2G8ZA

Crystal structure of the ternary complex of signalling protein from sheep (sps-40) with trimer and designed peptide at 2.5a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ternary complex of signalling protein from sheep (SPS-40) with trimer and designed peptide at 2.5A resolution
rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 118
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2g8zA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2g8zA01
1QI2A 5DF0A 1OD8A 4HPGA 1M01A 1BPLB 4H8VA 2WM0A 4H8HA 3T08A 1DWIM 5A95A 1ISXA 3I3EA 4BA0A 4DWSC 1E40A 1UZ4A 3BC9A 1B3WA 3N15A 3W28A 1JNDA 2IXVA 4H04A 3T2PA 1GOMA 1NARA 2DSKA 1XSIA 5A6BD 1WZKA 3HN3A 2OWWA 4AZIA 1LWHA 3WIJA 4PTWA 1WZAA 5AYBA 5HPCA 1ZU8A 1R7OA 1LL6A 3EBVA 4L4OA 1ISVA 3ARUA 1Z32X 3WDPP 4QLJA 3QOMA 1GUVA 1S46A 5E9AA 1UH4A 3ZT6A 5IFTA 3N18A 4OBRA 1CYGA 2GJPA 1KXHA 2DT0A 1UHVA 5JIPA 2J7GA 3CHEA 4MNKA 3W29A 3ARQA 1M7XA 2J77A 3ZR6A 4QFUA 4UFIA 1JD9A 2XVNA 1M04A 4WSKA 5HNNA 3WQ6A 3WDQA 5CQ1A 2WCAA 5HBFA 2HVMA 1BGGA 3VM5A 1FHLA 3M46A 3WQWA 4GZIA 4LPCA 4YN5A 2YBTA 1QI3A 2VX6A 4AD5A 1RP9A 2OYMA 1G0CA 2ZUMA 2D0HA 4GO8A 1TFVA 3BXWA 3AZSA 2VJXA 5JUVA 4KWUA 3IJ8A 4F66A 3WUBA 5BRPA 3EMCA 4UQDA 1E70M 1J0HA 2PI6A 3RO8A 1CGUA 2XIIA 1W2PA 3L2LA 1OCQA 4DUVA 4V28A 1UA3A 4BS0A 5A2CA 5AYIA 4RE2A 4F8XA 3EDEA 3AMKA 3N12A 3SCTA 1E43A 1KGUA 1TZ7A 4TVCA 5EMYA 4P7QA 3GNPA 5FL0A 1B31A 1E72M 1BYAA 1OSEA 4X9YA 4B9ZA 3CUGA 4HZ8A 4GI8A 2JEQA 2CBJA 1ESWA 1H41A 3PTMA 2VZVA 2VMFA 4J3SA 1JXKA 4D72A 4AD3A 2QPSA 5A2BA 4F79A 1GNXA 4GINA 2OWXA 3POHA 1GOKA 2JEPA 4OUEA 1AQ0A 1QI0A 1MW2A 2WSPA 3VO0A 4CU8A 2CERA 4HZ7A 3ZOAA 5D9PA 4P7LA 5HXMA 1H0IA 5M5DA 3W0KA 5IDIA 4OIFA 4QP0A 1LLOA 4BZYA 4IISA 3AIQA 4P7NA 3RCNA 1B3YA 1ZS2A 4P7RA 2PBOA 3CIVA 1V02E 4PSRA 1BYBA 2XWEA 3B8SA 1WZLA 4GO9A 1UG6A 4E2OA 2G3JA 1HXJA 3UR7A 1R85A 2BVTA 1U30A 3VD5A 2E9LA 3VMOA 3BAKA 4AIEA 1JIBA 4D6CA 2J7BA 4JFSA 1JGIA 4Z2IA 3GXMA 2J62A 3PZOA 1HP5A 1LF1A 4E8DA 1H49A 2D3LA 4MAZA 1EA9C 2J47A 4RL3A 4JZ5A 2WAGA 4MNLA 4LYRA 1CENA 1AQHA 4PTVA 1X6LA 2DH2A 3VVGA 4JCLA 3AZTA 3RPMA 4AD1A 4UR9A 2YBUA 2E40A 2CIPA 1N82A 3VKKA 2W61A 5D9MA 1SR0A 4W8BA 1HVXA 2DH3A 1K9TA 1EDTA 1CGWA 3BGAA 4UFMA 3MV01 3D3AA 2WLYA 3CHDA 2VNCA 2EQDA 3PZUA 1VIWA 3WY1A 4TVUA 3NSMA 2ZUWA 4MNJA 1PX4A 3UEQA 1NM9A 2WHKA 4MAVA 3POCA 1HX0A 5AC5A 4AWEA 2DSWA 3TP4A 2ZUVA 4XX6A 1HJXA 3APGA 1W9XA 2VQTA 1UH3A 1XGZA 2WVVB 3SIMA 5LA0A 1UR9A 3WD3A 2WC4A 3OLGA 4NRRA 4HMCA 2WXDM 2BHZA 1FH9A 4ZE4A 1E71M 1KWKA 3PZIA 5KEZA 3N9KA 4CD5A 3WF3A 5A1AA 4AIUA 2O92A 1I1WA 1BTCA 4C7GA 1OINA 2D24A 5D4YA 1B3ZA 2O9OA 3VPLA 1MYRA 4ZENA 1V02A 1G01A 3IK2A 5ABGA 3FW6A 3ZJKA 1W9VA 1G5AA 1F4AA 3NDYA 2VX4A 2OLHA 2PC8A 3AHXA 4W7UA 3BAWA 5A8NA 4QCFA 5EB8A 2X8RA 4M24A 2PWGA 1CTNA 3MMUA 3L4ZA 3QHOA 1RPKA 1HT6A 3VIGA 1J0ZA 2VZUA 1BLIA 4UOZA 3AS0A 1VBRA 3T2OA 3WQ8A 1ISYA 2ZE0A 3PTQA 2F2HA 1MQRA 3AHZA 1VFUA 1VEOA 3A3HA 1DHKA 4MDPA 4HTYA 1V3MA 4HA1A 3AMGA 3L4TA 1J0JA 2XG9A 2EPMX 4ZXLA 4UQBA 5A6MA 4ZXOA 2DGAA 3EMQA 2WMJA 2WANA 4PCSA 4MB1A 3F5JA 1VRXA 1JZ4A 2V3DA 2AAAA 1CXFA 4EAMA 2GSJA 5BRQA 1OD0A 5JBEA 2YJQA 1F4HA 2DEPA 2WMHA 3K4DA 3O2LA 3WH5A 1QI5A 2XFYA 1GCYA 2ZUUA 3SUTA 2E9BA 1LJYA 4XUYA 5A6JA 2CXGA 2ZXBA 2E8YA 2E4TA 3GH7A 4OKDA 1W3KA 5CJ5A 4D6DA 1V0KA 5DFAA 1V3JA 1B9ZA 1WZMA 3W6LA 2CBVA 1OGBA 4Z2LA 1EQPA 2EO7A 2JFEX 3CLWA 4J7RA 3N11A 3VIIA 1E4LA 2FGLA 2VZOA 4U31A 1MWOA 3KZSA 5FOOA 2VR4A 2CESA 2VRJA 4ML4A 1WP6A 1NP2A 1UUQA 4J3TA 1LWJA 3KEHA 3WUFA 1XYFA 3WD2A 1B1YA 6A3HA 3K46A 1NH6A 2G3IA 5IFPA 2D0GA 1W3LA 2Q8XA 3I3BA 4CD7A 1QW8A 4TTGA 2JE8A 2WMIA 1QNQA 3FN9A 4PMXA 1TUXA 4DWSA 1HIZA 5JBDA 3ECQA 1PIFA 4WKFA 3VIPA 2WKLA 4LX4A 1WDQA 3WMBA 1Q6DA 1W1PA 4U3AA 4M82A 4DUWA 1VF8A 1XHGA 1RH9A 2BVYA 2XGBA 3T09A 3OB8A 1ODZA 2BXZA 2VT0A 3BAIA 2YKKA 4JIEA 3ZO9A 3AIVA 3BCFA 5CSUA 1A47A 4NF7A 1XCWA 2O9PA 1FA2A 1Q6EA 1HKJA 1FFRA 4PMYA 2CHOA 1BYCA 4P8UA 4RE4A 3WBAA 3IJ9A 3NUKA 2BHYA 3DYMA 1B30A 3MU7A 1GONA 2X0HA 4BQ2A 3VD3A 3WH8A 1UKPA 3O9NA 4R27A 4CN1A 1K9DA 1RP8A 3WQ5A 3TTQA 3WD4A 1H4PA 4AW7A 1E56A 1CDGA 2YL6A 3MUIA 4N42A 3OZOA 2WK2A 1JZ2A 3PZQA 4DWSD 2XFFA 1CNVA 2WWCA 4A3YA 4MJ2A 3CTTA 1CXIA 1KGXA 1V03A 5E6YA 4MTVA 1GHSA 4D6JA 1JF6A 3PHAA 3AXHA 3E1F1 1G9HA 4XZWA 1W9PA 3VIHA 5EBAA 1CPUA 5ABFA 2ZXDA 4KMQA 5M03A 3L4XA 4H8UA 4TUFA 4AZHA 1W9DM 3CUJA 5DT5A 3F4VA 4H7VA 4EK7A 4MB5A 3IAPA 4MB3A 4B9YA 2DIEA 3BCDA 4PBGA 1W9BM 4GXPA 1Q6GA 1BVZA 3GZAA 1OT2A 5CGMA 2OSXA 4X0NA 1WB0A 1HNYA 3SCPA 5C8BB 4BQ4A 2WBKA 5CXPA 2WKGA 3WEOA 2YA1A 4AZ7A 4DM1A 3K4AA 4L4PA 3M07A 1HJWA 1FP8A 3WDHA 3SCWA 3VDHA 3WF1A 4HMDA 2JF7A 5CSYA 2DIJA 3RM4A 4TX8A 3UESA 1K9EA 1E6QM 2J7CA 2Y2WA 3U5UA 1KGWA 5M3WA 3QOKA 3MUZ1 2WMIB 3OLDA 3VGGA 3WBEA 2J7DA 2QF8A 1QNSA 1VFMA 2E0PA 3SUWA 3WNPA 2XFRA 1CGVA 3DYOA 2VCAA 3KE0A 1TG7A 2DSVA 4PMZA 2GVYA 4A3HA 2E9MA 2XM2A 1CXKA 3FHAA 3AXXA 1YHTA 4JAWA 2GJRA 1ISZA 4GKLA 3WMCA 1CGXA 2UY2A 3SCOA 1JNEA 2ZX8A 1GQKA 1OIFA 2CNCA 4MDOA 2EEXA 4CD8A 1LG1A 2VOTA 5DT7A 3PZ9A 1PIGA 4HPHA 2VVNA 2W67A 4HP5A 1KXVA 3T0AA 4HA4A 3VGEA 1QHOA 2J75A 3A6OA 4R5EA 2CKSA 3MUY1 3WDJA 5CLTA 1HL9A 4FLSA 4YPJA 2X05A 5CG0A 2WCGA 1GJUA 1EQCA 2GDVA 4UQEA 1ZBCA 2IXUA 4OJYA 1J11A 1MVYA 1C8XA 4TOQA 3ZJ7A 5A6AA 1FP9A 2MANA 1KQZA 2BXYA 1UYQA 2OYKA 1DWFM 1JYNA 5FD0A 4YHGA 4XZBA 1B2YA 1B0IA 1AQMA 2DT3A 3NIYA 1E6XM 4AZGA 1ZL1A 3WL1A 4RE3A 5GNXA 1HN1A 1V6VA 1EOKA 3K1DA 3AS1A 5E0FA 5I23A 2D22A 3VTRA 3GM8A 4D6EA 1W9UA 3IANA 3MUAA 3NDZA 3ALGA 4JFWA 1UD6A 4UFLA 3WF2A 4AZBA 1UR8A 4PN2A 3PZTA 1PX3A 4GQRA 2QMJA 3BAXA 1BVNP 1HJQA 1ZJAA 2X1IA 5CGTA 1EO5A 4PMUA 2D2OA 1QBBA 3FNDA 1GQLA 2YL8A 1OBAA 2A3BA 1BAGA 1J18A 4W85A 4UFJA 3AYRA 5D9NA 5HPOA 3A4WA 4PUEA 3WN6A 3AS2A 4W87A 5BXSA 3G6MA 1V3IA 1C90A 1R7AA 2JF6A 1UOKA 2VZTA 3GDBA 1R87A 1ECEA 2UY5A 4LYPA 3GH4A 1HF6A 3VGBA 2GJXA 3VOCA 3U7VA 1W1YA 3PZNA 5IHSA 2ZUSA 3SURA 2BFGA 3SCQA 4HZ6A 1HKKA 1NWRA 4FMVA 4U2YA 4JKKA 4OBSA 1JFXA 1UD8A 1EIBA 1E6NA 2YDRA 4B3KA 1IZKA 5A69A 1ZBVA 2X09A 4GI6A 5D8WA 2F8QA 3WELA 1G94A 3ZSSA 3RM8A 3ZQ9A 3WEMA 1JG9A 4HU0A 2C7FA 1CBGA 1QW9A 2Y24A 3ARVA 3WMSA 1EDQA 2O9RA 1BFNA 2YDQA 2PWDA 3CGTA 1PZ3A 1XSJA 4OZOA 2GFTA 4WIWA 1MW1A 2CHNA 2AMGA 4AD4A 5I24A 1HKIA 3VNYA 2WBGA 2BY2A 5BCAA 1K6AA 1J01A 4UFKA 3SCUA 1E73M 3RM9A 2WNWA 1H2JA 1H1NA 3BAJA 3VU2A 5DMYA 2WVTA 4GI9A 2WHJA 4M81A 1KBBA 4D6IA 4U33A 1L8NA 1WCGA 3CZLA 4M56A 3KL3A 2WW5A 2UWFA 2OSYA 3NYDA 4W88A 5E70A 4D6FA 3WD1A 3CMJA 4PMRA 3VIKA 1V08A 3OG2A 1A3HA 4PCTA 1QOXA 3WNKA 4PTMA 5JIWA 3KL0A 1UH2A 2VCBA 3PZVA 1ZJBA 3T2QA 2DT2A 2CYGA 1FHDA 3OA5A 3K8KA 2VZSA 4IUGA 1UR1A 1UZ1A 1E15A 3ZR5A 4ACZA 1E4MM 4UCFA 4TX6A 1W1VA 3SUVA 3N1AA 1E4NA 4M29A 3THDA 2WZHA 1E6ZA 3N17A 1GVIA 1Q6FA 3QHMA 2G8ZA 4IPNB 3CZJA 1GQJA 1WAWA 2WCSA 3WQ4A 3ZSTA 2XVGA 2FHFA 4UFHA 3WH6A 4LQ1A 3OBAA 1UR4A 3VMNA 2WZIA 1GORA 3BLKA 2VUYA 3AQUA 4WK9A 4U2ZA 2DT1A 5FCZA 1KXTA 3RJYA 1MQQA 2J4GA 4JHOA 3ZJ8A 2D0FA 1TMQA 2Z1SA 1HVQA 4CUCA 1SYTA 4FLRA 2W62A 5CLWA 4X0VA 3LPFA 1CGTA 4BCEA 5DEZA 1GQIA 1KBKA 1JI1A 2XYLA 3RILA 4LXFA 4D71A 4HOWA 6CGTA 1V3LA 2ZWYA 1CXHA 4W7WA 3MANA 4TVDA 1H3GA 1UA7A 3ARTA 4GQQA 5E09A 3WENA 2PF0A 3WF4A 4MPKA 3MKKA 1UD3A 2W5FA 3W24A 3AXIA 1JF5A 4AZCB 4U5IA 1H5VA 1TE1A 2CCRA 4XV0A 3UG3A 1EH9A 1R86A 3WNLA 2ZX7A 2J25A 5A6SA 2GK1B 4ZEPA 3K8LA 1VEPA 1QNPA 4UTFA 3AISA 1E0WA 2WVSA 4J3XA 2BHUA 4CD6A 3CH9A 3ARXA 5BWFA 1JI2A 2W66A 1XV8A 4W7VA 1C91A 2ZX9A 1WDSA 3RIKA 5D9OA 2J79A 3MO4A 1CXEA 1MQPA 2CPUA 1J0YA 2BV9A 5ABHA 4WJXA 1U33A 4PRWA 3CUHA 3U57A 1XH2A 1QBAA 3VDAA 2PWEA 3GBEA 4AMCA 3G6LA 2RGMA 2PWFA 4F9DA 1EO7A 1X6NA 1W2VA 4NSBA 4AZCA 4AZ5A 3F5KA 2CITA 1WKYA 1ZB5A 1OWQA 1EHNA 3LMYA 3WEZA 4M1RA 3ZM8A 1V6XA 3SEPA 5IXEA 4Z2KA 2BS9A 2CKRA 4AY1A 2W4XA 4C7FA 4NRSA 2NSXA 2HISA 4IPLA 1EDGA 1CLVA 2BVDA 2F61A 2WVVA 3CZKA 2WPGA 2YA0A 3WL0A 1Q6CA 4UNIA 2XSAA 4D6GA 5ECUA 2BY3A 3DYPA 4AZ6A 1E5JA 2QPUA 4Z2JA 4W5ZA 4PYSA 4MADA 5BXPA 3VIMA 2FH6A 2V3EA 1O6IA 3OGVA 4F9JA 4NI3A 3AMCA 2C8NA 5LA1A 4CU7A 3U7BA 9CGTA 3VNZA 3GTNA 1H09A 2VQUA 2V3GA 3TTOA 1AMYA 3L4WA 1OIMA 5AY7A 3VM7A 2VCCA 3RDKA 5A8OA 4QCEA 3LPGA 1NOFA 3L4YA 4UQ9A 2V3FA 3ARYA 2Y5EA 3ARZA 3GBDA 1ITCA 4MB4A 1KQYA 4D6HA 3VDBA 3CZGA 1HJVA 3CMGA 4CCCA 1C7SA 2EBNA 3BSHA 2D1ZA 1E0XA 2WYSA 3OZPA 5FKYA 2WB5A 1E1EA 2WVUA 4ACZB 2FHCA 4HU8A 1SFSA 3BMWA 1KFWA 1UKSA 3PZMA 2OWCA 1SMDA 5BROA 2X0YA 3EDFA 2GK1A 4BQ3A 2EXOA 1EXPA 4E4PA 5AC4A 3AIRA 1OGGA 3SCSA 1GVYA 1VFOA 2AOSA 2ZX5A 2YDSA 5GNZA 3BMVA 1JZ6A 3ARRA 3IAQA 5BYWA 3VUPA 1W91A 2FH8A 1QPKA 3PTKA 4JKLA 5CZKA 2G4FA 1L0PA 1U2YA 1E6PA 2VO5A 1TR1A 3AHTA 1HJUA 1GOQA 4Z2GA 2CBUA 3CZEA 4HMEA 4K68A 1B3XA 1VB9A 2WWDA 5I79A 3I3DA 1CIUA 5CPSA 1JYXA 2NT0A 1XC6A 1XD0A 1YQ2A 1OB0A 4PMNA 1J0KA 1P6WA 2ZWZA 2D20A 2EPLX 4JL2A 1HL8A 1JXJA 3AYSA 2QLYA 1TCMA 3VD9A 4CN4A 4ATLA 3CPUA 4H2CA 1TA3B 1X1NA 3BAYA 4TXEA 3TTSA 5I2UA 2YL9A 1H11A 2NW0A 2PWHA 3WUEA 4CVWA 5I6SA 4QAWA 2UY3A 4W93A 2WMFA 4PMQA 3ZMRA 1G1YA 3MS8A 1ZBKA 1UWSA 4C7DA 1HKMA 4P8VA 1J0IA 2D23A 2CEQA 1UKQA 3AJ7A 3B9EA 4W8LA 5A8PA 4CCEA 4S3KA 4CVUA 2GJXB 5EFFA 1E5NA 5C71A 3ARSA 2C0HA 3FAWA 1V0LA 1V0MA 2J78A 1J9YA 1EGZA 1V3HA 1IT0A 1MFUA 1GHRA 3BLPX 4KRUA 2V5CA 3K8MA 1QHZA 3ZIZA 5I77A 4Y7EA 4PUDA 3OGSA 2A3HA 3SUSA 2ZICA 1LL7A 1GOIA 1UKTA 1K9FA 2PB1A 4WKHA 1PX8A 5CPTA 1NWSA 7TAAA 5FL1A 1FH8A 1IV8A 1OGSA 2GUYA 4J28A 3THCA 3HMCA 2B31A 2E8ZA 2ZUNA 5GQBA 4NZCA 3WNMA 1JZ5A 3EDJA 2D3NA 5F7UA 2CETA 3UETA 4JFUA 1UQZA 3VIOA 3WSUA 4AXNA 4JHZA 3N13A 3AHVA 4D1IA 3CHFA 1E9LA 1E4IA 1FFQA 3F5LA 4P8WA 4PMOA 3VX1A 1ITXA 2A3CA 3FY1A 1QI4A 2XUCA 2YLAA 4U5KA 4M8UA 3VIFA 1V6WA 3AOFA 3DC0A 3N04A 2DDXA 4PMVA 3CO4A 4HOZA 5A3HA 3W82A 1KR1A 4BQ5A 1FH7A 2YOCA 4FLQA 3RJXA 4D1JA 5HOSA 3MMDA 4MJ4A 3VD4A 3WUGA 5DO8A 1XH1A 2X2YA 5I3DA 2TAAA 2GDUA 1CECA 1UD2A 8CGTA 3OGRA 1C93A 4URIA 1JYWA 3WNOA 2DPEA 1E55A 3WQVA 1WO2A 4J3UA 3W26A 2WSKA 4J3WA 2ZXAA 1NOWA 4PMDA 2Y8VA 1M53A 3GNRA 5E6ZA 3S6TA 2G3MA 3PN8A 3A47A 3W4RA 3AI0A 2ZUTA 8A3HA 3VILA 3ALFA 1WE5A 4CCDA 4JL1A 3UG5A 1KB3A 1LG2A 3TOPA 1E3ZA 2ZOXA 3VX0A 4WKAA 4OOZA 2VC9A 1CXLA 3AMDA 2ZX6A 1UWTA 3VD7A 2DSZA 1PAMA 2ZXQA 3L2MA 1BQCA 2EJ1A 3EDKA 1DEDA 1PZ2A 4KGJA 2ZIDA 3MSDA 2WZEA 3W53A 2FHBA 3UG4A 3NJ3A 3GXFA 4N0RA 3SCVA 2BY0A 3M7SA 2E3ZA 1UKOA 2JIEA 5HDRA 4J27A 1W3HA 2J7HA 3D5HA 4Q7NA 4AD0A 4DUXA 3KL5A 1US2A 2EPNA 1VJSA 5I5RA 1UWQA 2Y4SA 4UQCA 3OIHA 3HU7A 4W8AA 4PEEA 4AIOA 6TAAA 1WPCA 4U3CA 1E1FA 1HP4A 1DWHM 2WHLA 1O7AA 1J12A 3VIJA 5JH8A 1VAHA 4AEEA 1GOWA 1DP0A 3AIBA 4CKQA 1V0NA 3CUIA 3JUGA 3W38A 3ZT7A 2G41A 1DWGM 3WKZA 1B90A 5CPQA 4GZJA 1QVBA 2WMKA 4KRTA 3VINA 1VEMA 2V38A 1UD5A 5IHRA 3WDRA 1MXGA 3GH5A 2QMKA 4UZSA 3VMPA 3W81A 1TVNA 1XSKA 1Y7VA 4MNMA 3QGVA 1XYZA 1CLXA 3LPOA 1V3KA 4ZFMA 4CD4A 5A6KA 2ESCA 2BNJA 3AIUA 3QHNA 2J74A 2XPKA 1BF2A 1B3VA 1D7FA 4FLOA 3MSGA 3ARPA 1KCLA 1KXQA 4AD2A 2XVLA 2WHMA 3DECA 1PEZA 5ABFB 1CWYA 4H41A 2W92A 2VRQA 2G3NA 2CBIA 2PBGA 4XB3A 1JYVA 4YHEA 1JAEA 1UWIA 1UR2A 3CUFA 1JDCA 4TTUA 3AROA 2RGLA 1LQ0A 3EYPA 2A3EA 4V27A 1UWRA 1BHGA 1V6YA 3VGHA 4E8CA 2QV4A 1ISWA 3AIEA 3GNOA 2VR5A 3DHPA 4B15A 1ZBWA 1DWJM 1C7TA 1GJWA 3W25A 5A2AA 3EMZA 5TD4A 3WF0A 5BXRA 2BY1A 1OM0A 3CBWA 3QR3A 4W86A 1JAKA 1JDDA 1NP0A 4GIAA 2Z1KA 3AMLA 2DQXA 4BF7A 1GOOA 3J7HA 5C70A 2VX7A 1JZ3A 3FXYA 1E0VA 2QHAA 1DWAM 2UY4A 1FOBA 3KWXA 4AC1X 3ZT5A 3IJ7A 1C92A 5GPRA 2XTKA 2EPKX 2WC3A 1XH0A 3UCQA 1UWUA 1GZJA 4W89A 1MXDA 4WLCA 2J8FA 1VBUA 1JZ7A 3TONA 1MW0A 1UD4A 5A6LA 3W6MA 4M80A 4QLLA 1NWUA 2XM1A 3A4AA 2VRKA 3TA9A 5M17A 1JD7A 2YA2A 2IUZA 1NQ6A 4DWSB 3MV11 5A6BA 1W32A 5FIPA 1KWGA 1CZ1A 5D8ZA 1W1TA 5I78A 2JALA 1BGAA 4A4AA 4EKJA 3UERA 1GW1A 3SCRA 1US3A 1PJ9A 3ZJ6A 3S2CA 2W91A 1BSIA 4ZE5A 3WFLA 5ABEA 2Y8KA 4EANA 3VGDA 3W27A 1VJZA 2J7EA 1JL8A 3U5YA 3CHCA 3PZGA 3RMEA 1QNOA 1ODUA 1QNRA 4FF5A 4GZEA 1C3FA 4AISA 1NWTA 2EPOA 1J10A 3WFZA 5GNYA 4S3JA 2YLLA 3AHYA 4JFTA 3BSGA 3L4UA 4AYSA 4PSPA 3GXDA 2VTFA 3CZ8A 1GPFA 1TA3A 5BXTA 1AVAA 4P7OA 4B3LA 4AEFA 1RD6A 3WDIA 2WMGA 1BG9A 4OOUA 3FHQA 3T0BA 3UR8A 2VURA 1D2KA 3DHUA 4ACYA 1E3XA 2VVSA 4JKMA 3VDCA 2A3AA 4KGLA 1LL4A 4QLKA 3OLIA 5A94A 2XSBA 1VENA 2XHYA 2YL5A 1V6UA 1XCXA 2J7FA 3BH4A 1C8QA 1JFHA 3AS3A 1W3JA 1M03A 1E6RA 1E6SM 3NCOA 1MW3A 1C8YA 1JDAA 2YIHA 4CN6A 3AZRA 2VI0A 3WH7A 5E0CA 3AICA 2XVKA 4JCMA 1QHPA 3ARWA 2FGZA 1BYDA 4IM4A 1I75A 1SMAA 4LGXA 3HJEA 1PBGA 1IZJA 3VGFA 5KZ6A 1H0GA 3WD0A 4Z2HA 1BG4A 5LYRA 3T0DA 5A8QA 4KH2A 1VFFA 5EFDA 2JIWA 4WSJA 1UR0A 2OYLA 2VL4A 4FK9A 3B9DA 4HA3A 4UOJA 4ATWA 3TTYA 3O6AA 2O9TA 3AIWA 3SUUA 3EDDA 1MFVA 2WC7A 2XJ7A 4JFVA 1CEOA 1I1XA 1WDPA 2XGIA 1D3CA 1KR0A 3PBGA 3FAXA 1JZ8A 3SCNA 4W84A 4ATDA 2VX5A 3MMWA 3W37A 4UQAA 1EHAA 1XRVA 1KCKA 5I0DA 2W63A 2XIBA 3A4XA 1WDRA 4UZUA 1WNOA 4HOXA 3GYCA 5LA2A 1UQYA 3WH9A 1R8LA 4PTXA 2OSWA 4W5UA 4GPNA 1HJSA 3WNNA 1DTUA 4UOQA 7A3HA 1Q4NX 7CGTA 4V2XA 2FDMA 3B9AA 5JBFA 1PPIA 1NOUA 2DSUA 3LPPA 4P8XA 5A8MA 1XD1A 3NSXA 4CU6A 3AFBA 2J8GA 3NSNA 4DM2A 4J3VA 2WLZA 4CGTA 4EE9A 4WF7A 2XWDA 3M6DA 1EOMA 1OT1A 2NT1A 2XVPA 1TVPA 4LYQA 3GXIA 3OLEA 4QDMA 4B16A 4Q22A 1CGYA 2V5DA 3L4VA 3II1A
chains in the Genus database with same CATH superfamily
5CJNA 2QVNA 4PGLA 3R13A 4LRSA 2EULA 1DWIM 3Q4DA 1REQA 1YDVA 3IUDA 3LG3A 4L9YA 1IHIA 2PLCA 4Z42C 3BC9A 4LBUA 3NQCA 4MJMA 4F4RA 2IXVA 3TNOA 4BWLA 1O1HA 1NARA 4I7WA 5EA9A 3HN3A 3H9RB 3I7QA 2PTZA 1V4YA 1FKWA 3QTPA 3VOGA 1TTPA 3WIJA 3FXGA 4XVEA 3KXQA 3CB3A 3W2LA 2FQIA 3G2GA 3EBVA 4RV3A 2HSAA 3W23A 1KA9F 1TZ9A 5J8LA 1S46A 5A5WA 3M0YA 3BW4A 4DVOA 1OX4A 3F1QA 3O8AA 3WH0A 4FHAA 3ARQA 1ZPTA 1IX5A 3ZR6A 4AH7A 4QFUA 1K3UA 3TC5A 4UFIA 2XVNA 4QAIA 4WSKA 4XTDA 2QUNA 5HNNA 1FWRA 2OJPA 5HBFA 2PP1A 3QPZA 4DZAA 2F7FA 3XIMA 3BOLA 2CLMA 3NQMA 1XG3A 3WQWA 4MWAE 2PPPA 4CQDA 3KBMA 1EYEA 1RP9A 2ZUMA 3BXWA 3HV9A 1VYSX 1XQKA 3IJ8A 5TNVA 3W7QA 4HARA 2VGBA 1TPWA 4FX7A 2PI6A 1CGUA 3W71A 2XIIA 3MT1A 4DZHA 1OCQA 4IOTA 4BS0A 5DMLA 3R5EA 3EKLA 3TDFA 3M5ZA 5DIUA 1KGUA 2YCLB 2FKEA 4R34A 5EMYA 2NVAA 4P7QA 4LCQA 3GNPA 3R43A 4X9YA 3BLEA 2JEQA 3AJXA 3TFXA 3PTMA 4PUKA 3E74A 4NASA 3MB9A 4F79A 4XQ6A 3TX9A 3BSMA 4ROPA 1OCNA 4OUEA 1PTDA 3LGGA 1QI0A 3Q45A 4LAUA 1UOZA 1MW2A 1SZEA 1EL3A 1YTEA 3NL3A 5FSDC 1RBAA 1WXJA 4MOZA 4KBXA 1H0IA 3WJYA 2Z6IA 1F73A 3V7PA 5IDIA 4OIFA 1LLOA 4JDYA 1GEQA 3WLMA 2PLJA 3DC8A 3NR0A 4BZYA 3AIQA 3GYEA 2E68A 4RLIA 3UZZA 1S2VA 2PDXA 2Y5SA 3W7HA 3CIVA 1BYBA 1XW8A 3MA8A 3LHZA 2XWEA 1LBFA 5CEWA 4E2OA 2BVTA 3VD5A 2E9LA 4O50A 3UZWA 3GSMA 3VE7A 3QLDA 3T78A 3P60A 3MHFA 1GYNA 4ZSUA 2J62A 3IIOA 1JCHB 4JQ1A 2RURA 3VNLA 4JZ5A 3RLGA 4JTDA 2WAGA 4AVNA 3RK8A 3RO6A 1AQHA 4IXXA 1TUFA 2WQPA 3S0CA 4UTLA 2YBUA 3P2VA 2R8WA 1O94A 3MV01 4UR7A 2WLYA 2Y85A 2EQDA 3PANA 4IMFA 4IIHA 2ZUWA 2P1FA 4JTSA 1HX0A 3GG7A 2W9MA 4RX0A 3W7RA 3QQ0A 1ZK6A 3CHVA 3JVAA 2INFA 3SIMA 4NJIA 5LA0A 2F38A 4X2PA 1TX0A 2DG3A 2GGGA 2ITKA 2PN0A 1FH9A 2DU2A 3KZPA 5H6HA 2PTXA 3HZ3A 4TX0A 3N2XA 4KT2A 1I1WA 1BTCA 1OINA 4FX8A 4CCZA 3QW3A 1MEHA 4IGMA 1YYAA 2FMOA 3LRMA 3ZJKA 4IFOA 4FS9A 3MVIA 4H9UA 4A8RA 1UPMB 4EACA 2PC8A 2PDLA 4W7UA 4QCFA 5EB8A 3IRDA 4DWDA 2XZ7A 1RLDA 2XH7A 3LZ5A 1J0ZA 4PUUA 4UOZA 1BLIA 3BVJA 1PTAA 3AS0A 1ME8A 5CZ0A 2PRLA 2FTPA 4OE7A 4MSPA 4FAMA 1ISYA 2JKEA 4MKVA 2RDWA 4H83A 5FF2A 4AU0A 4Q4SA 3UQAA 3A3HA 4JQ2A 4MDPA 1V3MA 1IGWA 2BOGX 3AMGA 3L4TA 2IKHA 3CXOA 2XG9A 2EPMX 1NVMA 2YB4A 4AEOA 1N7KA 1WKFA 1EFZA 3GG1A 3UA4A 4FF7A 4LUYA 4QM1A 1ONWA 3F5JA 2PODA 2DVTA 1X97A 1XLCA 1U22A 1NDYA 5BRQA 3L7RA 5JBEA 2WMHA 3GE7A 4XK2A 2ZUUA 2PDNA 4HU4A 2PZNA 3P67A 5A6JA 2CXGA 2ZXBA 4LUSA 2IKJA 3GH7A 3UZXA 3G1HA 3GX9A 5CJ5A 3L23A 4D6DA 1AL7A 1LROA 1IIHA 1A4LA 1VFTA 5DFAA 2RUQA 3HGSA 1W0MA 1XLAA 1OC5A 1EQPA 5LGXA 3OHMB 4K36A 2A2IA 2C1HA 3OOBA 3RLUA 3EXSA 4O54A 8RUCA 5FOOA 1VPQA 2PRMA 3N29A 3LK6A 3GNXA 4R85A 6A3HA 1PINA 3K46A 5IFPA 2D0GA 3I3BA 1HGYA 3CNYA 4LAOA 3GFXA 3MI2A 2Y8UA 3WLOA 3G0SA 4L3NA 1TUXA 2BODX 4R9XA 1KRAC 4LAXA 5LIKX 4G6CA 1JEZA 2WKLA 1TV4A 4J9JA 1W1PA 3TW7A 4DUWA 5FAJA 4C6FA 1VF8A 1XHGA 3FV9A 3LCXA 4GVIA 3T09A 3OB8A 1YW1A 2BXZA 2OEKA 2YKKA 4K37A 4K8HA 4I9JA 4PUWA 1MEWA 1M7OA 5C6MA 1Q6EA 2QUVA 1FFRA 2CHOA 4RE4A 2PZ0A 1ZCNA 2ZTKA 3NUKA 2OQLA 4K8GA 3PG9A 3O5FA 3WH8A 1UKPA 1A5OC 1TPB1 2YPIA 1NSGA 4XG1A 4AW7A 3HQOA 1W5MA 1LOLA 2F6UA 4AXKA 4DXXA 1RQHA 3GVWA 2PDWA 4DWSD 4Q8NA 1CNVA 2MLXA 5H8PA 3QY8A 2POTA 3CTTA 4IGHA 2BMBA 1SO6A 3CEUA 2J9XA 4ZOAA 5E6YA 4MTVA 1JVWA 1F8IA 5AFDA 2J88A 4ZO9A 4MGGA 1G9HA 1M5WA 2BWGA 3R89A 2A6LA 1CPUA 3IV3A 4GD0A 4JTFA 4WXYA 1SZRA 4KMQA 1R3SA 4TUFA 1RCXB 3M0ZA 1W9DM 2RKXA 3CUJA 4L1WA 4PA8A 3HPXA 1IE7C 4J40A 3SSZA 2WJEA 5CGMA 3VCNA 3CMFA 2OSXA 4LF2A 3MHUA 1WB0A 1HNYA 3SCPA 3PPHA 4S39A 2XP8A 3M5XA 2WKGA 1EC8A 4DM1A 1WYIA 2TYSA 3P6LA 3DERA 3QMSA 4L4PA 2Z6JA 3VXGA 3CUZA 3M07A 5FJUA 3F4NA 3WF1A 4HMDA 5CSYA 4Z08A 3RM4A 4D8AA 4N7QA 3U5UA 2Y7DA 3MUZ1 1ME9A 3OVPA 1ML1A 1S2TA 3VGGA 2GUUA 1Q65A 3LCGA 1VFMA 3IIVA 4YYCA 3KE0A 3RRAA 3TU9A 3HPZA 2XM2A 3N34A 4WVXA 4J2PA 3SCOA 2BOEX 4H9YA 1LG1A 3IV8A 3PSVA 1C29A 1KLZA 2VVNA 4HA4A 1RBLA 4E3TA 2J75A 3FLUA 4R5EA 4EOUA 4YPJA 4XWUA 4GUFA 5DCBA 2WCGA 5T8GA 1BWKA 3GY1A 1EQCA 2O4MA 2GDVA 3CQ0A 1K03A 1Z89A 4TOQA 1MXSA 1XYAA 3DAQA 4O14A 5U4NA 3PY2A 4YTQA 2ATMA 4J4KA 4LFYA 2OYKA 4F0MA 1L6GA 4LVDA 4YHGA 4AZGA 3OA3A 2E09A 3HG4A 4FNPA 2NX9A 4ECLA 3RLHA 3O0KA 3K1DA 2Z2BA 2D22A 3B40A 3GM8A 5LIYX 3S2MA 3G0UA 4D6EA 1W9UA 3B4UA 3L65A 1VPYA 3ALGA 4JFWA 5CSRA 3DBNA 1Z7AA 3THQA 3WF2A 2QVHA 4AZBA 3PP7A 3R25A 1PX3A 4FNQA 3NXLA 4MZ8A 3L0KA 5CGTA 4NZ3A 1YE6A 1QU4A 1QBBA 1L6SA 3KRZA 5BU9A 3TOYA 1KFJA 3QFWA 2OQYA 3TTEA 3U8GA 1TQJA 4O0KA 3AYRA 5D9NA 4IIGA 4PUEA 3WQCA 5BXSA 2YXXA 3N4FA 1C90A 3QGAC 1V93A 1R7AA 1KV8A 1UOKA 1MZHA 4YVPA 5K3VA 2VN1A 2VZTA 3GDBA 4JNZA 1ZCOA 2VENA 3MP5A 5KZMA 1PTGA 3P8IA 3HGJA 1W1YA 2ZUSA 2BFGA 2JKAA 4BI7A 1LRTA 1NWRA 1VPXA 1X7FA 2C0AA 2ZRYA 1QO5A 3C2VA 3O5QA 5JVLA 2H8ZA 1EIBA 1E6NA 3DFYA 1GG1A 5K4XA 2X09A 2OKOA 3G1YA 2GZXA 4M1BA 2HMCA 3CL8A 5G2IA 3S5SA 3ARVA 4ZVJA 3LQGA 3VOIA 3VUSA 3B8WA 2A1YA 1A49A 2YDQA 1Q6UA 3QW4B 2FMNA 1PZ3A 4OZOA 4PBFA 5F2GA 3W9ZA 1OFBA 2X30A 1L2QA 1C9WA 2NQLA 1P0DA 2PF8A 2OEJA 2OZ0A 3SQLA 2OOGA 1WBJA 1H2JA 1H1NA 1KW1A 2YZ5A 3JXVA 3VU2A 2QDGA 5MF5A 2FFIA 3RGCA 1Q6OA 3AXMA 4K3ZA 2I5GA 4MWAB 1KBBA 4HD5A 1SVDA 3QQ1A 1WCGA 4ZQOA 3O07A 3DGBA 3M6YA 3NYDA 1HKVA 3PUOA 5E70A 4E38A 4JY8A 5JXQA 5D38A 4K39A 1ZQ5A 4DJFA 4PMRA 3VIKA 3OG2A 3K1GA 1A3HA 4DRQA 4PTMA 5LXXA 3NWRA 4IXHA 2EAWA 4JTQA 3CUXA 2DT2A 3KABA 4WUIA 1FCBA 2CYGA 5F1VA 1UZ1A 3HOJA 3ZR5A 2V67A 1E4MM 3ITCA 4H7ZA 2WJFA 2ZTJA 1W1VA 3SUVA 3N1AA 4H7CA 2Y88A 2WZHA 4ODMA 4FR6A 1SO3A 5D33A 1GVIA 3QHMA 2G8ZA 4IPNB 1A3WA 1FQ0A 5GPGA 1Q66A 1GYLA 5MHBA 4AIBA 3M9YA 4O10A 1UR4A 3O5PA 1G4TA 1P43A 1FKIA 2WOQA 5D03A 2EKGA 4WK9A 4LCSA 3W3OA 1KXTA 3RJYA 1MQQA 4JHOA 4F2UA 1W5OA 3ZJ8A 4GK8A 4UTTA 3STPA 4WGHA 3C2OA 3TMQA 1HVQA 2P5NA 4ZQNA 1NFBA 1TMHA 4A6GA 1MDRA 4X0VA 1L6YA 1CGTA 4JD4A 3RILA 4O2TA 2ZDRA 3QR0A 4LXFA 1W3IA 4UMAA 5T9CE 6CGTA 2TMDA 2OZ3A 3NQFA 1UA7A 3ARTA 2POZA 4K8EA 3TFCA 3WENA 3GTHA 1K1DA 1UJPA 3MKKA 3AXIA 3GU9A 4AZCB 2PUZA 5I3FA 1H5VA 3NPUA 4TX9A 1EC9A 3PNUA 4XV0A 3UG3A 4A21A 1YIXA 1L2UA 1LQAA 4LJ3A 3W85A 3L5MA 2AQWA 2J25A 3O15A 4IFRA 4RUBA 4ZEPA 1M9HA 5D2YA 5J5DA 1VEPA 2WVSA 2X0SA 4J3XA 3R0KA 1JI2A 2W66A 3H7RA 3TAOA 4MGVA 4W7VA 2X41A 2XH4A 3UWZA 3KBSA 3N14A 1EJRC 2A4AA 4WJXA 1Q6HA 1SGJA 3K4WA 4S3EA 4A2RA 2PWEA 1OK4A 4AMCA 3DEQA 3WG6A 4WJ8A 2CITA 2CZFA 1WKYA 2PA6A 1OWQA 4O1DA 5IXEA 2BS9A 3QY6A 2W4XA 1ADSA 4C7FA 3GHSA 1XYBA 1ZENA 3NO3A 1CLVA 3CZKA 4GGHA 1IWPA 2WPGA 2I9EA 2Z7KA 1FTXA 4WOZA 2XSAA 1H50A 2PFHA 2P4VA 4Z2JA 4W5ZA 4PYSA 4MADA 5BXPA 2FH6A 2V3EA 1O6IA 2A7PA 4LW7A 1E1CB 3TYDA 4NI3A 2PLMA 1J79A 1SQ7A 5LA1A 3V18A 3A9IA 5FEPA 2PDFA 1H09A 3DFPA 2VQUA 5I3KA 3TTOA 2VP8A 3VM7A 1L6WA 2VCCA 4DLFA 2BBFA 4TMCA 4UQ9A 3LCLA 2PTWA 3MUXA 1MO0A 2VGIA 3UXKA 1KQYA 4CCCA 2PDKA 1NQKA 4L9ZA 1E0XA 3UY7A 3ITXA 1FVPA 2AL2B 3H70A 3TEVA 2QCLA 2QULA 5CG7A 4ACZB 4CQ9A 5I3GA 1SFSA 3BMWA 3HPSA 1XBVA 4L7ZA 1L9WA 3BW2A 3NI6A 5I3JA 1ZAJA 1HFBA 4Q8TA 4U4MA 3EDFA 3B97A 2OPJA 2VEFA 4ZL1A 4LUIA 1QXLA 3AIRA 5AC4A 4ZQRA 4I9TA 2CFFA 3UCCA 2OZ8A 3B0UX 2AOSA 3QLLA 1B9BA 3TCZA 1THFD 4JY9A 3O5EA 3INPA 5LNSA 1EP3A 5BYWA 1HG3A 2FH8A 3U48A 3WLPA 3RGTA 1RJPA 2VO5A 3LXBA 3S1UA 1RBOB 4INFA 3CZEA 4HMEA 3BJSA 5I79A 1JYXA 1CI1A 1CIUA 3I3DA 4H2HA 3EWUA 1BRLB 1R30A 3O5MA 1XD0A 1YQ2A 1OB0A 2ZWZA 2F4EA 1EIXA 4JR5A 2BSLA 1WUFA 3R58A 1HL8A 3KZ7A 1TPH1 2YCLA 4XAZA 4YIWA 2Z1WA 3TTSA 3S2LA 3EIPA 2YL9A 2NW0A 2PWHA 4CNNA 3WK2A 4JQAA 1Z44A 4Q8QA 2UY3A 4IPJA 4HSNA 2WMFA 1ZBKA 1H5YA 1XIEA 4Q6XA 2P3EA 2HK1A 4C7DA 3H2AA 2D23A 1W1IE 1TRDA 1UKQA 3W72A 4W8LA 4NNAA 3SECA 3FGCB 4HIBA 3W1UA 1TO3A 1XYCA 3H24A 1QPOA 1TMLA 4CQAA 4I8DA 4OV4A 3WZ0E 1XRTA 4FNUA 2D2GA 2J78A 1J9YA 2ZKMX 5G1MA 1V3HA 2BLEA 4YL2A 2RDUA 4DQWA 1DHPA 1QHZA 3ZIZA 3TCSA 4MIMA 3PTDA 5DN1A 3S46A 4ZPTR 3TAKA 1OX4B 1GOIA 1UKTA 1K9FA 2PB1A 2PP3A 2W27A 5EBUA 3C0SA 5FL1A 1PWMA 4B92A 4TR9A 2B31A 1Y65A 1VZWA 1TCDA 3WNMA 1XLMA 1NTHA 3T8QA 1N55A 3AAMA 3PPFA 4JHZA 4PUNA 3N13A 7XIMA 3CHFA 3T1GA 3VX1A 1VD6A 4JFMA 1V6TA 3TN3A 2Z29A 1SW7A 3IJDA 2DDXA 4EXBA 3CO4A 5A3HA 2OG9A 3W82A 4JYEA 4D1JA 2YOCA 2VYOA 4FLQA 5HOSA 4E2VA 3MMDA 4C6CA 1XH1A 4KIRA 5DANA 4G50A 2TAAA 3EWXA 1UD2A 3GHRA 2VFHA 1JYWA 3ICJA 3WNOA 1RR2A 3E02A 4KF1A 2K8IA 1E55A 4GCXA 3W26A 1NF7A 1RLCL 3C61A 3GNRA 4OVXA 3O6DA 1R2SA 3VILA 2ZVIA 1DE6A 1W5QA 1UUMA 4CCDA 4Z1BA 3BMXA 4NJKA 3WK3A 1PYMA 4OECA 2SFPA 2VC9A 2XU2A 3AMDA 4LANA 4PULA 4S2BA 2A85A 3SY8A 1H60A 2EJ1A 2ZIDA 4FIRA 1AQFA 3QH2A 3S5YA 1HZYA 3EX6A 3W2KA 4FEZA 5I3HA 4LTSA 3H4WA 3REQB 1U1UA 4NXSA 3M7SA 5TAOA 1DYSA 1UKOA 1AMKA 1P0NA 4Q7NA 3A4JA 1US2A 2V69A 9XIAA 2ALDA 1KD0A 2Y4SA 3RPTA 4K7VA 4AIOA 5XIMA 2QIIA 6TAAA 2EKCA 1WPCA 4FNTA 1DWHM 3NA8A 1O7AA 4PCNA 1I0DA 5JH8A 4Q33A 4GFSA 5FEWA 1AD4A 5AHMA 1F76A 3HA1A 3S5NA 3W7MA 4AEEA 1GOWA 5MKGB 4CKQA 3CUIA 1OYBA 4O1EA 4DO4A 5CBBA 1AW2A 1DWGM 4GJ1A 5CPQA 4XD6A 1D8WA 2WMKA 4R0XA 4TQTA 2V38A 3DZ1A 2HTMA 2H9AB 1XGDA 2QCNA 1MXGA 4KR0B 1TVNA 3XISA 4K1WA 2Y70A 4ILSA 1Q2SA 3FAPA 1XF0A 1V3KA 1ZALA 1ZJHA 1FKKA 5A6KA 5AC6A 1ROTA 2XPKA 3ZWSA 2QDDA 1Q85A 3UWWA 2ASHA 3ARPA 3NQVA 1KCLA 3W7IA 3SN1A 5KINA 5K4ZA 3WBXA 1IT8A 4QT3A 4HN4A 1PEZA 1F07A 5AYXA 4PC8A 5EGRA 2W92A 2VRQA 2G3NA 4YHEA 1FWIC 3W1MA 4AC7C 1UWIA 1UR2A 5KSWA 3GXNA 1JDCA 4FOUA 3F7JA 4TTUA 4HYWA 1PO9A 4DRPA 3CB8A 1YTDA 2IQTA 1GVRA 4NNCA 3EYPA 4V27A 3DFTA 3JW7A 1S3HA 4G7FA 4PODA 2P0OA 1V6YA 1BHGA 3RFAA 2BB0A 1NF0A 3VGHA 3W02A 1TPFA 4B5XA 5BXJA 3Q94A 4F2BA 2CW6A 3OQEA 2VR5A 3NQ7A 4XBSA 1MMFA 5HQMA 5HINA 3NGFA 3GC2A 1GJWA 2YXOA 5AOUA 3W25A 5FACA 5TD4A 2UZ5A 1I6NA 3WF0A 4KW2A 2BY1A 3TQVA 1OADA 2FVLA 1OM0A 4H4IA 1JDDA 4GIAA 4W86A 4LU0A 1ICQA 2WZTA 3AMLA 1GOOA 5CPNA 1XDMA 1JZ3A 2I5IA 2P10A 2QHAA 1M3UA 1IWBA 4WGXA 4DRJA 3CPRA 3O5IA 3I4EA 5I07A 1XRSA 4G9PA 1C92A 4I9MA 1VFHA 2DG9A 1UWUA 3TZFA 2FPVA 5CSSA 1BWLA 2J8FA 3M0JA 1JZ7A 2ZQVA 1QW7A 2HBVA 4WD0A 3UXLA 4QLLA 3GNNA 5C5YA 3M16A 1SM9A 1JD7A 3UR2A 1U83A 5A6BA 5FIPA 3W2NA 3M1ZA 3TQPA 1QPQA 2JALA 4XKYB 7ENLA 3VK5A 4NZ4A 4L80A 1Q6IA 3H55A 4LS2A 3ZJ6A 1BSIA 4ZE5A 4KEZA 2Y8KA 3TR2A 3S42A 2PS2A 1OFDA 4LWWA 2J7EA 2DZSA 2MNTA 4FF5A 4GZEA 1AK5A 1PB0A 1C3FA 2DZPA 4AISA 2LPVA 1NWTA 3FIGA 4MPQA 4C6JA 3S8HA 3WLTA 2ZC1A 1IF2A 4AYSA 3MYOA 3L4UA 4QRNA 1XIGA 4OFCA 4JXCA 1TA3A 1A5LC 3LGEA 3DG7A 4B3LA 3OO2A 3M41A 2WMGA 4XAKA 1GW9A 1BG9A 4GC3A 4OOUA 3FHQA 3T0BA 2VURA 4IFKA 3WFAA 2BASA 1IXOA 4DIAA 1H7XA 4JKMA 2A3AA 1E9IA 4KGLA 4DROA 3TN4A 4DXKA 3OLIA 5A94A 4POCA 2XHYA 1V6UA 2J7FA 1UCWA 3QM3A 4QX4A 5BRBA 4E6MA 4WQ6A 3TC3A 3G1AA 3L2IA 2FYMA 1MW3A 1C8YA 2YIHA 2VI0A 2FZBA 2IW0A 3O5OA 3QYSA 1TKKA 4H6KA 4O1CA 1XLHA 3P84A 1D8CA 3C2RA 5M2FX 3ARWA 4IM4A 4S3FA 2XSXA 1GVOA 1SMAA 3H53A 3VGFA 2ZA2A 1B57A 1H0GA 1H7PA 4HJWA 4KH2A 4JEQA 2HROA 4A22A 5EFDA 1IEWA 2ZZ4A 1UR0A 2GWNA 3MYPA 4MKSA 2VL4A 4FK9A 4ATWA 4EVZA 3I68A 3GDLA 5D2TA 3EDDA 2KO7A 2J9ZA 2WC7A 1TREA 3UXAA 2IPFA 4M6QA 3OODA 7REQB 1I1XA 1WDPA 2F2KA 3PBGA 4HK7A 4NAFA 2VX5A 1DQUA 2PLKA 1XRVA 2CWNA 3LSCA 3A4XA 1WXYA 4UTWC 1WNOA 3UWUA 4WEVX 4HPXA 2VEKA 4PTXA 2YCJA 4PFMA 3WNNA 5IDZA 4UOQA 2AGTA 1Q4NX 3KAFA 4V2XA 2P8BA 2FDMA 3EKGA 4DJFD 3B8DA 3JU2A 1NOUA 1LOQA 4KEVA 2RJGA 2PPGA 4RPQA 4P5UA 4S3GA 3NSXA 4YCPA 3WCZA 3CAQA 2J8GA 3ITLA 5C54A 3L66A 4EE9A 1OT1A 3KDOA 2VOMA 3CO8A 1CW2A 4RDVA 3GXIA 3VDGA 4B16A 1IGSA 1SJDA 3L4VA 4MM1A 3II1A 1UMLA 3MDUA 2WQDA 4HPGA 4O13A 1M01A 1BPLB 2HCVA 4H8VA 1POKA 1ISXA 3CL7A 3IJQA 1E40A 1UZ4A 3GTIA 3Q37A 4XIAA 1B3WA 5EMMA 3N15A 3H2EA 3T2PA 3WYZA 1GOMA 3W86A 5J04A 3ITVA 5A6BD 1O5RA 3QC3A 2XP5A 1LWHA 1VGAA 3M47A 1XBYA 3LHYA 2A6NA 1RD5A 3DENA 5AZ0A 5HPCA 4BF5A 2RSEA 3GZ3A 1S38A 3GK0A 4IJRA 3UPMA 1R7OA 4L4OA 2EGZA 2PU0A 3H12A 3KLLA 2QCDB 2YR1A 2MLZA 2JK2A 4PBEA 3C0LA 3CWHA 4OBRA 4O8AA 5HTGA 1KXHA 3PUGA 1MUCA 2J7GA 3NOYA 3CHEA 2CZ5A 5LHFA 2GJLA 3WQ6A 4AF0A 3URAA 3N2BA 4DJED 1R0MA 4KS0A 3M46A 2CZDA 3V0TA 3W22A 4R53A 4O1BA 2P8CA 1TWZA 1QI3A 3R7MA 2VX6A 4AD5A 4FALA 2OYMA 1FX6A 3HGRA 1TFVA 4K38A 1X96A 4GH1A 1QPFA 2NWRA 4DPQA 3UI6A 3C2FA 1TYGA 3OYXA 3GW0A 3QV9A 1YNYA 4F66A 4J35A 4UQDA 1AG1O 1E70M 1RY8A 3OHIA 1VRDA 1OZQA 1W2PA 4H6EA 3HQ1A 3I7RA 4WOQA 5AYIA 4NZ5A 4NY2A 1EA0A 3EDEA 3AMKA 3A9BA 3APTA 3L21A 3DFQA 3CV6A 1E9ZB 1UP3A 1MNSA 1LWIA 3EX4A 1BYAA 2CZVA 2PE4A 5REQB 4B9ZA 1QPNA 4GI8A 2CBJA 1ESWA 3P0XA 1DXIA 4C6OA 4J3SA 3QMTA 2GQAA 3TW6A 3K30A 4ZOBA 5A2BA 1BL4A 4L6HA 2B4GA 3BG5A 2OWXA 4MVAA 3B8UA 3POHA 1UB3A 1KM4A 1CLKA 2JEPA 1WKEA 2ZR4A 1FUYA 3IK8A 2YZRA 2WSPA 5BZAA 4CU8A 4HPNA 3SADA 2CERA 2OXNA 1OABA 5D9PA 1G7UA 3W0KA 2PWUA 1WUEA 4LYKA 3VZZA 4W9QA 4DN1A 3N3MA 1B3OA 1B3YA 1ZS2A 1GTEA 4DYEA 3LX9A 3ITYA 4WRHA 4PSRA 1U5HA 3DG6A 4DAFA 3ZLHA 1WZLA 4GO9A 3C4UA 3SR7A 2C91A 4A8LA 4AIEA 4D6CA 2QDEA 2J7BA 1TWDA 1J6PA 1JGIA 2C71A 4U86A 3WK1A 1XGEA 2P53A 2ON3A 4O4WA 1NDWA 1LF1A 3PRAA 3GIYA 2J47A 4RL3A 5I06A 1Z69A 4QSFA 2HVNA 5EY5A 2R1MA 2DVXA 4PTVA 2RJHA 3LU2A 5C9UA 1X6LA 3EWWA 3VVGA 4AD1A 3QZAA 3ITGA 1JCMP 2Q8LA 2Q02A 2E40A 3VKKA 5XINA 1A5MC 1I0BA 4UFMA 2QJGA 3OW1A 2R6OA 3NL2A 1ZSXA 1XIMA 1JPHA 4TVUA 4MNJA 3DU0A 1PX4A 3UEQA 1NM9A 2WHKA 4MAVA 3POCA 5AC5A 2G50A 4NJJA 4X22A 1XM3A 3K13A 1M41A 4XX6A 1OCJA 1H7NA 3APGA 3UP8A 1XGZA 4HVXA 3WLLA 1UIOA 3WD3A 4Z1YA 1S2UA 4NRRA 5H91A 3I6RA 2PGWA 4ENLA 4ZE4A 3PZIA 5KEZA 1P6CA 1D3GA 4Z0SA 3TYAA 4CD5A 4LVFA 2O92A 3TR9A 3CIWA 3OZMA 2B7QA 1IYXA 3KOFA 6REQA 4ZENA 3DOPA 2VR2A 1Y5XA 3LLDA 5F4WA 4O12A 1Z42A 1ICSA 1W9VA 3EWZA 4LAKA 4FIQA 3OQ8A 5A8NA 2X8RA 2Y7EA 3C6CA 3JYJA 3L4ZA 1HT6A 1VJIA 3DXIA 2HK0A 2VCDA 4JEJA 1OYCA 3WQ8A 2NLYA 1EJVC 1S1PA 1PV8A 4KRZA 4C6NA 2ZE0A 3C8NA 2OKTA 1E44A 5AVHA 1VFUA 3R12A 4N9CA 3RXZA 2FKPA 3S1XA 1UASA 1DHKA 2QIWA 1T8QA 1I2NA 3ENLA 1J0JA 4DBDA 5L6UA 4ZXLA 4RZBA 3GC5A 4ZXOA 3NRKA 4MB1A 1G4SA 3QRHA 1VRXA 3TLLA 4LNCA 3KBJA 3TJ4A 1OD0A 1EQ3A 2YJQA 2LKNA 1F4HA 3K4DA 3O2LA 3GVVA 1GCYA 3SUTA 3QMRA 4D2JA 3VKDA 4QG9A 3THAA 2E8YA 1I60A 4RR4A 3LCWA 3KP1A 1J5SA 3W1XA 3W1PA 5LIUX 3UPWA 3LRKA 2E7FA 4ZO7A 4DF1A 1OGBA 3EOUA 5T26A 3VNMA 1S39A 4LNYA 4CQBA 3RLVA 3N11A 3VIIA 4WDTA 4GG9A 2JGQA 4A29A 4YNGA 2FGLA 4U31A 2HNHA 4OWGA 3QSRA 2CESA 1K6WA 1WP6A 3DGRA 4HNOA 2CZEA 1LWJA 2LGOA 4REQB 4DELA 1VCVA 5HNTA 1B1YA 1YPFA 4L4LA 2HS8A 5KMYA 4TU1A 2XDFA 1QW8A 4TTGA 2X1UA 3F4DA 1QNVA 1GT8A 2WMIA 3FN9A 3AXKA 4O53A 1EJWC 4NZFA 4ZB2A 1H61A 5JBDA 3ECQA 3PF3A 3BMBA 3WMBA 4PRRA 1RH9A 2B7PA 5C9RA 2XGBA 1ODZA 1TTJA 4JTRA 5DBUA 5I7GA 3ZO9A 2CLLA 3AIVA 3BCFA 5CSUA 1A47A 4KQNA 2QQ6A 1XCWA 1XLIA 4F0KA 4JFIA 1FA2A 4GBUA 3TSBA 4P8UA 4KQZA 4JNYA 1AFSA 4DRNA 2QCFA 3IJ9A 4ERIA 3MU7A 1B30A 1GONA 2X0HA 2Z28A 3VD3A 3VAWA 1J6YA 3WQ5A 3MDWA 3UYCA 4HHHA 3EA1A 2HWGA 3MUIA 4DO6A 1J4IA 3ISIX 2PGRA 2DZAA 3QTGA 2WK2A 2E6DA 1JZ2A 2YW3A 3MJMA 1FWNA 2WWCA 4JIPA 4LAMA 4A3YA 4Q4RA 1OZMA 4D6JA 1GHSA 4XISA 5H8MA 3E1F1 4NT0A 3BZJA 3PBUA 2O0TA 1TPDA 8XIAA 1KFEA 4Z1CA 4IT4A 3WLSA 3IWPA 5ABFA 3TXZA 4GQ0A 3ABOA 2RFGA 2WM1A 5DT5A 3UJFA 2VFGA 3CS2A 1XDLA 4GCAA 4M6UA 2GGHA 1FKSA 3IVSA 3GIQA 4H7VA 4MB5A 3IAPA 2ZZ3A 2C13A 2UBPC 3H8AA 4FOJA 3NO5A 1W9BM 4IJCA 1Q6GA 1BVZA 2GVEA 3GZAA 1OT2A 3S3GA 1DVJA 1FDJA 2C15A 3EZ4A 4K2SA 3KRBA 3WEOA 2EPHA 4DNHA 2NQ5A 4C91A 2R82A 5FEXA 1UC5A 1M65A 2GVGA 4GVGA 1ITQA 3IJIA 4GJIA 2FGBA 2DIJA 5K9DA 5FJOA 1E6QM 2J7CA 1PXGA 3BLFA 1EYWA 5HWBA 4NAEB 2WSYA 2WMIB 3WBEA 3UYIA 1TB3A 4Q8MA 2QF8A 1TV3A 3CK5A 3WNPA 1R2TA 1TJRA 4N9BA 4A3HA 3FHAA 3AXXA 1TV5A 1A5BA 2UY2A 3HFYA 3H2MA 3OBEA 1O95A 5G4EA 3KAIA 2VOTA 1RUSA 2H3BA 5U7SA 2WSRA 4JTIA 3TN5A 4BF9A 4DJDC 4LCRA 3S1VA 1GVFA 1WDWA 3KCLA 2X42A 2YFOA 2CKSA 2XIMA 2XP4A 1QASA 3MUY1 1QRQA 3DKLA 4QBXA 1EP1A 4QTGA 2X05A 3BLIA 1KBJA 1GJUA 4V1XA 2XIQA 2VEGA 5HK4A 2XISA 2IXUA 4IPXA 2C19A 4OJYA 1FP9A 1S5WA 3KVKA 1LUCA 1KQZA 2MANA 1JR1A 4JYSA 4Q8PA 3MQTA 2ZCGA 3USZA 3PSWA 1JYNA 5FD0A 3O5GA 1WDDA 2VM8A 4GUGA 2ONEA 3TSDA 3W7PA 3NIYA 5DXYA 1ZL1A 3EXTA 4RE3A 3TKFA 4V33A 4IP5A 1FXQA 3KFTA 5I23A 2E6YA 2NUWA 3DFSA 1BKSA 2BX7A 3ORWA 5CPMA 3LTYA 3MUAA 1YDNA 3DFNA 2UV8G 5HQEA 2PURA 4UFLA 3ANVA 4JOMA 3TUUA 2QXWA 3OJGA 4TW8A 1UR8A 4PN2A 4HN8A 3GDRA 3PZTA 4L61A 2QMJA 3BAXA 1FKJA 1BVNP 3R8HA 4P2VA 1EO5A 4PMUA 2D2OA 1FWSA 3HG2A 2RH9A 3W7JA 4RJEA 6REQB 2OX1A 4C6PA 3QQWA 4QQUA 1J18A 2ZRVA 2OFJA 4GQBA 3AS2A 4W87A 4C60A 3RNDA 1TQXA 1YXDA 1HO1A 3U0HA 1DJGA 2X2GA 2L2SA 4NNRA 5TBOA 2UY5A 4LYPA 5CPLA 2UZ9A 3PJTA 1B4EA 1HF6A 3ZVHB 1BKHA 4I7UA 3U7VA 4E5TA 3SURA 4L4MA 4HZ6A 4N2YA 5HW7A 1HKKA 4FMVA 4U2YA 3AC0A 3C5QA 3CGMA 4Q4MA 5E5CA 2C14A 3O5KA 1X39A 3BTNA 4MY9A 5I02A 2YDRA 3P8JA 4B3KA 1Q8AA 1ZBVA 2DY3A 1ELSA 2IQDA 3N2TA 2F84A 1H1ZA 2B7OA 3IGXA 3ZQ9A 3WEMA 1IZCA 3KAOA 2OCZA 5FF0A 4HU0A 4QJ4B 3Q65A 5CAKA 1QW9A 2GVLA 4LSBA 3JZEA 1EDQA 1BFNA 3SDOA 3TJLA 1ONRA 3BW3A 3IPWA 5RUBA 1IR1A 1XSJA 1DE5A 1MW1A 2AMGA 3ZLGA 2RAGA 3VNYA 2BY2A 5BCAA 3T81A 1DKWA 4Q4PA 1J01A 4C1LA 4AHOA 3RM9A 3SBFA 1OEPA 5HMDA 5H8UA 2WVTA 1QT1A 3SI9A 1FY6A 3CZLA 1UP0A 3KL3A 4JFLA 3H22A 3P14A 4DNMA 3GG8A 4DJDD 2GVJA 3CMJA 3OBKA 2GGEA 2OO6A 3RR4A 1QOXA 1J4EA 2VCBA 2ZADA 1SO5A 3T2QA 4LUTA 1JCXA 3BDKA 1US0A 2YFNA 4HCLA 1SO4A 4IUGA 1E15A 3SRKA 4IGNA 4UTMA 1OK6A 4M29A 1DJHA 1Z3NA 1Q6FA 1GQJA 1WAWA 3UI4A 4Y9NA 2I17A 2XVGA 2FHFA 4UFHA 4LQ1A 2Y61A 3BPWA 1Q7ZA 1GORA 3BLKA 2VC6A 2DFAA 3EXRA 4S3AA 1XJBA 3AU2A 1PSCA 5LHEA 2A3LA 3LXCA 4YXGA 4ZCWA 1XC4A 1EC7A 2NX3A 1TMQA 2Z1SA 3WLJA 4CUCA 1WA3A 3GU1A 3R11A 3S6DA 4BF8A 4BCEA 5PTDA 2JQXA 1X7IA 4GC4A 4UWMA 2M08A 3BV7A 3UU0A 4HOWA 3S5ZA 1MUWA 1CXHA 1IEIA 4W7WA 3MANA 2DUXA 4PCFA 3NM1A 1W8SA 7ODCA 3GXTA 5TQLA 1R3WA 4GGBA 5E09A 4HNVA 1CX9A 4GUJA 3URNA 3WF4A 1ZRQA 2W5FA 1SU5A 4U5IA 4B5NA 5FJPA 4YMZA 1YEYA 2CCRA 5LGZA 2DW7A 4UTKA 1R86A 4B2DD 4DH0A 1K70A 3EX1A 3K8LA 1QNPA 4UTFA 3DN5A 2BHUA 4Q7BA 4RXGA 5F1UA 3SB0A 2Z27A 5CH9A 3I4KA 3MKVA 1OC7A 3RIKA 4X9SA 4DRKA 4GWEA 2J79A 3AO0A 2CPUA 5AYZA 2BV9A 1FWWA 4KIEA 3DDMA 3U57A 2V2CA 4GYPA 4LVBA 1OY0A 1GTHA 4GZ7A 3RX3A 2RGMA 5AHNA 4F9DA 1EO7A 1X6NA 2C1GA 4NSBA 3DHFA 1XLBA 4AZ5A 3F5KA 4LH8A 3FOKA 2OT0A 4EWJA 4KCUA 3W2MA 4M1RA 4K1GA 4QZVB 3SEPA 4HKPA 4Z2KA 2QCEA 1O5QA 2NSXA 1KC7A 2Y7GA 2HISA 3B8TA 2BVDA 5CKSA 3G24A 4WY0A 5DY2A 3WL0A 1GKQA 4UNIA 4OGZA 4YS1A 5XIAA 5CPOA 4S2CA 2BY3A 2Z1BA 3U4AA 3UJ2A 3SSJA 1E5JA 4IX0A 3QFEA 3VIMA 3EWYA 5T9BG 1GGOA 1D7JA 3GD6A 4AG0A 3ZZ1A 2PDHA 3E12A 1VFLA 2C8NA 2EJAA 2A21A 4E3VA 4QQ3A 9CGTA 6XIMA 1T96A 3RMJA 3VKAA 4R7WA 3N9SA 3PWAA 3SW6A 3UXIA 4AQLA 3RDKA 3KVLA 5A8OA 1NOFA 5LNUA 3L4YA 3CV2A 4OHQA 4TV6A 4P61A 3VDBA 5C7VA 5HMFA 1KT0A 3CZGA 3U2ZA 2EBNA 3H7UA 4NYUA 7REQA 1PKYA 5HJYA 3VOHA 3OZPA 5I09A 1YX1A 4ZO6A 3PZMA 5HULA 2NZLA 3UJSA 3GQYA 1L8PA 3BUVA 2X7WA 4IG2B 1IQ8A 3V0SA 5BROA 4FAPA 1VLIA 2X0YA 4PZVA 4L9XA 4IWWA 3CEPA 3P80A 2IQ0A 2EXOA 4E4PA 4IQDA 1VHNA 3CAVA 3W83A 3RU8X 1VFOA 1UROA 2HE8A 1V51A 5GNZA 3GU0A 4JHMA 2NLIA 3ANUA 4UTWA 1EX5A 3IAQA 2AKMA 4TO8A 3LSBA 1QDSA 2JBMA 1KTBA 1L0PA 1U2YA 4D8LA 5HR7A 3OOQA 2NUXA 1ECQA 1JUBA 3PBWA 1NY1A 1DORA 3AHTA 3SY5A 5CPSA 3DESA 2NT0A 1YADA 5G4HC 3WJSA 1X38A 1YRRA 4JL2A 2CLFA 3MHGA 2KGJA 1IWAA 1R9HA 1R9YA 3GHTA 1TCMA 4ATLA 1YE4A 4H2CA 4GNVA 1TA3B 2QT3A 3BAYA 4TXEA 3ITOA 5I2UA 4Y9MA 3WUEA 5SWUA 3V5FA 2NVCA 4CVWA 2DJLA 3UD6A 5FF7A 3KM8A 3KACA 4N9EA 4ASTA 1RK5A 1UWSA 2E6AA 4XD3A 1HKMA 3BK0A 1RQEA 4WJEA 4G5DA 3AJ7A 4MWAD 3CH0A 3W1NA 3B9EA 3LM7A 3PBMA 1NAL1 4CCEA 4S3KA 3RAOA 2MF9A 4CVUA 2GJXB 4QR6A 1E5NA 1I2OA 4BWLC 3H2CA 4BY3A 4GH3A 4GJJA 1FDZA 3FAWA 5LKYA 1R3TA 2VUNA 4HBEA 4HYVA 4Y9AA 1EGZA 1IT0A 3BLPX 3K8MA 1R47A 3KX6A 3HPFA 5I77A 5B7YA 4Y7EA 4PUDA 3OGSA 2V68A 3O1NA 1W31A 2C18A 5FA5A 1FH8A 1OGSA 1GYMA 3HMCA 1DXFA 4L64A 4NQ1A 1VLWA 3UVAA 2CETA 3OIXA 1S5VA 2PDGA 3UETA 2OODA 4AYGA 5CZSA 3WSUA 3P93A 4H9VA 4D1IA 2YX0A 4ZMGA 2OQHA 2NQJA 4PMOA 5BOOA 3P61A 1ZZMA 4DI9A 3N4AA 1ZTVA 4U5KA 3W76A 3E9AA 2JKPA 3AOFA 3DC0A 4PMVA 4S3DA 4BQ5A 1H7OA 3CJPA 3E6EA 4MJ4A 4GX8A 3VD4A 3WUGA 3IKGA 2X2YA 2GDUA 1CECA 4D8ZA 1PWLA 4GACA 3VKBA 1DJQA 4NP7A 3IJ6A 2J6XA 3TH6A 5KZEA 1TR9A 4CQ8A 1QCWA 2ZXAA 5K9XA 3S5OA 2Y8VA 1M53A 3M0MA 5E6ZA 3S6TA 3PN8A 2VEIA 1XS2A 1UC4A 1X8FA 5HT1A 1RCOB 3ALFA 3WLNA 4JL1A 4ODRA 2B5UB 3NZ1A 3QVQA 4GBDA 3CGNA 3VX0A 3KCOA 1W3NA 1VFSA 4BEUA 1UWTA 4C5YA 1AODA 3IK4A 5BU6A 1PAMA 1G6CA 3L2MA 3G3DA 3EDKA 3BZGA 3DUGA 3S4TA 4U10A 2FZDA 2D73A 2R14A 2WZEA 1KBIA 3W53A 4NILA 2YSWA 3PG8A 3NJ3A 3FYOA 3BLLA 4JIQA 3NXFA 3GXFA 3F4CA 1UMYA 3HPAA 5HDRA 1WBHA 1X1OA 4WR3A 5AB3A 1W3HA 3N3TA 3IGHX 4QS6A 3D5HA 1XUZA 2QF7A 4JYDA 4Q4QA 1ZLPA 2FJKA 3W7LA 2R24A 1Q2RA 3HU7A 2J66A 1QR7A 3IVUA 3G1XA 3TWAA 4RXFA 1HP4A 3B0VC 1SUXA 2PDUA 4Q6JA 1J12A 2XN1A 3NTYA 3QYQA 1RVGA 1EJ7L 1SZNA 3PAOA 5LNRA 1DP0A 2V0TA 4HBOA 3ZFHA 1ICPA 1V0NA 3JUGA 3W38A 3ZT7A 1LCOA 1LP6A 3CU2A 5HQLA 2G41A 3WKZA 1B90A 5I98A 3WLKX 1VEMA 2R1PA 1UD5A 4CNTA 5IHRA 4UTJA 4UZSA 3VMPA 3M0XA 3W81A 4MNMA 1EJSC 4UNLA 1YMYA 1XYZA 1CLXA 1LUCB 2NWSA 4PMJA 1B3VA 3TSMA 2BZNA 4IT6A 2G95A 1D7FA 3JYMA 3Q67A 2XN0A 4HCHA 4O1AA 3CASA 1BWVA 1K8XA 3PK7A 1D6OA 1KXQA 5G2WA 1MZRA 2XVLA 3QKZA 2WHMA 3DI0A 1CWYA 4KFOA 1JYVA 1T8XA 2XGZA 1JAEA 4JPGA 3FA4A 2CLIA 2TPSA 4EX4A 1KM6A 2RGLA 5HJXA 1LQ0A 3MP3A 4ES4A 4IIFA 3QV6A 2BG5A 4BI5A 1P5BA 2QV4A 1ISWA 4NZJA 3AIEA 3DHDA 3DHPA 2PPOA 3RITA 4G2DA 4B15A 2VDGA 1AA1B 1C7TA 3V1PA 2ZZ1A 5A2AA 2CLHA 3EMZA 2TSYA 3LDVA 3A13A 3E5BA 1XLEA 1Q7QA 4DZ5A 3QR3A 4O28A 1NP0A 4EPEC 4BF7A 5C70A 2VX7A 1DWAM 3NO1A 1Q5MA 5DX7A 1A5CA 3GNDA 3HG5A 3KRUA 4HPJA 1FOBA 3KW3A 4FX6M 5GPRA 2EPKX 1QJWA 4ZODA 4WLCA 4W89A 1P1MA 5D2VA 5FF3A 3LOTA 2W79A 3TONA 1MW0A 1VC4A 2WSQA 1PBKA 5A6LA 4A3UA 4NX5A 3TA9A 3A4AA 3GVQA 5M17A 2IUZA 1NQ6A 4DWSB 3ANYA 3MV11 4UXDA 3PUDA 4EAYA 4NUWA 4BK9A 5IM51 1W1TA 4A3RA 3TCEA 4DXVA 2ETNA 4C5ZA 3UERA 3FGCA 3SCRA 1US3A 5K7JA 1TWWA 5ABEA 4LY8A 2VGFA 1VJZA 1VKFA 1JL8A 3CHCA 3RMEA 2CC0A 3GR4A 3N2OA 3I6EA 1J10A 4ALDA 3WFZA 4S3JA 4JFTA 3W73A 3O7UA 3UJRA 4CNPA 3CLMA 4PL1A 1F05A 4XAYA 4WDWA 1W17A 4DBWA 3UR8A 2OMAA 1PDYA 3DHUA 4I9AA 4WSHA 3MSRA 4C6LA 3KWSA 1Z48A 3KLKA 5LXEA 2YCKX 1VENA 2OT1A 3FEMA 3MUCA 1MSSA 4DJEA 1S5MA 2J24A 4AHQA 1TVLA 3LENA 1W3JA 4JNMA 3AUJA 3T0CA 1E6RA 1A5UA 5DRIA 3WLIA 4CN6A 2IPGA 1VCFA 3WH7A 2H8XA 3LBMA 3PNZA 2WO5A 5E0CA 3F2CA 2DW6A 1BYDA 5FJTA 1I75A 4LGXA 3HJEA 1PBGA 2INZA 4NIRA 1QWGA 2HXTA 2ZFAA 1BG4A 4XO6A 3UR5A 3O05A 3W84A 4XD4A 3LHWA 4WDXA 1N8FA 5A6TC 1DTNA 3B9DA 2Q5AA 3ELFA 2O9TA 3SUUA 3IEBA 5IOBA 1MFVA 4Y8EA 2VD9A 5D37A 4JFVA 4OTKA 4DPPA 3N2MA 3N9RA 2PV1A 1YPXA 3QBUA 4C90A 3FAXA 3SCNA 4LEFA 1PE1A 2VELA 1RSCA 1FBAA 1KCKA 1G69A 1P7TA 5I0DA 5HUPA 3W7DA 2XIBA 1Q63A 3KP0A 1Y0OA 4A05A 3GYCA 3KBNA 5LA2A 4JTUA 3UA3A 2OSWA 2G97A 5DBTA 2ALRA 4HNUA 1HJSA 2NUYA 1DTUA 2ANUA 4KCWA 4XZLX 1ZY9A 2REQB 3B9AA 5JBFA 1PPIA 3L68A 3LPPA 4P8XA 2OR2A 2X7VA 4JN6A 4CU6A 4E8GA 3AFBA 4DM2A 4KFPA 2O56A 5HNUA 4HHPA 1EOMA 3T0TA 2NT1A 4FOKA 1XCFA 4QDMA 1CGYA 3TIMA 1QI2A 5DF0A 2Z1XA 2ZVRA 3TMLA 3BGJA 3OTRA 3VABA 3C0QA 4H8HA 3T08A 5A95A 3I3EA 2B81A 4BA0A 4B5TA 3W88A 4DWSC 3L9CA 4DLMA 3UNDA 5HKGA 2V30A 3W28A 4QDPA 1DQXA 3EWCA 4EIVA 1WZKA 3D3FA 3T9PA 1DIOA 5BOEA 1C8VA 1RPXA 1R5YA 2FTYA 4LF1A 4PTWA 4ONVA 3KTCA 3UT0A 1ZU8A 4G8TA 4QJ1A 4PUJA 4AHPA 5HA7A 4GE8A 1ISVA 3ARUA 1Z32X 2C3ZA 1K8CA 3WDPP 1GUVA 5E9AA 3ZT6A 1NFGA 2Z2AA 5IFTA 1F2JA 2P88A 1S2AA 3N18A 3BWWA 4F0RA 1QPRA 2DT0A 1UHVA 3RRXA 5JIPA 4MNKA 3W29A 2J77A 2DJXA 4Q3MA 1JD9A 1ROUA 1FWHC 1M04A 3RX2A 3WDQA 5CQ1A 2WCAA 1BGGA 4Z1DA 3VM5A 2X1SA 3TLQA 3B4YA 2PDCA 4IUOA 2OU4A 4GZIA 4LPCA 4LC6A 1B6CA 4JTAA 3EEGA 1GZGA 4H9XA 3ABQA 3O3RA 1G0CA 5GJMA 3VAVA 4GO8A 4GVHA 3I6TA 2E5DA 3AZSA 2VJXA 5JUVA 1T7LA 4IPPA 3VCRA 3LN3A 3WUBA 5BRPA 2RUSA 3EMCA 1Y5WA 1J0HA 3CQHA 1M5YA 3L2LA 4GXWA 1OYAA 4V28A 1UA3A 5A2CA 1GVQA 3SGGA 4O0ZA 3SCTA 1E43A 4QDWA 4QROA 4I8YA 3PPGA 1FKXA 4YVXA 1A5NC 3W07A 4V1YA 4Y8FA 1XIFA 1E72M 2PMQA 3G22A 2HEJA 4HZ8A 3QC0A 1JCYA 3TYZA 3VNDA 5KTLA 4JYFA 3ABZA 1JXKA 4AD3A 2QPSA 1VS1A 3MZNA 1LT8A 1OF6A 1AQ0A 3QN3A 4Q8UA 1XDJA 3VO0A 4E2DA 4HZ7A 3ZOAA 1BD0A 5M5DA 4KWVA 5HAOA 1S1RA 3T55A 4QP0A 2G0WA 4C6MA 4IMAA 4GVFA 3UFYA 3RCNA 1T40A 1SZFA 1V02E 1NDZA 3NURA 4JIHA 5CC3A 3W87A 3B8SA 3HJZA 1UG6A 4JICA 2G3JA 1HXJA 3UR7A 1R85A 1Z41A 4F40A 3VMOA 3BAKA 4CQCA 1JIBA 2P50A 4JFSA 4A35A 1J93A 1E0UA 1J4HA 3GXMA 3RYSA 1HP5A 5E0KA 4E8DA 2D3LA 4XBKA 4MY8A 1EA9C 3BOXA 6XIAA 4GYKA 1KFBA 3V0UA 3A12A 3UBPC 4HK6A 3RPMA 3AZTA 1KFCA 4UR9A 4HQVA 2W61A 1SR0A 4H9TA 2DH3A 3BGAA 1CGWA 3D3AA 2VGGA 2Z2UA 2GYIA 1VIWA 4NYYA 4DAIA 1FD9A 3PULA 3TYCA 1LLZA 2DSWA 4C6KA 5HWCA 3N6HA 3TP4A 1DPMA 1ZUAX 4LVAA 1W9XA 2WVVB 2QJHA 1K77A 1XP3A 1UR9A 4GABA 3SIZA 1T5AA 3HG3A 3W01A 1FWCC 2AQOA 6ALDA 2AMXA 2WXDM 4ERGA 1E71M 2A5HA 1KWKA 3IUIA 3N9KA 3NGJA 1EB3A 3WF3A 3U2OA 5A1AA 4ICMA 4C7GA 2D24A 5D4YA 1B3ZA 2O9OA 1G7VA 3VPLA 4PCPA 1V02A 1G01A 3UXDA 3QR1A 2QCDA 3G1SA 4UMBA 3NDYA 1F4AA 2VX4A 3TYUA 2FZ9A 1QK2A 1YW5A 3AHXA 2RUCA 3WQGA 2G4JA 4DHGA 4M24A 2A7NA 2PWGA 1LRQA 1CTNA 1EGVA 3MMUA 1R46A 4ADSA 2VZUA 4EPBC 3GS6A 3STFA 1VBRA 3T2OA 1Q45A 3PTQA 2F2HA 1U1JA 1MQRA 3FKRA 2XPBA 3AHZA 1VEOA 2QPXA 4ADTA 1BSLA 4XAFA 4HA1A 4ODNA 1GWJA 3VNIA 1KTNA 1TPC1 4L6DA 4UQBA 3BARA 4UCGA 4I5XA 3PR2A 2KAUC 2WMJA 2AQVA 4R3UA 4AY8A 1JZ4A 2V3DA 4N4PA 1CXFA 4EAMA 2ISVA 3NTPA 2CXEA 3FJLA 3EWDA 2DEPA 1LTDA 4XBJA 1NIUA 3WH5A 2XFYA 4AFYA 5C2CA 1K4HA 5D04C 2E77A 1IEXA 4OU1A 2DIKA 2E9BA 2NXGA 3W7OA 1LJYA 5HMSA 2R1NA 3CIXA 2OGJA 2E4TA 5C9WA 1I2PA 1IEVA 4OKDA 4FSAA 3CT7A 5D02A 3EOEA 1WZMA 4ORIA 3W6LA 4O57A 2CBVA 3ABRA 4ODOA 4QIBA 2Q8ZA 2EO7A 2JFEX 3CLWA 3LRLA 3O6YX 4AMAA 3EOOA 1E4LA 3EA2A 1MNZA 1O5XA 2VZOA 1NU5A 1MWOA 3KZSA 1TSIA 4IF2A 1GVSA 3WJWA 2VR4A 3IKDA 2VRJA 1SFTA 4ML4A 4FO4A 4KPLA 1NP2A 3CQIA 1K7EA 3URQA 2ICSA 1DJXA 2ACUA 1ZP4A 3AWNA 3NDOA 1XR2A 4MMWA 1KM5A 5J6EA 4A3QA 3WUFA 1A3XA 1NH6A 3S9IA 3JRKA 3A3WA 2PD5A 3G5EA 4H1ZA 1QWKA 3N6JA 4IPIA 4I7VA 4GOAA 2VC5A 3BG3A 4DWSA 2Z25A 8XIMA 2YCIX 3NZPA 3SQMA 1PIFA 4GHRA 1WDQA 1Q6DA 4I6KA 4M82A 1O1ZA 3BAIA 4EF9A 4JIEA 4HNCA 1X98A 5B7ZA 3UY8A 2O9PA 1FKBA 1W1B1 4GIVA 4PMYA 1ZJIA 1BYCA 3MW7A 3DFOA 3KDNA 3DYMA 1XLGA 4H00A 2MNRA 4Q4OA 1HQTA 1OG0A 4UTIA 1H4PA 1E56A 4XUGA 3MZ2A 4N42A 4U84A 1O5KA 3OZOA 4LVGA 1UBPC 4IMCA 4W9OA 1V03A 3T6CA 3PHAA 1HGWA 3FK4A 5G2HA 4WX2A 2Y62A 3AXHA 1KFKA 4AAJA 4WXZA 3F2DA 4TNSA 4XZWA 1W9PA 3D6NA 3HQNA 3VIHA 2WNNA 2ZXDA 3GDMA 1JCJA 5M03A 4H8UA 1H63A 5HR6A 4DBSA 3LNMA 3E2VA 3TJIA 2C79A 1R2RA 1P0BA 4MB3A 1O60A 4B9YA 2DIEA 5A8GA 3W7GA 3BCDA 1U79A 4PBGA 4KCVA 4GXPA 1IXNA 1PVNA 4X0NA 2QUMA 5C8BB 4BQ4A 5CXPA 1KKOA 4X63A 3K4AA 3UGRA 2I7GA 2Z24A 1W5NA 3WDHA 3KVMA 4YLWA 3VDHA 2JF7A 4ZQCA 4TX8A 1K9EA 4JFJA 4OQVA 1KGWA 4JTGA 1KO0A 5EMLA 5D09A 3STCA 3O16A 1G4PA 1SW3A 1QNSA 2BVWA 2E0PA 4HU3A 3SUWA 3RF9A 1CGVA 4M7TA 1NSJA 1TG7A 2DSVA 2GVYA 1JCLA 3LZ3A 2O4QA 3UGVA 3IGUA 1CXKA 2IKGA 3NQEA 1H1YA 1YHTA 4JAWA 4XIMA 2GJRA 3WMCA 5D05A 1CGXA 4M6PA 1XIDA 1JNEA 1UZDA 5KZDA 1GQKA 4WHBA 2CNCA 2EEXA 2FZ8A 3WQDA 3RUBL 3HTWA 3PZ9A 3ATZA 1PIGA 4XAGA 2VHLA 1KXVA 3VGEA 2Y6ZA 1QHOA 1VBGA 4IMDA 1FAPA 1R38A 1IEQA 3R2GA 2WJDA 5CLTA 4FLSA 1BXBA 3GFYA 1U5JA 1TELA 1LORA 3M0LA 1ZBCA 1IR2A 1J11A 1MVYA 1C8XA 3UNTA 5A6AA 1AJ0A 1V79A 4DZ2A 2ACQA 2Q71A 5DIVA 7PTDA 2BXYA 1P1XA 2XZ9A 3A23A 1G4EA 3MBDA 3TNBA 4Y96A 4ZB0A 4XZBA 1ITUA 2F9RA 3BQ6A 2DZXA 3KOZA 3ZXWA 1V6VA 1EOKA 5E0FA 1ONXA 3VTRA 3IGSA 3DIPA 2F6KA 2FVKA 1G67A 2ISFA 4KWSA 1UD6A 2GL5A 5FF4A 2NQ9A 3G1VA 3W7NA 1XFBA 2R94A 3LBOA 4M6VA 1TE6A 2VFEA 4U85A 3G1FA 1OQFA 1H51A 2F6XA 4QITA 3O5RA 3L12A 4G1NA 3Q58A 2A0NA 1GQLA 2YL8A 2WV8A 4GIYA 3HFTA 1W56A 2R91A 5DY3A 1OBAA 1BAGA 3REQA 3NVTA 4IP7A 3K5XA 4NZ1A 2QUTA 4LAZA 1SW0A 1R87A 4HNTA 1JRBA 1VCGA 4QG8A 1XIHA 3DFHA 3C86A 3HO8A 2GJXA 3VOCA 2C16A 5CBJA 3PS7A 1FCVA 3SCQA 3BJTA 2YXGA 3APYA 2NQHA 2Z7GA 4JKKA 4OBSA 3PFMA 3M5YA 2CU0A 2ZA1A 3F2BA 4A8NA 4MY1A 2CLOA 5A69A 3FDKA<