LA 1G1YA 1H11A 3UY8A 4DWSC 1VBRA 1UOKA 4MOZA 1E9ZB 4IJRA 5A6KA 4AVOA 1SO4A 4GYPA 3IAPA 4W89A 1JCMP 1VLWA 3TC5A 1H1YA 1JZ4A 1UD3A 2ACSA 2J79A 1V6WA 3H8AA 4H83A 5IHSA 4GJJA 4UDMA 3N15A 1FDJA 3M0KA 4K1WA 3HF3A 4IP4A 4HIBA 1IIHA 2DH3A 3O9NA 3NAVA 2DPEA 2XPKA 4ZS6A 1E43A 3MYPA 3W7NA 5K3VA 4LUYA 2DG4A 1D7HA 1PIFA 1JUEA 1V6XA 1FWHC 1WXYA 1XG3A 5MF5A 2D2GA 2VD9A 3W7DA 1EDQA 4RZ6A 2A7RA 5I78A 1H61A 4ML9A 5G4WA 2XN1A 1H4PA 4M6QA 2YR1A 4DZ5A 3PA7A 5D8ZA 3H21A 5FF4A 4LQ1A 4G7EB 1SVDA 1A5SA 3CEUA 2DORA 4JTCA 5BRBA 2OX4A 4LUSB 5E93A 4QT2A 1O5QA 3GZ3A 2WZEA 1I4NA 3W84A 5AVNA 2D22A 1TREA 3OBAA 1GPWA 1WZLA 4JFIA 2OELA 3BGAA 5CSSA 1BXNA 3O6YX 1R87A 2C3ZA 2TMDA 2QGYA 2XFRA 1RA5A 2AGKA 3F4VA 5E0KA 2W91A 1RP9A 4IQLA 1YTEA 2WQPA 3WNOA 3S3GA 2DT1A 3RLUA 5CPOA 4ZBCA 4S3DA 3QBUA 5JH8A 2WMGA 2DSUA 4L4OA 1UG6A 3O5QA 3EPOA 3WYZA 1UWTA 5GNZA 3O5IA 1QDSA 1HVQA 1RD6A 4DZHA 2V81A 4R9XA 3IV3A 3LHUA 1J9YA 4MNKA 1FWCC 2ZQTA 2X09A 3LEPA 4AYSA 4LX4A 1QU4A 3GR4A 3EEGA 4K8GA 3TK7A 4DRHA 3URNA 4ODRA 5DY3A 1YNQA 3Q4DA 2R94A 5BOEA 2B7OA 1W5OA 1XICA 2QDGA 3QPYA 4Q6JA 3OODA 1J93A 3CIWA 3VPLA 5GJMA 1E73M 1LCOA 3ECQA 1AMKA 1TR1A 2Y85A 2UV8G 2FFCA 3B40A 3T44A 3QHOA 4HMCA 3URBA 1FKGA 2FMNA 4YPJA 1TJ0A 4TTUA 1WO2A 2PDKA 3R4IA 3VZYA 2D69A 2KX9A 3GG0A 4J7RA 3IACA 2YCKX 2V2HA 3EZ4A 1PHWA 3EWUA 2FZMA 2PZ0A 1MQPA 1LLWA 5CLTA 2WMIA 4XD3A 1NMVA 2R8WA 4RX0A 3MUXA 3C2YA 4ZA0A 2J27A 2BOEX 2ZR6A 2PSNA 5CBJA 4Q8OA 2P53A 1TWWA 2Z25A 3TJLA 2WLZA 4NT0A 3C2EA 3MV01 3Q65A 4Q3MA 5LIWX 1R3VA 2W63A 3NSXA 3ZSSA 4DM2A 2WO5A 3DC0A 3IARA 4IFOA 1K7EA 3AIBA 1K9DA 3CL8A 4KRTA 3B0PA 2DUXA 4B92A 5CH9A 4LS0A 1P1XA 1K6WA 4WCJA 4AIUA 2XVGA 3H2NA 2FMOA 4ZENA 4MWAE 1CGXA 1QI3A 4ODQA 3P74A 3MCNA 4FZIA 2FDSA 3NO1A 2FLIA 2B7QA 1VFTA 2XZ9A 5C6MA 4GQ0A 3KVKA 3FFSA 4PGLA 3T9PA 4KH2A 4A8RA 2C14A 3WLKX 1X96A 2H8ZA 1XIEA 4DEFA 1WQ5A 3M41A 1L8NA 5J5DA 1UASA 1Q2RA 1UR3M 4W5ZA 3S6DA 2QCMA 4O10A 3WEOA 3FHQA 3BICA 4LNCA 4HN4A 4DJFA 3LA4A 3ISIX 4CD4A 4A35A 1VENA 1E5JA 1REQB 4FAPA 3GNPA 4UTFA 1I2RA 5D9PA 4EPDC 2OODA 1TA3A 4JFMA 3URQA 2EQDA 4FO4A 5G2WA 1F74A 1QT1A 3B0UX 4MKSA 2ZQSA 1V6UA 3EB3A 2XTKA 2ZRWA 1YMYA 2HQAA 3E5BA 4LGXA 2DSKA 4GRSA 1W3NA 1GVQA 4CN4A 4HZMA 2WM1A 3NPVA 2QIWA 4GVGA 4O15A 3DFSA 4MGVA 5DIUA 2YLAA 5CKSA 1RA0A 2SFPA 2ZRXA 1WDDA 3POHA 4FP1A 1JNTA 3UQIA 4XBJA 4HNLA 1ITQA 3DHFA 1A47A 2PDGA 4OBRA 1H09A 3H4WA 2KE0A 3BMBA 1DEDA 4WY0F 4DM1A 2QCFA 1D7IA 3EKGA 4GINA 1XQKA 4MWAD 1KWGA 4LALA 3ANYA 2NVDA 1TE1A 3KHDA 5A8MA 4B3ZA 3CU2A 1W1A1 2XIBA 2EULA 4DJDC 4KPLA 1BL4A 1VEOA 3USZA 3C4UA 3CM4A 4RLIA 1PYMA 3H2MA 5AVHA 1OFAA 2QPXA 1PS9A 4EVZA 1CENA 2IKIA 1EB3A 5CPTA 3R8RA 3ZJ7A 2DZXA 1FKSA 4AHOA 2VURA 4G56A 4ACZA 2NV2A 2CHRA 4RDVA 5HMEA 3W73A 1B3WA 4MF4A 3AZTA 3S1XA 1T8QA 3VCRA 3W76A 1VFFA 3CUFA 3NQAA 2ZX5A 4TNSA 5D75A 2W79A 5HNUA 5H8UA 1ONXA 5DXYA 4UFKA 1JPKA 1C93A 2BB0A 3RGTA 5C9WA 3MI6A 3BAYA 1F9CA 2QGHA 1JDCA 4AMAA 3NUKA 4O13A 2CLKA 2YZRA 4DELA 2ZR4A 4UB9A 3H4GA 3W70A 3C8FA 3RX3A 3V18A 1P6BA 3LOTA 1XKYA 2V5CA 2ZQVA 1Y8BA 2XG9A 5C2XA 5AYYA 1WKEA 4HP5A 3G6LA 3BUVA 2OSYA 4CQAA 4UTJA 5AZ0A 2HISA 2HJPA 3HJEA 2XSAA 4PA8A 4UTTA 3MSDA 4P7LA 3R0UA 3ZT6A 2Z2AA 3IK4A 4XV0A 3PJUA 2R82A 4TX6A 1F3EA 1GVEA 1KM2A 3AXKA 4YHEA 1E6SM 2JEPA 3OW1A 1XLBA 3MBFA 3DFOA 3MHUA 2PE4A 3PJWA 4PODA 1M5YA 3NZQA 2INFA 3A23A 3I3DA 4MDOA 3COTA 2QF8A 4LUIA 3VNLA 1V79A 4QJ4B 1I2NA 4WHBA 5D03A 3C3NA 3UJSA 4LS2A 1JPMA 1UR4A 2DUAA 2DZTA 3DIPA 2Y24A 5BNKA 3G8EA 3A6OA 3AHVA 5HT1A 1K9EA 1Z44A 1OJXA 3QRHA 3KW3A 3W07A 1V0NA 4DI9A 3QH2A 2NV1A 4IMCA 4FIRA 1YW5A 1W9BM 4TMCA 4IIBA 3DEQA 4LBSA 4UCGA 3GH5A 4EX4A 3BLDA 2Z29A 4MAZA 4Z1CA 1BHGA 4O1EA 1Y0OA 4JX4A 2A0NA 1NDWA 1LTDA 4JFLA 3EYPA 3T81A 3GK0A 4MY9A 5GJNA 4ORMA 1NU5A 2ZDRA 1W3KA 4MNMA 5BRQA 2HPIA 3SCWA 2QV5A 9XIAA 1D3GA 1HNYA 1I75A 4S2CA 1KXVA 4HCDA 2PURA 2KGJA 3LCFA 5CJNA 5TAOA 2W27A 5D33A 1TRIA 2ZQ0A 3EKZA 2VQTA 3HQOA 3B8DA 1UD2A 3RDKA 2BHZA 3BLIA 1H7OA 2A2IA 2ZWZA 2OQLA 3LTSA 3UJ2A 2Z24A 2I5IA 3BCFA 4F79A 4O57A 3KE0A 2VEMA 2GJNA 4S3BA 3UXKA 1US0A 3BG5A 3AC0A 4ZQPA 4A3QA 1U30A 4U84A 1KXHA 2OOGA 3W26A 5I07A 3IRDA 4NYYA 1LLOA 5JVLA 3HBLA 4C90A 4IGHA 3DECA 4W93A 3TSBA 1FJDA 4AZCA 1WDQA 4D6CA 4PTWA 3ITGA 4C6QA 1JFXA 1ME7A 5J6EA 4LPCA 1I0BA 1ZALA 4KRZA 2RJHA 1FCQA 4JY9A 3RM8A 3G24A 1ONEA 2G4FA 1SFTA 4PBFA 5BYWA 2CZFA 1KFBA 3U6WA 1EC9A 1GVOA 3WBYA 2FKEA 4JFWA 3UF8A 2XWEA 4QM1A 1IIGA 1SO5A 2WKJA 3K2GA 2E8YA 4WGXA 1RZMA 3JW7A 1A5KC 2VX4A 3WK0A 4FPSA 1ITUA 2R9RA 4R53A 1UH3A 4AEOA 1JF6A 4CKQA 2EG7A 4LEQA 3WQ8A 1J12A 4MSSA 1XIFA 3OB8A 1Z41A 1EX5A 4DRJA 1QXLA 2MLZA 3ZWTA 2EPLX 3LU2A 5A8NA 4AZBA 1MO0A 2ZZ2A 1OIFA 2D73A 1WZMA 3QPZA 1LT7A 4U86A 1FVPA 1FKXA 3QYQA 5F2MA 3WEZA 1UJPA 4LUSA 1O5KA 5F2GA 4F48A 4OTKA 3NQFA 5I09A 4LSBA 3TR2A 4Y9AA 1W1ZA 1R3SA 2XGBA 2ISVA 3PZ9A 2PDQA 4QSHA 1QJWA 1W3TA 5C9UA 5HJYA 2QLYA 3PTDA 1UH2A 3GTIA 1KKRA 3TJXA 1UWAA 4GZJA 2WB5A 5HPOA 5E9XA 3KAHA 1W3IA 2PU1A 4HJFA 1PL9A 4CUCA 2FYMA 3RFWA 2FZNA 3WD2A 2GJXB 3VAVA 2VZUA 1DJWA 3H9RB 2OEMA 2PDMA 1O5XA 2XVPA 2I9UA 1QNRA 4FAMA 4N0RA 3W7QA 3SEPA 5D30A 2V3FA 3TWAA 3NQ8A 3G6MA 3C0SA 5LA0A 1HX0A 3FLUA 3W7KA 1UD4A 5FJPA 5AC7A 3BK0A 1YPFA 4HARA 3ZFHA 4C65A 3C52A 2G37A 3P3BA 5HA7A 1PTAA 3Q94A 4EACA 4UTKA 2ZXQA 3UR2A 3I4EA 1UHVA 4HVXA 3B8UA 3GG8A 5E6YA 1MQQA 3S9YA 4O1CA 1DIEA 4RZ5A 4LAVA 3B9AA 4DRQA 5FF0A 3OVQA 4KCTA 2OWWA 3DHPA 3JU2A 1PCWA 2WCGA 4V1XA 3KBNA 4US5D 4ZB5A 4GJIA 2PCEA 5EB8A 5DEZA 2VYOA 3WFZA 3GLCA 4NZ3A 1IT0A 5LHFA 2MF9A 4KWOA 4IQCA 3EWXA 1E70M 5BXJA 1ZP4A 4HZ8A 3WQ6A 1UD5A 3TVAA 1GVFA 2OEKA 5JBEA 1VCFA 1RBOB 4O4WA 2BGNE 1IGSA 2NV9A 5D2VA 4INFA 3W2NA 3VD9A 4DROA 4F0LA 3UVIA 4EXBA 3I3EA 1K1DA 1KT1A 3N4AA 2Y0FA 5CZKA 3MCOA 3GUGA 4UOJA 1L6SA 1HJWA 4IXXA 4GX8A 1S2WA 2ZUVA 2ZZ3A 1CGWA 4MJMA 4L1XA 2VR2A 1V51A 1LWHA 2XVNA 3EX4A 1LZOA 2BXYA 2V2DA 4Q6XA 2HE5A 2JKEA 3CQJA 3R12A 3HGSA 1E1FA 4MYXA 5D05A 3TA6A 1JIBA 2UY2A 4QAIA 1SW0A 1HJUA 1QHPA 1REQA 2D9FA 3NVTA 1KXTA 4HBKA 3WJSA 3QY8A 1BG4A 3H22A 2YW4A 5C7VA 1QNOA 1L8PA 3DXIA 2P8CA 4LAMA 3BQ5A 1UIPA 1CW2A 4CQ8A 2WKLA 1J4HA 4UWMA 2FVMA 1JXJA 3R25A 4GBUA 3A3XA 4IT6A 1TQXA 3NJ3A 1IXQA 1TZ9A 3TDFA 3AMGA 3PNUA 1DJHA 3QSTA 3W88A 1UWRA 9CGTA 4XTIA 3G1HA 4V1YA 2VUNA 1JULA 4C1NB 4CNOA 4DRPA 3UZ5A 3W7LA 2XP8A 2X40A 3KOYA 7A3HA 2AQOA 4DVOA 3VDHA 1LBFA 5AN7A 4MNJA 1OCJA 1ISYA 3GXNA 2GUYA 1KGXA 4M82A 4LF2A 2IKJA 3H53A 1RV8A 1OYBA 1BKHA 1ITCA 4NXKA 3U4FA 1U5HA 3WN6A 4RZ4A 4BQ3A 1MEIA 1OFRA 2Y6ZA 4DY1A 1ROTA 1BD0A 2X42A 1Z6KA 1UUOA 1J6OA 3FJ4A 1CYGA 3KL3A 3N19B 1BF2A 3KBWA 1GQIA 4JTIA 2Y88A 3W7RA 5XIMA 3BLEA 3SY5A 1WPCA 2PDPA 1X97A 3SY1A 4AYGA 3E0WA 5HW6A 4LF1A 4TX8A 1RJRA 1AQ0A 4AWTA 3B8WA 1M1BA 1E4MM 2F6KA 1SW7A 1QNVA 2OZ8A 3OOBA 2X1UA 2GQ3A 4GG9A 2EPKX 1UWSA 3BLKA 5C71A 3UJFA 3LGEA 4K38A 4KMQA 5GNXA 3OGSA 4L56A 1JZ6A 1F6YA 1CBGA 1XSKA 1RJQA 2OJPA 1XG4A 3KX6A 1HXJA 4HHLA 1T40A 4WGHA 4L1GA 4AH7A 3TWBA 5B7YA 4HNTA 2VP8A 2J7BA 5I00A 3UWVA 1PSCA 2M2AA 1F76A 4C02B 2W6RA 1R0MA 2D1ZA 3UXAA 3NL5A 3GNNA 2OZTA 5H2ZA 1JFHA 2Z28A 3DFYA 3AIVA 3KL5A 4NNAA 1TPFA 2J78A 4IOTA 3THDA 2PRLA 5HNRA 2ZZ4A 4GUIA 2E40A 3W6LA 3WLSA 3W01A 1I60A 3VCNA 4UZUA 4Z1AA 1RD5A 1CIUA 4X9SA 4FF5A 3WH9A 3DOPA 3M0VA 1QOPA 2MNTA 1G4PA 2HDJA 4J3TA 2NZLA 1UQZA 2BGSA 4L7ZA 4KBXA 3E12A 1JD9A 5D04C 1XIHA 2ASHA 4C6EA 4ICCX 2E9BA 3R94A 1GVIA 1T8XA 3MW7A 2RH9A 2XH2A 1VH7A 1CB7B 2PGFA 4MAVA 2GGGA 1DIKA 2BTMA 3VE7A 4NP7A 4RNFA 4L4MA 3LZ3A 2X0YA 1A49A 2WCAA 1DE6A 2L2SA 2A3BA 4GD0A 1X6UA 1A5MC 4BQ5A 5DITA 3VI2A 3REQA 1PTGA 2BDQA 1JNDA 3WNNA 4O0KA 5HWJA 1F3XA 3MVTA 4JTUA 2VDIA 5HWCA 1XM3A 3SJNA 4NJHA 3ZR5A 3L0GA 4R7OA 3E2VA 3WQVA 3ZLGA 1ZSXA 2ISFA 4CQCA 4GC3A 4L61A 4DX3A 1ZY9A 6A3HA 3VIHA 1FKIA 1KR0A 4E3TA 3IIOA 3IGUA 2R1KA 3WDRA 3DG6A 1HJVA 2CW6A 4LCSA 5A8GA 2FAPA 4L1WA 4GY1A 4I8YA 3NXFA 1L2UA 1J6PA 3B97A 1I2OA 2F6XA 4TV6A 3BQ6A 1OF8A 4GXWA 2ZRYA 1I0DA 3ZWSA 4UQBA 1CXHA 2QJMA 3C61A 1TB3A 2EJ1A 4XX6A 4PRRA 3O15A 3W83A 4ZQCA 3VNJA 2DZVA 5DANA 1PV8A 4MB5A 2VWSA 1J2BA 3M5XA 4H9ZA 3EWBX 2G96A 4EWND 3RMEA 3PWAA 2WMJA 3TP4A 5C9RA 3OIHA 1HP5A 1UBSA 2GGIA 5C7HA 1MW0A 1BVWA 3ALGA 1US2A 4JFVA 2PTXA 3CQIA 4FLOA 1Q6IA 4CEXC 3APTA 5GPGA 1V77A 4EXAA 5DELA 1OD8A 3DZ1A 1O95A 1A0CA 1J79A 1S2UA 2HBXA 4JFUA 2RKXA 2PWHA 4R85A 4W85A 1FAPA 4YMZA 1XBVA 3KBMA 4Q4SA 4QEHA 3WJZA 5DIVA 4OKDA 3Q2DA 5J5RA 3W7CA 1BXCA 1KD0A 3H2EA 4C6JA 2V3GA 2OCZA 1C9WA 1C7SA 2F4EA 2FQIA 1W1PA 4HHMA 1XIDA 4ERIA 2WLYA 2GZXA 3L9CA 4ACYA 5FL1A 1V0KA 3JYMA 1XDJA 4O1AA 2J77A 4A4AA 3W2MA 4JTRA 1KO0A 1T11A 1W8SA 5BXSA 2ONEA 4QNWA 3XINA 3LDVA 2EGZA 3OZYA 2RUQA 3NA8A 5FI8A 1BG9A 3L5AA 3AXXA 1P5BA 1ONRA 1GJPA 3WK3A 3LNPA 1M5WA 3VMOA 3WBEA 3KDOA 3LCLA 2QNEA 3C2FA 4YCOA 5JBDA 2YSWA 4CU7A 4O18A 3F4NA 2GJXA 3V0SA 3NFUA 1P0EA 1POJA 2DZSA 1YKWA 4I7UA 1E1CB 1V3IA 1P43A 5IDIA 1EWEA 2IPGA 2Y61A 6XIAA 4PUMA 4IMFA 4G8TA 1OFBA 3KRUA 2FZ8A 4NI8A 2OQHA 1K7XA 4GFIA 2J9XA 5BU6A 2WOQA 4JTGA 4FLRA 2V3DA 3VGHA 1OT2A 2E28A 3CQ0A 1BVNP 3DYMA 3ZT7A 1SO3A 5MHBA 1KV8A 3THQA 3HPXA 2V0TA 5FJIA 1OBAA 3DI0A 1M7JA 2GUUA 1BQCA 4ZOBA 3V0TA 2OO0A 1WE5A 2PLCA 1EUAA 4Z1BA 3UG8A 2J62A 1PZ3A 1WBHA 2G41A 1DIOA 4LOCA 5A2BA 1W9XA 4ZFMA 1K8XA 3UCCA 4N6EA 5I3KA 3ZVHB 1E0WA 4NNBA 5C8BB 4MUZA 3OVPA 1KCKA 2O56A 1E72M 4HSNA 2VX7A 3DGRA 1P0KA 4H6QA 4NILA 3PAJA 4BQ4A 5A6SA 2X16A 4MSPA 4RV8A 3HG2A 2EBNA 3QW4B 3A22A 4AC7C 3ALFA 2B81A 2CCRA 2AL2B 4GPNA 5E0CA 1J0JA 3CGTA 3NM3A 4R7WA 1TRDA 2RURA 1JUBA 3IJ7A 3VINA 3MJMA 3O5KA 4ZTYA 2XFWA 4TU1A 3TMLA 1H7WA 1R47A 1ZQ5A 2Y8KA 4RJEA 5LIUX 4OHQA 4NNCA 1EBGA 2HROA 2A6NA 4TW8A 3BOFA 4H7CA 3G0SA 3TEVA 3FW6A 1Q13A 1RBAA 5EFFA 1G69A 1F8AB 4QZVB 1PKYA 3NCOA 4KWSA 3TN6A 3W00A 4AAJA 4IX0A 3H6OA 4DWSB 4YTUA 4LEFA 2HNEA 1ZCCA 1AD1A 4H8UA 4K8HA 3IVUA 1SO6A 1JRBA 3FNDA 4MFDA 2IQDA 1X6NA 2DSZA 1GYNA 4IQJA 1AL7A 4JTSA 3LY0A 1B2YA 3EPMA 4IFKB 3TCSA 5M3WA 3GHSA 8CGTA 1B30A 3QOMA 2GGJA 3NOYA 4N4PA 1D9EA 1AFSA 1E6NA 2XISA 2OT0A 4CVWA 3GR8A 4PSRA 2F8QA 2XN2A 1IT7A 3E2QA 3R6IA 1EGZA 3S2NA 3B4UA 3N2TA 4IH3A 5DMYA 4PMRA 3E96A 3FDKA 3QGVA 3OU8A 1YATA 1FFQA 4IQ2A 2CKRA 1W1YA 2BVDA 3KACA 4IUGA 1JCXA 3K8MA 4RNIA 4C1NA 2ZZ6A 1E6QM 3NPWA 3QZAA 4GA8A 4GMEA 7CGTA 3PG8A 5L9FA 3LHTA 1UB3A 5HWMA 2NXGA 3TW7A 2K8IA 3CAQA 3NGJA 3CZEA 3QVQA 3CIVA 3MZNA 1OZQA 1B9BA 3QC3A 2QAFA 1UWUA 2F7FA 1XV8A 4JCMA 3TZFA 4PTMA 3SCUA 2C1HA 4JPGA 1IEWA 3EA3A 3QLDA 3P93A 2I16A 3CAVA 2J66A 4KCUA 1NY1A 1XGDA 3LBMA 3QGAC 2AQVA 2J25A 3N3TA 1K77A 4KW2A 4URIA 1WDPA 3OYZA 1H1NA 4AEFA 1KNWA 3KXQA 3AS2A 4WJXA 1B90A 1D2KA 2YL6A 1UUMA 2QR6A 3W22A 3KVJA 3LRMA 3QTGA 1SZNA 2DJLA 4Q32A 1OC6A 1ZTVA 2CPUA 2XU2A 4M29A 1A5UA 1NF7A 4H6RA 3KADA 3U2CA 1J0KA 1PZ2A 1TV7A 3SSZA 2VC9A 3OHMB 4XKMA 1VFUA 3GAYA 3AHYA 3T2PA 4Z2HA 4IICA 4PMUA 3G1FA 4CD5A 1GOXA 4C6NA 1LWIA 1DBTA 3ZR6A 3KBJA 3WH8A 5LA1A 4S1FA 4HSHA 1PVNA 5HAOA 1JUKA 5I24A 2W4XA 2KI3A 2AGTA 4IIFA 1OABA 4WVXA 3TROA 3ELFA 1Q4WA 3EMQA 4L80A 3RFAA 2J88A 1E55A 3GBDA 1S2VA 3IS4A 2YPIA 1TJ1A 4I9MA 2WZHA 1WKYA 1ITXA 1LQ2A 4CNUA 2H6RA 3AS1A 2VEFA 1ZBKA 4F3HA 1TZZA 1Q6EA 3VIGA 1EJRC 5I2UA 3KZSA 3I10A 3MPGA 3LBOA 1P48A 3LXBA 3LMZA 3GIQA 2G95A 4X0VA 4ZXLA 3M7SA 1G94A 5DF0A 3U57A 3TFXA 1IZJA 2HNHA 4MHBA 1AW1A 2XFFA 4B4FA 3VUSA 2ZWYA 4Q7NA 1KFLA 2P8BA 1MW1A 4KFNA 2VX5A 4J3VA 3PFMA 4UFIA 1QAPA 1I45A 3TNOA 4Q7IA 1O5RA 2J8TA 3UPWA 3M0IA 4ALDA 4FA3A 4CD6A 4TW7A 1XLHA 3UFYA 3T0BA 4FNRA 2D20A 2NUXA 2PC4A 3NEVA 4N19A 3N04A 3SN4A 1RUSA 3UWQA 3QR0A 1CT5A 4ADUA 1NOUA 3E0FA 3M0JA 4Q4KA 2CXGA 2MANA 2PWGA 4E4FA 1D3CA 3UG5A 2ZUTA 1IXNA 3BAWA 3BW2A 5AHFA 2ZRUA 3BAKA 3UI5A 5A6JA 1RH9A 4M56A 4Z2LA 3VNKA 1EZ2A 1TUXA 1HG3A 3MWAA 3A4JA 3NTYA 4G50A 3CUZA 3L68A 4ROPA 4L5ZA 5ABEA 4FR1A 5DO8A 2CLIA 1A3WA 2EPNA 2ALRA 3TYZA 4JYDA 3LM7A 3A9BA 3WK2A 3QYSA 5IFTA 4HPXA 3ZJ6A 2J7CA 3RITA 3M7WA 4HYVA 3ABQA 3FHAA 3H23A 1GQKA 3O6CA 5JH2A 4FXRA 3PZNA 1XUUA 4HNOA 2GSEA 1EA0A 2A1YA 3BMXA 3AIQA 1QPNA 3O1NA 1XLKA 1S39A 3VNIA 3L67A 4W5UA 1XLDA 3GM8A 3GXPA 3F2BA 1G7UA 2GLKA 3S6TA 2E9LA 1TTPA 1JI2A 1VRXA 3DFHA 3QQWA 2GSHA 4GACA 4LRSA 3TW6A 1TPDA 2P3ZA 1A5CA 3H2CA 4NJGA 5BOOA 3PVFA 3SRHA 4W7UA 3BE7A 2PTWA 2AKMA 2NT0A 4A2SA 2XH0A 3UP8A 1TSIA 3LI0A 4D9PA 1TV4A 1K70A 4DJED 3UYCA 4DUOA 4J3UA 1PJ9A 5F7UA 1AZ2A 1YNYA 1E1EA 4IHCA 3CNYA 2QUUA 4GBDA 4OOUA 1SJDA 1CEOA 4WK9A 4A8LA 4HYWA 3FIGA 1JCHB 3EWDA 1P5QA 4MVAA 2QJJA 2OZ0A 1RVKA 2OB3A 3WX7A 2FHBA 1LOQA 3CB8A 1G7VA 4QJ1A 2M1IA 5LKYA 4JBRA 1U83A 3AQUA 5AB3A 1BGAA 2A3LA 1QPOA 2QYGA 3SJ3A 8A3HA 1TTQA 3B06A 1D7FA 2BY0A 2JKAA 4TIMA 4U33A 1U1HA 1GKPA 3AS3A 1XYFA 1Z7AA 4CNPA 1KTCA 3AJ7A 4FIQA 1EBHA 3GNXA 5CAHA 4HCHA 4B5SA 1R30A 2R1PA 2C91A 2A3HA 2WVTA 1LP6A 5AHNA 3WQEA 5L6UA 4GISA 3GUWA 2DQXA 3NYZA 4WY0A 1BAGA 5AYXA 1UWQA 4Q4QA 1MSSA 2Y5EA 1XLJA 3P81A 3LCXA 4GH1A 2JQXA 1VPYA 4H01A 3TR9A 4AMCA 4E6MA 4ODKA 4BCEA 3L4VA 3RCMA 1Z32X 1GQJA 4UFJA 3M0HA 1SW3A 2MUCA 3F2CA 1C8VA 4DO6A 2VEGA 2VNCA 1W9DM 5KZDA 3W25A 2FTYA 3W1NA 3R1ZA 2EEXA 4JZ5A 3NQCA 4D6HA 2CWNA 2J75A 2YBTA 2PF8A 3MO7A 3NPXA 1DV7A 2AL1A 2ICSA 2E3ZA 4XVEA 3M1ZA 3IIPA 1ZPTA 1FH8A 1C9HA 4L3NA 2BS9A 1MVYA 4PUUA 4XO7A 1Y5WA 5TF0A 3TN3A 4CQ9A 1F5ZA 3RU6A 3ANVA 1GZ1A 3HG5A 3ZVHA 3RYSA 4UTWA 4HU8A 5C2GA 2PS2A 3TC7A 2Q71A 7PTDA 4RDYA 4XZWA 1CWYA 3CTTA 4IM4A 2GVYA 1UR1A 3I6EA 2JGQA 5IHRA 1KB3A 5TIMA 2J9ZA 1O1ZA 1MEHA 4HNVA 2O7QA 4EIVA 2DZAA 3WFLA 2J13A 3C0QA 2CLOA 3CHDA 1D7KA 3BXWA 1EEXA 1RVGA 3P2VA 2WJZA 2AL2A 3CMFA 3AXIA 3EPNA 1JXKA 1P4CA 2XFYA 2Z6IA 3ICJA 3H7RA 3ARSA 2WSYA 1TG7A 2LJ4A 1XBYA 2FVLA 3VD7A 4MWAC 4ZMGA 2VGGA 4IIDA 3ZS4A 5EGRA 4DWSA 1YPXA 1TVLA 2RQSA 3BURA 1YXCA 2ANUA 1S1PA 5BXTA 3VUPA 3EWCA 3A3HA 1DJIA 4RDZA 5D37A 5FEZA 4JIRA 3V1HA 1YLVA 2Z1KA 3W27A 1TJPA 2F23A 3PWGA 1V6VA 4UMBA 4C5YA 1HT6A 3DESA 5CSUA 1XJBA 3TYCA 1SPQA 1UPMB 4R34A 3WD4A 4O11A 4BF5A 1O12A 1Y5XA 4JOMA 3EB2A 1JZ2A 4BA0A 2XUCA 3PN8A 1DTNA 1WZAA 3W1PA 1ZS2A 1H51A 1ROUA 3QPEA 4O12A 1Q63A 8XIMA 3IUHA 4DAFA 1X7FA 2MPHA 2E4TA 3ME3A 1NFPA 2PN0A 1D3HA 1AW5A 1VFHA 1EPXA 5LA2A 1QCWA 5D32A 2OG9A 5AYBA 1HKVA 3ES8A 3CIXA 3LHVA 2WPBA 4D1JA 4R5EA 1UMLA 1GOMA 3LHZA 4C5ZA 1XUZA 3NTPA 1EXPA 3RRXA 3OVRA 3OLDA 3I6TA 3MMWA 3HQNA 2RUSA 2G3NA 3EOEA 1IXPA 3KTSA 5I3IA 3IEBA 2BASA 3RAOA 3KUMA 4QX4A 3ATZA 4OVXA 2GGEA 1RQBA 3GNRA 2ZXDA 4OECA 1EJTC 4YNGA 1TV2A 3BLLA 3W1AA 3TTOA 3ARYA 1V3KA 3DYPA 4UXDA 5BWFA 1HW6A 1V3JA 1VP5A 2BP1A 4GQRA 4JFKA 2B7PA 1U1JA 4JD4A 2XH4A 1DXIA 1VF8A 4R0XA 3LUOA 1IHIA 1MZHA 3EGJA 4GY7A 2FPTA 4POCA 3F03K 2WHKA 1SJBA 1U1UA 2DW6A 3PS7A 2VT0A 2V30A 2PEVA 4EPEC 5CEWA 1C9DA 2Q3RA 2BGQA 1AQHA 3PR9A 3VABA 3H7UA 4HU0A 3UYIA 4V2XA 1PINA 4JQ1A 1RP8A 3RJXA 3ZQ9A 1XC6A 2IPWA 4BF8A 2ZZ1A 3APYA 4WQ6A 3GKFA 5T8GA 4NASA 4V33A 4EKJA 1KFEA 1NWUA 3SUSA 2Y5JA 3EEZA 4C6CA 5DCDA 1I9CB 1H0IA 2JALA 1XDLA 1V93A 2NXIA 4AD0A 2PBOA 2OKTA 5FF7A 2YOCA 3P61A 1GRJA 5EMYA 2WNWA 3NZRA 4ATDA 1UD6A 5CGQA 1V0MA 3LHWA 1I2QA 3BCDA 4Z2IA 1GVYA 4OFCA 3OA5A 4G5DA 3MSGA 3L65A 1V6YA 4UUIA 1P0NA 2HBVA 3G3MA 2ISSA 1OX4B 1XFCA 5U4NA 2ZZ5A 3TOPA 4Y90A 3L23A 5HUAA 6REQB 1E0XA 3RX2A 3T8QA 1UC5A 2DVXA 1KTNA 4XO6A 4JQ2A 1F61A 1TCDA 2QQ6A 3NPUA 1ZFJA 3W85A 3IPWA 2I5QA 4E5TA 3EA2A 3GC2A 1MMFA 1KCLA 3VDAA 3AICA 3C0LA 4AUBA 1TTJA 1XLCA 2DVUA 1BYBA 3BWWA 2KR7A 1L0PA 5B8IC 3GTHA 2PGRA 3KDNA 4O52A 2UY5A 1DIDA 1ZJBA 3DERA 5F2LA 4CN6A 2CLLA 3FJ6A 1VS1A 5IBXC 2WMKA 4NYUA 2MNRA 3KS5A 1PX3A 4OWGA 4UBPC 1GVSA 5A6BA 1THFD 3LLFA 3WO8A 5EMKA 3GS6A 1OX6A 3KP0A 3O05A 3B9EA 2V5KA 3C2VA 1KFKA 1X1OA 1GQLA 3EDEA 3UZWA 4WSHA 1FXQA 3MA8A 1QPQA 2CKSA 1UH4A 3T78A 1EDTA 2NLYA 2W9MA 1QI4A 2V8ZA 3VKDA 4C6BA 4GIAA 1UUQA 3UXLA 5F4SA 4QDMA 3O63A 1OT1A 5H8PA 4ZB2A 4E4PA 5CJ5A 3WLOA 5I77A 3WD3A 1VBHA 2PWFA 1Y5VA 3T07A 1TCMA 2PU0A 3U4AA 4DLMA 1KV5A 2CITA 5BWAA 4GUGA 3UY7A 4Q8NA 3ZLHA 4GNKB 1ZBVA 1X7IA 1PTDA 1A80A 1PIIA 2CFFA 3WDIA 3QLLA 3KCJA 2CLPA 3POCA 1HKJA 4IUOA 3GC5A 4GFSA 2XIIA 3PRBA 3NRKA 4IPNB 2PGEA 3SM0A 3VMNA 1Q7QA 3MDWA 2V68A 2XIQA 4GVHA 2QXWA 5KZ6A 1FTXA 3BSHA 1OY0A 1WUEA 2VVNA 3GYEA 1EQCA 2BNJA 2VI0A 2P5NA 1AJ0A 4DJDA 1R9XA 5HW8A 4X60A 4TVUA 3Q58A 5MKGB 3U3HA 4AIEA 1F05A 4XVDA 1MI3A 3K8KA 4FNPA 2RUDA 1B54A 1FHUA 5E5CA 1YDVA 5DXXA 4N7QA 1XGZA 4WKHA 1GG0A 3CB3A 3QMRA 1ZUAX 4JHOA 3W1UA 1N8FA 2HZGA 1EWDA 5C5YA 3HGJA 3GQYA 3AS0A 3G1YA 3GVRA 4IF2A 4S2BA 4JTAA 4N4QA 1FWIC 2ABAA 3D3FA 3L4YA 3NWRA 3IJLA 3WJXA 4LXFA 2OOFA 1YADA 2I5GA 1GORA 2X7WA 1PYFA 4IL0A 4IG2A 4AQLA 5K2ZA 4HNCA 1OFEA 1B3ZA 4AXNA 4AD4A 4IPPA 4A3UA 2BY3A 4EF8A 5KZEA 4MZ8A 3KOXA 1C8YA 1NOWA 4LBUA 4AWEA 4O28A 3BV7A 2QJNA 4OBSA 2WVVB 1EEPA 4I9JA 1E9IA 1QO2A 1WXZA 4XWUA 3GVVA 2Z1SA 4WRHA 2TPSA 1KXQA 2NQ5A 1ZLPA 3AUOA 3FK4A 4UNKA 3R8GA 1ADDA 2IKGA 2O92A 3MCMA 1RBLA 3IJ9A 4CCZA 3LK6A 2WNQA 3ZSTA 3NQVA 3WY1A 5HTGA 2XGZA 1ALDA 3CAKA 2YBVA 4EPBC 1AVAA 1CXFA 1O4UA 3WUFA 1PKLA 4JQAA 3WUEA 3LG3A 4E0CA 5C0QA 1EX1A 4DPPA 2B31A 3T42A 2R1LA 5G1MA 4JTKA 1J01A 1U5VA 3VKJA 4TVCA 4WOZA 1EFZA 5AC4A 4YU1A 1AZ1A 2BHUA 2ZUWA 3VU2A 4AD1A 5FAGA 4RXGA 3M5YA 1QFEA 3W74A 1E6ZA 1G6CA 3FJNA 3URAA 3KOWA 4U3CA 3VOJA 3GYCA 5BMXA 1HKIA 2PFHA 4UTLA 2XDFA 1ME9A 4MJZA 1OC7A 1Q66A 1ISXA 1LL6A 4LH8A 2OTDA 3BLPX 3BW3A 3KVLA 4CQBA 4UTMA 4WDUA 1SSGA 2X1TA 2PPOA 4XSLA 1RSCA 2DH2A 3TLLA 1S5TA 4ODNA 5GNYA 1KBLA 3AHTA 4QHRA 4CEUC 1UKQA 5A6BD 2ZR5A 4H4IA 1RLCL 3WNLA 1CXEA 4OE7A 5GVJA 4BJHA 3TC6A 3AIEA 4IMAA 4P7OA 3G18A 2RDXA 2ESCA 4H19A 1VIWA 3MDYB 4I90A 2WM0A 4HPGA 4I9AA 2HPMA 3GWQA 4QCFA 2WK2A 5HQMA 3P0WA 4MIMA 1XYAA 3O5GA 1LDCA 1DE5A 1VB9A 4TX0A 3WUGA 1RK5A 4ZOEA 3CMJA 4AD5A 4KR0B 3HIJA 2CHOA 2Y8VA 4ENLA 4GIYA 3SCTA 2QCEA 4CVUA 3ERPA 3F4DA 4QXIA 4JCLA 3N11A 2F2HA 1IF2A 1VKFA 4HBEA 1LRTA 2RDTA 4QDPA 3EDFA 3WDQA 3FS2A 1QR7A 2GL5A 2V5LA 2JF7A 3BJFA 2GJLA 1WOAA 4NU7A 3WSUA 1TUFA 2CBIA 4BWLC 3AALA 4FMVA 3THUA 3KCLA 4PYSA 4LAYA 3SRDA 4AG0A 5U7SA 3Q67A 2I14A 4C60A 1A7XA 2RHGA 4LAKA 1QATA 5I3GA 1WDWA 1LL4A 5JU6A 4XBSA 4I8DA 1DOSA 4WSKA 3T8LA 3UZJA 3CHVA 1RR2A 4AZIA 5CAKA 5I7GA 1Q45A 1MWOA 4KESA 1WB0A 3DC8A 4DHGA 1OHLA 4GI9A 3EDJA 1MXGA 4RW3A 3VGGA 3VOIA 3UJRA 4B5NA 2WPGA 4ZTXA 3MVIA 1M03A 4Z2GA 2VRKA 2XVLA 1MXDA 2H3DA 2QCNA 1TPH1 4UTIA 3TTEA 2PBCA 4FOJA 2FTPA 2J8FA 3GU0A 3SI9A 4ZQOA 1M7XA 1ZCNA 1TPVA 1LBLA 3GBEA 3PZTA 4RCXA 1J18A 2FH6A 5E6ZA 2ZX8A 4HGXA 4UQ9A 1A3XA 3HM7A 1ZB5A 1TX0A 4A8NA 2PUZA 1QPKA 3H24A 3MMDA 5C9XA 5BXRA 1UZHA 2HXUA 5HNNA 5FJUA 3C56A 4B9YA 2X30A 3UI6A 3W81A 3KFTA 5DY2A 2VCAA 1MDLA 3WLLA 1XIBA 1MEWA 4U5KA 4ILSA 3T40A 5BROA 3NR0A 3QOKA 1RAKA 3WH0A 3TONA 3F7JA 3DG7A 3WMLA 1NWTA 3P62A 3IK2A 5A6AA 3S2JA 4L64A 2I56A 3QR1A 4JN7A 3S83A 2E6AA 3EOLA 2VZTA 3RIKA 1T41A 1UR9A 3ODKA 4DYEA 1K8ZA 3O6DA 4GNVA 2DZUA 5EBAA 4AZ5A 3LM3A 1L6WA 2PI6A 2WVUA 1QK0A 3B04A 3VA8A 1E4NA 3NDYA 3VIOA 3SUTA 2ZUNA 1Q85A 2DJXA 3CQHA 1EDGA 3U5UA 5TNVA 3CPGA 1PZ0A 3VIPA 1IT8A 4LAXA 4MADA 3ABZA 3TOYA 2P4VA 2X2GA 5C54A 4O8RA 1YPIA 1UA3A 1NWRA 3SUWA 4DZAA 1FD9A 3WL1A 2DFAA 3BH4A 2YKKA 3B9NA 2QJGA 4H3DA 3AJXA 2FFIA 2ETNA 3N2OA 4M51A 2DG3A 5HANA 3ARXA 4O0ZA 1RPXA 4DO5A 3IJQA 1EYEA 4NZ1A 3KZPA 2XJ7A 1VZWA 5D4YA 3N73A 4ICMA 2Z6JA 5IM51 2PF0A 3AMDA 3MY9A 3WBWA 3FEQA 2OR2A 4LCRA 2Z00A 1BXBA 3GXIA 3L0KA 1XLFA 3SZ8A 1A50A 3BPWA 2A21A 2P3EA 4ML4A 1B31A 2VR5A 3CBWA 4WKFA 3N17A 5A8PA 1JAKA 2H8XA 3LQLA 4K2SA 1SZFA 3KM8A 3O5LA 1PCKA 3OG3A 3LENA 3W1LA 3MT1A 1PZ1A 4JTFA 5E0FA 3YPIA 3H2AA 1BQGA 4JN8A 5JIWA 1W5PA 4WJEA 2CBUA 1DWFM 2DIEA 4GY0A 2JZVA 3R58A 3STCA 2OO6A 1A53A 4MZYA 2X05A 3W86A 4QR6A 4TYOA 1QNQA 3R10A 1KBKA 3F5LA 3OPSA 2Q8ZA 2CESA 3SBFA 3O2LA 2EPHA 3CPUA 1XP3A 3OBEA 1FUYA 2E67A 5FAJA 3L5LA 1OWQA 4HQVA 4HT3A 4FX8A 1OM0A 4LJ3A 2PDHA 2R1NA 1V5XA 4AD3A 4J35A 4DNHA 3IIXA 1TVPA 1R2RA 3DBPA 2PLMA 3DYOA 4QE5A 3VGEA 4X3ZA 2PC8A 5T91A 1W2PA 2W62A 1TV8A 1TMQA 5A94A 4NAEB 4WR3A 3BAIA 2HVNA 3AWOA 5B7ZA 3LBCA 2X0HA 3FDGA 3EAUA 3ID7A 1XQLA 3S0CA 4PRTA 4AF0B 1JJKA 1Z48A 3A21A 3T2QA 5H91A 2R1MA 4PUJA 5FF2A 3T0CA 2VELA 1JAEA