2G8ZA

Crystal structure of the ternary complex of signalling protein from sheep (sps-40) with trimer and designed peptide at 2.5a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ternary complex of signalling protein from sheep (SPS-40) with trimer and designed peptide at 2.5A resolution
rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 118
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2g8zA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2g8zA01
3CZEA 2FGLA 3UR7A 2XUCA 1YQ2A 1LQ0A 1ZBWA 3UETA 1GW1A 3TOPA 3M46A 1CENA 4JL2A 1E5NA 1E9LA 2D3NA 4TTUA 4PTWA 1B2YA 1BFNA 1I75A 5BRQA 1VRXA 2X8RA 3OZPA 2XSBA 1F4AA 2X05A 1H49A 3UG3A 1NH6A 3PHAA 1E4NA 3ZJ8A 4FMVA 4UFHA 1KQYA 3PZQA 4MNJA 1EO5A 3N1AA 3WFLA 2ZXQA 4AZIA 3T0DA 4F66A 2UY4A 1H0GA 1C3FA 1EGZA 1J0IA 2Q8XA 3SCQA 2E0PA 4KRUA 4QLKA 2E9MA 2XIBA 1SFSA 3TTOA 3WUGA 3FHAA 3VIIA 3W28A 4H8HA 3AI0A 3ZSSA 4UZSA 1QNPA 3OGVA 4NRRA 2E40A 3UG4A 1G0CA 1IZKA 5ABHA 4HMEA 1DHKA 2Y2WA 2J7CA 3N15A 1HL8A 2FHBA 1ESWA 1PPIA 2J75A 1BYCA 1D7FA 2VX5A 1U2YA 3EBVA 2OSYA 3MUIA 3CMGA 6TAAA 4D6FA 4ZXLA 5I5RA 3T0AA 2ZIDA 3ZJ7A 1Q6EA 3CZ8A 3SUSA 3WF3A 4MTVA 1BGAA 1LG2A 1CGTA 3QHOA 1J0YA 3A4AA 2CESA 1UWSA 2DSWA 4MNMA 2CHOA 1VAHA 3FAXA 4U3CA 2D20A 2XWDA 4EK7A 5CGMA 3ALFA 3VMOA 4TTGA 3G6MA 1JD9A 3ALGA 3EMZA 3ARUA 4UQ9A 2JF7A 2XPKA 3SURA 1CEOA 4BQ5A 1CXEA 3BAXA 4CU8A 2CBJA 5BXPA 5FL0A 3N04A 4E8CA 4V28A 4UOJA 1UQZA 2PWDA 3FNDA 4UNIA 1E5JA 3VIHA 1J0HA 3DHUA 1XHGA 3POCA 1B3ZA 5GNYA 1UR2A 3THDA 1BYAA 2EPMX 3VGHA 5I0DA 3VIGA 1OINA 3IJ9A 3ARYA 1CLXA 3SCWA 4HMDA 3OLGA 3WD3A 1UWQA 5E9AA 1O7AA 5E0FA 5EFFA 3DYPA 4TXEA 3KZSA 1KR0A 4HOZA 2VNCA 4U3AA 2X1IA 3WMBA 2Y4SA 3T09A 4D6GA 4JKKA 4MPKA 1GHSA 2DSVA 4C7FA 2CIPA 2DT0A 1DTUA 3CO4A 4AZ7A 7CGTA 3AOFA 3T2PA 1QNSA 4LYQA 3WEMA 4QDMA 3ARZA 4S3JA 2XJ7A 4E8DA 1O6IA 3CZKA 4MADA 2QF8A 4FF5A 3VD7A 3WD0A 3VDCA 2YBUA 2FH6A 5BXRA 1GQKA 4TUFA 3SCVA 3AHVA 1PAMA 1OT1A 3CZJA 3GXDA 4HU0A 2OWXA 1J0JA 5CZKA 1C90A 2O9RA 5BWFA 2O9PA 3DC0A 2XVPA 1UWUA 1DP0A 4PMUA 5I78A 4WK9A 3F5JA 2WC3A 4UQDA 3CHEA 4DUVA 1UA3A 5EBAA 4GQQA 4JKLA 5C71A 2W91A 5A8QA 4JKMA 2JALA 4UFJA 3ARVA 1ZJAA 1HKIA 1Q6CA 1BYBA 4UQCA 1W32A 1E72M 1QI0A 4TX6A 4YHGA 3TTQA 3BC9A 3WH9A 2ESCA 2A3BA 1L8NA 4GO9A 2J7DA 3ZT5A 4HPGA 2J47A 2QMKA 3E1F1 2NT1A 3KWXA 1VF8A 5IFTA 2WZEA 1SR0A 1JZ3A 1B9ZA 2WM0A 3VD5A 4P7NA 2ZX5A 4YN5A 1X6LA 1NOWA 4FLQA 5ABEA 3RM8A 4HOWA 2EQDA 1F4HA 4H8UA 2CBVA 3S2CA 5DO8A 3MANA 4CVUA 4GO8A 1JF6A 2WXDM 1V6UA 5EFDA 2DGAA 1UQYA 2BFGA 2DQXA 1DWFM 1KGWA 2WKLA 2XFYA 1JAKA 1MQPA 2XGIA 1TVNA 2BVTA 3WEZA 2V3FA 4JFSA 1OGGA 3M6DA 1EQPA 1EDGA 1R86A 2J4GA 5A6KA 2WMHA 3J7HA 3MKKA 3II1A 4JFTA 5BROA 3A47A 1JFXA 1HNYA 1GOMA 3VPLA 4JFVA 4A3YA 1C8QA 1U30A 1XYFA 4J7RA 1GOKA 5A69A 1KGXA 4HTYA 1PX8A 4BF7A 3B8SA 4JFUA 4CCCA 3IK2A 2VZSA 4LPCA 4FLOA 3OLDA 5A2AA 1H1NA 2WANA 3W0KA 4OOZA 1S46A 3RILA 1UH4A 1BF2A 4R5EA 3BCFA 2FGZA 1JDCA 4RE3A 1XRVA 4U5KA 2BHUA 3CGTA 5CQ1A 5DEZA 8CGTA 2ZX7A 3K1DA 2CCRA 3CPUA 1V0NA 1FFRA 3WQWA 3QGVA 1V03A 1WE5A 2G4FA 2W62A 1AQHA 3ARQA 3WD2A 1UA7A 1E43A 2PWFA 4NZCA 1WDRA 3AZTA 3IAQA 4ATLA 3AMCA 3WDJA 1KCKA 1QVBA 1JZ7A 4IISA 3WD4A 4J3UA 1W1PA 5A8NA 2NSXA 2WK2A 4CCDA 5A6JA 2EEXA 4S3KA 1G94A 2WZIA 3MUAA 3CHCA 3PN8A 5A8MA 4CD4A 4F79A 1RH9A 3OZOA 3AYRA 1W3KA 3A4WA 1UHVA 3VIFA 3SUTA 4LYPA 2WBGA 1HN1A 3RM4A 1PEZA 1ZU8A 4P7OA 2GJXA 1CPUA 4Q7NA 1G01A 4D6DA 2EBNA 1B3WA 1MFVA 1NP0A 2WWDA 3THCA 5A2CA 1KBKA 1XCXA 4V2XA 4WKFA 1TR1A 1V3HA 4GPNA 1QW9A 4MJ4A 4C7DA 4CGTA 4NRSA 3CIVA 3N17A 3EDDA 2VX4A 2ZX6A 1RPKA 3LPOA 2XTKA 5ECUA 4OOUA 2G3NA 1WKYA 5A8PA 5BCAA 3ARRA 3VNZA 2XVNA 1KXVA 1BG9A 4GI8A 2VRKA 4AC1X 4A4AA 4UFKA 4NI3A 3NYDA 4W7UA 1QHZA 3UEQA 3WL1A 3AZRA 4W93A 1X1NA 5GPRA 4R27A 2WSKA 3FAWA 4MAVA 1CWYA 5HOSA 1JYXA 2WVVB 4U2ZA 4UQAA 1E4IA 2WHKA 2RGLA 3VGBA 3CHDA 3WQVA 2J7EA 4HA3A 3W24A 1VEPA 1C7TA 5M17A 1NP2A 5JBDA 4IPLA 3AHYA 1BVNP 4PSPA 1E6QM 4U5IA 2DDXA 4M24A 3W27A 4AXNA 1MW3A 2CPUA 3OG2A 3AIVA 1TG7A 1H5VA 2QV4A 3SUUA 1E56A 5I77A 1UKSA 1XD0A 3VD3A 3WKZA 3MU7A 1ZJBA 1LWHA 2E3ZA 2D23A 3W4RA 1QNQA 1VFFA 1K6AA 2W5FA 3GXIA 5TD4A 2QPSA 3ZR6A 2Y5EA 3UERA 4ACYA 4HA1A 4D6EA 5CXPA 1HKKA 5IDIA 1CXKA 2WHMA 1UWIA 3AS1A 2WB5A 1EDQA 1HP4A 1OIFA 3HN3A 3VVGA 4W89A 2JF6A 2CERA 1LG1A 1FH8A 1SMAA 1V02A 1PZ2A 1UD5A 3L4XA 2VMFA 4JZ5A 1G9HA 4M80A 4YHEA 5FD0A 3WUFA 1R8LA 3PTQA 3WENA 1OD0A 1MW1A 2YIHA 2G8ZA 2WC4A 2FHCA 1KCLA 2WMFA 1KQZA 2DSUA 5D4YA 1W3HA 5FCZA 3VIJA 5IHRA 1AMYA 1J01A 4PEEA 1UWRA 2WHLA 2DIEA 2G3IA 1E3ZA 2BV9A 1JF5A 3PZTA 4GZJA 1HIZA 2YOCA 2V5CA 1B3XA 3M07A 1GCYA 1GNXA 3EMQA 5GQBA 1KXQA 3GH4A 2BY1A 5A95A 2WMJA 3BMWA 1CDGA 5IXEA 1JNEA 1OCQA 3L4YA 4GQRA 1SYTA 3GXMA 5D9NA 5AC4A 3VX1A 1ZB5A 1WZLA 1B30A 2VC9A 4Q22A 4PBGA 2WKGA 2GDVA 1GJUA 2BY2A 2BS9A 2XM1A 4QLJA 4N42A 4RL3A 1E4MM 2ZXBA 3WH7A 3QOMA 3WF0A 4GI9A 4B9ZA 1C93A 2VTFA 2G41A 4V27A 5LA1A 4ZXOA 3B9AA 5KEZA 2J25A 1UD2A 2X0YA 3A6OA 1J12A 2YL5A 3KE0A 5CLTA 4IM4A 1JXJA 4RE4A 4F9DA 3W38A 2GUYA 3AFBA 3D5HA 1KR1A 1HJXA 1GVYA 1GHRA 1W9BM 1ISXA 1V3LA 2W61A 4AYSA 3AICA 1OSEA 1TA3B 1BAGA 4H8VA 4AD2A 3WNOA 4LYRA 4W8LA 4Z2KA 4P8XA 1E55A 4B16A 4EAMA 2E4TA 1GOIA 1OM0A 4WIWA 3AS3A 1XSKA 2VJXA 1US2A 5CPTA 3VOCA 4HZ8A 3EMCA 1DWGM 1FP8A 2XFFA 4Z2GA 4NF7A 3VD4A 1QBAA 4AZ6A 1DWIM 1MXDA 2PWEA 1X6NA 4CU6A 4PTVA 1W1VA 1FOBA 2VZVA 4DWSB 3EDFA 4KWUA 1K9FA 7TAAA 4QCFA 3F5LA 2DSZA 3TTSA 1L0PA 2IUZA 2YL8A 3AROA 3ARWA 4OKDA 2XIIA 3SEPA 2PI6A 1WDSA 2GFTA 5A2BA 1PIGA 1RD6A 1UD4A 1XV8A 1FH9A 2D0HA 4GIAA 1JI1A 1XSIA 2G3MA 1IV8A 1Z32X 4BA0A 1BPLB 3F4VA 3EDJA 1IZJA 3WDIA 2VVSA 2V3DA 1R7OA 5D9OA 5CPSA 1EA9C 3RIKA 5M5DA 3BAWA 4B3KA 5A6BD 3GTNA 2G3JA 3L4ZA 4IPNB 4FLRA 1ZBCA 3B9DA 2OYLA 4Z2IA 2J8GA 4W86A 1I1XA 2W92A 1UWTA 5C70A 1E73M 2VRQA 3MUZ1 2VT0A 2DIJA 2WCGA 4BCEA 1Q6DA 3RDKA 4WKAA 4KH2A 3K8KA 1YHTA 5M03A 4IUGA 2OSXA 3WF4A 1JD7A 4CN4A 4D72A 1Y7VA 3WIJA 1LWJA 1OBAA 1C7SA 2WHJA 2D1ZA 1HJVA 4UOQA 2VOTA 5JBEA 2J7BA 4GKLA 3VKKA 1QHPA 4P8VA 4C7GA 3N12A 2YBTA 4CN6A 3PZUA 1W2VA 2ZWYA 4CKQA 2EO7A 5HDRA 4M1RA 7A3HA 1GPFA 3VDBA 1H3GA 3UESA 1C91A 1JG9A 1EDTA 1JFHA 1SMDA 4WF7A 3M7SA 3AMGA 4U33A 3SCUA 3MMUA 3RJXA 3WMCA 5D9PA 4PRWA 1PZ3A 3ZO9A 2W67A 1B90A 5FOOA 3ARTA 4MAZA 2UY3A 4CD8A 2WC7A 4ACZA 1V02E 3HU7A 2IXVA 3AMLA 2PWHA 1JYWA 1ISWA 3SCTA 3OLIA 2XHYA 3ZSTA 3ARXA 2WMIA 4UQEA 1FA2A 2GJRA 3VINA 2J79A 2O92A 2XVKA 3MO4A 4PMDA 2OWCA 4XB3A 2PF0A 4W7VA 3L4UA 5M3WA 2QMJA 3SUWA 1JDAA 5A8OA 5LA0A 4PCTA 3OGSA 1W9XA 2V3EA 3NSXA 5FKYA 5CGTA 2VL4A 2YA1A 1E6XM 3IJ8A 4AEEA 1KFWA 3AS0A 4OJYA 3S6TA 1E6PA 1Q6GA 1HJSA 1QNOA 2DH2A 4DWSA 1K9DA 2BVDA 4Z2JA 1EH9A 1MQQA 3WD1A 3WMSA 3K8LA 1HX0A 2ZXAA 3W29A 4P8UA 4GINA 1CNVA 4PMOA 1PX4A 2HVMA 5LYRA 2VO5A 3PTMA 1CIUA 1VIWA 5IFPA 3WQ6A 5E70A 1GORA 4LGXA 1J18A 3GZAA 3ECQA 1V6YA 3WN6A 3ZM8A 1MQRA 2XWEA 5FL1A 3L4WA 3T08A 2WWCA 2D22A 4LX4A 1QI3A 4D71A 2Y8VA 1NM9A 1E6ZA 3WDPP 5JH8A 1NOFA 1G1YA 3W6LA 4PCSA 1ZBKA 1H2JA 4OIFA 1ISZA 2Y24A 3QHNA 2WLYA 4D6CA 2UY2A 5EMYA 1CGXA 1ZS2A 3VIPA 2VQTA 2YLAA 3ZR5A 1KXHA 2VZUA 1ITCA 2XVGA 1LL7A 3OBAA 1EHNA 1WNOA 5E6ZA 2OYMA 4JHOA 1M01A 1OGBA 4GZEA 3VGGA 2A3EA 1W1YA 1B3VA 1E1FA 2E9BA 4OUEA 1NWUA 3VO0A 4UQBA 2Z1SA 2A3HA 2ZUMA 3N11A 1OB0A 2DPEA 4OBRA 2YLLA 4LQ1A 4J3WA 2ZUNA 2J77A 1WO2A 1H11A 4HA4A 1NWTA 3FY1A 1HXJA 1MYRA 4AZGA 2Z1KA 2YDRA 4X9YA 1TMQA 3KL3A 1HKJA 4AD1A 1WDQA 1E0XA 2WVUA 3SUVA 1C8XA 3SCNA 2CHNA 3VMPA 4AIOA 4AZCB 4W85A 1D3CA 5D8ZA 3W37A 2W66A 2X09A 4CU7A 3W25A 1ISYA 5JUVA 1WZAA 5AC5A 2VI0A 4BQ3A 2GK1B 4D1JA 3AIEA 1EO7A 5I3DA 4QFUA 2J7FA 2QHAA 3LMYA 1WPCA 3VGEA 4K68A 3EYPA 2J8FA 1EIBA 1OD8A 3WNNA 1VENA 1OT2A 2YJQA 2YL6A 1WZMA 3OIHA 5HBFA 4J28A 1OWQA 1E40A 5I79A 1V3IA 3MUY1 2W4XA 4JFWA 4BZYA 2XFRA 4ZEPA 3IANA 2ZUTA 3WNLA 4M56A 3HMCA 4WSJA 3U57A 2E9LA 1VEMA 3VNYA 3AJ7A 3VMNA 5CSYA 3GYCA 3AMDA 2FH8A 2YL9A 3CUIA 3W81A 4WLCA 1GONA 3O6AA 3VDHA 4URIA 4JIEA 3MSDA 3BAKA 1E1EA 3POHA 1QW8A 4XX6A 3BAJA 3T2OA 3TTYA 4YPJA 4D6HA 1W1TA 1EQCA 3KEHA 3WUEA 4UZUA 1MW0A 4AD4A 3ZJKA 2WVVA 3W6MA 4B15A 3BMVA 3VGDA 4PMXA 3U7VA 1P6WA 4CCEA 3BLPX 3VIMA 5I2UA 1JZ5A 2EXOA 1PX3A 3GBEA 1UUQA 5FIPA 1QPKA 3SIMA 4ZE4A 4PTMA 4E4PA 3K4AA 1V3MA 4TVDA 1UD6A 2GJXB 3N18A 4MB1A 3BAYA 4M29A 1D2KA 3PZMA 4CD5A 4MB3A 1H09A 4JCMA 2YA0A 3L4TA 4LXFA 1XH1A 1MXGA 4J27A 1UD3A 1GJWA 2BXZA 4B9YA 2WZHA 3WEOA 2BHYA 4BQ2A 4W8BA 5GNXA 2XVLA 1ODZA 3BXWA 3KL0A 2BY3A 2WW5A 3DYMA 2D3LA 4HMCA 2XYLA 4EANA 2V38A 1A3HA 2QLYA 4GZIA 4H7VA 5DT5A 3FHQA 1EOKA 1DEDA 3VIOA 2O9TA 1V6XA 5BXSA 1JI2A 3NDZA 4J3TA 2ZX8A 3SCOA 4ZFMA 2RGMA 1UZ1A 2BXYA 5BYWA 2BNJA 2ZWZA 4MDPA 3PZOA 5DMYA 3CLWA 3IAPA 2EPKX 4WSKA 2ZICA 4UOZA 4DUWA 1DWHM 1XCWA 1ISVA 4UFMA 4TOQA 1NOUA 1JZ4A 2X2YA 4X0VA 1J0ZA 5DF0A 5I23A 2ZE0A 5A6BA 1JAEA 4WJXA 2FDMA 3OLEA 1E71M 1MW2A 2C0HA 4PMNA 1ITXA 3VM5A 1MFUA 2CBIA 1UR1A 3T0BA 1E70M 1R7AA 4UTFA 1HT6A 3FXYA 3O9NA 1UR8A 1HL9A 2XG9A 2PB1A 4CN1A 4D6IA 5JBFA 1QNRA 2VX7A 3AIBA 1FFQA 1HF6A 1TZ7A 5HXMA 4DWSC 3GBDA 4D6JA 5BRPA 3LPPA 3ZIZA 4W87A 4XUYA 3PZGA 1JXKA 5DT7A 5C8BB 1R85A 4OZOA 5CSUA 1VFMA 4KGJA 4AD5A 2VZTA 3OB8A 2XSAA 3UCQA 1FP9A 3AHZA 1J0KA 5A6MA 1UR9A 1HJQA 2EJ1A 1WDPA 1VBRA 1GOQA 3CZLA 3WDQA 1B3YA 1CXIA 3AHXA 3G6LA 1J11A 4PMRA 2OYKA 4PN2A 2BHZA 1TE1A 2PC8A 1U33A 2MANA 5CJ5A 1FH7A 1UD8A 1HKMA 2ZUUA 3RMEA 2BVYA 1B0IA 8A3HA 1E4LA 1WZKA 1JNDA 2WPGA 5EB8A 1J10A 3IJ7A 4AMCA 1CGWA 5GNZA 4DUXA 1VBUA 1UH3A 1W2PA 1JYNA 3AMKA 2WCSA 3U5UA 2CETA 1QOXA 1J9YA 2GDUA 1KGUA 3WQ8A 3NSNA 3WF1A 2OSWA 1H0IA 1GQLA 4WKHA 1V0MA 4QP0A 1PBGA 4KMQA 4XV0A 1HP5A 4AZHA 3I3BA 1JL8A 1KWKA 3WQ4A 1CZ1A 4MB5A 4ATDA 2DT3A 4H41A 2CBUA 5LA2A 1UOKA 1KXTA 3CUJA 1CXFA 1M7XA 4MJ2A 4W88A 4W7WA 3VTRA 3RPMA 4DM1A 4Y7EA 1WB0A 4AIUA 3WY1A 2E8YA 1EOMA 2HISA 4PMQA 2V5DA 1E6SM 1CGUA 3GXFA 2YDSA 1V08A 1H4PA 3CBWA 3BCDA 3NJ3A 1KB3A 4GI6A 2WVSA 3TONA 2WMKA 2Y8KA 5A6AA 4W84A 4HOXA 1JZ8A 1C92A 2IXUA 1VFOA 1MWOA 4J3SA 1VFUA 1GVIA 2VCCA 3VGFA 2NT0A 3CH9A 3DECA 3BLKA 3VDAA 2VR5A 4HZ6A 2WMIB 1GZJA 1XSJA 2VQUA 3VU2A 3WNPA 1QHOA 1I1WA 1G5AA 3ARSA 3SCSA 3APGA 4PSRA 4N0RA 3GH5A 2PBGA 4AWEA 4DM2A 1BG4A 4PTXA 4JHZA 9CGTA 4OBSA 4D1IA 2OWWA 6A3HA 1KBBA 1Q4NX 2JEQA 2ZUSA 1JGIA 2WVTA 2QPUA 3WDHA 4ZENA 1W9UA 3HJEA 1CBGA 1UKOA 1TFVA 2O9OA 3W82A 4U31A 2C7FA 1UKQA 1B31A 2F8QA 4MNKA 2VX6A 2C8NA 4FK9A 1N82A 5ABGA 2ZOXA 1M04A 1JIBA 1GQJA 2W63A 1PJ9A 1BTCA 4TVUA 3GNPA 3PZIA 3NDYA 3MMDA 3RO8A 2F61A 2VVNA 4M82A 3AHTA 1Q6FA 3MSGA 2DEPA 3EDEA 3MV01 1BYDA 3ZOAA 2EPOA 1OGSA 5E0CA 1W9PA 3VUPA 5KZ6A 3AQUA 3AYSA 3CTTA 1E15A 1JDDA 3TP4A 5JIPA 3BSHA 3NSMA 4PUDA 4UFIA 3U7BA 3CZGA 3RJYA 4GXPA 3VM7A 5AYBA 2J7HA 2JEPA 4TX8A 2WBKA 1OIMA 2PBOA 1WCGA 2YKKA 2J78A 3GNOA 3AISA 2WAGA 3L4VA 1JZ2A 5AY7A 5E6YA 4BQ4A 2AOSA 4AY1A 3ZMRA 3CUHA 3WNMA 2ZX9A 2ZUVA 3N13A 1NQ6A 2VURA 4F9JA 1IT0A 1CTNA 6CGTA 2D0GA 1ECEA 2D2OA 1CGYA 2WCAA 1JZ6A 1NARA 2B31A 1UH2A 2CITA 4F8XA 5CLWA 1XYZA 3T2QA 4J3VA 5A94A 1B1YA 1XH2A 1XGZA 2E8ZA 2VCAA 3CHFA 1V6VA 4JCLA 3K46A 1K9TA 4AD3A 1CYGA 3AXIA 2PWGA 3BSGA 2DH3A 2F2HA 3PBGA 1LL6A 1XC6A 4ZE5A 1E0WA 1BVZA 4J3XA 4AZCA 2OLHA 1H41A 3AXXA 4W5ZA 3ZQ9A 3ZT6A 2JIEA 3W26A 5A6SA 4BS0A 2X0HA 1C8YA 3WBAA 1AQ0A 5BXTA 3AIUA 3BGAA 3DHPA 2ZXDA 4KRTA 2XGBA 4CVWA 3VILA 3FW6A 2WLZA 3AIWA 4MB4A 2J62A 2GVYA 2DT1A 1CXHA 3QR3A 3K4DA 5F7UA 3K8MA 4NSBA 3UG5A 1ZL1A 1GQIA 4PMVA 4JAWA 5I24A 1M53A 1QBBA 2AMGA 5D9MA 2VR4A 5AYIA 3VD9A 3O2LA 4W8AA 3WBEA 3BAIA 3ARPA 1BSIA 3CMJA 5HPOA 1UR0A 1A47A 1LF1A 2XM2A 3MS8A 1LJYA 4M8UA 4CD6A 3AIRA 1E6RA 4AEFA 1TUXA 5CPQA 3KL5A 4QLLA 3RM9A 1TVPA 4FLSA 2GK1A 3OGRA 3F5KA 3WUBA 4A3HA 3AS2A 4M81A 1JYVA 2DSKA 1BHGA 1GOOA 1WAWA 3MV11 3CUGA 5D8WA 1W3JA 1VJZA 3GDBA 1QI2A 1V3JA 1EHAA 4UR9A 4AISA 3WL0A 1W9VA 2UWFA 3W53A 1TA3A 2DT2A 3WH8A 2J74A 3PZ9A 1BQCA 3GM8A 4MNLA 3PTKA 3WH5A 1M03A 1DWJM 4Z2LA 2VZOA 1FHDA 4HU8A 2A3AA 4QAWA 2J7GA 3MMWA 1E3XA 2D24A 3A3HA 2GJPA 1R87A 3A4XA 2AAAA 3GNRA 2TAAA 4HZ7A 4CD7A 1UZ4A 1V0LA 5A6LA 2CNCA 4UFLA 2ZUWA 2VUYA 1MVYA 2WMGA 5JIWA 3NUKA 4H2CA 2A3CA 4TVCA 2NW0A 1CLVA 3ZT7A 3U5YA 1AQMA 4DWSD 4L4OA 3JUGA 1ZBVA 4UCFA 3VX0A 2D0FA 3L2LA 4XZBA 1V3KA 3QOKA 4PMYA 1UR4A 1HVQA 4P8WA 5E09A 5HNNA 3EDKA 3FN9A 2CYGA 1UG6A 1CGVA 3N9KA 1CECA 4RE2A 1GUVA 4XZWA 1US3A 4AIEA 2WNWA 3VIKA 1XD1A 2WSPA 3OA5A 5ABFB 2JIWA 5A1AA 3D3AA 3WELA 2VCBA 1BGGA 4X0NA 1BLIA 2EPNA 5ABFA 1CXLA 3BH4A 2EPLX 2FHFA 3B9EA 2JFEX 1LL4A 1UYQA 1W91A 2CEQA 4JL1A 1NWRA 1DWAM 3I3EA 4MDOA 1GOWA 4B3LA 3AIQA 1E6NA 4Z2HA 1V6WA 1VB9A 1E0VA 1LLOA 1W9DM 4P7LA 3AXHA 3GH7A 3WQ5A 4W5UA 4U2YA 3WH6A 1K9EA 1RP8A 3RCNA 3WFZA 3SCPA 1W3LA 4EKJA 1HVXA 2VRJA 4AW7A 3WNKA 4ATWA 4P7QA 5DFAA 4PMZA 3I3DA 3UR8A 2CKSA 5IHSA 2WYSA 4PYSA 5A3HA 1EXPA 1QI5A 4P7RA 3WF2A 1ODUA 1PIFA 2CKRA 2UY5A 4KGLA 1XH0A 4AZBA 2YDQA 3SCRA 4QCEA 1RP9A 4HP5A 4L4PA 5HPCA 4EE9A 4H04A 3PZNA 4AD0A 5I6SA 4E2OA 3NIYA 1FHLA 1VJSA 4PUEA 3LPGA 3WDRA 3LPFA 4CUCA 2JE8A 3DYOA 2GSJA 4ACZB 4HPHA 1TCMA 1V0KA 3AZSA 1UKTA 2CXGA 3WSUA 1QI4A 2BY0A 1KWGA 3QHMA 3L2MA 3TA9A 1VEOA 3CUFA 2YA2A 1HJWA 4AZ5A 3PZVA 1UKPA 1WP6A 2V3GA 1AVAA 3NCOA 1NWSA 3ZJ6A 4ML4A 1HJUA 5CG0A
chains in the Genus database with same CATH superfamily
3UR7A 2XUCA 4LBRA 5MKGB 2PWUA 1PYFA 3PPFA 2YBVA 3UETA 1RSCA 3EX4A 3TW9A 3M46A 3GXTA 2WPBA 4FN2A 4TTUA 4IQCA 2JKPA 3W7KA 1R9YA 2XSBA 2DW7A 3PZQA 1P5QA 3N1AA 2PTYA 3WFLA 2ZXQA 3T0DA 4RE0A 3CC1A 2UY4A 3GLCA 1H0GA 1C3FA 1EGZA 1J0IA 3MB9A 1KM4A 3SCQA 2QCCA 4S3CA 3IGHX 2V63A 4JTFA 1DKWA 2E9MA 2J9ZA 4DYJA 3UP8A 4BEQA 3SDOA 3BANA 4G9PA 2OFJA 3S9ZA 4N4QA 1H7XA 2WOQA 3W72A 3GAKA 2E40A 2D2HA 3THUA 2HRWA 1IZKA 4F0SA 4HMEA 3PG9A 1DHKA 5ABHA 2FHBA 4LVBA 2FLIA 1IEQA 4I9TA 3EBVA 2OCZA 3H4WA 5AECA 5FF2A 3MT1A 4GIVA 1E9ZB 1IEIA 3T0AA 1Q6EA 1PCKA 3WF3A 1B54A 3WJWA 3VZZA 1LG2A 3M0KA 2NWSA 4ZQCA 3NQ2A 2RKXA 3CASA 2MLZA 4L1WA 1UWSA 2CHOA 3OZMA 1VAHA 2XWDA 2INZA 3ANVA 4LWWA 3URQA 3ALFA 4MSPA 1M7OA 3UA4A 2QW5A 2FZMA 3ARUA 4UQ9A 3UVAA 1P0DA 3PULA 3NQGA 1LUCB 3WK3A 2JK2A 5DITA 4E8CA 2PRLA 4V28A 5HWNA 1IT8A 3FNDA 1P5BA 4J3ZA 3GVVA 2ABBA 3STCA 1NMVA 2CLMA 4GA8A 2GGGA 4HMDA 2C1GA 1UC5A 2ALRA 4HPNA 3NL5A 1EEXA 2HK1A 5E9AA 5EFFA 3DYPA 5FACA 2B7OA 2FB3A 4UTJA 4JKKA 2F21A 2CIPA 2DT0A 1IXOA 1QNSA 1I4NA 4PUJA 1IXPA 1TJ1A 4E8DA 2VEFA 1H7WA 2YBUA 2FH6A 1XPYA 3SCVA 4ZGYA 3NTYA 2FTWA 3W01A 1V51A 1J0JA 5CZKA 4AUBA 3VE7A 3EOEA 2Y8UA 3T4WA 2GQ8A 3W87A 4L4MA 4O28A 3UF8A 1UWUA 3W73A 4O1AA 4PMUA 3U2EA 3H2FA 2WC3A 4UQDA 5C71A 5A8QA 2JALA 3QBUA 4UFJA 4BKNA 4REQA 1GTHA 1E72M 4ICCX 2A3BA 3TJXA 3T78A 5I3FA 4FS9A 4PULA 4LUIA 5IFTA 2A1YA 2WZEA 4IMEA 5HJXA 1JZ3A 3B04A 2WM0A 3H53A 2ZX5A 1X6LA 1NOWA 1NU5A 3C4UA 3OQEA 4FLQA 5ABEA 1OCBA 2PDPA 3W2JA 2GGHA 3M43A 4H8UA 4PTDA 2CBVA 1NSGA 2AQWA 3MANA 1A4MA 1TZZA 1JF6A 1EUNA 1T99A 1W8SA 1MQPA 3CK5A 3CWNA 4I8YA 2XGIA 4BF8A 4DYEA 1KTBA 1SO3A 3S2MA 4FO4A 2VN1A 1EQPA 1FKDA 3DDMA 1R86A 3P14A 1ZJHA 2WMHA 3M0HA 3RU8X 2ITKA 1RJRA 2B4GA 2V5JA 4C6JA 4A3QA 1HNYA 3VPLA 4IOTA 3TMQA 3QY7A 1U30A 1OCNA 3CH0A 3BOXA 1GOKA 5A69A 2ZRUA 1AZ2A 8XIAA 1WXYA 4CCCA 2VZSA 1F40A 4FLOA 1HW6A 1NELA 3RILA 1BF2A 3EB4A 4ORMA 2RH9A 2FGZA 1JDCA 3CGTA 2RDTA 5DEZA 8CGTA 2ZX7A 2ANUA 2NV1A 2EAWA 3LXAA 3CGNA 3GU2A 3OIXA 4AXKA 3L0NA 1FFRA 3O15A 5J6EA 3QGVA 1XCFA 3T07A 1R3RA 2W62A 3LHTA 3WD2A 1RALA 4NZCA 4GGQA 1WDRA 4JTKA 3S0CA 3QW4B 3IAQA 4O1FA 3IK4A 3QZEA 2ATMA 3WDJA 4F2UA 2NVAA 1LQ2A 4BY3A 1VCFA 2VHLA 2VCDA 3P8IA 1FKHA 3P5ZA 1XLHA 3B0VC 4DB7A 2Y7EA 1X1OA 3W1TA 2AAMA 3MZ2A 2WZMA 3E12A 4GCAA 3PTDA 2NQZA 1O60A 3IVUA 2WZIA 3MUAA 3CHCA 5AKQA 2OLSA 3O5LA 3O06A 3WJZA 4YTSA 2C13A 2Y6ZA 4WY0F 1FWSA 4LYPA 4ERGA 5LIYX 3UYIA 3RM4A 3TAOA 1VHCA 2E68A 4P7OA 3ZVIA 2GJXA 1XLDA 4CEUC 4YVXA 3M0IA 2C14A 1KBKA 4DF2A 4JN6A 4WKFA 4C5YA 4KW2A 5D03A 4CGTA 3ONCA 4KETA 1Y5VA 1N1AA 4US6A 3CB3A 2EF9A 1P0KA 1ZENA 3T0TA 1HG3A 5ECUA 4OOUA 3ARRA 4XZLX 1KXVA 4GI8A 3TN3A 3BICA 2H90A 4GWEA 4UXDA 1SFTA 3S8HA 1Q6LA 4JDBA 4W7UA 3UEQA 4EACA 3QJAA 3AZRA 4W93A 5BXJA 2VEKA 3UQAA 4C5ZA 3P81A 4R27A 3CAKA 3DN5A 3GIPA 1VFTA 3S3GA 3FAWA 3GNNA 1PKNA 3QSRA 4NYYA 1NF7A 4UQAA 1E4IA 3EPOA 3KAHA 3WQVA 2E67A 4NJIA 3W24A 3MCOA 5F1VA 4IPLA 1AW2A 3S2JA 2HROA 2OELA 4FHAA 2Z6JA 4U5IA 4XK2A 2DDXA 3UJFA 1FWAC 2CPUA 2BMBA 1H5VA 2QV4A 3PUEA 3FA5A 2QPXA 1UKSA 1XD0A 1JCLA 3MU7A 3KTXA 2R6OA 1PSCA 1WX0A 1QNQA 4Z08A 5G4HC 1VFFA 3KWSA 5HANA 4EF9A 2GOKA 3ZR6A 1T8QA 2WNNA 2HDJA 3UERA 4FOJA 4ACYA 3LUTA 4D6EA 5IDIA 3KBJA 2HJPA 1HP4A 3I7SA 3HN3A 3VVGA 1KKOA 4LOCA 1LG1A 1FH8A 1SMAA 4HYRA 4YWIA 4IT6A 1PZ2A 3NR0A 5LIXX 2PDMA 4DO4A 2I9UA 3FCPA 1KM0A 1PKMA 3IV8A 1R8LA 4LTSA 1MW1A 2YIHA 3QV6A 1KCLA 4RK8A 5G1MA 3VFCA 1MO0A 4LUTA 4KRZA 3MC5A 3DFTA 1UWRA 3PRBA 4QG9A 2WHLA 4RR4A 2UBPC 2G3IA 4ZQRA 2Y78A 1QK0A 2BV9A 3PZTA 2YOCA 1B3XA 2DZPA 5GQBA 2XP3A 3EWWA 1KXQA 2P50A 4ZB2A 3H12A 1U5VA 2KE0A 3Q45A 4GVHA 1KRMA 2L5HA 3VX1A 2PDUA 4I9MA 3GTIA 1YDNA 1FXPA 3L12A 4AB4A 2R1MA 3C3UA 4UMBA 3H24A 4A8RA 2A7PA 4U84A 4V33A 3O07A 4Y9AA 2J25A 3IKDA 2PF8A 2ISFA 5A5WA 5H6HA 3ITOA 4R9XA 3INPA 1JXJA 4RE4A 3PS7A 3BOFA 4MG4A 3MYPA 4AY8A 1TJRA 3VFLA 1GHRA 4CQ8A 2X7WA 3UYCA 4MY8A 4MSSA 3AICA 4QTGA 4LAOA 4L6HA 3WNOA 1VFLA 4Z2KA 4UWMA 4WY0B 1OZMA 5HK4A 1XSKA 5HATA 1US2A 5CPTA 4IX0A 2BDQA 2PSNA 3O5EA 3RITA 2GQ9A 2A7NA 3V0SA 5AHMA 1W1VA 4LAXA 3T81A 2VZVA 4DWSB 1K9FA 5G2HA 4O19A 3VKJA 7TAAA 3TWAA 2DSZA 3IUDA 1DJZA 4OWGA 3TTSA 1W1IE 5HWMA 4O1BA 4R7JA 2YL8A 2OOGA 3UJ2A 3HZ3A 4QJ4B 1WDSA 3N2CA 3QY6A 4S23A 4NU7A 5HR6A 2XFWA 3B8UA 2EKCA 4NG3A 1QMLA 3KUMA 1XSIA 2G3MA 4XBSA 1GZGA 1IV8A 1F07A 1F73A 1Z32X 1DL3A 1ZAIA 4BA0A 2RUSA 4GUJA 2FMOA 3WO8A 1LUCA 3F4VA 3M6YA 3EDJA 2DG9A 1IZJA 2V67A 1L2QA 4GFSA 2PDBA 2PDGA 3APTA 5CPSA 1EA9C 3RIKA 2OB3A 4AIBA 3IIXA 3GTNA 3PK7A 4IJBA 5AC6A 1FKSA 1M6JA 4IPNB 1V79A 3B9DA 4IL0A 4I90A 2OYLA 4Z2IA 3NZGA 4Z0SA 3PC0A 4MUPA 3FJ6A 1UWTA 2YCLB 1MUCA 5C70A 1FKKA 5HW8A 2OEKA 3JVAA 3BV4A 1Q6DA 4KH2A 3K8KA 1XIBA 3WF4A 4GNVA 4MFEA 1NMWA 3NA8A 3TE9A 3HQOA 1FKIA 1BTMA 1XFBA 3GYEA 3ITGA 4GI4A 3C6CA 1UP3A 3WIJA 2BGQA 3VAVA 4IHCA 2VOTA 1LP6A 4GKLA 4JTEA 2GOUA 1YKWA 2FB2A 3RFAA 4NJJA 4NUWA 3GK0A 1W2VA 4CKQA 4MVAA 3B0PA 4MOZA 3VDBA 4KKXA 1UUOA 1JG9A 1EDTA 1SMDA 4ODKA 1MEHA 1XIGA 2PGRA 5CSRA 1EKOA 5G1TA 4ZPVR 3ANYA 4M51A 4NZJA 1P43A 4KEUA 5D9PA 2D9FA 5CKSA 1AL8A 4Q6JA 3ZO9A 4QX4A 5FOOA 1DORA 5HUOA 3ARTA 4MAZA 2UY3A 3HU7A 3N9SA 1HO1A 1SJCA 1XRSA 1ZY9A 2KX9A 1TRDA 3AO0A 4CQCA 1XX1A 3PA7A 1ISWA 1KRAC 2W6RA 3FYOA 3LK6A 2PDNA 3ZSTA 5ENLA 2XPAA 1XIFA 5FI8A 3VINA 4IPJA 2ZZ3A 4RNFA 4PMDA 2Z1XA 2ISDA 1GEQA 1V77A 2QMJA 3URAA 5I06A 4PCTA 3OGSA 4H6KA 1UR3M 2XN1A 5C6MA 3DG3A 1Q6GA 1EP3A 2DH2A 3EWXA 1KBIA 3URBA 3NOYA 1PS9A 3QYSA 1RQBA 2PDCA 5CC6A 2QAPA 1VRDA 1MQQA 4B5NA 3ONBA 2EPHA 4L6OA 3WMSA 2BVWA 1VYPX 1V7AA 3LB0A 1BKHA 4NZ4A 3R8GA 4L56A 3SIZA 4JFIA 3VXGA 1PX4A 2DZSA 3GVWA 2JZVA 3FYYA 2VO5A 1KM5A 5IFPA 3WQ6A 3KCOA 1GORA 1QATA 2X1TA 1ZTVA 1BKSA 3RX3A 4LB4A 1NIUA 1V6YA 1Q5MA 3HV8A 3WLMA 1MQRA 2GSHA 3T6CA 3O5OA 2FKPA 5F4WA 3E0WA 3KCEA 4D71A 1L6SA 2Y8VA 1NM9A 1CCWB 2HK0A 3W6LA 2KR7A 5B80A 2CU0A 1H2JA 4OIFA 4PEKA 3NQCA 2WLYA 3RLUA 2UY2A 3CQJA 1SSGA 3VIPA 2VQTA 3ABQA 3BLEA 1ITCA 1AODA 3OBAA 1EHNA 1MEIA 3UZJA 1M01A 1W5PA 1W1YA 1B3VA 2E9BA 1NWUA 2F23A 4FIQA 2PPOA 4ZO8A 1OB0A 3EX1A 1H11A 1J8VA 1A80A 4KPLA 2VFGA 3SRHA 3RK8A 3FY1A 5HW7A 2XIQA 2Z1KA 2YDRA 1LOQA 1HKJA 4AD1A 1OZQA 1WKEA 3SUVA 1C8XA 3NGJA 4AIOA 4AZCB 5FF7A 3UG8A 3KOFA 1RA0A 3WLSA 1A0CA 2W66A 2X42A 5JMUA 4UB9A 3S1VA 4IQ2A 3GIYA 4ILSA 3LXCA 4D1JA 1EO7A 4RX0A 1WPCA 3EYPA 2VELA 1W1A1 2PDQA 1EIBA 3Q94A 2YGYA 3BCJA 4QJ5B 3LS9A 4ODNA 4RUBA 2DZUA 4BJHA 1H7OA 5BMWA 4ZEPA 2ZUTA 4QQ3A 4M56A 3HMCA 4ADSA 3U57A 1Q6IA 2ZFAA 3JW7A 4NJHA 3QZAA 3VMNA 3R7MA 3AMDA 2FH8A 4JQAA 4DRHA 3W81A 4GK8A 4URIA 1RCOB 2HBVA 3A4JA 3BAKA 1E1EA 3BVJA 3POHA 1OFRA 1VC4A 2B7PA 5D2XA 4XX6A 1QPQA 3PUGA 3V5FA 4LF1A 1OC6A 3XIMA 4JFMA 5E0KA 4ECLA 1X97A 3VGDA 3G5EA 2WM1A 4CCEA 3BLPX 5I2UA 1JZ5A 2EXOA 3E3HA 1L2UA 3M0YA 2Y0FA 1RQEA 1R3QA 3KHJA 5FIPA 3LRMA 4TVDA 4C1KA 3N18A 4L7ZA 4MB1A 1XIIA 4M29A 3REQA 2XH7A 1D2KA 2DZTA 3UCCA 1FWNA 1H09A 1J6PA 3TWBA 5AZ1A 4LXFA 1RCQA 3WBXA 2C6QA 3MDUA 4WHBA 1ITQA 5C7VA 3GXNA 4ZPTR 2QDHA 2BHYA 4W8BA 4IUOA 4J9JA 1ZHAA 4HMCA 3R0KA 4O15A 1A3HA 3ODKA 4NAFB 4H7VA 3ME3A 2BOGX 2O9TA 4J3TA 3G8RA 3LM3A 2XIOA 3SCOA 2XGZA 2RGMA 1WUFA 2BXYA 3WFAA 5BYWA 2FGBA 2I1OA 1G69A 4MYXA 1MDLA 4WSKA 4W9TA 1FHUA 4UFMA 5C2CA 4TOQA 2C0AA 3I4EA 3O1NA 1LT8A 4ODQA 2YB1A 4X0VA 5DF0A 3N2BA 4JTGA 1RHCA 3QV8A 4KCVA 3MY9A 4Q3MA 2YCLA 2FVKA 2AL2B 1MFUA 3FVDA 1R6WA 3G3DA 1R7AA 1HT6A 3DCPA 2OKTA 3TYDA 1UR8A 3TC5A 4C6BA 4AX6A 1IE7C 3IIVA 3RF9A 1QNRA 3E2SA 2PZ0A 4GLEA 4EPEC 1HF6A 1TUFA 3KFTA 1XS2A 4D6JA 4LS0A 4Q8NA 4LVAA 4XUYA 5DT7A 3MQTA 5C8BB 5CC7A 1CB7B 5FJRA 4OZOA 4O0ZA 4QISA 4AD5A 3GY1A 4FAMA 1RPXA 3OG3A 3W9ZA 5A6MA 3KACA 1VBRA 1GOQA 3CZLA 3B0UX 3WDQA 3L7RA 3W83A 1KCXA 3PF3A 4LNCA 1UP0A 4PMRA 2IQ0A 4MJMA 1TE1A 4B3ZA 1U5HA 3KDOA 2BVYA 2PLCA 1UJPA 1O95A 2BSLA 2VEIA 4WGXA 3TW6A 4AFYA 3IJ7A 1OVDA 2GJLA 2NLIA 2OVLA 3MJYA 5GNZA 3ZVHA 4YCOA 4UTMA 4IPXA 1GQNA 1SUXA 4K37A 4PCFA 1YDVA 2WCSA 3U5UA 1QOXA 2A2IA 3DI1A 4WDUA 3WF1A 3W74A 4JEQA 1GVSA 4K36A 2BXVA 1RK5A 3WLPA 1XDLA 1PBGA 2VEMA 4KMQA 1YMYA 5C0QA 4MB5A 3MCMA 5LA2A 1D7KA 1UOKA 2GJNA 5T26A 3O5GA 4GUGA 4IMDA 3UWQA 3RPMA 4DM1A 3TEVA 1EOMA 1K3UA 1CGUA 3DUGA 3IRDA 3UCDA 3GXFA 2GVLA 4GVFA 2YDSA 3H54A 1VHNA 2OT1A 1YPIA 3CBWA 4YTRA 2OXNA 3SSZA 4NNBA 2C91A 4GQ0A 1LT7A 1W8GA 3W7CA 1S2UA 3IJLA 3KLKA 2WVSA 3NOEA 3TONA 3V5CA 3LBOA 1MWOA 1ZK6A 1TX0A 2NT0A 1OK4A 3DECA 5D75A 2QVNA 4CNUA 3C0QA 3VU2A 2VQUA 4KBXA 1QHOA 1S5WA 1I1WA 1PCWA 3IGSA 1G5AA 5G5IA 3VOHA 1QNVA 4QDPA 4PSRA 1UZHA 3AC0A 1DBTA 1BF6A 5F4SA 4CQBA 4RNHA 4AWEA 3CIWA 4PTXA 3F1QA 4JHZA 3BW3A 1BL4A 2V81A 1C29A 1F3TA 2OWWA 5HJLA 4YJ5A 5I3JA 4PC8A 3KZPA 4LVFA 2XH0A 4K39A 3WDHA 2BX7A 3HJEA 1TV3A 1DPMA 2O9OA 4DXKA 2G96A 1UKQA 5AYZA 2QUTA 3VKBA 2C8NA 1VFSA 3NFUA 2PCEA 2ZOXA 3S6DA 1JIBA 1Q4WA 1PJ9A 1A5MC 1BTCA 3B06A 7REQA 5I3GA 3NDYA 3ZYZA 2F61A 3QH2A 5MKGA 3MSGA 4LAZA 3ES8A 4A22A 3MV01 3KP0A 4J40A 5E0CA 3AQUA 3KRZA 3TXZA 5F1UA 1T5AA 4RV3A 3NSMA 3PRDA 3WQOA 1CB2A 2G95A 3CZGA 3RJYA 4J4OA 4HZMA 4AVFA 1JCNA 3WQFA 3NURA 3TH6A 2XN2A 1PIIA 4G56A 1XLAA 1JZ2A 5C5YA 1D9EA 3TYZA 1FAPA 3JRKA 3CUHA 3CLMA 4I6KA 1XFCA 3H55A 4F9JA 1IT0A 3FIGA 3QSTA 4HNTA 2O7SA 4HHMA 4I7VA 1V8EA 2B31A 3GUGA 3MHGA 4F8XA 4QR6A 1XYZA 4DO6A 1D7HA 2JGYA 3I6EA 3CYVA 1XH2A 3HPZA 1XGZA 2E8ZA 4G50A 4AMAA 4A21A 4Q4KA 3CHFA 1FJDA 4AD3A 1K8CA 2Y70A 5LXXA 3AXIA 2F2HA 3UWEA 3NL6A 3PBGA 1XC6A 1BXNA 3H70A 3SFWA 4W5ZA 3ZT6A 1HL2A 3QPEA 3W26A 3NQVA 1SZRA 2X0HA 1C8YA 4LCRA 3EPMA 2ZZ5A 5BXTA 3AIUA 4CVWA 2ZXDA 4KRTA 2QXWA 1MUWA 3FW6A 3L2IA 3NL2A 3CWHA 3A21A 1EC9A 4C6KA 3QR3A 1SVDA 3I6CA 2E6AA 3GTYX 4H3DA 2VD9A 4ROQA 1I2RA 4JAWA 2QGYA 4M7TA 1MI3A 5I24A 1TJ0A 4P5UA 4UUIA 3HMJG 1M53A 5CPLA 5D9MA 1DJGA 1AD1A 3VD9A 3O2LA 4Q33A 4ZQMA 1BSIA 3EEGA 3O6DA 1A47A 1WXZA 2XM2A 3IARA 2YXOA 4CD6A 1QAPA 4XZHA 1JR1A 4QLLA 4V1YA 3W1RA 1AJ2A 1M1BA 1TTIA 2GK1A 3R6IA 1IYXA 3WUBA 4AHOA 2J8TA 4A3HA 4I7WA 1K7XA 4M81A 4JFJA 1Q8AA 3TSMA 2J24A 1BHGA 1GOOA 1OX4B 4CNPA 4U86A 1W3JA 2DZBA 2PLMA 1V3JA 3O8AA 4UR9A 3W1MA 3WL0A 1W9VA 6REQB 2ZR5A 3OOBA 4PGLA 3HFTA 4MNLA 1X6UA 1B57A 4DI9A 4Z2LA 3QFEA 3I68A 4QAWA 4ZA0A 3MMWA 5CC5A 1E3XA 1EWEA 4A05A 3P5YA 1FKFA 2DV0A 4DZ2A 3W2LA 3D6NA 4CD7A 2XP7A 5A6LA 2QJHA 1QPFA 4UFLA 1YBQB 2C19A 1MVYA 2PUZA 2WMGA 3NUKA 5JIWA 3E2RA 1KT1A 4O54A 4Q32A 2BOEX 4B5SA 4D8ZA 4JBRA 1AQMA 4UCFA 3L2LA 4K1WA 3L0KA 4XZBA 1V3KA 3M0XA 2X40A 4JQ2A 1QJWA 1G4PA 5HNNA 5DN1A 3THQA 2ASHA 3SI9A 3QQ1A 3DBNA 1P0BA 4LT9A 3ID7A 1F3XA 3N73A 4K8HA 4DJED 4QZVB 3R12A 3HOJA 1XD1A 4WOZA 2ZZ4A 2GQ3A 3WELA 4LUTB 4X0NA 3SQMA 3EX6A 2FHFA 3B9EA 1UYQA 4L65A 2CEQA 4IL2A 3DC8A 3NWRA 2VDHA 1NWRA 2UV8G 1DWAM 3I3EA 4O52A 4OV9A 5LHFA 4MMWA 4WCJA 2QYGA 1E0VA 3AXHA 3GH7A 1W26A 4W5UA 3WFZA 1N55A 1AW1A 1W3LA 1VS1A 4AW7A 7ODCA 5DFAA 1IWBA 1XXXA 3UR8A 4F2TA 3NM1A 3EB3A 1Z7AA 3WLJA 1OYBA 3SQLA 4P7RA 1Z41A 1ODUA 3DFYA 3HTWA 3KVKA 3DG6A 4FI4A 2YDQA 4MHBA 1S2WA 3U2CA 4H04A 5JXQA 3NIYA 3WLHA 1TV8A 3HGRA 4QEHA 4PUEA 4X9SA 4N6EA 4K38A 4MWAE 3SBFA 2ACUA 1ITUA 3H9RB 4HPHA 2OX4A 2CXGA 3WSUA 2BY0A 5EU9A 2XZ7A 3USZA 4AZ5A 3PZVA 1TX2A 4DJFC 1AVAA 1JNTA 2OU4A 3DX5A 5CG0A 3V36A 3PJWA 1QPOA 1YQ2A 4L1XA 5D05A 4DLFA 3PB2A 3GU9A 3T0CA 2IPWA 5JU6A 1E5NA 4JHMA 2HVNA 1B2YA 1BFNA 1I75A 2X8RA 3FA4A 3OZPA 1BXCA 1DJXA 1E1CB 1GEHA 3JZUA 1NH6A 3U4FA 4FMVA 2CZVA 2ALDA 4WXYA 1LWIA 1J4HA 4AZIA 3E0IA 2QDGA 3QPZA 4GNJA 4DBUA 4HBKA 2MNTA 1Q7ZA 4JTUA 1OY0A 5CCZA 2E0PA 1MRAA 4QLKA 3W1PA 3HGJA 2WJFA 3EWBX 3BK0A 3VNMA 1J6YA 2XIBA 3LU2A 4HHLA 3TTOA 4X63A 3LSCA 3KTSA 3EB2A 4H8HA 4Q7BA 4JIPA 1VLWA 3AI0A 1PINA 4Q4OA 1QNPA 2W0UA 1SQ7A 4L61A 4ZO6A 1WQ5A 3UG4A 4R53A 3N15A 3KTCA 1ESWA 2KZHA 1PPIA 4HNUA 2Z2UA 3ES7A 1DIDA 2A4AA 4GH3A 4V15A 1R38A 4D6FA 3TZFA 3C0JA 4NX0A 4ZPWR 2ZZ2A 5C7HA 2ZIDA 3LD5A 3ZJ7A 4S3FA 3CZ8A 2Z2BA 4PCPA 5LKYA 4Q8MA 5KZDA 1CGTA 4L6DA 3QHOA 3A4AA 1NFBA 2CESA 2A3LA 9XIMA 4ZTYA 2DSWA 4MNMA 2REQA 3W88A 3G22A 4EK7A 3O05A 4TTGA 1JD9A 4EAYA 5D38A 1NSJA 4A8NA 5JVLA 2JF7A 2P1FA 2XPKA 3SURA 1XYCA 1G4SA 2JBMA 3ORWA 4NY2A 4CU8A 2CBJA 5FL0A 3KAOA 3N04A 3ZWTA 2HEJA 2PWDA 3CUZA 2Z25A 3S2LA 3DHUA 4M7SA 5I0DA 3VGHA 4YVPA 3FJ4A 1OINA 3IJ9A 3A64A 4EPBC 3ARYA 2P53A 1NQKA 4I5UA 1UWQA 2VFIA 4ZBCA 5E0FA 2H6RA 4ZOEA 1KR0A 4HOZA 2AMXA 2X1IA 3T09A 3PR9A 2B7NA 4MPKA 1GHSA 4BWLA 2FVLA 1BWLA 4C7FA 4ZSUA 5FSDC 7TIMA 4PL1A 3TTEA 4AZ7A 7CGTA 1EP2A 3WEMA 3P80A 2XJ7A 1UASA 3IKGA 3CZKA 1VIZA 4HSNA 3LGEA 1SU5A 2C3ZA 3BOLA 4MADA 2QF8A 5AB3A 3G1AA 4S3GA 5HNRA 3V3WA 1G7UA 3M4HA 5FJOA 1PAMA 2OWXA 4IG2A 2REQB 4B4FA 1C90A 3I10A 3EZ4A 1K8ZA 4KFOA 3N29A 3V18A 4FALA 2PTXA 4HYVA 4WK9A 1DJYA 1R2TA 4DUVA 1UA3A 3KAIA 3LA4A 5SWUA 2RAGA 3LENA 3CAVA 1YNYA 3ARVA 3PBVA 1YE6A 1ZJAA 1HKIA 2CLPA 1Q6CA 2QCHA 4GQGA 4JIQA 3V1PA 3KBSA 4YHGA 3TTQA 1S2AA 3NQ8A 4NYUA 2HV5A 5JH2A 2ADAA 3E1F1 3CS2A 1VF8A 4HNNA 3E0FA 4G7EB 2FZBA 1SR0A 2VFHA 1B9ZA 3QF0A 2QCDB 1PWLA 4I8DA 4P7NA 2TODA 3WX7A 4UTLA 5I09A 4HOWA 4H1ZA 2EQDA 1W3IA 1REQA 1AG1O 5DO8A 3LNMA 4U10A 2J9YA 5EMMA 2WXDM 2DGAA 1UQYA 2BFGA 1WDWA 4XZIA 2NQ5A 1JAKA 4XD6A 2GQAA 3RFWA 1J6OA 4A8LA 3UWUA 1GVRA 2V3FA 1OGGA 1TWIA 3M6DA 2VWSA 5EY5A 3A3XA 4CLMA 2J4GA 3J7HA 3H2AA 1LRTA 2Z28A 4JFTA 5BROA 3A47A 3BGJA 4LF2A 3R89A 1GOMA 2R8WA 4LY8A 4BF9A 2XH4A 4JFLA 4J7RA 3GU1A 1TRIA 3OBEA 1L9WA 3FDKA 2W3ZA 1TV7A 2YYUA 3APYA 3KHDA 3SGUA 1TKKA 2QKFA 4LPCA 5PTDA 3OLDA 4B5VA 1IF2A 3W0KA 1S46A 4JX6A 2IW0A 1J5SA 2AKZA 4HVXA 3KAFA 2BHUA 3KOWA 4IQDA 1D8CA 4GISA 3TU9A 4EXBA 5BRBA 1M5WA 2NZLA 4L1GA 3S9IA 4F0KA 4QM1A 1EA0A 3MUCA 1LBMA 3WQWA 1W1B1 3TLLA 4I9JA 4Y8EA 3DFHA 1VYSX 4EPKA 1WE5A 1AQHA 3ARQA 1I2NA 3P0WA 1GJPA 4OVXA 4FPSA 1C9DA 4ATLA 1QDSA 3AMCA 4LUSA 5AHLA 4H7CA 1KCKA 1QVBA 3N14A 1JZ7A 4IISA 1JVNA 1GYNA 4J3UA 1W1PA 3N3TA 3MP3A 4N4PA 4E2BA 5A8NA 2E1WA 3NPVA 2NSXA 1OFAA 3B97A 4E8GA 2Z2AA 5LNWA 2W27A 3PN8A 4I7UA 5CZJA 3OZOA 3DESA 3A4WA 2CLLA 3UWYA 3SUTA 1SR9A 3QPYA 5CZSA 3VNIA 4B2DA 1HN1A 2Y1HA 1PEZA 4H6QA 1TV5A 3G2GA 1ZU8A 1S5MA 4YYCA 4YS1A 2GLKA 4L9ZA 1G01A 4D6DA 2QJMA 1IIHA 3IUIA 1B3WA 1MFVA 1TTQA 1EXBA 2WWDA 3WBYA 3TYEA 4DX3A 1XCXA 4UTUA 4F0LA 2KAUC 1TR1A 1V3HA 4GPNA 4MJ4A 4FNPA 4DNHA 3ZR4A 4O8AA 1U1UA 3IVTA 4NRSA 1QWKA 3MTWA 1WV2A 1XYMA 2R94A 3N6JA 1ONRA 3RXZA 1R9ZA 2ONEA 2KI3A 3RX2A 2VRKA 1LLWA 4UFKA 3N2OA 3BE7A 2PRHA 3NYDA 5C9ZA 2GUUA 4WJEA 1XBYA 4GIRA 4XKYB 1UIPA 1SZFA 4LALA 1FD9A 2EKGA 1JYXA 4U2ZA 2NQLA 3IGXA 2WHKA 3W7DA 4M19A 4HA3A 1VEPA 2VDIA 1C7TA 1NP2A 5JBDA 3T42A 5C9UA 3U2OA 4PSPA 4JNYA 5AN7A 1TYGA 1TIMA 4M24A 1MW3A 3TYCA 3OG2A 4Z1BA 3WLNA 3P6LA 1E56A 3DU0A 4JR5A 4LBSA 1PB0A 3WKZA 5H8UA 1GZ1A 2DVTA 3NQFA 3QZ6A 1O4UA 3URNA 4C02B 5H91A 1FKBA 2E3ZA 5K4XA 3W4RA 5I3HA 2W5FA 3GXIA 5TD4A 5T8GA 3G0XA 3CV1A 2FFCA 2Y88A 4AF0A 3QLDA 2MLXA 4HA1A 1EF3A 1CXKA 1IZCA 3SFKA 1OFDA 2NX9A 4W89A 2JF6A 1Q85A 2CERA 2QUUA 5LHEA 1UD5A 2VMFA 2ABAA 1QOQA 4MWAB 4JZ5A 1KTNA 1G9HA 3CJPA 5FD0A 4Q4RA 3PTQA 4HHPA 3WENA 1OD0A 2E6DA 2G8ZA 3BMBA 2WC4A 4UNLA 2SFPA 3P82A 3NAVA 1W3HA 3VIJA 2E5DA 2IKHA 1J01A 3NDOA 4RDVA 3BTNA 4NXSA 3OTRA 1HXVA 3BJFA 4GZJA 3WJXA 4Z1CA 3EKLA 4LUSB 3EMQA 2NQJA 4NNAA 2D69A 2WMJA 3W1QA 3ABRA 3NM3A 3CV7A 1MEWA 1Y8BA 3L4YA 5FJTA 1KLYA 1SW7A 3FVMA 2OEJA 2A7RA 3GC5A 5CGQA 1H51A 1AQFA 1OABA 1ZB5A 4HQVA 1B30A 4Q22A 4HBOA 2WKGA 2GDVA 1GJUA 2BS9A 3WLQA 4QLJA 1O5XA 4N42A 1ZCCA 5FEPA 3QOMA 4OV4A 5LA1A 1ADDA 1C93A 2VTFA 3SN1A 4IP4A 5KEZA 2BG5A 4LB3A 2X0YA 1Q65A 4K6AA 3HURA 4XTIA 4JYDA 1S5TA 3A6OA 1J2WA 2WNQA 1ONWA 2V9DA 5CLTA 4IM4A 1JUBA 1RBAA 4O17A 3W38A 1PTAA 2V0TA 4N9BA 1HJXA 1GVYA 2POTA 3LERA 1Z69A 1ISXA 1V3LA 4AYSA 3PSVA 4AD2A 2PS2A 1GPWA 3QQ0A 4P8XA 1E55A 4EAMA 5FEZA 1Q6RA 3MI2A 1A3WA 2E4TA 1OM0A 4F0MA 2NUYA 2QT3A 3STGA 3W2KA 1VP5A 4IIDA 3W07A 4G2DA 3VOCA 8RUCA 4DXXA 3GDKA 3E0VA 3VD4A 3AU2A 1X6NA 4YWSA 3A5FA 2BLEA 2A85A 5LNRA 4DH0A 3EDFA 4GH1A 1IT7A 2Z24A 4NP7A 4JYSA 3EY6A 4X2PA 4IQJA 1L0PA 2IUZA 5BWAA 4G7FA 3ARWA 2PV1A 4GABA 1H1YA 2V82A 4ZOCA 1VKFA 3O3RA 2RDXA 5FA5A 1B4KA 3OODA 1LRQA 1ZALA 4G5DA 3B4YA 3G0SA 3KBNA 3WDIA 5T9CE 3LV5A 2V3DA 2OZ8A 1R7OA 2E7FA 3LHUA 1K7EA 5A6BD 4HK7A 1FXQA 2QDEA 3L4ZA 3V1HA 2OGJA 4POCA 2NWRA 1Q7QA 6REQA 1H7RA 4HB7A 2ZZ7A 1PDYA 2X0SA 4IG2B 4KERA 3LCWA 4LAVA 1I1XA 1E73M 4BCEA 3RDKA 1YHTA 5M03A 3IJ6A 2OSXA 3QV7A 5F2IA 5D37A 2PDLA 2TMDA 3LCIA 1LWJA 3DAQA 3R2GA 1BXBA 3H2MA 2WHJA 4UOQA 3VZXA 6XIMA 4PUMA 5JBEA 2NUWA 4P8VA 2YBTA 5GVJA 4FEZA 7A3HA 1LM1A 3UESA 2G97A 4IFRA 1OEPA 2VENA 2NSOA 3M7SA 3E74A 3DGRA 3SM0A 2ZQTA 1TZ9A 3NEHA 3SCUA 3DFOA 3MMUA 3WMCA 2TSYA 2NVCA 2RDUA 3KCJA 3BURA 3VABA 3KRBA 4PMJA 4KQZA 2WC7A 1TMHA 1HZYA 3TYUA 4LH8A 3SCTA 3OLIA 3ARXA 3E5BA 4LFYA 4UQEA 1FA2A 2J79A 2XVKA 3CM4A 3LBCA 4UIOA 2EG8A 2E09A 2ZQSA 3P60A 2OWCA 4JX5A 4DBEA 2BBFA 5M3WA 3SUWA 3VOGA 5LA0A 1DOSA 6ALDA 1W9XA 1IEVA 3BL3A 1XBVA 5CGTA 2VL4A 2YA1A 3IJ8A 4AEEA 1KFWA 3AS0A 4OJYA 1QNOA 4DWSA 3CV6A 5E5CA 2BVDA 3ITVA 4JTHA 1XLFA 4FNQA 1EH9A 5IM51 3TXVA 3K8LA 4IQLA 4P8UA 1VD6A 3P8JA 4GINA 1CNVA 1ZGDA 3QR1A 2F84A 3IUHA 5LYRA 3DGBA 3PTMA 1CIUA 4WRHA 1J18A 1P6CA 1JULA 4PUNA 4TU1A 2E6FA 3ZM8A 2QJJA 3LCHA 5FL1A 3CAQA 2ACQA 4GJIA 4AY7A 3T08A 1W5NA 4BK9A 3Q58A 3SO7A 3RR4A 4O13A 4H9ZA 1ISZA 2I5IA 2Y24A 3F03K 3DIPA 3TYBA 1JGMA 5EMYA 1CGXA 2YCIX 1V7YA 4JICA 1B5TA 3ZR5A 1KXHA 5CC3A 5M2FX 3LN3A 2XVGA 3QMTA 3TC6A 4Q4MA 5E6ZA 2OGYA 3B05A 4ZB0A 3NQBA 2QDDA 3KADA 3VO0A 4UQBA 4K8GA 4XVDA 2Z1SA 1HQTA 3ANUA 3N11A 1H60A 3H8AA 3LZ3A 4RZ5A 2KFWA 3DH7A 4Q4QA 1H1ZA 4QJ3B 4AZGA 3OVPA 3OW1A 3GTFA 1TMQA 4JTAA 1WDQA 3UY7A 3V16A 3VC5A 2Z26A 5DRIA 2CHNA 2D73A 1VBHA 3VKAA 3R8RA 4O53A 3W25A 1ISYA 1OG6A 3TN6A 3C2RA 5AC5A 2VI0A 2GK1B 5D33A 3W75A 3GR4A 2BB0A 5EA9A 4QFUA 4IPPA 4H9TA 6PTDA 3LMYA 1ML1A 3GTXA 4XZNX 2PPNA 3NO1A 1Y5WA 3L5MA 3G77A 4Z17A 3T8LA 3IIZA 1QR7A 3GR8A 1P7TA 5KINA 3ZFHA 5HBFA 1OWQA 1JNSA 1E40A 4DUOA 5D2WA 4JFWA 4N9EA 1O5RA 2FMNA 3WNLA 2O55A 2R14A 3RUBL 5HW6A 3NL3A 4HN4A 4WSJA 3VNYA 1XR2A 3AJ7A 2W79A 2PGWA 3O6AA 1Z48A 4JY9A 3VDHA 1VCVA 3S5OA 3CL8A 4N19A 1DE6A 3TJIA 2PDWA 4CQDA 4WR3A 4UZUA 4JDYA 4AD4A 5MHBA 3SQSA 3ZJKA 2WVVA 3TKFA 3W6MA 3BMVA 1UP2A 4O11A 4DQWA 1P6WA 3S1GA 1P48A 3VIMA 2FJUB 4NJKA 2Z00A 1QCWA 1K77A 4ZO7A 3UNTA 4JIRA 5FSEC 3KVMA 4PTMA 3K4AA 1UD6A 2CXEA 2Q8LA 3PZMA 4KWWA 4MB3A 3PUDA 4JCMA 3SY8A 4GYJA 1O68A 1NJJA 4HA0A 1ME8A 4QJ1A 4KCWA 5DMNA 1GJWA 4ROPA 4IMGA 4DXVA 5C54A 4BQ2A 4IMCA 2BY3A 2WW5A 4EANA 3N25A 3AAMA 1IIGA 1FCUA 1KKRA 2QLYA 4GZIA 3ZLGA 1AJZA 1PHWA 3L5AA 5DT5A 3FHQA 1DEDA 3FKKA 1V6XA 1M7JA 2CZDA 1CT5A 4DZAA 3XINA 1ZNNA 2ETNA 3PZOA 3GD6A 3UR5A 2WSRA 1XIEA 2JKEA 4KEVA 2EPKX 4Z1YA 3CPRA 3UZYA 2QR6A 1NOUA 1DE5A 4XVEA 1NDYA 2X2YA 1J0ZA 5K3VA 2Y7FA 4C6EA 3HV9A 4PUUA 4WJXA 2FDMA 3OLEA 3LTYA 1E71M 5IOBA 4PMNA 1QO5A 1ITXA 1JUKA 2CBIA 4B5TA 1W3TA 1C9HA 1E70M 3B8VA 5L6UA 1EPXA 1XINA 1IXNA 4CNNA 2XG9A 1XF0A 2M2AA 1O5KA 2LGOA 1IGSA 4RZBA 2IPFA 3EGJA 1YPFA 4K7YA 5BRPA 3ZIZA 4W87A 4IIFA 1ENUA 3PZGA 1LYXA 1JXKA 1WOBA 3P74A 2J6XA 3EXTA 3M1ZA 2PP0A 5CSUA 1VFMA 4KGJA 2VZTA 3OB8A 4QHRA 3UCQA 1FP9A 3WH0A 3EXRA 1V5XA 3EOUA 1K8YA 2QULA 2OLAA 4DRPA 3AHZA 7REQB 1SZGA 4JN8A 1WDPA 2O56A 3D47A 1B3YA 2BGSA 3N9RA 1K70A 1EIXA 2OYKA 3MWCA 3Q4DA 3L0GA 4OGZA 3TMLA 1U33A 2MANA 5CJ5A 3NQ7A 2B0MA 4LC8A 4EF8A 3RMEA 1B0IA 3K1GA 8A3HA 1E4LA 5CBIA 3HO8A 1WZKA 4ORIA 3W86A 2WPGA 5TAOA 4AMCA 1UPPA 3CUXA 1JPIA 4DUXA 5DIUA 2E77A 3EWCA 4M6UA 1C9WA 4CNOA 1JYNA 1U5JA 1J9YA 4C6QA 1F3EA 3LCGA 3WQ8A 1SJBA 2OSWA 5DELA 4IGNA 1H0IA 4QP0A 1LROA 3B03A 4GMEA 4XV0A 4H01A 1H7NA 3DEQA 3RGTA 3QMRA 4TV5A 3A22A 3I3BA 3WLIA 3W7PA 2Y61A 3WQ4A 1CZ1A 1RBOB 1K8XA 2CBUA 2A6NA 3H21A 3HM7A 4JOMA 4AAJA 2GGIA 4MJ2A 4DRIA 1YRRA 3BZGA 3VTRA 4Y7EA 2QV5A 3CO8A 4ZSTA 1O1HA 3GDMA 3AYVA 3EWDA 5AFDA 3M0JA 1V08A 1H4PA 9XIAA 2R1KA 2Z1VA 3NJ3A 1TTPA 2HXTA 3NNTA 3QKZA 2RURA 2WMKA 3KCLA 3GC4A 4S1FA 4W84A 1RXOB 1JZ8A 1DJNA 1VFOA 4XD4A 4QNWA 1U22A 1VFUA 1GVIA 1KCZA 1UUMA 3VGFA 4GBUA 1J4RA 3BLKA 2VR5A 4HZ6A 4KT2A 3WNPA 1MMFA 1ZLPA 3MKVA 3OA3A 1XICA 3APGA 1EZWA 3GH5A 3WLLA 2XIJA 4DY1A 1IX5A 2XSXA 3R1ZA 1KFJA 1S2CA 1KBBA 2I5GA 2JEQA 4EWND 1JGIA 1RD5A 1SGJA 4FNTA 1XIHA 3IK8A 1UKOA 1TFVA 4GGBA 4G7EA 2XINA 3F4NA 3C61A 2NX3A 4JTQA 1TTJA 3O5MA 1KT0A 1N82A 4FNSA 1M04A 1XG3A 3IIOA 3PFRA 4TVUA 3PZIA 1SFJA 4M82A 1A0EA 3TC7A 1Q6FA 1R9HA 2DEPA 1Z3NA 3ZOAA 3UZZA 4QT3A 1I60A 1OGSA 4D8AA 3G24A 3UWWA 4IIGA 1JDDA 5ECVA 5JIPA 3DOPA 1V93A 3P93A 4GXPA 1RLCL 1RA5A 3OO2A 2H8ZA 4E2DA 5AYBA 1QO2A 2J7HA 2JEPA 4TX8A 3H7VA 1VPXA 2WBKA 1OIMA 1P1XA 2IMRA 4RXFA 3GNOA 2J78A 4LAKA 2WAGA 5HMEA 4L64A 4F0HA 2AOSA 3WNMA 3O7UA 2ZUVA 2IF4A 3N13A 4H8NA 2VURA 6CGTA 1OFEA 1ECEA 4UTTA 1CGYA 1JZ6A 1NARA 3DXIA 3EAUA 4U28A 3KW3A 2P76A 1XUUA 2C18A 1AW5A 5A94A 2QUNA 3N4EA 4GIYA 4O57A 3P62A 3G1HA 3FV9A 2YXGA 3FGCB 1V6VA 3M5XA 4Q6XA 4GJJA 4JEJA 3BQ5A 4ZFCA 1K9TA 3TN5A 2PWGA 3AWNA 5K7JA 3BSGA 1AH3A 3LQLA 3LX9A 5EMLA 4ZE5A 1E0WA 4J3XA 3B9NA 4WSHA 3AXXA 3TUUA 3HGOA 3ZQ9A 2JIEA 3M7WA 5A6SA 2XDFA 4QG8A 3WBAA 4HGXA 1QWGA 3BGAA 1FWGC 5AYXA 1D6OA 4A3RA 4XZMX 3V5OA 3AIWA 4UBPC 4QROA 2DT1A 3WLOA 4AEOA 2GUBA 4IFKA 4WOQA 4NSBA 1LZOA 4FXFA 4L4LA 3UG5A 1ZL1A 3GDLA 1F76A 1GQIA 1RVGA 3RRAA 2FKEA 3LHWA 3QY8A 1QBBA 5AYIA 2Y62A 3UGRA 3MO7A 3BAIA 3ARPA 3MMTA 1FWRA 3QW3A 3OHMB 2LJ4A 3TDBA 4OECA 2FVMA 1LJYA 1E6RA 4AEFA 5CPQA 5I00A 2Q5AA 3QMSA 4FLSA 2PTWA 3F5KA 3RAOA 3AS2A 3L23A 2DSKA 2ZRXA 1WAWA 4JN7A 3CUGA 4DRMA 1U83A 4UR7A 3TCSA 1YTKA 3GDBA 4AISA 2UWFA 1VYRA 3DG7A 3W53A 2DT2A 1Q6HA 2J74A 2Y7GA 3HQ1A 3S46A 3N6HA 3SRFA 1ZRQA 3PPHA 1MNZA 4WVXA 2PDFA 1DWJM 2VDGA 2D24A 3CMFA 2OQLA 2GJPA 1TQJA 2DJLA 2P0IA 3LY0A 3A4XA 4H9VA 5AZ0A 3DI0A 2LPVA 4N9CA 3K4WA 1TR9A 2YFOA 1A5CA 1EC7A 3VOFA 3ZT7A 5IBXA 3U5YA 1GRJA 2TRSA 4L4OA 4IFOA 3VX0A 2I57A 1YNPA 4WXZA 2RUCA 3M41A 3W70A 3PAOA 3RX4A 1RY0A 4PMYA 4P8WA 2PTDA 3N19B 1F61A 2ZADA 3NGFA 3DENA 1UG6A 4AX7A 3N9KA 3A3WA 1X8FA 4EWJA 1E0TA 4NXKA 5F2LA 1JPDX 1GUVA 1DJWA 4XZWA 3EOLA 4Z1AA 3U0HA 2WZTA 2WNWA 3QQWA 1VQTA 1D3GA 3OA5A 1XDMA 5ABFB 2JIWA 3M9YA 1FWWA 2VOMA 2VD8A 5IRPA 2VCBA 1AJ0A 1JCTA 3JXVA 4GX8A 1LTDA 1UJQA 1BQGA 2JFEX 4JL1A 1UOZA 3CL7A 1A5SA 2EHHA 4RJEA 1H63A 1TPFA 3S9YA 5MF5A 1KW1A 1W9DM 3S4TA 3N3MA 5AC8A 4P7LA 3JYJA 3QGKC 2RJHA 1ICSA 1K9EA 3VC6A 3W7MA 2DY3A 4EKJA 4LC6A 2VRJA 3WNKA 4ATWA 3ZXWA 4ASTA 3I3DA 2PAJA 4IJRA 2CKSA 2WSYA 1XISA 3C56A 2WYSA 1UB3A 3PR2A 3ZS4A 3YPIA 5A3HA 1EXPA 1P6BA 2L2SA 2YYTA 1PIFA 4DN1A 4KGLA 1XH0A 5AOUA 1NF0A 4RLIA 4AZBA 3SCRA 3UPMA 1OF8A 5G2IA 4QCEA 4L4PA 1SPQA 4YU1A 4AD0A 4HBEA 2QJGA 3NZ1A 3FJNA 1P0NA 1ZCOA 4DZHA 1N8IA 4NKCA 4PA8A 2GWNA 3DYOA 1PHQA 4GYPC 4ACZB 5JH1A 2PP3A 1UKTA 4DYKA 4GZ7A 1OADA 3QHMA 3L2MA 3TA9A 1VEOA 3T4CA 3CUFA 3UA3A 4ERIA 4ZTXA 5XIMA 2V3GA 4LNYA 3P2VA 1NWSA 1IR1A 4DJFA 2R1LA 1HUVA 4FB7A 4L72B 4H00A 1GW1A 1UCWA 3TOPA 8TIMA 1RK6A 4JL2A 1JQXA 1XL9A 2XP8A 1R3YA 2D3NA 4PTWA 1EJXC 4JTSA 3F2CA 2CLIA 4O18A 1EJWC 4X22A 1GVFA 3UG3A 1H49A 2PEVA 3FAPA 1QT1A 1E4NA 3PHAA 4LV4A 2PLJA 4HNCA 4UFHA 1KQYA 4O1DA 3MVTA 1EO5A 4DPPA 2YSWA 4F66A 5K9DA 2CLKA 3V0TA 3R58A 1XJBA 2Q8XA 3P67A 3R8HA 5CG7A 3M0ZA 4UMCA 5AC7A 3VKCA 4KRUA 1WYIA 2Z4GA 3BJTA 3PJXA 3SW6A 3CT2A 2WJEA 2B7QA 1DQWA 4N6FA 1SFSA 3WUGA 5EMUA 3FHAA 4NZ3A 3VIIA 3W28A 3GHTA 3HFYA 1GK8A 1JRCA 3ZSSA 4GIEA 3LGGA 1JDFA 3GR7A 3KAGA 1JCMP 2J75A 3DFPA 4A6GA 3VZYA 3BLDA 1VPYA 3U3HA 4OBTA 2F7FA 3N2MA 5D2YA 5D09A 3CMGA 6TAAA 5I5RA 2BWGA 2OG9A 3SUSA 4NIRA 2Z6IA 1BGAA 4W9QA 5HNUA 2P3ZA 1J0YA 2C15A 2GZXA 4M6VA 1DHPA 3V7PA 1RLDA 4U3CA 3WQEA 3NZQA 1QPLA 3WLTA 4RPPA 3EOSA 2BODX 5CGMA 3VMOA 3GU0A 3O6CA 4FAPA 2INFA 4BF5A 1KM3A 3TQKA 1PWMA 2LLEA 1J96A 1R3VA 3EA1A 4NNCA 1CXEA 1XGDA 2Z1BA 2NV2A 2ZZ1A 5BXPA 4CNSA 4UOJA 1UQZA 4UNIA 3FDGA 4R3UA 3MW7A 5EPDA 1J0HA 2K8IA 1UR2A 2EPMX 4W9OA 1QU4A 3VIGA 3SCWA 3RMJA 4C6DA 3WD3A 2I56A 1H62A 1W1ZA 4TXEA 3KZSA 1JPKA 2VNCA 3KBWA 2Y85A 3S47A 2DSVA 2XISA 4H9MA 2WQDA 1KV8A 2IPGA 1DTUA 3CO4A 2PDHA 3BLIA 3AOFA 3T2PA 4LYQA 4P2VA 3Q37A 4QDMA 5FJUA 4AYGA 5LZLA 1S1PA 3WD0A 2FZ9A 4KCTA 5F2MA 1GQKA 4LW7A 4FX6M 2VGFA 4TUFA 3STFA 3NRKA 4NVTA 2EGZA 3KX6A 4Y9MA 5TBOA 3GXDA 4MZYA 4HU0A 3T40A 3SR7A 2O9RA 5BWFA 4ZR8A 3NTPA 2Q3RA 3WLKX 5I78A 3VNKA 3F5JA 3DFQA 3OQ8A 1FKGA 4JKMA 5EL1A 3RNDA 1FHVA 2ISSA 3F2DA 3K2GA 4H6EA 3LI0A 1ME9A 5T91A 1QI0A 3LTSA 3BC9A 4DO7A 3UXIA 2ESCA 1L8NA 5BNKA 4GO9A 4IIEA 1PYMA 4HPGA 2J47A 5F4XA 3UBPC 1A5UA 2QJNA 1XRTA 3NVDA 3KWXA 1HKVA 4F3HA 3C5QA 5IDZA 4YN5A 4DF0A 3PRAA 1EF2A 5AHNA 3S83A 1VH7A 1F4HA 2P8CA 1K1DA 4E5TA 1OFOA 2M1IA 3S2CA 3CV2A 1RAKA 4G6CA 1HKWA 1Y0OA 2DQXA 1KGWA 4AC7C 4YXGA 3ATZA 3O5PA 1DYSA 4XBKA 3WEZA 4CQ9A 3W6YA 2YW3A 1YE4A 4JFSA 3L21A 1F3WA 5HUAA 5A6KA 1X8CA 1NEYA 3II1A 1W31A 4AG0A 1JFXA 1C8QA 1XYFA 1H5YA 2RSEA 2QUVA 4QBXA 4HTYA 1PX8A 4BF7A 4JFUA 3B8SA 2HNEA 1XDJA 2WANA 2RUQA 1JPMA 4OOZA 1UH4A 3BCFA 4EIVA 4GACA 2Z0IA 5CQ1A 2FFIA 2ZA3A 3T44A 4M0XA 3OVQA 4KFPA 4QRNA 2CCRA 1W0MA 4TQTA 3BV7A 4DEFA 5KSWA 1T6MA 5H8PA 5E93A 3O16A 4C6OA 4HKPA 1E43A 3R11A 1UMYA 5AHFA 2DW6A 4KFNA 1J2BA 1TREA 4I3GA 1AK5A 4MWAD 1TPWA 4JTIA 3N4AA 1S2VA 3M5VA 3BSMA 3WD4A 3HBLA 3W02A 2HNHA 2IQTA 3LBMA 1EL3A 2WK2A 4S2CA 4CCDA 4JX4A 3ZWSA 2Y7DA 4HNOA 4IF2A 2EEXA 1G94A 3U9IA 4FR1A 4C60A 2Q01A 3OOQA 4F79A 3WQPA 2FJKA 5C2XA 1UHVA 4H19A 4X3ZA 4N02A 2ZA2A 2WBGA 2JGQA 2HTMA 2Z7GA 4R7OA 3WQGA 4J35A 1RQHA 1V6TA 4GRSA 1R2SA 1CPUA 4Q7NA 3N2XA 2ZR4A 1NP0A 3THCA 4NZFA 3UI4A 4JTCA 1YLVA 4V2XA 5DCEA 3A13A 5BOEA 3MA8A 4GUIA 1RR2A 4MUZA 3UZ5A 4N9DA 1A50A 1ZP3A 1LDCA 1KD0A 3TV8A 3EDDA 3T8QA 2ZX6A 3N4FA 4K8EA 3K13A 3LPOA 4DJFD 4HCLA 2ZBTA 3CXOA 5A8PA 5BCAA 5EBUA 3VNZA 3Q2DA 1BG9A 1VJIA 1KRCC 4NI3A 3CU2A 1LORA 2H9AA 1QHZA 4JQ4A 1TPVA 1WKDA 5GPRA 2QCFA 2Q8ZA 2CZEA 4M1BA 1J79A 2WSKA 5HTGA 3KXQA 3DKJA 2O0TA 5HOSA 4MKSA 3EX3A 2A0NA 2NUXA 4EXQA 3Q65A 2O7QA 2RGLA 3VGBA 3CHDA 4GGHA 2GSEA 4DRSA 4IPIA 5EYWA 1BVNP 5HWBA 1EYWA 4NX5A 4AXNA 4K1GA 4QXIA 3SUUA 5DXXA 5I77A 5L9FA 1XW8A 3VD3A 2INEA 5HMSA 2R24A 4RW5A 3LLFA 2HCVA 3V75A 1UBPC 1ZJBA 1LWHA 3W1NA 3HGSA 4E3VA 1EJSC 1K6AA 3G1SA 1XUZA 3SADA 3UPWA 1XLGA 5LSMA 1IHIA 2OO0A 3DHFA 7XIMA 2Y5EA 2V2CA 5D30A 1SFLA 2WHMA 1UWIA 1E1CA 2WB5A 4E4UA 3NPUA 4ZS6A 1V02A 1W56A 1KC7A 4S3AA 5DO2A 2RFGA 4YHEA 2QCEA 1IXQA 3GFXA 2PFHA 5CH9A 2FHCA 2WMFA 3ELFA 5D4YA 5FCZA 4UNKA 1AMYA 3A24A 1FY6A 4TYOA 4MLJA 1QZ2A 1VZWA 2DIEA 1JF5A 1EGMA 4D8LA 3KRUA 2V5CA 1GG1A 4G2PA 3M07A 1GCYA 1MZRA 2F6KA 4Y9PA 4UR8A 5A95A 3BMWA 2BTMA 2PGFA 5IXEA 4S39A 3HPFA 4YCPA 2DVXA 4C6FA 1SYTA 1UWAA 3GXMA 2G37A 5D9NA 3MDYB 4DAFA 3TR9A 1XKJA 1OFPA 4PBGA 2BY2A 5HMFA 3NEVA 1VCGA 4RL3A 2ZXBA 1CI1A 5CAKA 3UU0A 3WF0A 2G41A 4QQUA 4ZXOA 3B9AA 3M64A 4IGHA 4DJDA 1UD2A 5F2GA 4Z0JA 1GG0A 3KE0A 2PP1A 3P61A 4TX0A 3TSDA 3NO3A 2RJGA 2GUYA 3ITXA 4GYFA 4HJFA 1D7IA 1PVNA 1KRBC 1W9BM 3KVLA 3N2TA 1TWWA 1OSEA 3MI6A 1TA3B 4LYRA 2HQAA 2V68A 2Z1WA 4W8LA 3W7EA 2X1UA 4B16A 1GOIA 3GAYA 2PLKA 2ZRVA 3AS3A 1K4HA 1PKYA 3UJSA 3LI1A 1Q45A 1WOAA 3EMCA 1DWGM 1FP8A 4Z2GA 2CZFA 1Q2RA 1DWIM 2PWEA 4R0XA 4CU6A 4PTVA 1CW2A 1EX1A 3R0UA 4I6VA 2PCQA 2F2KA 1QPRA 2Z7KA 2ODOA 2ZCGA 3HG2A 4PE8A 3REQB 2QCLA 3F5LA 3MCNA 4HYWA 1Z9AA 3LCLA 4HPJA 3ZVHB 4ODPA 2QNEA 4J4NA 1WXJA 5J5RA 4OKDA 2XIIA 3SEPA 2PI6A 1I0BA 3A9IA 2UZ9A 1RD6A 3VCRA 3KRSA 3CYJA 5BW6A 3WMLA 3W00A 1KFBA 1FH9A 2YB4A 2D0HA 4FP1A 3MWAA 4GIAA 5EMKA 4YTUA 1EJVC 2CLOA 4ENLA 2PN0A 2Y5SA 1BPLB 1IEXA 1EYMA 3GTHA 3WQCA 4HTBA 1XIDA 1JEZA 5M5DA 4B3KA 1A49A 1OFQA 2G3JA 3VE9A 3CTLA 1W5OA 1JVWA 2JQXA 4HMNA 3RPDA 3EX2A 1ZAJA 2J8GA 2VUNA 4LS1A 4OFCA 3G1RA 3DZ1A 3B8IA 3MUZ1 2DIJA 2WCGA 2Q3OA 4JS3A 1C8VA 3I7RA 2Y5JA 4PBFA 3LHVA 4IUGA 4C65A 1JD7A 3R0DA 1G6CA 4GY1A 2KGJA 1FDZA 1SW0A 3T55A 1OBAA 2FDSA 4O4WA 1C7SA 2D1ZA 1ROUA 3VNDA 2WV8A 3E38A 3M47A 1V4YA 4NL1A 4C7GA 3NQDA 5FJIA 3CWOX 4CN6A 3PZUA 4KESA 2ZWYA<