2G8ZA

Crystal structure of the ternary complex of signalling protein from sheep (sps-40) with trimer and designed peptide at 2.5a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the ternary complex of signalling protein from sheep (SPS-40) with trimer and designed peptide at 2.5A resolution
rcsb
molecule tags Signaling protein
total genus 118
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2g8zA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2g8zA01
1MFUA 4AW7A 4WLCA 1WDPA 1DEDA 1HP4A 2XVKA 2XYLA 1FHLA 1VRXA 2F2HA 2GK1B 1CNVA 4JAWA 1GJUA 3IAQA 3ARSA 5D8WA 4EE9A 1Q6DA 1H3GA 3SCUA 4BF7A 4UZUA 4N0RA 2O9RA 1KWKA 1FFQA 2V3DA 4Z2LA 3WDPP 4R5EA 1UD8A 1PX4A 4AXNA 3POCA 2A3EA 3PHAA 1F4AA 5CQ1A 2ZXQA 1KXVA 1CGWA 4H2CA 5EBAA 5A8QA 1UKSA 2D0GA 1EOKA 1KFWA 2PWEA 3A4WA 1CGYA 3U5YA 4S3KA 2ZICA 4HZ8A 2WK2A 3CLWA 3WD4A 3POHA 1E3ZA 3B9EA 2VI0A 2PBGA 1BLIA 9CGTA 2WCGA 4PTMA 2BS9A 1AQHA 2VZOA 5I2UA 2OWXA 1HF6A 3AYSA 4MDOA 1NM9A 4FLSA 3QOMA 4D1IA 1H5VA 3MMDA 2GDUA 3PZVA 4IPLA 1I1WA 2ZX7A 2DT1A 3AS2A 1JFHA 4AISA 2WVUA 5HPCA 1E5JA 1GOWA 3FY1A 3W26A 3A47A 2CBUA 4PYSA 3T2PA 2XM1A 1QHZA 1DWHM 1JDCA 3BSHA 2OSYA 1H49A 4IUGA 3N17A 4PCSA 4C7FA 5IHSA 1GOMA 3VINA 3DYOA 1J0KA 2DSKA 4OBSA 2X8RA 1V6YA 1HVQA 1BYDA 2WMFA 1GNXA 3RM4A 3MKKA 2DT2A 5IXEA 4B9ZA 3BGAA 1G94A 1KXTA 4XX6A 1I75A 4TX8A 3VX1A 1OD8A 3VGFA 2XIBA 4KGLA 3SCWA 1GHSA 1SMAA 2V5DA 4FF5A 1JG9A 2VJXA 4H04A 2VTFA 2WSKA 3A3HA 4OUEA 1K9TA 2JIWA 4AC1X 1B3XA 5EFDA 2W62A 3EDJA 2F8QA 2YDSA 3UG3A 4LGXA 4LYPA 5A6LA 4AD0A 3W38A 1NH6A 3RM8A 1PZ3A 2VR4A 2VQTA 1CLXA 2Y8VA 1Q6CA 3T2QA 4JFUA 4KRTA 1E4NA 2NT1A 2ZIDA 1V3JA 3RPMA 3EDKA 3WD2A 1O7AA 3ARPA 2WVVA 5DMYA 2E9MA 3BLKA 1SFSA 2ZOXA 4GPNA 4EK7A 1UR1A 3GH4A 1DWJM 3VX0A 1UD5A 4AD3A 3T09A 4Z2JA 3PZ9A 1V3KA 1VBRA 3VIHA 5IFTA 3RIKA 1UWRA 4AZCA 1VB9A 4HPHA 3WENA 1JD7A 2JEPA 1B2YA 3JUGA 4TVCA 1JAKA 1H0GA 1B30A 3WH8A 1UWQA 4S3JA 1XRVA 5JH8A 2ZXDA 1M7XA 2V3GA 2WVTA 3FAWA 2O9OA 3ZR5A 5A2CA 2XGBA 1OBAA 2VRQA 2J47A 1ISWA 2FGLA 3WNNA 4LX4A 2WC7A 3VU2A 2JE8A 1J0YA 3KEHA 2JIEA 2BFGA 1UUQA 5JBFA 1XGZA 3S6TA 1E5NA 3PTMA 5M5DA 3K1DA 5GPRA 1B0IA 3KL5A 4OZOA 4KGJA 3VIPA 1CIUA 3OIHA 5FOOA 3WBAA 3BMVA 1MQRA 1TVPA 4P7OA 2Y2WA 2X09A 3ARWA 4QCEA 3WUBA 3WMCA 2DDXA 3MU7A 3SCQA 3EYPA 4CN6A 1JF5A 4AIOA 3F5LA 5CSYA 2W67A 3GNRA 3NIYA 4AYSA 4M8UA 4MB3A 1JZ4A 1QNRA 1JNEA 1BVZA 1ECEA 1WDQA 2ZX8A 4W84A 3WQ4A 1HJQA 4N42A 1V08A 4UOJA 1G9HA 3EMZA 3M7SA 3MUZ1 4PMZA 1VFMA 3CZJA 3WEZA 1FP9A 2QLYA 4W87A 2WPGA 3AS0A 1OB0A 1R7OA 2WVSA 2DT3A 3MO4A 4D6GA 4QLKA 3VDBA 1M53A 3SCTA 5C8BB 1B9ZA 3EBVA 3I3EA 4TVUA 3AHXA 1SYTA 3APGA 1YHTA 2ZUVA 3LPPA 2CETA 2JFEX 4DWSD 3WNMA 5F7UA 1E6PA 2J79A 4OOUA 3TOPA 4WSJA 1QI4A 4JFVA 1WB0A 1WZKA 2ZWZA 3WNPA 3CHCA 4AZCB 2XFYA 3VIOA 2DPEA 3THCA 3W24A 2E40A 1WDSA 3VO0A 3A6OA 2GJXB 3D5HA 2VZVA 1XC6A 3ZO9A 1CXHA 4GI9A 1DHKA 1V3HA 5BXPA 2WWCA 3BXWA 1CZ1A 2MANA 1IT0A 3LPFA 1CGXA 3O2LA 4E2OA 4WKHA 1O6IA 3T2OA 3QHOA 1LG1A 1PX3A 3AMLA 1NOFA 4QCFA 3CUGA 4UQEA 2QF8A 3WL0A 1TG7A 3RCNA 4M1RA 1H1NA 3PZNA 2J7EA 3RDKA 3CIVA 4P7QA 1IZJA 4HTYA 2Y5EA 1E6NA 1L8NA 4NI3A 1E73M 1V3LA 3QR3A 1QI3A 1JZ7A 4PN2A 2BNJA 3TTSA 2W4XA 4U2ZA 5ECUA 4NRSA 4FMVA 1HJVA 4WIWA 1BPLB 4AMCA 3L2LA 1GOIA 3J7HA 4J3WA 4TUFA 3GXMA 1BG4A 3RJXA 4W7UA 1CXFA 1UWUA 3AS3A 4XZBA 4W8AA 3AYRA 1GW1A 5DT5A 3CZGA 1BAGA 4JFSA 1E0VA 1U33A 4D6CA 1KQZA 4D71A 4JKMA 2OLHA 3AIBA 3UR8A 3CMGA 3WQWA 1KGWA 3WNLA 1AVAA 2ZX6A 4KMQA 1V6UA 3ZJ8A 2WKGA 4AZHA 1ZS2A 4HA1A 3PZQA 4D6FA 1UKTA 1ZBKA 1GORA 2X2YA 1HKIA 3N04A 1V0KA 3SUUA 5FL0A 3WH5A 1EHNA 1W9DM 3CHFA 3AJ7A 2E9LA 1ZBWA 2WMKA 2X05A 4AZGA 4U5IA 4PMNA 4A3HA 6TAAA 5A95A 1R85A 1ISVA 3VIIA 2BVTA 3VNYA 1Q6GA 5BRQA 3RILA 5JUVA 4XV0A 1ZJBA 1RH9A 1SR0A 2WLYA 5AYBA 4JFTA 2WSPA 1MXGA 2QMJA 3UCQA 5BXSA 1WZLA 4QLJA 4FLOA 4GKLA 1JF6A 4F9DA 4UQCA 1DWAM 3RJYA 1PZ2A 3AIVA 4CN4A 2BY0A 4P8XA 1AMYA 1HT6A 1J10A 1XD1A 2WMIA 3IANA 1HKKA 2W5FA 1ITCA 2Q8XA 1FH9A 2CKRA 2Z1KA 2ZUNA 1E1FA 3A4XA 2WHJA 5DT7A 3U57A 4GQQA 1CXEA 1BSIA 5DO8A 2WNWA 4ACYA 1TA3A 4UNIA 2J7HA 4MNMA 4B9YA 2J62A 2GFTA 1VFUA 3W27A 4QLLA 4PSRA 1JYVA 3WQ8A 1OGSA 4WF7A 2AOSA 3UETA 2VL4A 2J4GA 1UQZA 2EPOA 4AD1A 3AZRA 4V27A 2EPNA 5BRPA 1CTNA 1NQ6A 3AS1A 4C7GA 4W85A 5HBFA 1GQLA 3WKZA 1LL7A 4PMOA 5A69A 4HOZA 4YPJA 1US3A 1C93A 4IISA 5CGTA 1WDRA 4UOQA 2YDQA 4Z2GA 1JZ2A 2A3HA 1QBBA 4PRWA 1KXHA 2VUYA 1E1EA 2ZWYA 2A3BA 4M81A 3WQ5A 3B9AA 1MQQA 1XSIA 3NSXA 1W9VA 1E56A 1UA3A 3OLGA 1J12A 3OA5A 1EA9C 1JZ3A 3A4AA 4FK9A 1C91A 3AIEA 4DUVA 4ML4A 4J3XA 2VNCA 3RO8A 1UKOA 5A1AA 4TVDA 1KBBA 1G5AA 3WN6A 5CG0A 2AAAA 2TAAA 3WH9A 4X9YA 1HJSA 5LYRA 4UQ9A 3SUWA 3ARTA 5HDRA 4WK9A 4BQ5A 3CHDA 1D2KA 5GNXA 4MAZA 2CYGA 1GHRA 1MW0A 1UA7A 3QOKA 2G3IA 4W8BA 4PTWA 3KL0A 1W9PA 3AHVA 1VBUA 4WSKA 3AZSA 1ZU8A 3WFLA 1EIBA 2J7GA 2V38A 3N11A 3VVGA 4U3AA 3AMGA 3VGEA 1BYBA 1TR1A 3VM7A 2VR5A 7CGTA 1CECA 2WMIB 4V28A 2XM2A 4JHZA 3L4YA 2WKLA 3ZIZA 2DT0A 3BLPX 5ABEA 3VTRA 1FH8A 3K8MA 3AOFA 3FN9A 3SUSA 4M56A 2ESCA 1EOMA 1MQPA 2DH3A 2G41A 2XTKA 4P7RA 1E72M 5JIWA 3WL1A 1PEZA 3OGRA 5EMYA 1NWTA 5GQBA 2WBKA 1B1YA 3N18A 2CITA 3OLEA 4LXFA 2D22A 4PEEA 5JIPA 1MFVA 2YIHA 4J3UA 4YN5A 4UFJA 4JL1A 4RE3A 1TE1A 4HOXA 4JFWA 2WZIA 2EBNA 2A3AA 4UR9A 4R27A 3AHYA 1NWUA 4CD7A 4BCEA 1FA2A 4DWSA 2WCSA 5HPOA 2BHYA 5HNNA 4NF7A 3SUVA 1JYNA 1X1NA 4CKQA 2DEPA 3VD7A 4W5ZA 1ISXA 3L4XA 3ARUA 4MNLA 2WANA 4J3TA 1UWIA 3QHMA 1VEPA 3CZLA 3IJ8A 1EQCA 3AQUA 1M01A 2XVNA 4PTVA 4U33A 1AQ0A 4WKAA 1S46A 2DSUA 3GH7A 4XZWA 4W8LA 4P8UA 1OGGA 2DSWA 2V3EA 3ARZA 5C70A 2J8GA 1E0WA 1KCKA 1OT2A 3AIWA 3SCOA 1A47A 1E6SM 2J75A 3ALGA 2WWDA 2QV4A 1AQMA 1X6NA 3WD0A 3W29A 4AIEA 5IFPA 5JBDA 5E6ZA 4CU7A 1VEOA 1BFNA 1ZBVA 3NCOA 1HL8A 4GO9A 4J3VA 4DUXA 3WUFA 3WSUA 3M07A 4HA3A 3VGDA 3EMQA 5E0FA 3NJ3A 4UFKA 3BAJA 2XG9A 3LPGA 3UG4A 3SCRA 1E0XA 3ZOAA 2A3CA 2O92A 3M6DA 4M82A 2UY4A 3GNOA 1GONA 3T0BA 3I3DA 1EDGA 3CGTA 3ZM8A 2E9BA 3VIGA 2OWCA 2PWFA 4U5KA 3VDAA 1CXIA 3WIJA 3OB8A 4UFLA 2XSAA 3HJEA 2IUZA 2J77A 4U2YA 4URIA 2WB5A 4W86A 2FHFA 2OYMA 2Y24A 1GZJA 3MS8A 3VOCA 3ZR6A 2VOTA 3WF2A 4CCEA 3TTYA 3VGGA 1VF8A 4HZ6A 4ZXLA 4BQ3A 1NP0A 1K9FA 4JZ5A 3VMNA 1E6XM 1BYAA 1J0JA 4CU6A 2D3NA 2DQXA 1CXKA 2GVYA 5BWFA 2CIPA 1J9YA 1QI2A 2D0FA 3DYMA 1LG2A 5DF0A 5I79A 5ABFA 4DWSB 5D9PA 4NRRA 3B9DA 3VDHA 3WDHA 1KB3A 1GVIA 2OYLA 1PIGA 3W4RA 1HVXA 1FH7A 1OSEA 3BCFA 5A2BA 1JL8A 3OLDA 1KCLA 7A3HA 3BAYA 2VT0A 3CZEA 1SMDA 1H2JA 4BZYA 1BYCA 1CGTA 3G6MA 2CPUA 1QOXA 5LA1A 1WPCA 4Y7EA 2V3FA 4TTGA 2YOCA 4AEFA 1GQJA 2O9PA 4HU0A 4MJ2A 3G6LA 1XH2A 2WHLA 1W1TA 2BVDA 2W66A 3L4ZA 1UR0A 1HIZA 1PAMA 3AFBA 3L2MA 5A2AA 2JEQA 2D0HA 5DFAA 4PMQA 4UCFA 1V0NA 2YA0A 4GZJA 4H8VA 4W7VA 4GINA 4CU8A 4UFHA 4MB5A 8CGTA 3ECQA 4AD4A 5I24A 4JCLA 1H11A 2DIEA 2WVVB 4CUCA 3DHUA 4Q7NA 4WKFA 1OCQA 1WP6A 2ZUWA 1JXKA 3N1AA 1EO7A 3U5UA 2G3MA 2J7DA 1NP2A 1NARA 3L4UA 1UZ1A 1VJSA 1BHGA 1CGVA 1LWJA 2VVSA 4F9JA 3VIMA 4CVUA 2CBIA 2JF6A 3DYPA 1P6WA 4Z2KA 3CUJA 3I3BA 5E9AA 2YA1A 2BHUA 2BV9A 1TVNA 1W3LA 1OINA 3PN8A 4UZSA 2YDRA 2YLLA 4LYQA 1C7TA 2UY5A 1RP8A 1Y7VA 2CERA 3AXIA 5GNYA 1JYWA 1KXQA 1MVYA 2XVPA 4D1JA 3VD4A 1BF2A 1V6XA 1J0HA 2QPSA 3VIKA 4PBGA 1TZ7A 2CEQA 3ARXA 4B3KA 1R7AA 3CUFA 4OJYA 4MB4A 5E6YA 3IJ7A 1E40A 1HN1A 1NOWA 4AD2A 4E8CA 5D9OA 5CLWA 4HMEA 4PMVA 1C8YA 4TTUA 4NZCA 4HPGA 3EMCA 3DECA 4PUDA 5I78A 1X6LA 4UFMA 2E0PA 3K4AA 3CTTA 2J8FA 1GQIA 2WBGA 2XWEA 1QHOA 4MAVA 3VILA 1PJ9A 3GM8A 1OGBA 3BMWA 4MTVA 2CBVA 2GJRA 2NW0A 1R87A 1JI2A 5CGMA 3CPUA 4CD5A 1ZB5A 3N9KA 1H09A 3WD1A 2G8ZA 1CEOA 5A94A 2VO5A 1JYXA 3AIRA 3BCDA 1W9BM 1W1PA 2XUCA 1WNOA 3SURA 1HP5A 4CD8A 3KL3A 1R86A 1UYQA 4DUWA 3FHAA 2WAGA 1QNOA 4AZBA 3VGHA 1UWSA 3IAPA 1E4LA 3MV11 1CLVA 1KR1A 1ESWA 3AMCA 1GOQA 1WZMA 4BQ4A 3AROA 2VZTA 3N12A 1MW3A 4M29A 3PZIA 3II1A 1RP9A 3WDIA 5EFFA 3BAXA 2XSBA 1B3VA 2D2OA 2ZX5A 3ARVA 1UR9A 1E4MM 3VNZA 2WM0A 1XSJA 2G4FA 3ZT7A 3WH6A 3CZKA 4GO8A 3BH4A 6CGTA 1JIBA 3S2CA 1E6QM 1UH2A 4H8UA 1BGAA 4GZEA 4J3SA 3UERA 3W82A 2CNCA 1J0ZA 1DTUA 3ZMRA 3EDEA 2GK1A 3O6AA 2DGAA 2FH8A 3DC0A 3K4DA 5A3HA 5I5RA 2YBUA 1JZ6A 2VCAA 1HJXA 1CWYA 3WDRA 1OM0A 4CCDA 5I77A 1WKYA 1W9UA 3AMKA 1JNDA 3GBEA 1VFFA 3CMJA 4QFUA 5BYWA 1EXPA 5IDIA 3W28A 1OD0A 4ATLA 4PUEA 1E9LA 2YKKA 5DEZA 5CSUA 3W6LA 3SIMA 5BXRA 1W2PA 1UD3A 1Q4NX 1U30A 1UHVA 4UQBA 2BXYA 5A8OA 4D6IA 4X0NA 1B90A 2WZEA 1GCYA 3ZJ6A 1XCXA 4MPKA 5TD4A 3FHQA 3ZJ7A 1V6WA 4CN1A 1BG9A 3TTQA 1UH3A 2WZHA 2VCCA 5JBEA 2QHAA 2UWFA 2PWGA 4BA0A 4AD5A 7TAAA 1G01A 1V0LA 2UY3A 2J7BA 4QAWA 3VUPA 4UQDA 3LPOA 1PPIA 3T08A 1W9XA 1VIWA 3SCSA 1HJUA 2GSJA 5D8ZA 3WDJA 3OBAA 2DSZA 1DWGM 1JI1A 3W6MA 1CENA 4F79A 1B3YA 3AHTA 3W81A 1EDTA 3RMEA 4ACZA 4OKDA 1J18A 2QPUA 4AIUA 2D1ZA 1ZBCA 1QW9A 3UESA 3OG2A 1EGZA 3GXFA 1UR2A 4UOZA 5ABGA 2VX4A 3WF1A 4FLQA 3AIUA 2VZSA 3WEOA 3T0AA 1KWGA 1QW8A 4UFIA 3ARRA 2XVGA 3NSMA 1F4HA 4GQRA 4V2XA 4WJXA 1MYRA 1QNQA 4TXEA 1H41A 5FCZA 1LL6A 2CBJA 1E70M 4M80A 2BY2A 2YJQA 1CDGA 1HJWA 5CPTA 1R8LA 4P8VA 5CLTA 2VURA 1E71M 1W3KA 1UKQA 2Y4SA 1W1VA 1V3IA 1EHAA 2VZUA 5I0DA 2FDMA 1JZ8A 2ZXBA 5LA2A 1WCGA 2PWDA 2FHBA 5A6AA 4MDPA 3HN3A 4UQAA 1OT1A 1CPUA 1TA3B 3FAXA 3NUKA 3AXHA 4D6DA 1C3FA 1BVNP 1QNPA 4MJ4A 1MXDA 4PMUA 3WUEA 4FLRA 3VPLA 1V02E 1KGXA 5GNZA 4D6JA 2JALA 2XGIA 1ISYA 2NT0A 5D9MA 1UQYA 1QNSA 1E43A 2QMKA 3BAWA 3L4TA 3GZAA 5CPSA 5HXMA 3WY1A 4H7VA 4ZXOA 3GNPA 4HZ7A 4W7WA 4JKKA 5A6BD 1PBGA 3WQVA 2W91A 1US2A 3UEQA 4CVWA 2BY3A 1VAHA 1QI5A 3K46A 4D6EA 1JFXA 2FGZA 1V0MA 4E4PA 2ZUMA 3CUIA 2XIIA 4W89A 3VMPA 1G1YA 4J28A 3TA9A 3OLIA 1FFRA 4GI8A 4UTFA 1JXJA 3VIJA 2X0HA 3VD5A 3MSGA 4QDMA 2XJ7A 2WC3A 2Y8KA 4PSPA 2OSXA 2JF7A 4JCMA 1HL9A 1FHDA 4EAMA 1V6VA 1JDDA 1W91A 2EPLX 2C7FA 2HVMA 2BVYA 4DM1A 4E8DA 1RD6A 3WQ6A 4ACZB 4PMYA 2EO7A 4K68A 2AMGA 2IXUA 5M3WA 1K9DA 3GXDA 3AMDA 4PTXA 3MMWA 4CD6A 4P7LA 3THDA 2HISA 3MMUA 2ZUUA 4RE2A 5E0CA 1PX8A 4MNKA 3VIFA 2PI6A 4EANA 2W63A 6A3HA 3BAKA 3WF3A 3E1F1 3AI0A 1M03A 4PMXA 3WELA 1JAEA 3BSGA 5C71A 4ATWA 3NDYA 4MNJA 2YL9A 2XVLA 1UWTA 1K9EA 2XFRA 8A3HA 2WMGA 5AY7A 4KRUA 3PZTA 2XHYA 4AEEA 4ATDA 2WHKA 2YLAA 4ZE5A 3ARQA 2XPKA 4CD4A 3FNDA 1WE5A 3CBWA 3WEMA 2WYSA 5AYIA 1LQ0A 3AICA 2WMHA 2CHNA 3KE0A 3WF4A 2NSXA 4Z2HA 5A6SA 1JZ5A 3WNOA 4LYRA 1YQ2A 4J27A 3TONA 2CXGA 3MUY1 2BY1A 3AISA 1EQPA 4H41A 5CZKA 4GXPA 1W1YA 3K8KA 1NWRA 5A6KA 3AXXA 1XV8A 2GJXA 4OBRA 3GDBA 4HP5A 3ZJKA 2W61A 2GUYA 2VC9A 4B15A 5FKYA 3WMSA 1I1XA 3ZT6A 4XB3A 2E8YA 3VGBA 3WUGA 4EKJA 3ZT5A 3WDQA 1K6AA 5AC4A 3NDZA 2YBTA 5I3DA 1MW1A 4KWUA 1HXJA 1GPFA 3W25A 2VMFA 4GIAA 5BXTA 1GVYA 2ZE0A 1C92A 4ZE4A 3AIQA 3W53A 2DH2A 4U3CA 2EEXA 4PCTA 4BS0A 1UD6A 3KWXA 3TP4A 3OGVA 3WNKA 1XD0A 3QGVA 3VMOA 2E3ZA 1VENA 3WFZA 1V03A 2F61A 3F4VA 2VCBA 2OWWA 2WHMA 4HMDA 1WAWA 1WO2A 1UH4A 3WF0A 2XFFA 5M03A 1J11A 5D9NA 4XUYA 1XYZA 3QHNA 4JIEA 2WLZA 2J7CA 1ZL1A 5ABHA 4W88A 4AZ6A 4DWSC 3OZPA 1UD4A 2J74A 3NSNA 2EPKX 1RPKA 1OIFA 1MW2A 3M46A 4TOQA 3CZ8A 5I23A 4J7RA 2PB1A 2G3NA 5LA0A 4QP0A 1QVBA 4L4PA 4PMDA 3MV01 3SCNA 2PWHA 3MSDA 2C0HA 2XWDA 2IXVA 3N13A 1CYGA 3RM9A 1JGIA 1GUVA 5HOSA 2X0YA 1TUXA 3ALFA 3VDCA 3N15A 3GXIA 4MADA 2VX7A 1PIFA 3GYCA 1JDAA 2B31A 2VX6A 2E8ZA 5KZ6A 2EJ1A 1BGGA 1H4PA 3W0KA 2DSVA 1H0IA 4L4OA 2OSWA 5BCAA 1VEMA 2FHCA 4AZ7A 2VQUA 3EDFA 1CGUA 2CKSA 1UOKA 1NOUA 1VJZA 3WBEA 1A3HA 2VVNA 1FP8A 3FXYA 5ABFB 2CHOA 4A4AA 1EDQA 4CCCA 1UG6A 3WH7A 1KQYA 3AZTA 3F5JA 4ZEPA 4W93A 1DP0A 3AHZA 4ZENA 1BQCA 4JKLA 2EXOA 5CPQA 3SEPA 1WZAA 2G3JA 3MANA 1HX0A 4X0VA 2Z1SA 3WD3A 4F8XA 3VM5A 1LWHA 1FOBA 3PZMA 5CXPA 1CXLA 3BC9A 1C8XA 4P7NA 4OOZA 3ZSTA 3DHPA 4F66A 3PTQA 2D20A 4AZIA 1M04A 1J01A 1GOOA 2UY2A 2D3LA 2CCRA 2EQDA 3GH5A 1TCMA 1EH9A 2WMJA 2WXDM 1E3XA 4MB1A 1E55A 1TMQA 3VD9A 5FL1A 3MUAA 2DIJA 1J0IA 1W2VA 3F5KA 1IV8A 1E4IA 1LL4A 5A8MA 2EPMX 3VKKA 2RGLA 1UR4A 4D6HA 1Q6FA 3SCPA 3FW6A 3ARYA 4IPNB 1UR8A 1VFOA 3HU7A 4RL3A 4B3LA 3O9NA 4D72A 5A8NA 5AC5A 1QPKA 3U7VA 4YHGA 1XH0A 3D3AA 3VD3A 1V3MA 3T0DA 1DWIM 3PBGA 4HMCA 1JD9A 3IJ9A 2BXZA 1KGUA 2VRJA 4Z2IA 4NSBA 2CESA 1UZ4A 1ISZA 3GTNA 3KZSA 2W92A 1ZJAA 1B3ZA 4GI6A 4HA4A 3LMYA 4HOWA 1LLOA 3CH9A 1GQKA 1C90A 5EB8A 1Q6EA 5A6BA 4TX6A 3CUHA 3L4WA 1NWSA 2YA2A 4P8WA 1XYFA 3PTKA 4U31A 5IHRA 4LQ1A 1HNYA 1U2YA 4AWEA 3UG5A 1GOKA 2VRKA 1CBGA 1Z32X 3ZSSA 5BROA 1C8QA 1ODUA 4Q22A 5A8PA 2FH6A 1V02A 2WW5A 4IM4A 5M17A 2C8NA 5KEZA 1UD2A 2GJPA 4DM2A 1DWFM 1ITXA 3EDDA 3PZGA 3PZOA 1ODZA 1KBKA 1C7SA 1W32A 1GJWA 2J78A 3SUTA 2PC8A 1OIMA 2O9TA 4PMRA 1LJYA 1E15A 4W5UA 4HU8A 5D4YA 5FIPA 3W37A 2WCAA 1HKJA 4OIFA 1TFVA 1HKMA 1E6RA 2E4TA 2ZX9A 4AY1A 1XH1A 2OYKA 1B31A 2YL8A 4YHEA 3IK2A 3BAIA 3UR7A 5E70A 1MWOA 1UKPA 2PBOA 4H8HA 2BHZA 3CO4A 2WC4A 5CJ5A 1OWQA 1D3CA 1EO5A 2ZXAA 1E6ZA 1QI0A 2YL5A 2D23A 2PF0A 2J7FA 5I6SA 3U7BA 4C7DA 1L0PA 3TTOA 1KR0A 1W3HA 2YL6A 4AZ5A 1IZKA 4JL2A 3WMBA 1D7FA 4GZIA 4RE4A 1BTCA 3SCVA 3NYDA 3OGSA 2X1IA 2J25A 2RGMA 5A6MA 3L4VA 4KH2A 1N82A 4JHOA 1G0CA 3MUIA 3CHEA 5E09A 1B3WA 2V5CA 4LPCA 2GDVA 2ZUTA 4A3YA 1QHPA 5FD0A 4BQ2A 3PZUA 2VX5A 4M24A 4ZFMA 3GBDA 3OZOA 5A6JA 3B8SA 3K8LA 3ZQ9A 1LF1A 2D24A 1W3JA 1XHGA 1XSKA 2ZUSA 1QBAA 3HMCA 1XCWA 4B16A 4CGTA
chains in the Genus database with same CATH superfamily
1MFUA 4O52A 3DFYA 3JS3A 2XVKA 2F2HA 1CNVA 4JAWA 5K4ZA 3KTSA 4ZB2A 1JNTA 1TPC1 3KABA 1K4HA 1JPMA 2P3ZA 4R7WA 3QN3A 3UWQA 1WXYA 5TIMA 1PV8A 3GRIA 4KCVA 3LCGA 4DRPA 4L65A 1UD8A 2QCGA 5U4NA 4L61A 1MSSA 2FB2A 4AXNA 1ZLPA 3POCA 2A3EA 2WM1A 4JQ3A 1KXVA 5A8QA 2QJIA 2D0GA 4KEUA 1B6CA 1CGYA 2PEVA 1Y0OA 1VLWA 2XH7A 2ZICA 5G4WA 1YDNA 1R3SA 3CLWA 3RO6A 4LC6A 3C3NA 1XS2A 3T07A 2GLKA 4YWSA 1TUFA 1FDJA 2OWXA 3IV8A 3SY5A 3BV7A 3QOMA 1H5VA 1DJIA 1ME9A 1VP5A 4IPLA 4L1GA 2DT1A 2ISFA 5XIMA 1MEIA 3RLHA 3O6CA 5HPCA 4MZ8A 1GOWA 3FY1A 4V15A 3MBDA 4DELA 1P6CA 1ROUA 1B5TA 1VHNA 1TPVA 4DYJA 3W02A 1O5RA 2XM1A 2VC7A 2FVLA 1QMLA 5AVNA 4IUGA 1GOMA 3DYOA 1J0KA 4OBSA 2HE8A 3IKGA 1AD1A 2H3BA 4QR6A 1BYDA 2WMFA 3LENA 4S3AA 2DT2A 3OJGA 3BGAA 4Q4MA 1I75A 3DFQA 1OD8A 3VGFA 3CL7A 3G18A 2XIBA 4A3UA 2O0TA 3PSVA 5T8GA 3W2LA 2VJXA 4PULA 2VTFA 4OUEA 5AHFA 2JIWA 1YNQA 3E02A 3KS5A 3F03K 3HQOA 4PMJA 3P8JA 2F8QA 2YDSA 3UG3A 3ATZA 4H3DA 4EXBA 1CT5A 1FCVA 1X1ZA 3GLCA 1Q6LA 4QG6A 3A12A 3RM8A 1Z41A 1PZ3A 3KACA 3PBUA 1Q6CA 3T2QA 4JFUA 5H8PA 3D6NA 4KRTA 1LQAA 2A6NA 2NT1A 2ISDA 1V3JA 3RPMA 1O7AA 2OEKA 4Q8QA 2WVVA 3BLKA 2FYMA 1MUWA 4YTTA 3ITCA 2KAUC 4DXXA 2WJDA 4C5ZA 1D7JA 3LUTA 3NA8A 4H9XA 4AD3A 5C7VA 4R34A 1V3KA 4E6MA 6TIMA 1OCJA 1UWRA 2RUDA 1VB9A 4GYPC 4HPHA 1K8ZA 4TVCA 1NJJA 6REQB 2ZXDA 1M7XA 1V79A 3UA3A 3NTYA 5FA5A 3ZR5A 5A2CA 1Q7QA 3GPKA 1OBAA 3RAOA 3VNLA 3HZ3A 4LX4A 3ENLA 3XIMA 1PUDA 1R3WA 1NEYA 3KEHA 2RH9A 2JIEA 1UUQA 2DZPA 2XP8A 4LAZA 2HTMA 3B8TA 1OY0A 5BZAA 3HV8A 3R2GA 4JN8A 2WPBA 2WO5A 2ITKA 4O54A 5GPRA 3KL5A 2L5HA 1X39A 2ZC1A 4C6CA 3W7MA 2V82A 3E3HA 2J6VA 3OA3A 6XIAA 3N3MA 1A5NC 2CZEA 1AJ2A 3RK8A 1JF5A 1WDDA 3F5LA 3GNRA 1M1BA 4HYVA 3TKFA 2YDAA 2OR2A 3L9CA 4MPQA 4ZOEA 3P82A 3SJNA 1HJQA 4N42A 2IKJA 3IACA 2MF9A 3MUZ1 4XD5A 3CZJA 2QLYA 1LBFA 4W87A 1YE4A 3EKGA 3T7VA 3LG3A 1OB0A 5FJJA 2DT3A 1UMYA 3SCTA 3F2DA 5C8BB 1GW9A 2R1NA 3G1XA 4KQZA 4ZCWA 2OCZA 3C52A 1SYTA 5I3FA 1EC9A 1TX2A 1JEZA 3NDOA 3TOPA 2VUNA 4WSJA 5DELA 1TV7A 1WZKA 3FSTA 1OFDA 3CHCA 3GUWA 1RV8A 3NQFA 3KHDA 4AZCB 4P61A 1DHPA 3W24A 2JGYA 3H2NA 1B4EA 4BR1A 3D5HA 1GYMA 3HPFA 3L2IA 3RYSA 2C19A 1GKQA 3VDGA 1M6JA 2HNEA 5BXPA 4HK5A 3UY8A 3VOIA 2ZA3A 3TXVA 2BP1A 1IT0A 3O2LA 3VC6A 2PDXA 3QY8A 2Y88A 1NOFA 4UQEA 3WL0A 1TG7A 2PDQA 4AC7C 1VR6A 3RDKA 3UWWA 1KRBC 4ZOCA 2H9AA 3MMTA 4P7QA 1IZJA 4MWAB 1L8NA 1VYRA 2YXOA 4NI3A 2O4MA 3UXLA 2E5BA 4PN2A 1YXDA 3LCWA 4MSPA 1R5YA 5KSWA 4WIWA 1BPLB 1GOIA 3J7HA 2A5HA 1BG4A 4FA3A 1JNSA 3N6JA 2HEJA 4G7FA 3QFWA 2ALDA 3GDTA 1REQB 5DT5A 4O1EA 1TKKA 2R9RA 1E0VA 1U33A 1T96A 3I6RA 3T8LA 4HU3A 3B0PA 2OLHA 3AIBA 3CMGA 4F0MA 2XZ9A 3UNTA 1AVAA 2ZX6A 4KMQA 4A21A 4ADSA 2PZ0A 3PR2A 4IFKA 3ZJ8A 4LVAA 4AZHA 1ZS2A 3M0LA 2VENA 3PZQA 3QY7A 4Z1CA 2CLPA 1I2NA 1GORA 3M1ZA 2X2YA 1HKIA 1JRCA 3L23A 3LM3A 3TTEA 1EYMA 4MGVA 4EPDC 4IIDA 1AFSA 2XDFA 1XLAA 1W9DM 1Q6QA 3AJ7A 2E9LA 3TA6A 3TQVA 3EXRA 3FEMA 3ABRA 3VNMA 3IIVA 1KM0A 4AZGA 1LBMA 2FQIA 4U5IA 2I5IA 4PMNA 6TAAA 4GKTA 1E51A 3BARA 3U8GA 4ZTXA 1QNVA 4QNEA 5BRQA 1XYAA 4ZOBA 4HGXA 4Q8UA 3R4IA 3E2RA 4XV0A 1ZJBA 2J8TA 2WLYA 4LUJA 5AYBA 3D3FA 4I5UA 1ZCCA 2QMJA 1SZEA 3A21A 3TIMA 4UQCA 1DWAM 2Q71A 3R6IA 2BY0A 3IGXA 2CWXA 1AMYA 3NQCA 1ZP3A 2J24A 1K4GA 3NZPA 1J10A 2YYTA 2WMIA 1RQEA 3IANA 1OZMA 2ZUNA 1BSIA 3R25A 2PDLA 4ACYA 1BVWA 3BCJA 4MNMA 5EYWA 2W27A 3KS6A 4QLLA 1JYVA 1FKJA 2ZDRA 1G4PA 4JTGA 2PURA 4ODMA 4JD4A 3AYTA 3FJLA 4H6KA 3RGCA 1UQZA 4AD1A 1J4EA 3AAMA 5IBXA 2EPNA 3KRSA 5LGXA 2FPTA 4M19A 1CTNA 3AS1A 4ALDA 3A5VA 4C7GA 4W85A 2D2HA 4NHVA 1C93A 1H51A 1WDRA 2OPJA 5SWUA 3IVSA 1TJPA 4HB7A 1JZ2A 3R10A 1TTJA 2CLKA 4JGDA 4JPGA 1FWFC 2ZWYA 4M81A 3WQ5A 3IS4A 2XP3A 1XSIA 1E56A 1J12A 1SM9A 1IEWA 4AY8A 4NKCA 4FK9A 1C91A 3NPXA 3AIEA 4DUVA 1R3VA 4J3XA 4XZMX 2QDDA 1UKOA 5K7JA 4FNRA 1OYAA 1WAUA 1R0MA 4GFIA 2AKMA 2TAAA 4X9YA 1HJSA 4R53A 5LYRA 3SUWA 4ODPA 2BSLA 3VKJA 5XIAA 3DFHA 2ZA1A 4MAZA 3OIXA 4GYPA 4JNYA 3O5LA 1UA7A 3O5QA 2G3IA 4L3NA 2QF7A 4J1OA 4DZ2A 4NZ3A 4A2SA 1ZU8A 1EIBA 3PRDA 4DRQA 1YNPA 1R3YA 4U3AA 3ITGA 3VGEA 1TR1A 3VM7A 4HPXA 2FLIA 4XKYB 4V28A 2QCDA 1AL7A 4EF9A 3L4YA 2M1IA 3ZIZA 5JVLA 2DT0A 5ABEA 4A8LA 2DH3A 1Z69A 2G41A 3NL5A 5JIWA 3GYEA 4BF5A 1PEZA 4HQVA 2Y7EA 1B1YA 4H9MA 4R0XA 4FP1A 3MB9A 4HPJA 3HQNA 4PEEA 4WXZA 4UFJA 4RE3A 4ERIA 5G1TA 4R27A 1NWUA 4R3UA 4CNTA 4DI8A 3UI6A 4BCEA 3VK5A 4O1DA 2B81A 3H7RA 4O14A 4TQTA 5HNNA 4AH7A 2DG4A 4FAMA 2ZZ4A 4W5ZA 4YNGA 2FFCA 1Q85A 3TFXA 3ARUA 4MNLA 2V2CA 2WANA 3G1RA 2QJGA 1TPWA 5AHMA 4G1NA 3AQUA 1M01A 2FMNA 2XVNA 4HSHA 4RNFA 1W17A 2BOEX 1E0TA 2FTPA 1S46A 2YYUA 4XAZA 3TN6A 2V3EA 1DORA 1FWJC 5C70A 2H6RA 1E0WA 1OT2A 2EG8A 3AIWA 1A47A 2J75A 3ALGA 2EAWA 3AO0A 3WLIA 1J4IA 2XIOA 4DF2A 4AIEA 4MKVA 5E6ZA 1FWHC 3NM1A 4CU7A 1BFNA 4GO9A 3OOQA 3WUFA 2PPPA 3M07A 3VGDA 3M0KA 1FKLA 4UFKA 5I7GA 4Z0JA 3FYYA 2GQ3A 4S3EA 1DJGA 2O92A 1LBLA 4BEUA 5HMSA 2ZRYA 4IP4A 2GGJA 3CGTA 3TYBA 1ZPTA 2B4GA 2AGTA 1HUVA 3VIGA 1NDZA 4EWND 1F7BA 1EF2A 2HRWA 3SB0A 3QZEA 3IGUA 3TNOA 2WNZA 3OB8A 2XSAA 2ZQTA 5CH9A 3MCMA 4R7OA 4REQB 4GC3A 4W86A 2ANUA 2FHFA 3MS8A 3VOCA 3PF3A 2V67A 3AU2A 3ITYA 2NUXA 1F05A 1SZFA 4PCNA 3T42A 4ZXLA 2O4QA 1XLIA 4QITA 3NFUA 3KAFA 4CU6A 2GVYA 3RNDA 1H7RA 2CIPA 3QSTA 1B9BA 5I79A 1XIJA 2QYGA 2BGQA 4FZIA 1G69A 3VDHA 1O4UA 1GVIA 2PDWA 3W2KA 3PPCA 1PIGA 2Y78A 3W4RA 1HVXA 2DZTA 1JL8A 1RJQA 1ZAIA 3B04A 1SMDA 3AWNA 3WLNA 1QOXA 3EY6A 3N19B 1V93A 4AEFA 2GSHA 1X7FA 1GQJA 2IPJA 4HU0A 4FIQA 3E9AA 3G6LA 3P0XA 2WHLA 2BVDA 2OZ3A 3R8HA 1UR0A 2ZKMX 4IQ2A 2DFAA 3PBMA 1K7XA 2I16A 3MA8A 3URQA 4MZ1A 3TXZA 2D0HA 3ODKA 1KKRA 4JTKA 3MTWA 3H2CA 1V0NA 3CS2A 4GX8A 1FXQA 4Y96A 3TN4A 3ECQA 3K1GA 5I24A 2B0MA 1H11A 1R3TA 3V0UA 2FZDA 1C9WA 4QRNA 4I3GA 3PUEA 2Z2UA 3DHUA 1OCQA 2F2KA 2C0AA 5J6EA 2QUVA 1JXKA 2BXVA 1XC4A 3N1AA 3C2FA 3U5UA 2GQAA 4QM1A 2J7DA 1NP2A 1VJSA 1LWJA 1U1UA 3VIMA 1K6WA 2CBIA 3DYPA 4Z2KA 2V81A 3JW7A 3O05A 3WQDA 1OFQA 5CZTA 2BHUA 1G4EA 1TVNA 1W3LA 1OINA 3GG1A 4XBJA 2Z6JA 2PDFA 3DOPA 2I9UA 4LYQA 1F3EA 4I5RA 1RP8A 4LAMA 3FJ6A 5MKGA 1Q3NA 3KAGA 2AQWA 4D1JA 5JMUA 1V6XA 2QPSA 2ZR4A 3P74A 4RNJA 3ARXA 4B3KA 2DVUA 1R7AA 1K8CA 4OJYA 5HNTA 3QVQA 5E6YA 4Q8WA 1F61A 3TMLA 3PB2A 3PK7A 1NOWA 4R7JA 4UDMA 1FKTA 5CLWA 1YBQA 4TTUA 4NZCA 2PV3A 3QY6A 4HPGA 3RUBL 1ZTVA 5I78A 2ZDSA 4K3ZA 1X6LA 5KZEA 1IR2A 1ZCNA 5AVHA 3O5MA 3BMBA 4MAVA 4JICA 4A29A 4IPJA 3GM8A 1Z6KA 4MTVA 2CBVA 2H8XA 3ID7A 1D9EA 2NW0A 1R87A 3LTSA 1JI2A 4C1NB 2BOGX 2W6RA 4CD5A 3JYJA 2CZDA 1ZB5A 4IZGA 3UXKA 4JTQA 1H09A 3WD1A 1SSDA 2BB0A 3AIRA 3BCDA 3FCPA 3H12A 4JTJA 4CD8A 3W75A 4DUWA 2QCFA 3FHAA 3LY0A 3KVJA 3SDOA 3STPA 3LHWA 1JJKA 1QNOA 4AZBA 3VGHA 3IAPA 2PU0A 2QIWA 1KR1A 3KVLA 3NZQA 3GAKA 1ESWA 3TAKA 4JY9A 4QZVB 3RFWA 3TSDA 3PZIA 1RP9A 5I00A 4LU0A 3WDIA 2FKEA 1B3VA 2D2OA 4LVGA 3W2JA 3IIZA 5DY2A 4A8NA 3ARVA 2WM0A 1P5QA 3PVFA 5HA7A 2QGHA 3WH6A 1RBAA 3FAPA 4NAFB 5BNKA 3INPA 4HSNA 5FF7A 2Q6ZA 3NRKA 1E6QM 1R2RA 4H8UA 3BL3A 5EKYA 9XIMA 3LNMA 2POZA 3O6AA 1XRFA 3EB3A 1TMHA 3DC0A 3K4DA 1WUEA 5A3HA 5I5RA 4GQBA 3E74A 3HV9A 3EWWA 3OEXA 3CQHA 3MP5A 4NYYA 4CCDA 5I77A 3AMKA 1JNDA 4MUZA 1VFFA 4QFUA 2QCEA 3RR4A 2H90A 3RCMA 4C6QA 4PUEA 2REQA 1V77A 4EP8C 5LNRA 3W6LA 1WKEA 1AD4A 1LROA 4WVXA 1O66A 1EPVA 3UWVA 3GC5A 4A8RA 1OK6A 3GFXA 3EOSA 4YVPA 3SI9A 4H9TA 4PCFA 3W23A 4RW3A 3DZ1A 2P1FA 3M5XA 4TW7A 5FJPA 1XR2A 2AQOA 1V6WA 4Z42C 4S23A 2MLXA 1BG9A 1AK5A 4ZPTR 2ZADA 3TTQA 2BLEA 3VKDA 1J2BA 2WZHA 1YXCA 5JBEA 4IX2A 4BA0A 7TAAA 4AD5A 5H91A 2OQLA 1G01A 1V0LA 2UY3A 1PPIA 1ZZMA 1EGMA 3NAVA 1A5LC 1HJUA 1I2OA 4O53A 2JK2A 4E5TA 1O1HA 2XGZA 1UZHA 3DXIA 4WX2A 1VRDA 2GQ8A 3OZMA 5F4SA 2HQAA 4GBDA 2D1ZA 3GNDA 3V36A 1ZBCA 4XBSA 2OT1A 3OG2A 3L0GA 3ABOA 4RW5A 5ABGA 3WF1A 3AIUA 2VZSA 2FTYA 1KWGA 1QW8A 3TQKA 2XVGA 3EXSA 2VEKA 1K7FA 4IF2A 1LL6A 2CBJA 4H1ZA 1R8LA 3HMJG 3P5YA 2INEA 1UKQA 1W1VA 4O18A 1EHAA 3ZWTA 4W9PA 1KFKA 4G50A 1JZ8A 5LA2A 2PCQA 1WCGA 3VNIA 4E0CA 2FHBA 2OKOA 4MDPA 2BZNA 3HN3A 1I8JA 2X42A 1EA0A 3FAXA 3NUKA 3AXHA 5HWCA 2YCLB 3IJQA 1A5AA 3UQIA 1BVNP 1QNPA 3Q67A 1DJQA 4XK2A 3VPLA 1KGXA 1T99A 2XGIA 2NT0A 5CJMA 2C71A 4QIBA 1JCTA 1BKFA 4M51A 5B8IC 4HZ7A 2OZ0A 4U84A 4A35A 2PRLA 1PBGA 1XG3A 3IRSA 2W91A 1US2A 3UEQA 4CVWA 4EXQA 2BY3A 1VAHA 3K46A 3IGHX 3VYLA 4F0LA 3D46A 5I98A 3VMPA 3LUOA 4J28A 3PULA 1FFRA 4DH0A 2RDXA 4J4KA 3MSGA 4QDMA 4WDXA 4FOKA 2NX1A 2Q02A 4BJHA 4JX6A 4OHQA 1HL9A 3A22A 1V6VA 7REQA 2BVYA 4GIYA 4IGSA 4DM1A 2PGFA 1YX1A 5AHEA 4ACZB 1DIOA 4PMYA 4JN7A 1PE1A 3SR7A 2EO7A 1KM4A 4MYAA 5F4WA 1K9DA 3GXDA 2PCEA 3AMDA 1Q2SA 1LUCB 3DUGA 3MO7A 4ZZ9A 4XBKA 3O5GA 3MMUA 2J66A 3NQ2A 2ZUUA 4RE2A 4EOUA 2CZVA 3TC7A 3CV1A 1A0EA 2Z1VA 5DBTA 2X40A 2D69A 4O12A 5DIUA 2OJPA 1B3OA 3RXZA 4L9ZA 2ZR5A 4IFRA 3WJSA 3DKLA 4MNJA 1XBVA 1UWTA 3R8RA 8A3HA 4WZHA 3FVDA 5AY7A 5G1YA 5HW7A 1HXVA 2LLEA 1UASA 3KX6A 4YCPA 1RK5A 5D2YA 3MYOA 1ONEA 2OX4A 1M9HA 3W7PA 3AXMA 4LB4A 3JR2A 4F2BA 3PUDA 2F4EA 2QCNA 1QPLA 3WEMA 3QV8A 5G5IA 2WMHA 2DY3A 2GYIA 4FHAA 1FCQA 5HANA 1JZ5A 4LYRA 4O16A 3G3MA 3AISA 4GXPA 1TJRA 5AC6A 1W1YA 4R9OA 1BRLA 1NWRA 4B5XA 4DRMA 4LUTB 3CASA 3RX3A 4WRHA 2VC9A 5CPOA 1V7AA 5H1WA 1I1XA 4I5XA 3O5KA 3ZT5A 1K6AA 5HUAA 3PJUA 1UZDA 3STGA 5D32A 5I3DA 4KWUA 4GIAA 1GVYA 2DZUA 4ML9A 1C92A 2I17A 3W53A 2EEXA 4QBXA 2M08A 3TP4A 3OGVA 4G5DA 1XD0A 2GGHA 4WXYA 1V03A 3F4VA 1EX5A 4Q8OA 5D03A 2OWWA 2WHMA 1DE6A 4JTHA 3GG7A 3ABQA 1UH4A 3H4XA 1P43A 3DERA 3CGNA 3ABXA 4UMCA 5D9NA 4XUYA 1HKVA 1DJWA 3QHNA 1YLVA 4GJIA 1I0DA 4NZJA 3OYZA 3KVMA 1SW7A 1Q6HA 3KWSA 4W88A 2P0OA 1UD4A 2J74A 2EPKX 4S39A 1OIFA 3WMLA 5HMFA 5I23A 1IWPA 3FJ4A 2QUNA 2XSXA 1BKSA 3UZ5A 4QP0A 4S2CA 1QVBA 2IQTA 4O57A 3QF0A 2PWHA 1FKXA 3MSDA 3EWDA 3IIPA 1XLHA 1CYGA 3FA5A 5HOSA 1QPRA 3ALFA 1SJAA 3C2OA 3N15A 1UP0A 4BEQA 3S8HA 2ZBTA 1PIFA 3GYCA 3LXBA 1Q7ZA 2VC5A 3GFZA 4FXFA 4X2RA 2VX6A 5FACA 4LWWA 1FWEC 1K70A 5T91A 3QRHA 1S3TC 2RFGA 2DSVA 5BOFA 1H0IA 2UZ9A 2OSWA 3UF8A 2Y5JA 3RLGA 4QNWA 1LT7A 2FHCA 3QW3A 2CKSA 4K38A 4LF1A 4DROA 3DH7A 1QWKA 3FXYA 5REQB 2HZGA 4JIQA 4GOAA 4DBDA 1PZ0A 4CCCA 3OG3A 3DI1A 3AZTA 4DWDA 1R3RA 4W93A 1VPYA 5CPQA 3OZYA 4IT1A 4L1XA 3H23A 4CNOA 1Z89A 1SJBA 4TU1A 1YPFA 1TZ9A 1HX0A 5BWAA 2Z1SA 3VA8A 4F8XA 3KUMA 1FOBA 1XFCA 1CXLA 1C8XA 3ZSTA 3APTA 4DO5A 3DHPA 3PTQA 1P0BA 4FI4A 3JZEA 2CU0A 2VR2A 4MUPA 5K2ZA 2Y1HA 3GR8A 2D3LA 1O5XA 4S3DA 3W6YA 1E3XA 3WJWA 1TMQA 4NVTA 2QGYA 1J0IA 4IMEA 4WY0A 1IV8A 1A3XA 3PB0A 4O8RA 4XD6A 2Q5AA 2ONEA 4AB4A 1Q6FA 1IWAA 3SCPA 4YYFA 1VFOA 3MZ2A 3O9NA 1HFBA 2X1TA 5HR6A 5AC5A 3U7VA 1XH0A 1ONWA 3THUA 1BWKA 2CZ5A 2GSEA 1RHCA 4HMCA 2PP3A 5FAGA 3QM3A 2BXZA 1KGUA 1ISZA 4KPLA 1HO1A 3DDMA 1Q66A 1B54A 3GHTA 2AAMA 3KZSA 4I6KA 4GI6A 4G2PA 1UPPA 2VM8A 4HA4A 3LMYA 4X61A 4HOWA 1GQKA 1FBAA 3I7SA 4S3GA 1Q6EA 2EG7A 2OG9A 1NWSA 1H7OA 3WBXA 4KIRA 3PTKA 3TDFA 5IHRA 4F4RA 4AWEA 3R7MA 4JTAA 5HK4A 3ZSSA 1QXLA 5BROA 1C8QA 1UC5A 4Q22A 1V02A 4IL0A 2WW5A 3KZPA 1UD2A 2GJPA 2DZVA 2P88A 3N3TA 2W79A 4DM2A 2GL5A 4JHMA 3W2MA 1ODZA 3ZLHA 1A5OC 3CWHA 2PP0A 4AX7A 3EB4A 3OYXA 4PMRA 3UWYA 1LJYA 2ZZ6A 1UIPA 5D4YA 3GC4A 2WCAA 4LANA 3C6CA 2PWUA 3B8UA 3H2FA 2ACQA 1HKMA 1E6RA 4Q32A 1W5QA 3F4CA 1Y8BA 3KAOA 1CB2A 1ZGDA 1QPFA 4ZGYA 1PIIA 1T6MA 1UKPA 1W5OA 3O5EA 4LUSB 1LLZA 3KOWA 4IP7A 4LY8A 3QZAA 5I3HA 2QXWA 2BGSA 1DQXA 2QDGA 5HW8A 2KGJA 4FX8A 1QI0A 2YL5A 4B2DA 3HQPA 2WZMA 2C13A 1KW1A 3NEHA 3H2EA 1W3NA 1L0PA 3TTOA 3GD6A 4AU0A 3FOKA 5C55A 4UTLA 5EPDA 3WMBA 1D7FA 4GZIA 3Q65A 1I2QA 3IJ6A 4DAIA 5J8LA 4LS2A 5A6MA 3L4VA 5HW6A 3MUIA 1P6BA 2V5CA 1TV8A 5D2XA 4N7QA 5CZJA 3MQTA 4ZFMA 3B7XA 4HBOA 1TELA 3B8SA 4IQLA 1K1DA 4LT9A 4XG1A 5LIUX 4XVEA 5HMEA 4PB4A 2ZUSA 2M2AA 1QBAA 1OFPA 1XCWA 3TYUA 3U2EA 4JY8A 4AW7A 4KBXA 1BXNA 1HP4A 4Z0SA 1ITUA 2XYLA 1FHLA 1M3UA 1ML1A 2GK1B 4GVHA 5HJYA 2YZ5A 4QAIA 3ARSA 1N7KA 3TCEA 3VI2A 4BF7A 1EJRC 3P0WA 1VPXA 1TJ2A 5F4XA 4UZUA 2O9RA 3F4DA 1KWKA 2V3DA 2AL1A 4Z2LA 3WDPP 4R5EA 1U5JA 2QVHA 4L4MA 2CLHA 4GRSA 2PPNA 4QE1A 4M6PA 1RQBA 4XZIA 5EBAA 1O60A 3A4WA 3R13A 3CIWA 4MKNA 3KFTA 2GVGA 4JR5A 4HZ8A 1S38A 1E3ZA 3WYZA 3P84A 2PBGA 1RVKA 2BS9A 3LHVA 4Q4SA 2VZOA 4H7CA 1XICA 3MDWA 3RCYA 3CYJA 3AYSA 3S46A 4D1IA 5HINA 2R14A 4BWLC 2ZR6A 1W5MA 4XZHA 2WVUA 3E0IA 3DFTA 2PDUA 3CHVA 1W8GA 1QAPA 2Z4GA 3KBJA 4EF8A 3E0VA 2VGFA 2R24A 1X97A 2TSYA 2QZRA 1ZRQA 4F40A 1DWHM 1H49A 5IHSA 5KINA 3VINA 2QPXA 1NFBA 5HQEA 1U1HA 1S2WA 3ONCA 3MKKA 1XG4A 4BF8A 3T6CA 4B9ZA 1KXTA 1XLCA 3DFOA 4TX8A 3VX1A 4C6IA 2VYOA 4PUUA 2Z24A 4KGLA 3SCWA 3E0FA 1VC4A 2WSKA 3LS9A 1GG0A 3MCOA 1B3XA 2XISA 3PG8A 3RFAA 8RUCA 4XAPA 4LYPA 3ZLFA 1NH6A 4PB5A 3UPWA 4ODNA 4RJEA 2Y8VA 3MSYA 3W7KA 3LCLA 1E4NA 1AL8A 3TMQA 3WD2A 2MLYA 2Y89A 2E9MA 2FZ9A 1I0BA 3VKAA 4S3CA 1DWJM 3BV4A 3T09A 4Z2JA 4UTHA 3PZ9A 3WQEA 1OYBA 3REQA 3UJ2A 3RN6A 4AZCA 3UY7A 3CAWA 1C9DA 3SRDA 2JEPA 3W7OA 3JUGA 2MPHA 3R5EA 1H0GA 3MJYA 1UWQA 3FXGA 5JH8A 1MDRA 2WVTA 3NZ1A 3FAWA 3PBWA 1TPDA 3FJNA 2XGBA 2VC6A 3NQBA 5KZMA 3RX2A 3UWUA 2Z1XA 4K8GA 4LF2A 3L0NA 1DJHA 3GW0A 3W2UA 2YFNA 1XM3A 3W74A 2O55A 4IMAA 2PP1A 4LRTA 5JBFA 4JS3A 4LCSA 4AUBA 4ES4A 2VFIA 3WQPA 3RRXA 3O63A 1CLKA 3HQ1A 3PTMA 2LJ4A 5M5DA 3K1DA 1SZRA 1GEHA 1B0IA 4J2PA 3T8QA 1S1RA 4KGJA 1CIUA 3GTFA 2VEGA 4FNPA 4KFPA 5FEPA 1K3UA 3GE7A 3GDLA 1TVPA 5JU6A 2X09A 1NF7A 4YCOA 4WY0F 1MEWA 3TWBA 2FIQA 5CPLA 4KESA 3H6OA 2PV1A 2VGIA 1REQA 3EX2A 3RPDA 3EYPA 1TIWA 2W67A 1ADSA 1T41A 1LP6A 4MB3A 3FKRA 4F2TA 3V1HA 1QNRA 1MEHA 5FF4A 2Q09A 3NNTA 5HULA 3MW7A 1ECEA 3PWIA 2ZX8A 5H8MA 1G9HA 3EMZA 1WKDA 1VFMA 3S2LA 3KCEA 2Z7GA 4AIBA 1JCNA 4FXSA 2JGQA 3PBVA 3BVJA 3A23A 4D6GA 3UF9A 1M53A 3VDBA 4S3FA 3H21A 3IARA 3EBVA 4HYRA 3AHXA 4ILSA 4B5UA 2ZUVA 2CETA 2JFEX 4GMEA 5F7UA 4TO8A 4WSHA 2J79A 4OOUA 4XO6A 5DXXA 2OELA 4UTKA 3WNPA 3B0UX 2UBPC 2XFYA 4C6EA 4FX7A 2E40A 3RITA 3A6OA 3CTLA 2Y5SA 3N6HA 2DUXA 5A6TC 2NLYA 1OFEA 4MG4A 5I3IA 1XC6A 4O0ZA 4GI9A 1DHKA 1HQTA 3OBKA 1CZ1A 2HMCA 3LPFA 3T1GA 1IR1A 4E2OA 4WKHA 1O6IA 1H61A 3TSBA 4ZA0A 1LRNA 3ATYA 3W07A 1LWIA 3NL3A 1DTNA 1KM5A 4M1RA 4JEJA 3PZNA 3LN3A 4IGNA 4UR7A 1YTEA 3CIVA 1L8PA 2A6LA 4HTYA 2BGNE 2Y5EA 3CUZA 1E73M 1V3LA 3W22A 3B97A 3QR3A 1QI3A 4DJFC 1JZ7A 2AGKA 4NJGA 3IUDA 5ECUA 3WCZA 5DRCA 3L2LA 1TSIA 1PCWA 4LNCA 3RJXA 3GIYA 4W7UA 1CXFA 2BOFX 1RQHA 5DCDA 4UC5A 1UWUA 4OV4A 1GW1A 1TWDA 1BAGA 2F38A 2VD8A 4JFSA 3GNXA 1YNYA 3TZNA 3CNYA 1S2CA 1VD6A 3MSRA 4QTGA 1X96A 4D71A 3NQ7A 4JKMA 5AHIA 5AZ0A 3WQWA 1KGWA 1Q8JA 4DJFD 3KADA 1UIOA 3UWEA 4RDZA 3LQLA 1D7IA 2WKGA 3GK0A 3A9BA 1UB3A 4UB9A 3GVGA 1IT8A 1ZBKA 2FB3A 3VCRA 1WX0A 1SO5A 3N04A 5CJNA 3L67A 2ZRWA 1V0KA 3R11A 1Q6IA 1ZFJA 4K6AA 5CCZA 4FF7A 4GXWA 4CQCA 2GUUA 1J93A 3TW9A 3MZNA 1BWVA 5RUBA 3RRAA 5I03A 1R85A 1ISVA 3RGTA 2BVTA 2BDQA 1S3HA 4EACA 1XIBA 3E6EA 4HTBA 2ZZ2A 1E1CB 1RH9A 2HWGA 1SR0A 1KCXA 4HT3A 4JFTA 5M1TA 1MXGA 3AUOA 2E1WA 4QLJA 4FLOA 5D37A 4PBEA 1PZ2A 1U1JA 3T0TA 1H7WA 3FA4A 2WSQA 1EP3A 3H53A 4I9MA 4BWLA 1XD1A 4GNKB 2NX9A 4PL2A 1HKKA 1UUMA 2CKRA 4E38A 1AW2A 1F76A 1H62A 5DT7A 1CXEA 5AFDA 5DO8A 2WNWA 3GAYA 2YCKX 4JIHA 1W5PA 2I57A 1VFUA 3MWAA 4IG2B 4WF7A 2G37A 5CBJA 3O5RA 3ORWA 4CQ9A 4JTFA 3TLQA 3DI0A 1Z44A 2EPOA 1AW5A 4V27A 3CV7A 4TMCA 4WR3A 3HM7A 3M0YA 3WJXA 5HBFA 3WKZA 5A69A 4HOZA 4O0KA 4YPJA 1JCJA 1JPHA 1QBBA 1KXHA 3G1SA 1E1EA 4GXMA 3PC0A 4K37A 3B9AA 1MQQA 3NSXA 1DJZA 1UA3A 3OLGA 6XIMA 4M6UA 1JZ3A 1QWGA 3A4AA 1ZCOA 4ML4A 3ZVHB 1EF3A 4M6VA 3RO8A 4TIMA 1KBBA 3G0UA 1V4YA 4ODRA 5CG0A 3B0XA 2NQLA 3H24A 2ASHA 4W9QA 4GYFA 3ARTA 5HDRA 1D3GA 3TJIA 4JDYA 3O16A 1D2KA 1K02A 4IIBA 3BLLA 2QCMA 4AF0A 4GJJA 5AYYA 4O4WA 5CBIA 3YPIA 2VELA 1VBUA 4WSKA 4QHRA 1BKHA 3WFLA 1J6PA 3UZYA 3N11A 3C56A 2PV2A 3STCA 7CGTA 1TV5A 1CECA 3BICA 4IPPA 2VDHA 3QBUA 3OOBA 4GH1A 2XM2A 4JHZA 4Y9PA 4FR1A 1OF6A 1J2WA 3BLPX 1FH8A 3K8MA 3TYZA 3G8RA 1DOSA 4EPKA 1IGWA 2J13A 1EOMA 1MQPA 3P62A 4P7RA 1E72M 5FF0A 1JPDX 3BOXA 3A3XA 3CU2A 3OGRA 5EMYA 1NWTA 3LX9A 2WBKA 2PGEA 3GTHA 4Z1AA 2D22A 4TW6A 3HGJA 2YIHA 1XDLA 4J3UA 3KW3A 2PTZA 4H9ZA 4JL1A 1TE1A 4JFWA 5IOBA 3SFWA 3TYAA 1IEVA 1VHCA 1HO4A 3GIQA 5KMYA 1AJ0A 4KEZA 1FA2A 4JX4A 2BHYA 4I8DA 4NF7A 1O94A 3VD7A 1ISXA 4KQNA 1TPEA 3L4XA 3DGBA 3LM7A 2Y7DA 4PUNA 3B0YA 4NAEB 4PCPA 3NOEA 4U33A 1AQ0A 4WKAA 4PL1A 3GH7A 2F21A 1XKYA 4P8UA 1OGGA 2J8GA 1KCKA 4LV9A 3SCOA 1E6SM 3L21A 3G1AA 3TZFA 5C9UA 2QV4A 2RKXA 1AQMA 5MHBA 2KZHA 3CYVA 3WD0A 3P2VA 3W29A 2DW6A 1TQXA 5D30A 1HL8A 4DUXA 4J3VA 4HBKA 1PB0A 3S5SA 3N2XA 4AWTA 1O68A 4ICCX 4HCDA 2TRSA 1EJVC 1WA3A 1E0XA 2A3CA 1J6OA 9XIAA 3M6DA 3GHRA 4M82A 3VFLA 3T0BA 4DZHA 3K13A 3TU9A 2Y0FA 4DO6A 4ECLA 3UR2A 1FWWA 3ZM8A 1A80A 3PWGA 1UMLA 3VDAA 4HN4A 3T4CA 3HJEA 4C02B 3LBCA 3TCSA 5HWNA 5LZLA 2J77A 3KHJA 1FKWA 3RU8X 1IYXA 4DJFA 2VOTA 4RV3A 5CAHA 4CCEA 3VGGA 1A0CA 3BLEA 4JX5A 3G22A 4BQ3A 2DUAA 2PDBA 3LCHA 1EWDA 4JZ5A 4MMWA 4LNYA 4RLIA 3V16A 3FLUA 2DQXA 5EU9A 1IXQA 4XTIA 2PDNA 1PSCA 1QI2A 5DF0A 4DWSB 4WD0A 4L56A 3NQMA 3B9DA 5KTLA 1KB3A 3T55A 3WJYA 5LGZA 2D2GA 4NI8A 1OSEA 3OHMB 5A2BA 3WLHA 3SO7A 4I7WA 1KCLA 1ADDA 4CQDA 2VT0A 3RR1A 3EA3A 4DB7A 5LA1A 4Y7EA 2V3FA 4TTGA 1MRAA 3OTRA 4O17A 1EX1A 2PLMA 3HG2A 4MJ2A 2HPMA 1M7PA 2W66A 1X1OA 5CG7A 4I6VA 1QUMA 2E6FA 3ZVIA 3UBPC 5AB3A 1A3WA 1AUSL 1ZAHA 3NWRA 5DFAA 4PMQA 1A5MC 5D75A 2QJHA 4YVXA 4H8VA 3QLLA 3T78A 1U22A 4MB5A 8CGTA 4JTLA 4AD4A 1H63A 3FDGA 1JUBA 2WVVB 1N8WA 4JYFA 4CUCA 3UQBA 3TQPA 2YCEA 2ZUWA 1P1MA 4CQ8A 4JFIA 3WK3A 1PS9A 1BHGA 3T0CA 3HPSA 2IPWA 4F9JA 4KWOA 4RKAA 1NMWA 3EKZA 5EMUA 3I3BA 4CNNA 4Z1YA 4J2MA 4UZSA 1FHUA 2WSRA 2YDRA 2YLLA 4JNMA 1C7TA 1T8QA 4YYCA 1SR9A 2CERA 5GNYA 5BXJA 3EX1A 2PTDA 4XTDA 4ORMA 2DQWA 2D9FA 1J0HA 3BJFA 1IX5A 4QE4A 1TWWA 1V51A 3CUFA 3QW4B 4NNCA 1E40A 1UJPA 4RR4A 3GVQA 5D9OA 3UWZA 4AEOA 2QAFA 5FEXA 4L9YA 3SQLA 4BKNA 1D8WA 1KV5A 4XAKA 5F2IA 3EMCA 3DECA 4JBRA 1NFGA 4CQAA 4UFMA 3GC2A 2E0PA 3K4AA 3CTTA 3NR0A 2J6XA 1VBJA 1HTIA 3VILA 3BLIA 3V35A 3VOFA 1S5MA 4HCLA 5LIXX 1OGBA 2GJRA 2I1OA 2Y61A 3W2NA 3CPUA 1F6KA 2KI3A 3OPSA 5A94A 1FX6A 3VZXA 3PWAA 2VO5A 2E25A 4NZ4A 1JYXA 2CZFA 1Z48A 1O1ZA 1FKDA 5BU6A 2WAGA 4CCZA 5C9ZA 1Y65A 3MV11 2NVDA 1GOQA 4FO4A 4ZL1A 1QFEA 3N4EA 3KCLA 3N12A 1L6WA 4QDPA 1MW3A 5LIWX 2WJFA 4M29A 1YDYA 5EFFA 1WBJA 3LXAA 2XSBA 3KCOA 1S2TA 1UR9A 2NZLA 1XSJA 1LOLA 2RAGA 1POJA 2Z28A 4C90A 3UU0A 3V0TA 1Q2RA 1AA1B 3K2GA 2VDIA 3S2CA 1BGAA 3UT0A 4J3SA 3UERA 3W82A 2CNCA 4C6DA 2GWGA 1J0ZA 4DXVA 5HUPA 1YEYA 3PJTA 4ZFCA 3NXFA 4JQ4A 2YBUA 2CC0A 1JZ6A 1JGMA 1NELA 4L72B 3H26A 3UR5A 1GVFA 4ZQRA 2NQ9A 2VDGA 2H9AB 1GJPA 2L2SA 1TPB1 3TJLA 3KZ7A 2CXEA 1NDYA 4IQEA 3QQWA 4KEMA 4E4FA 1ONXA 2YXGA 4ATLA 1RA5A 4IMGA 3DENA 5CSUA 2VHLA 4EPBC 2OFNA 3VCCA 3ME3A 1QU4A 4JQAA 4N6FA 1LLWA 2CHRA 2PD9A 1ICQA 4RPPA 2WZEA 1XYBA 1XCXA 4MPKA 3W1LA 3FHQA 1GG1A 2F6XA 1OCBA 2PDHA 1XLLA 4KWSA 1UH3A 3TW7A 2DIKA 4Q8NA 2ZC8A 4ADTA 2AQVA 4IFKB 4JDBA 2PWGA 3C2RA 2GJNA 1QZ2A 2V5BA 3LPOA 4HU4A 4I9TA 1GVQA 1VIWA 2FZ8A 2E5CA 5D8ZA 3OBAA 2DSZA 3GVVA 4JTRA 1JI1A 3W6MA 1CENA 4ZSTA 3M0MA 3AC0A 1B3YA 3KOXA 2B7QA 2PZNA 3S5OA 2G3FA 1EDTA 3A13A 1KFCA 3ANUA 2YGYA 4ACZA 4OKDA 5CZSA 1EEPA 1VFHA 2GOUA 3LV5A 3WBWA 4AQLA 1QW9A 4U85A 3G1VA 3GXFA 1K7EA 3NO5A 4HKPA 3T0AA 4UFIA 3CIXA 4PUKA 3ARRA 2INFA 3FA3A 4MJZA 4ZO8A 2PDMA 4V2XA 4WJXA 1MYRA 4TXEA 1H41A 4O50A 2GDQA 3LB0A 1HJWA 1VGAA 5CPTA 4A6GA 3STFA 4DZIA 2VURA 4TX9A 1J4HA 1W3KA 2YW4A 2Y4SA 3Q2DA 3V5FA 2FDMA 3Q94A 5D05A 4CNPA 4IJBA 3OVPA 4TR9A 3TK7A 2VP8A 3S0CA 2C1GA 1OT1A 1YPXA 1YW1A 4UQAA 1XPYA 3MHFA 4X9SA 4MYXA 4LRSA 3LBOA 4D6DA 2LKNA 1C3FA 3B4YA 4WUIA 3QFEA 3WUEA 1JRBA 1V02E 4N02A 4D6JA 4ZB0A 1H5YA 2QMKA 3GZAA 5CPSA 1Q13A 4H7VA 4GD0A 5HQLA 3SFKA 3LHUA 4NXKA 2ACSA 2OTDA 4JKKA 1ELSA 3CAVA 3WQVA 2TODA 3CEPA 1QI5A 2ZUMA 2X1SA 3ZFHA 1L1PA 1UCWA 1G1YA 1PCKA 3OLIA 5DRIA 4GI8A 4YWIA 3WLKX 1NY1A 2X0HA 5EGRA 1GVRA 2WC3A 1U5HA 4DPQA 3ISIX 4LB3A 2OSXA 1ZHAA 4JYSA 1JDDA 3HG5A 1G7VA 4E8DA 2FGBA 2NQJA 3LGDA 4MVAA 2QVNA 4K68A 2AMGA 2QJJA 3PFMA 4PRRA 2QIIA 3CGMA 2IPGA 2KR7A 4P7LA 3QC0A 1TQJA 2KX9A 1B4KA 5IBXC 3KP0A 2C15A 1OC7A 4PB3A 2Z6IA 1JVNA 3AXKA 1L6GA 1PX8A 5IRPA 1F6YA 1IE7C 5EMMA 4O1CA 3VIFA 2X7VA 4A3RA 3UJSA 4EANA 1W1B1 3KP1A 2G5WA 4JTSA 3E1F1 1QPOA 1M03A 2Z7KA 1IIHA 4PMXA 3WELA 4Q4OA 3A24A 4WOZA 1JAEA 3MI2A 4ATWA 2YL9A 3L7RA 3R0KA 3FKKA 4GVIA 5DMNA 2ALRA 4IJCA 4KRUA 4AEEA 3ANVA 2WHKA 4CNUA 3UCDA 5B7ZA 3V0SA 1SVDA 3ARQA 2CLEA 4D8LA 3FNDA 2ACRA 3LZ3A 4IPXA 4PA8A 4ZOAA 1JDEA 1WE5A 3CBWA 4YS1A 3JZUA 1TJ1A 5A6SA 3M0JA 1TR9A 2G4JA 3UD6A 2VFHA 2WSYA 3SECA 1ITQA 3GXNA 3P3BA 3S2JA 1W1A1 2BY1A 2A4AA 4AWUA 3K8KA 3AXXA 3WLTA 1XV8A 2GJXA 4OBRA 2OEJA 3GDBA 1XUUA 2W61A 2GUYA 1OX4A 1MUMA 1O95A 3P80A 3BG9A 4B15A 2ICSA 3WLMA 2W3ZA 1Z9AA 2G96A 4LAYA 3WMSA 3VGBA 3WUGA 1W54A 4WJ8A 2HXUA 3WDQA 5AC4A 4LVDA 3CT2A 1XL9A 5CSRA 4LAKA 2YBTA 3TROA 1VFLA 1FKSA 5CPNA 3AIQA 4U3CA 4K8HA 6PTDA 4N4QA 2ZTKA 2PD5A 3GIPA 4DYEA 2ZRVA 2E3ZA 1VENA 4PRTA 2F61A 4L7ZA 1GPWA 4HMDA 4IPIA 3LQGA 1LOSA 3JXVA 3SY8A 4Z08A 5M03A 3SRKA 2QJMA 1VCVA 4S3BA 1UPMB 4YJ5A 1KFEA 4JIEA 3M43A 3I4KA 2A21A 1ZL1A 1Y5VA 5ABHA 4AZ6A 1DYSA 4GGBA 1WOAA 2PUZA 1KRAC 1W56A 3CZ8A 1KBLA 3A4JA 4H9VA 4XIMA 4J7RA 7ODCA 4YVVA 4LALA 2PB1A 5LA0A 3CO8A 5GJPA 4FNTA 1LTDA 4L4PA 4PMDA 3MV01 2RQSA 3N25A 2IXVA 2PDIA 7TIMA 3N13A 3RM9A 1GUVA 5C5YA 3GXIA 2KFWA 1FDZA 2VX7A 3KM8A 4F0KA 1W6TA 2R82A 2B31A 4U86A 1GGOA 3UZXA 4IMCA 2EJ1A 1BGGA 1NSJA 3W0KA 4RXGA 3H7UA 1FKBA 1HGWA 3UZZA 2ZVIA 2VQUA 3EDFA 3WBEA 1TV4A 2F7FA 5H8UA 4ZVJA 1EDQA 3M64A 4OT7A 3MBFA 4JTTA 1UG6A 4QT3A 2OZTA 5ENLA 2F2DA 1BQCA 4JKLA 3NYZA 2EXOA 1W0MA 4KRZA 1EC7A 4C6FA 4B3ZA 4HJWA 4IT6A 1TJ0A 4H00A 1W31A 3NURA 4X0VA 2V69A 2VEFA 4C6OA 3PZMA 3E5PA 5CXPA 4LS0A 3BC9A 3RMJA 1OG0A 4HHLA 4X3ZA 4P7NA 4OOZA 1EGVA 3TN3A 4LUYA 2D20A 6ENLA 4LUSA 2CWNA 1M04A 4JQ2A 1PYMA 3GH5A 1EH9A 3LCIA 5BRBA 1AMKA 3C0LA 3F5KA 1T8XA 5A8MA 1EQ3A 4B4HA 4B4FA 4D6HA 2JZVA 4B3LA 2XP7A 5A8NA 5AECA 4DRNA 4LEFA 4YHGA 1VFSA 1V3MA 3NO1A 3PBGA 5HTGA 1P0KA 4HBEA 2QJNA 2Z2BA 4NSBA 3MHUA 2H3DA 1KM3A 1NTHA 1Y0EA 4X22A 3SRFA 4UR8A 5A5WA 3CH9A 1PDZA 2OQHA 4TX6A 3LOTA 2YA2A 1XYFA 4YIWA 4L9XA 5JXQA 1SZNA 4GWEA 1IXNA 4LQ1A 4GFSA 5FJIA 1HNYA 2WOQA 3PS7A 3HJZA 2ZZ1A 3IIXA 5TAOA 3UG5A 5MKGB 1GOKA 2ZA2A 3LA4A 3QTGA 1SQ7A 1ODUA 2F6KA 3PY2A 5M17A 4NJIA 3PZOA 1BXBA 1EUAA 1C7SA 1KBKA 1W32A 1GJWA 1FKIA 4DRJA 3TSMA 1YBQB 3GHUA 4Q7BA 1OIMA 3V7PA 2FFIA 4GBUA 5K9XA 3IEBA 4W5UA 2NV1A 4HU8A 1EJ7L 3TUUA 1TMLA 4UCGA 2Z26A 1EB3A 4UXDA 1HKJA 4DYKA 4PFMA 1SGJA 1GTEA 3R79A 1LOQA 1VS1A 2C79A 2ZX9A 1YKWA 1XINA 5LXXA 1OHLA 1XH1A 2OYKA 1B31A 2YL8A 4B5TA 4YHEA 3GR4A 3IK2A 3GQYA 3QTPA 3UR7A 3LSCA 1J6YA 2PBOA 4AXKA 3E96A 2RDUA 2WC4A 3SSJA 4Z17A 3GO2A 4M3PA 5CJ5A 2PC4A 1OWQA 2QDHA 2ZXAA 3WJZA 3NZRA 2PF0A 2J7FA 2MNRA 2I5QA 3MP3A 1KR0A 1YIXA 4F2UA 1IZKA 4JL2A 4UNLA 4J3ZA 2A2IA 2ATMA 2OO0A 3NYDA 3OGSA 3W71A 2X1IA 4HK7A 4UMBA 1ICPA 4KH2A 3BG5A 5HNRA 3EOEA 4QEHA 2ON3A 5E09A 3BOFA 4QS5A 1B3WA 4LPCA 1NU5A 2HVOA 2GDVA 4A3YA 4GABA 8TIMA 1QHPA 5FD0A 4NX5A 3PZUA 2GOKA 4M24A 3OZOA 3MI6A 3K8LA 2DORA 1LDCA 3NGFA 4WGXA 3L5AA 2D24A 2J27A 1W3JA 2QNEA 4IGHA 2F84A 1GOXA 1Q6RA 2AWGA 2QV5A 3URNA 1WDPA 4BI6A 4JEQA 3S5ZA 4HCHA 1WBHA 4C6KA 4GIEA 1S5TA 1AH0A 4EE9A 2EG6A 4WHBA 1Q6DA 2QCHA 2IW0A 7ENLA 3ITXA 1XQLA 4IQJA 4N0RA 4D8AA 1FFQA 3UW6A 1LRTA 1S2AA 3UYCA 1JCYA 3PHAA 1F4AA 5CQ1A 2REQB 2ZXQA 1ROTA 4H2CA 3WLJA 1UKSA 2NWSA 3NM3A 1KFWA 1ZJIA 2PWEA 3TX9A 3GDMA 2GJLA 1PVNA 4H6QA 3G1DA 3WD4A 4MGGA 3POHA 1RUSA 2WCGA 4LTSA 4PTMA 4NJHA 5I2UA 4O10A 1HF6A 4MDOA 1NM9A 4FLSA 4OE7A 3VOGA 3HGSA 1TO3A 3MC5A 2TPSA 4Y6GA 4DF1A 2GDUA 1D6OA 3PZVA 1I1WA 2ZQ0A 2PLJA 4S2BA 2ZX7A 3MVIA 2OZ8A 4QG8A 1JFHA 4AISA 1GKRA 2G50A 4DY1A 2GGIA 1P0NA 3W26A 3A47A 3TFCA 4ZO6A 2PS2A 3T2PA 4JTIA 1DXFA 3IUIA 3N17A 4PCSA 4C7FA 1T7LA 2DSKA 2X8RA 1V6YA 3N4FA 4YTUA 5DMMA 1JVWA 1EBHA 1GNXA 1DQWA 3LHYA 3RM4A 3QSRA 5IXEA 4HVXA 2FZMA 4PUJA 1SFTA 5CC6A 4N9BA 1OFOA 2V5DA 1ME7A 3W7EA 4A8IA 4LCRA 1YMYA 3WLOA 2W62A 2OLAA 3EDJA 3IJDA 4LGXA 2XIJA 5A6LA 4AD0A 3W38A 3UJFA 3QZ6A 5MF5A 3UI5A 1XRTA 2ZIDA 3EDKA 1JCHB 5DMYA 3NPUA 2ZOXA 2CLIA 1XKJA 4EK7A 5IM51 1UR1A 3GH4A 1JUEA 4K1WA 1UD5A 3R8GA 3GHSA 4NNBA 3HIJA 3QMTA 5BW6A 4PFHA 1VH7A 3G5EA 2E28A 3QYSA 5AOUA 3VIHA 3RIKA 4AAJA 4J4OA 3LYEA 1JD7A 1QOPA 3S1XA 1B2YA 4DZ5A 4S3JA 3KTXA 2ABAA 2DP3A 4RDYA 5H2ZA 3NQDA 4DN1A 1Q7MA 1UW9A 5C7HA 2VRQA 1ISWA 3HURA 2FGLA 3EPOA 1W1IE 3VU2A 5FESA 5JQ9A 1YE6A 1PTDA 1XGZA 1FVPA 2YSWA 3S6TA 7REQB 1E5NA 3NQEA 3ES8A 1DXIA 2WV8A 4O1FA 2ISVA 3VIPA 4ASTA 3BDKA 4HPNA 4GC4A 3IPWA 4ZO9A 2ZZ5A 5FOOA 3NEVA 3WBAA 1MQRA 1T5AA 2C18A 4GGQA 1PKNA 2ZRZA 4QCEA 2N87A 1Y5WA 3SJ3A 3LLFA 2DDXA 3MU7A 4BFAA 4CN6A 4N9EA 1Y5XA 4M8UA 1JZ4A 3IK4A 4C6NA 1JNEA 4ONVA 4E2BA 2EJAA 3PPGA 3M7SA 2HSAA 1KD0A 3TJ4A 3VNKA 3O1NA 2Z1BA 2WPGA 3AS0A 1R7OA 3FS2A 3HF3A 4QLKA 4AVNA 1XJBA 1XISA 1FTXA 5JH1A 3G1HA 3LK6A 5LNWA 3NL6A 4QJ4B 1KBJA 2NLIA 3CL6A 3I3EA 3SGGA 1GVEA 4DIPA 1FWTA 4TVUA 3LPPA 3WNMA 4DWSD 1JPIA 4DJEC 3BZJA 4DJDC 3Q58A 3H70A 5D09A 1QI4A 5E9XA 1WB0A 1J8VA 3UJRA 3THCA 1FWIC 4US6A 1U83A 4IJRA 4AX6A 5I02A 3TC5A 3MKVA 4X60A 1I6NA 3W1AA 1MUCA 2RUCA 3QMRA 2VZVA 3ZO9A 3K4WA 3GDKA 3W01A 2WWCA 2EKGA 4KT2A 1SFLA 3NPVA 3TYDA 3EAUA 1CGXA 2PRMA 4O11A 3SZ8A 4DJED 4C5YA 4DJDD 3T2OA 3QHOA 1KLYA 3LDVA 1LORA 3CUGA 3RCNA 2J7EA 4M1BA 1D3HA 1OX6A 3WQCA 1S5VA 3L12A 4C6LA 4GCXA 2DZWA 1R2SA 1EYEA 7PTDA 3BK0A 5GJMA 4EIVA 4N19A 3BQ5A 1YYAA 4IT4A 3TTSA 4NP7A 1HJVA 4AMCA 1R38A 2BBFA 4J3WA 1T0OA 2OB3A 4TUFA 3GXMA 2Y62A 4IG2A 3GKAA 5AHLA 3KAHA 2FAPA 3W70A 4O0QA 2Q3OA 1PXGA 3O8AA 4W8AA 3CZGA 3W86A 2MLZA 4FXJA 4XAFA 4D6CA 1F07A 1DXEA 1KQZA 3W7IA 3HGRA 3EOUA 3ZS4A 3UR8A 3WNLA 4ROQA 5EY5A 3P61A 2VGBA 1OK4A 3N2MA 4HA1A 3E38A 1J5SA 1UKTA 1A7XA 1I9CB 3S3GA 4V1XA 1HZYA 4NJKA 5FL0A 4TYOA 3W72A 3GDRA 3P6LA 4HNLA 1XDMA 1ZBWA 3ZVHA 4TNSA 2X05A 4GHRA 4WCJA 5A95A 1WYIA 3VIIA 3GXPA 3VNYA 1Q6GA 3RILA 3KOZA 4FX6M 1DIDA 2VGGA 5JUVA 3CH0A 1KNWA 4HHMA 1W3TA 1WZLA 2XFWA 4GKLA 3S1UA 3H2OA 3NI6A 4Q4RA 2HPIA 3AIVA 1M7JA 4P8XA 1W37A 3W1XA 4PODA 1K03A 3DG7A 3BSMA 2PDCA 4FOJA 1EFZA 1ITCA 2Q8XA 5EMLA 1FH9A 2Z1KA 4OV9A 1E1FA 3A4XA 3U57A 4I7UA 2RJGA 1TX0A 4GQQA 1EWEA 1C29A 1TA3A 2J7HA 1L2UA 4QISA 1XLJA 2GFTA 4PSRA 3WQ8A 4O15A 5DMLA 2AOSA 2BX7A 3WK0A 1XYMA 1UP2A 1TVLA 4QQUA 2ETNA 1SJDA 4MY1A 3AZRA 1VBGA 4YXGA 3OVGA 4LAUA 5HWBA 5C0QA 3CPGA 2NWRA 3UGRA 4CEUC 4QDWA 1LL7A 4PMOA 2E6YA 1TB3A 4Y8EA 5CPMA 2PF8A 5L9FA 1US3A 3NQAA 5CGTA 1FWNA 4UOQA 2YDQA 4Z2GA 4PRWA 5HKGA 2GUBA 2ADAA 2A3BA 3XINA 3TR2A 3QH2A 3UZJA 3VOHA 1VYSX 1W9VA 2ZRUA 3JVAA 1EA9C 4GUIA 2VEIA 2VNCA 2ZE3A 1OC5A 5A1AA 1G5AA 4RZ6A 1SO4A 2AAAA 3SRHA 5FJTA 4MSSA 1LYXA 2CW6A 3AALA 3EX6A 1SZGA 3F4WA 4WK9A 4BQ5A 3VKBA 3CHDA 5GNXA 4HNVA 1GHRA 1MW0A 2GZXA 3QOKA 1DBTA 5ECVA 2P3EA 4PTWA 3KL0A 1W9PA 3ERPA 5D33A 1FJDA 3AHVA 2V30A 5CZ0A 2V38A 3IJLA 3VVGA 2A7RA 3W73A 4GH3A 2G0WA 3O15A 1QO2A 1L6FA 1IEQA 5K3VA 2FZBA 2WKLA 1M41A 3VTRA 1Q4WA 4C1LA 3AOFA 3FN9A 3SUSA 2A7NA 4H2HA 3FGCA 1EP2A 2XTKA 1Q65A 5G4HC 3M0ZA 4QXIA 4G7EB 2IQ0A 4LXFA 4GG9A 4Q33A 2MNTA 5JIPA 3CAQA 2V5LA 3UNDA 4IH3A 3IKDA 3B0VC 2XP6A 2WZIA 3HFTA 2A3AA 1RJPA 1OCNA 3AHYA 4G1KA 1GYLA 3USBA 4GYKA 1FCBA 4ENLA 4DWSA 3PRBA 4Q8VA 4IUOA 4ICNA 1PDYA 3SUVA 4NNRA 3G1YA 1MNSA 1JYNA 1RCQA 4NZ1A 5HWJA 4CKQA 4RNHA 1ZK6A 3GS6A 3CWNA 4ZPVR 3CZLA 3W7DA 1EQCA 1F8IA 1QK0A 3UXDA 3HTWA 1TTQA 3S1GA 3PR9A 5KETA 2DSUA 3SW6A 4XZWA 4W8LA 1UROA 3B06A 3FIGA 1TIMA 2A85A 4FN2A 1X98A 4DJEA 3KOYA 4FXRA 2W0UA 3G3DA 3S47A 4DJDA 1OFRA 2V0TA 1LQ2A 2DZSA 2PMQA 1RVGA 4J40A 1VEOA 1VJIA 1ZBVA 3EPMA 2F23A 1H7XA 3EMQA 3NJ3A 1OADA 2XG9A 3LPGA 1X8CA 3G1FA 3DEQA 1A50A 3KCJA 3S6OA 4FEZA 4P2VA 3LBMA 1KM1A 2UY4A 3KRBA 1N55A 2NXGA 1GONA 4B2DD 3I3DA 3R43A 3KRZA 1EZ2A 3PPHA 1QPNA 2RSEA 1FRBA 3SAZA 2OWCA 5G2HA 4HNUA 4WEVX 2RJHA 3SIZA 3QXBA 1CXIA 3WIJA 4RNIA