2G8ZA

Crystal structure of the ternary complex of signalling protein from sheep (sps-40) with trimer and designed peptide at 2.5a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPKLKTLLSVGGWNFGPERFSAIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKRHLTTLVKEMKAEFIREAQAGTEQLLLSAAVSAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFAGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSFTLASSKTDVGAPVSGPGVPGRFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAVKDVLAEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the ternary complex of signalling protein from sheep (SPS-40) with trimer and designed peptide at 2.5A resolution
rcsb
molecule tags Signaling protein
total genus 118
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2006-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2g8zA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2g8zA01
1UD5A 3WEZA 3DC0A 4PMQA 1JDCA 3L4XA 1XH0A 1J18A 2PBOA 3VGDA 4WF7A 4BA0A 1HJVA 2J7BA 1E56A 2EEXA 4TVCA 4Z2LA 3AHTA 4ZEPA 1W91A 5ECUA 1ISYA 4WIWA 1UYQA 2CBUA 3K8KA 4U33A 4UFIA 5E6ZA 3IJ7A 4W86A 2WLYA 2NSXA 2WBGA 4K68A 4CD5A 3RDKA 4AZGA 3BAJA 2CKSA 3WDPP 2E9MA 1CXIA 1OIFA 3U7BA 2OYLA 2J78A 4CD8A 1A47A 3HU7A 4Z2KA 5BXPA 2Z1SA 1AMYA 2XJ7A 4C7GA 2BXZA 3MO4A 3WBEA 4V27A 1JFXA 3CO4A 1GVIA 2VNCA 3ZM8A 2AMGA 3BCDA 4ATLA 5DF0A 3WY1A 2G3JA 1LWJA 3VU2A 3D5HA 1B0IA 3WH8A 4W87A 1HJWA 1KGXA 1UR1A 3CMGA 3POCA 5A8OA 2F2HA 4E4PA 2WKGA 2V38A 4D1JA 1VBUA 3ARXA 5A3HA 5IHRA 5ABHA 2J79A 2YOCA 2G4FA 4TX8A 2F8QA 3LMYA 4PMXA 1SR0A 3RM8A 3ALGA 1UD4A 3K8LA 2UY2A 5ABFA 2DDXA 3L4VA 1V3LA 3W0KA 4B3KA 4QCFA 4CN1A 1R85A 1FOBA 4U5IA 3RIKA 3VX1A 2PBGA 3WD4A 2BHUA 5AYBA 1TVNA 3O2LA 1KR0A 2XTKA 1UWSA 4Q22A 3W25A 3WH7A 1G01A 4GI9A 2OSWA 1C90A 1W3KA 4PMYA 2DT0A 4W84A 5CG0A 1UWIA 2E4TA 2XUCA 4CCEA 1HJSA 3WBAA 3VIOA 1ESWA 5E6YA 1UKPA 5KEZA 2WMJA 1C91A 2BY3A 1LG1A 1M04A 4UQEA 1PAMA 5A6MA 1CZ1A 2GVYA 3GDBA 4H04A 1H0IA 1OIMA 1D3CA 5E70A 3J7HA 1H49A 2EO7A 3ARTA 3VDAA 1H3GA 1E0XA 2ESCA 3BSHA 3A3HA 3FHAA 1EQCA 4PEEA 3IJ9A 3MUZ1 4UQCA 1DWHM 4GQRA 2XIBA 4M82A 4UQ9A 5A2BA 1V6XA 3ARQA 4BQ2A 1GQIA 5DT7A 3VD5A 4PSRA 1E9LA 2EPOA 3LPGA 3OLGA 3WL0A 2J7GA 4Q7NA 3CGTA 1GNXA 2JE8A 4MNKA 1ISZA 4WJXA 3ZOAA 1AQ0A 1ZBWA 1W3JA 4MNJA 2E0PA 3WQ5A 1QW8A 3CZEA 1MWOA 3SCVA 2YL8A 3UG5A 3UG3A 1K9EA 3CZ8A 3PZVA 3VDBA 1J0KA 2QF8A 3VIPA 1X6LA 2DIEA 3NSMA 1JD9A 3OBAA 1FH8A 1HIZA 2ZUVA 2FHCA 3HMCA 4KRTA 2OSXA 2WC7A 3WD2A 5GQBA 4GZJA 4P8UA 3PTMA 2BXYA 3LPOA 2WHKA 4MNMA 4HOWA 2WMKA 1CGUA 3RJXA 3VIKA 3MMWA 3PHAA 4MAZA 3WEOA 2OYMA 1CYGA 2VT0A 4QDMA 2EPLX 4NRSA 2YKKA 1EHAA 2Q8XA 1Z32X 4X0VA 3VPLA 1MW2A 2J7EA 1W3LA 2XPKA 2NT1A 1E40A 2GJXB 2ZX6A 5E0CA 4HPHA 3WUBA 1Q6CA 2QPSA 5EMYA 4GZEA 2VZVA 5D9OA 4ACZB 5C70A 1MW3A 1VAHA 1UD2A 3U57A 1C7TA 2WCSA 2XVPA 1R7OA 1WE5A 3IAPA 3NCOA 1TZ7A 1HT6A 3WD3A 3NSXA 3PZNA 4AY1A 1QOXA 3AIEA 4GPNA 1JG9A 5BCAA 1EIBA 2J8GA 3UR8A 1CXFA 1U30A 2D1ZA 3RCNA 1JI2A 4AZHA 4H8UA 1W9UA 4F66A 4W7WA 5DMYA 2JIWA 4DWSA 5HNNA 4FLOA 4HU8A 3AIUA 3AS0A 1C7SA 4H8VA 3MV01 3SCSA 1JXKA 3OGRA 1JDAA 4W5ZA 1C3FA 1NWRA 4H7VA 1UWTA 2VZTA 1HJQA 3MMDA 4AD5A 1NARA 4JKLA 4E8CA 5AC4A 5I6SA 5LA0A 2V3GA 4MDOA 2ZWYA 3VOCA 2WK2A 3A4WA 2F61A 5JUVA 4DUXA 4AZ6A 2WZIA 4CKQA 3OGVA 3T0DA 4CU6A 3AXXA 1CEOA 3AMGA 2X2YA 3T0BA 2VTFA 1H5VA 3AISA 1GCYA 1VFOA 5E0FA 1MQQA 1W9PA 1E70M 4YHGA 1KXHA 3KL5A 5BXRA 1QHOA 3FY1A 1QBAA 3AHVA 1VIWA 2XIIA 4D6DA 3MUIA 1E4MM 3VTRA 3L4WA 3N12A 4DWSD 4P7QA 1CGWA 1GOOA 1KR1A 2ZUWA 1F4AA 3GXIA 1FP8A 4AZBA 1E1EA 2CHNA 4PN2A 2Y4SA 4HP5A 1JXJA 3BSGA 4W8AA 4P7NA 1OSEA 2BFGA 3RM9A 3ARPA 3II1A 4P7LA 2J47A 1WZKA 2UY4A 3A4AA 2W63A 3TTSA 1TG7A 3HN3A 2J7HA 2OSYA 4YN5A 1MYRA 3VDCA 3HJEA 3AXHA 4ZE5A 3WNPA 1US2A 4A3YA 3SCPA 5FD0A 4P8XA 3PTQA 4CD7A 1MW0A 4UFLA 3ZSTA 2AAAA 5AY7A 2X1IA 1UR0A 2DEPA 3PN8A 5D4YA 3VM5A 2J7FA 1G9HA 2CHOA 2IXUA 5E09A 5JH8A 1JF5A 3WDJA 2WVUA 1DWFM 1E6PA 4AC1X 1NWSA 2WMIA 4A3HA 4W7UA 2WHJA 3CUHA 2YA0A 2W67A 4QLKA 4B16A 4PCSA 2WANA 3MMUA 4W89A 3PZ9A 1BGGA 4D6GA 3AZRA 3PZGA 2Y2WA 4PMZA 1C92A 1B3XA 4UFMA 3VGFA 3WDHA 5A8QA 1CLVA 2RGMA 1E6SM 2X0YA 3BLKA 2D0FA 1UR4A 1KCKA 1OD8A 2GDVA 3AHZA 4RE4A 4AD0A 5A2CA 5GPRA 1CGVA 3VIIA 4MNLA 4LYPA 5HPOA 1E6NA 2XG9A 3GXDA 4XUYA 2WM0A 5AYIA 3UETA 3OZOA 3W81A 2FDMA 1JF6A 3ZSSA 5A6KA 3EDDA 4PYSA 3ZT5A 5I23A 1CNVA 2BHZA 2JEQA 1NP0A 1NOWA 5BYWA 1C8YA 1DP0A 2YL5A 2DT1A 1DWAM 2WCAA 4AWEA 2WXDM 1E5NA 2NW0A 5D8WA 4Z2GA 5LYRA 1K6AA 3W27A 1W32A 3W53A 2BVDA 2G3IA 3UCQA 1UH4A 4AD4A 3E1F1 4Y7EA 1JGIA 4BQ5A 5JBFA 1W1YA 4JFVA 1PX8A 2VRKA 3W29A 4Z2HA 4NI3A 2UY5A 5I2UA 1PX4A 1VENA 5EBAA 4D72A 1HKIA 2D24A 1UR8A 5IFPA 3O6AA 4HA1A 4E8DA 1UR2A 2GK1B 4QCEA 1MW1A 5F7UA 4RE2A 4TVUA 4OOZA 4F8XA 1GHSA 3KL3A 3WUGA 2G3NA 4PMNA 2XFYA 1B31A 2VX6A 4BCEA 3AMLA 1VBRA 1G0CA 3VINA 4RL3A 1K9DA 3CH9A 3NUKA 3W4RA 4CN6A 2JALA 4D1IA 3ZJ7A 2GDUA 4MB3A 4C7DA 1QNQA 4NSBA 1JAEA 3ARVA 3N13A 3VD4A 2WZHA 3T09A 3DECA 3PZIA 3BCFA 2BY0A 1I75A 1W1VA 3OLIA 1UQYA 1UH3A 4HA3A 2C0HA 2G8ZA 8A3HA 1FP9A 1DHKA 1UD8A 3ZQ9A 4FMVA 1KWGA 1LL7A 3SUTA 2XSAA 3BMWA 1EOKA 4PMVA 1I1XA 3L2LA 3PZUA 2D0GA 1G94A 4LGXA 2XSBA 1E4LA 4QAWA 3AYRA 5I78A 1IT0A 1HVXA 3EMZA 3OLEA 1M03A 2XGBA 5E9AA 4XV0A 3ZR5A 4JFWA 1CBGA 1J0YA 3M46A 1KWKA 1BLIA 1E4IA 1HP5A 2OWWA 2OYKA 2J75A 1SFSA 4BQ4A 3N15A 1ISVA 2D2OA 4HTYA 1KQZA 1NH6A 3K4AA 1E0WA 3O9NA 3M6DA 4PUEA 1B3ZA 1H09A 3DYMA 1DTUA 6CGTA 4Z2IA 2YBUA 2PB1A 4GI8A 1GPFA 4GKLA 3W6MA 3CZGA 1BPLB 3AQUA 5HBFA 1ZU8A 4R27A 1JIBA 1EO5A 1CGXA 3AMCA 1V08A 1LG2A 2Y5EA 2CBVA 1OGBA 3FNDA 2BY1A 1JZ3A 2D20A 3AICA 4QP0A 3ALFA 1EGZA 3OB8A 2YA1A 2VJXA 1ODUA 1OT1A 3AZSA 3OLDA 5BRPA 3FAWA 1TR1A 4QLJA 3EMQA 2YDSA 1G5AA 2MANA 1BGAA 4TTGA 3L4ZA 1J0IA 2VRJA 1B3VA 2GJXA 3ZJ8A 1TMQA 4W7VA 1ITXA 1WP6A 5HOSA 2DT2A 4WLCA 3AS3A 2V3FA 1LQ0A 4TTUA 3VNYA 2EQDA 1GVYA 4ACZA 2WSKA 2DSUA 1OCQA 5M5DA 1E6ZA 1W9BM 3QGVA 4M81A 2B31A 1UWUA 5IDIA 3W28A 1HNYA 1TUXA 3EYPA 3ZJKA 2VL4A 1FH7A 2WCGA 2W91A 4UTFA 2VCBA 3UERA 2J74A 5A6SA 1JYXA 1E15A 3K4DA 4FF5A 3B9AA 1KCLA 1QI0A 4M24A 4ZFMA 3WQ6A 3SCQA 2QLYA 3GYCA 1B30A 2NT0A 1D2KA 3AIVA 3MSGA 3AOFA 1F4HA 2PWHA 2CERA 3PTKA 3WUEA 5FOOA 2YL9A 1VJZA 1GOQA 4M8UA 1V3HA 1JZ6A 3ARUA 3K1DA 2QMJA 4PTVA 2XVGA 1KBBA 1WZAA 4AZCB 2D23A 2A3HA 4JCMA 1HF6A 3QR3A 1WDQA 2ZE0A 2CPUA 4MB5A 1J12A 1WZLA 1KBKA 1RD6A 4UQAA 5IXEA 2ZX9A 5EB8A 1OB0A 3DYOA 3W82A 4D6JA 1C93A 4F79A 1VFFA 2ZUUA 1XC6A 1BYAA 1W2PA 2UY3A 1B1YA 1E4NA 4CD6A 5A2AA 4HPGA 5CGMA 4UNIA 4BZYA 5KZ6A 4PMOA 3VKKA 1E6RA 1L0PA 4PRWA 3TONA 1JZ8A 1RP8A 3T2PA 3AJ7A 3WUFA 3MUY1 3ARRA 3WF2A 2VX7A 2WC3A 1J9YA 3CUIA 2GUYA 4H8HA 2YLLA 4M56A 2UWFA 2CITA 4PTMA 4FK9A 1TA3A 1IZKA 1KFWA 3GBEA 5I3DA 4X0NA 3SCOA 1U33A 3F5KA 4F9JA 1EDQA 4U31A 1B90A 4WSKA 3LPFA 3WF0A 2VQUA 2CETA 1VF8A 3RPMA 4CCCA 3QHOA 1E73M 4AEFA 1BHGA 1LJYA 4AZ7A 1UG6A 4GIAA 2GJPA 4M80A 2G41A 2J8FA 1ZJAA 1LF1A 4R5EA 2O92A 1KXQA 2IXVA 1ZS2A 3GH4A 4XZWA 3K8MA 4AD2A 2X09A 4E2OA 1VEPA 1HL8A 3AMKA 1K9TA 1J01A 2O9OA 2WAGA 1JD7A 1BQCA 1JYVA 3RM4A 1CTNA 1LWHA 3W38A 4UCFA 1UKOA 1AQMA 4TVDA 1W2VA 1XH2A 1AQHA 1D7FA 4PCTA 1PPIA 5JBDA 1QNSA 4JKKA 1BYCA 1QHPA 3VIMA 4AW7A 2WVVB 1JZ5A 4S3JA 5HDRA 1JYNA 1US3A 2V5DA 2Y8VA 1J0HA 1UZ4A 4J27A 4AISA 2VZUA 3PZQA 4W93A 2ZOXA 4IPNB 3S2CA 4JAWA 2TAAA 2VZSA 2WHMA 3MV11 2VO5A 1PIGA 2XM2A 1XCXA 1HN1A 1NOFA 3EBVA 1DWJM 2ZWZA 4UOQA 3N9KA 1H11A 2ZX8A 1E1FA 1UKSA 2W5FA 2CXGA 3VD9A 4PUDA 4CVUA 1YHTA 3U5UA 2XHYA 3KE0A 1CWYA 1EA9C 3EDKA 3N17A 3AHYA 3ARYA 1HKJA 4OBSA 3WFLA 5A6AA 4F9DA 4UFHA 5CPSA 1WNOA 3T2OA 1UH2A 3L4YA 2EJ1A 1EXPA 1UR9A 4KGLA 4UZUA 5BXTA 4OZOA 5A8PA 2CNCA 5BXSA 1UWQA 4P7RA 5GNXA 1CECA 2WPGA 1VEMA 2GJRA 1EHNA 1QHZA 4HOXA 1WDSA 4CU7A 4CN4A 3WNOA 1ODZA 4N42A 4W8BA 3IANA 1S46A 4X9YA 1E0VA 1O6IA 1XSKA 3ARZA 1UHVA 3BAYA 4J3VA 3RMEA 1MXGA 1RH9A 4BQ3A 3RO8A 5ABEA 1V02E 2GK1A 3AIRA 1WAWA 4EKJA 4TX6A 1CGYA 4J28A 2DSVA 2ZX5A 1QI3A 4W8LA 2ZX7A 1TFVA 1BFNA 4DUWA 1MQPA 2EPKX 2VR4A 1BTCA 4U5KA 3VMNA 5I77A 3WNKA 5IFTA 1KXTA 4EANA 1VB9A 3NJ3A 3JUGA 1CXLA 5CLWA 2ZXBA 1VEOA 2WMGA 1P6WA 1W1PA 2VCCA 3ZIZA 2XM1A 1UZ1A 2YLAA 4UQBA 5FL1A 3OA5A 1NWUA 4DWSB 3CHEA 5A6LA 4HMEA 1J0JA 1EQPA 4FLRA 5JIWA 3OZPA 2Y24A 4A4AA 4AYSA 2A3CA 1MXDA 5D8ZA 1GOMA 1VFMA 2WMHA 2X8RA 5CPQA 1PEZA 3BAIA 2PF0A 1WDPA 3EDJA 1NQ6A 2VRQA 2CIPA 2J62A 3KEHA 1O7AA 3WD1A 1B3WA 5TD4A 3PBGA 2BS9A 2CEQA 2FH8A 1J10A 4CCDA 3G6LA 1W1TA 2PWGA 3N11A 3POHA 1OINA 1E3ZA 2A3AA 2D3NA 3NDZA 1NWTA 3GM8A 2WNWA 2YA2A 4TOQA 3MANA 1R8LA 3BH4A 4MDPA 1TCMA 4D6IA 3TOPA 1ZB5A 1CXKA 1JI1A 1ISWA 5BRQA 2VOTA 5FCZA 3QOKA 1ISXA 4LPCA 4PTWA 3PZTA 1V6UA 3IJ8A 1JNDA 3TA9A 2VI0A 5BROA 4HU0A 3B8SA 3CLWA 3FHQA 1JDDA 3BAKA 1KQYA 5LA2A 3ZT6A 2VR5A 1YQ2A 3WH6A 1V0LA 2X05A 1BAGA 4AZIA 1A3HA 1QI5A 2WVSA 2BVYA 5JIPA 4URIA 3WF1A 1BYBA 1HP4A 2PWDA 3BXWA 3SCWA 1JYWA 3ZJ6A 2XVLA 3NSNA 1EO7A 1E6XM 3WSUA 1PIFA 4WKFA 4P8WA 5D9NA 5A95A 7TAAA 3A6OA 4QFUA 4HZ6A 1XHGA 3SCTA 6A3HA 1Q6EA 3WH9A 4P7OA 1EDTA 4UZSA 4JIEA 1K9FA 4FLQA 1B9ZA 3APGA 1J0ZA 3MUAA 1BG9A 3BAXA 4GXPA 2FHBA 4D6EA 4NZCA 4B9YA 4HZ7A 3GNOA 3F4VA 1ZBVA 1KGWA 4JKMA 5FL0A 5A8MA 2OWCA 1VFUA 2WWDA 1W3HA 4HZ8A 1WO2A 5DO8A 5M17A 4CD4A 3SUSA 1MFUA 3LPPA 2CYGA 1QI2A 1EOMA 2JEPA 1PJ9A 2VVNA 5HXMA 1HX0A 2WBKA 2DH2A 2E8ZA 3UEQA 5CLTA 1HJXA 5A69A 1V03A 4ML4A 2JIEA 1HXJA 2YIHA 3VMOA 2DQXA 1BSIA 4M1RA 4AZ5A 4EAMA 1QW9A 1H41A 4ZXOA 3A4XA 2X0HA 4XX6A 1W9VA 1V3KA 3VNZA 4ZXLA 1QI4A 1UWRA 3AIBA 2WW5A 1MVYA 3ARWA 1HVQA 2GSJA 4KGJA 3BC9A 2DSZA 4PMRA 2BY2A 5DFAA 4AD3A 3SEPA 3THCA 3K46A 1EDGA 4AZCA 2C7FA 1CENA 2WVTA 2DSWA 2ZUSA 2XFRA 3OGSA 4J3SA 4LX4A 1ITCA 2DH3A 4ATWA 1QNOA 1WCGA 4AIUA 1GZJA 1SMAA 1JZ2A 1BYDA 3ECQA 4W85A 1SMDA 2YDQA 1W9DM 4V28A 2CCRA 3AIWA 4HMCA 4CU8A 2ZXDA 2ZXQA 5CXPA 4HA4A 4DM1A 3KWXA 2G3MA 4KH2A 1CPUA 4WSJA 4KRUA 3BLPX 4D71A 3CUJA 3VIGA 2WB5A 3WIJA 1XCWA 1MQRA 1R87A 5HPCA 5CGTA 3ARSA 2J7DA 4HMDA 5A6BA 5CZKA 1E71M 3GNPA 1OT2A 4IUGA 1OM0A 3D3AA 2V5CA 3CBWA 2WLZA 3B9DA 3T0AA 2WSPA 3MKKA 1VJSA 1R86A 3T2QA 1V6WA 1XV8A 3CHDA 1GOKA 3WMBA 4DUVA 1UD3A 2WKLA 3I3EA 1GOIA 1BF2A 1L8NA 1X1NA 2GFTA 1JZ4A 1FHLA 3OG2A 1TE1A 5C71A 1GONA 3W37A 3AXIA 4AD1A 1V0KA 3AZTA 2D0HA 3QOMA 3B9EA 1XD0A 4P8VA 1V3JA 4ZE4A 2EXOA 1TVPA 4J3UA 2XVNA 2ZIDA 4MB4A 3ZMRA 4L4OA 4OIFA 1Y7VA 1GOWA 4JL2A 1UD6A 2DPEA 1QPKA 3GXMA 4YHEA 4EK7A 1QNPA 4JZ5A 3WQ4A 3AROA 3W6LA 4IPLA 2O9PA 4OKDA 3VX0A 3TTQA 5A6BD 4KWUA 2VC9A 2WVVA 2VQTA 5CQ1A 3L2MA 3PZMA 3VGHA 1C8QA 2YDRA 4LXFA 1JAKA 3FAXA 3VGEA 2A3BA 1CGTA 1I1WA 1GHRA 3CZKA 4OBRA 2E9LA 3FW6A 4GQQA 3CZJA 2PWFA 3CPUA 1E43A 4D6CA 3AMDA 1XYFA 3GH5A 5FKYA 3SCUA 4IM4A 1RPKA 3GXFA 4ATDA 1OGGA 1KGUA 4DWSC 1GQLA 4MJ2A 2FGZA 3T08A 2QPUA 3KL0A 1V6YA 1Q4NX 2WC4A 4XB3A 2XYLA 8CGTA 3EDEA 1PX3A 3TP4A 4BS0A 1Q6GA 4EE9A 1RP9A 5LA1A 1UKTA 4AMCA 4UOJA 3UESA 1XGZA 3EMCA 5M03A 2YJQA 4J3WA 2OWXA 1UUQA 1AVAA 1GQJA 9CGTA 2WZEA 4NRRA 3VO0A 3UG4A 1E72M 5C8BB 2W92A 3BGAA 2ZUTA 5CSUA 1PBGA 4L4PA 1IV8A 1QBBA 3G6MA 2WWCA 4JHOA 3VVGA 3WN6A 3BAWA 5GNYA 4AEEA 5ABFB 3OIHA 3MS8A 1QVBA 4LYQA 5EFDA 7A3HA 3QHMA 4WKHA 3SCRA 3U5YA 4PMDA 1DWIM 1WZMA 1JZ7A 3WL1A 4MPKA 4D6HA 2CKRA 2V3DA 1CIUA 1QNRA 3WF4A 3MU7A 3TTOA 3AYSA 3AHXA 3DHUA 4D6FA 1J11A 1FHDA 4OJYA 3UR7A 6TAAA 3IK2A 1M7XA 1V0NA 3SIMA 4LYRA 3WH5A 1KXVA 1GW1A 1B2YA 2HISA 1UKQA 4W5UA 5GNZA 1W9XA 4RE3A 1JNEA 3PZOA 5FIPA 3I3DA 5IHSA 2E8YA 2BHYA 1ZJBA 5CPTA 3QHNA 2XWEA 4NF7A 3SCNA 5I24A 2VZOA 3L4UA 3AS2A 4MAVA 2JFEX 2PC8A 4OUEA 3M7SA 5A6JA 4AIEA 2OLHA 2DT3A 5I5RA 4B9ZA 1FFQA 1XSIA 3THDA 3CTTA 4HOZA 1B3YA 3GBDA 3WMSA 3EDFA 2ZICA 5D9MA 2VCAA 1ZL1A 1UA3A 1OBAA 1N82A 3WD0A 1M53A 5AC5A 2ZUMA 3RJYA 4PSPA 4UOZA 1KB3A 2BV9A 3CIVA 4CGTA 1M01A 2W62A 3VM7A 1XSJA 5A94A 2XFFA 2YBTA 3WDRA 3FN9A 3WF3A 2BNJA 4GO8A 1HKMA 3KZSA 1FH9A 3N1AA 2PI6A 2WHLA 4U3AA 2J7CA 1CLXA 2WMFA 1BVNP 2CESA 4S3KA 2PWEA 5EFFA 1H2JA 3VGGA 3BMVA 4JFUA 1WPCA 4GO9A 3WENA 3VIJA 5CJ5A 3A47A 1ZBKA 2A3EA 2VVSA 1V6VA 4H2CA 3ZR6A 1NOUA 2XWDA 3VGBA 3AS1A 2HVMA 1LLOA 1XRVA 3N18A 4W88A 2J4GA 1TA3B 1BG4A 2E9BA 2ZUNA 7CGTA 3AI0A 2W66A 3W24A 3VDHA 4WK9A 3IAQA 3VUPA 4UR9A 4TXEA 2EPMX 3L4TA 2VURA 2DGAA 3WFZA 4Z2JA 2D22A 4FLSA 4V2XA 2DSKA 3WELA 4YPJA 1BVZA 4JFTA 1E55A 2CBIA 1V02A 4BF7A 2JF7A 2J77A 2Z1KA 2E3ZA 5A8NA 4AXNA 3WMCA 5DEZA 1DEDA 4QLLA 4ZENA 5A1AA 3S6TA 3WQVA 4CUCA 3AIQA 1UOKA 4PMUA 3GTNA 3VD3A 4WKAA 5M3WA 2FH6A 3CHCA 1JFHA 1GUVA 1EH9A 1FFRA 2AOSA 4GZIA 1CDGA 1GJUA 2EPNA 1MFVA 1U2YA 4U2YA 3AFBA 2XGIA 1OGSA 3FXYA 3VD7A 3NIYA 1E5JA 4MJ4A 5ABGA 1PZ3A 3WNLA 2JF6A 2VX5A 3N04A 4J3XA 3NDYA 2YL6A 4GI6A 1FA2A 2C8NA 3W26A 4J3TA 2D3LA 2W4XA 2O9TA 2BVTA 3WQWA 1XH1A 2QHAA 2ZXAA 3NYDA 1Q6DA 1JL8A 2RGLA 2WYSA 3SUUA 2QMKA 1H4PA 4UFKA 2Y8KA 1WB0A 1V3IA 3M07A 3VIFA 4B3LA 4AIOA 2DIJA 2FHFA 3WNNA 4H41A 3SUVA 4N0RA 1NM9A 1LL4A 1HL9A 3GZAA 3SUWA 1HKKA 2V3EA 1GORA 1VRXA 3CMJA 1ZBCA 4LQ1A 1R7AA 3CUGA 4UQDA 4MADA 3WEMA 2W61A 3WNMA 1XD1A 1E3XA 3VIHA 2XVKA 3DYPA 1UQZA 4J7RA 3WDQA 3TTYA 3F5JA 4DM2A 1HJUA 4JCLA 1Q6FA 3RILA 3CZLA 4PTXA 4ACYA 4C7FA 3ZO9A 1GQKA 4PBGA 1H1NA 4M29A 3VILA 3WKZA 5CSYA 4MB1A 2J25A 1C8XA 3U7VA 2CBJA 1WKYA 1NP2A 3WDIA 1DWGM 1CXEA 1CXHA 2FGLA 5DT5A 2E40A 2QV4A 1SYTA 3SURA 3F5LA 4U2ZA 2VX4A 1PZ2A 1WDRA 3GH7A 1X6NA 1E6QM 4JHZA 2IUZA 1UA7A 1ECEA 2VUYA 4GINA 2EBNA 4JL1A 2VMFA 3MSDA 4KMQA 1IZJA 2WMIB 4MTVA 4CVWA 4JFSA 3DHPA 3VMPA 4IISA 3ZT7A 1OD0A 1V0MA 1V3MA 5I0DA 5I79A 4UFJA 3GNRA 1LL6A 3I3BA 5JBEA 1XYZA 3WQ8A 5BWFA 4TUFA 4U3CA 3CUFA 4B15A 1H0GA 1OWQA 3CHFA 1GJWA 2O9RA 4OOUA 4XZBA 1G1YA 5D9PA
chains in the Genus database with same CATH superfamily
1UD5A 3QGAC 4ZPWR 1W5OA 2C1HA 1J18A 4C6MA 4RXFA 1B4KA 3EWWA 4JX6A 4WF7A 1HJVA 3UW6A 1M5YA 4HBEA 3M0YA 3W7DA 1ISYA 2YW3A 3THQA 2WZMA 4W86A 4ZO6A 2WLYA 4HVXA 3THAA 2NSXA 1FAPA 1P0BA 4K68A 4ZGYA 2BOFX 2CKSA 3BAJA 4ORIA 2R1KA 4LT9A 1NF7A 3VOJA 4DRJA 2DW6A 2NXHA 3S9YA 1QZ2A 5EY5A 3UF8A 1AMYA 3G1FA 1JFXA 3CO4A 2VNCA 3ERPA 2AMGA 5DF0A 1LWJA 4IIBA 3WH8A 1OZMA 1KGXA 3POCA 1H7WA 5HJYA 5JH2A 2V38A 4CCZA 4PTNA 5IHRA 4ZPVR 1TO3A 1QAPA 3RM8A 1H61A 4FXSA 3IRDA 1N8FA 1QNVA 2DDXA 5AHLA 4B3KA 3C86A 1DQUA 3RYSA 1F6PA 5H1WA 4NP7A 4QDWA 3WD4A 2BHUA 5AYBA 1EKOA 1KR0A 3W25A 2Y6ZA 4MGGA 1B6CA 1W3KA 4GUJA 4BKNA 4CCEA 2AWGA 4HSHA 3WBAA 3LUTA 1ESWA 1UKPA 4JTJA 2DG9A 5KEZA 4IQJA 2BY3A 4UQEA 4Y9OA 1IWAA 3IK8A 4H04A 4JICA 1D3CA 1S38A 3FDGA 1H49A 2P8BA 1EQCA 3MUZ1 4GQRA 4KEUA 4M82A 3JS3A 3OIXA 2Z6IA 3W83A 2INEA 3JU2A 1E9LA 3LPGA 3OLGA 4DROA 1EJXC 3WL0A 1EF3A 2ISDA 1GNXA 2POTA 1ISZA 4WJXA 1QCWA 3F4WA 1O5RA 4MNJA 1NQKA 2BLEA 2Y61A 3SJ3A 1IR2A 1K9EA 4DEFA 3VDBA 5CC5A 3TSDA 1M5WA 3QMRA 3DFHA 1J4EA 1O68A 4F2TA 3VIPA 1X6LA 4A6GA 3CQHA 3OBAA 2ONEA 1KM1A 1LUCB 4MMWA 3VFLA 3ZVHA 1JUKA 2OSXA 2Y85A 4KRTA 5T9BG 4HIBA 5GQBA 3TUUA 4P8UA 3JW7A 5DY3A 4MNMA 4BR1A 1CGUA 3RJXA 1JNTA 4BWLA 3CB8A 3OVPA 4JX4A 4NRSA 1XIBA 5FF3A 1EHAA 3WLOA 2Q8XA 4X0VA 3VPLA 3N14A 2Z29A 3UA3A 3BLEA 1TMHA 2ZX6A 5E0CA 1PCWA 1S5TA 1Q6CA 3QV6A 2F9RA 4GZEA 1PZ1A 3NTYA 4ACZB 4FALA 4ZQOA 1VAHA 4IQEA 4NUWA 4QAIA 3DXIA 3NM3A 1P6CA 2PGEA 4ZSUA 2ACSA 4ZB5A 4ZB2A 3AIEA 5BCAA 2J8GA 2OKTA 3DG3A 2I9UA 3UT0A 2V30A 2DORA 1JCXA 1U30A 2VEKA 1CLKA 4QQUA 4AZHA 1RBOB 5DMYA 1XUZA 4TV6A 4FLOA 3P5ZA 3LBOA 1Q7QA 3W1RA 2EULA 3BLIA 3OP2A 3UYIA 5G4HC 1P7TA 2Y1HA 4IGSA 1EUNA 4MG4A 1NWRA 4H7VA 3FSUA 1UWTA 3PAOA 3QR0A 1NARA 2QYGA 2J24A 5I6SA 5AC4A 5LA0A 2V3GA 4MDOA 5I03A 2F6KA 3PPCA 2WK2A 1Q6LA 1XYBA 2P50A 3NNTA 4RPQA 5D2VA 2PDBA 1TWIA 4CU6A 2RUSA 1CEOA 1JR1A 2E6AA 4I3GA 4DPPA 2VTFA 4S2BA 1H5VA 3AISA 3VAWA 1IYXA 2FJKA 3P67A 7REQA 5C7HA 3H2AA 3KL5A 4GE8A 4FEZA 4D6DA 3B9NA 4C6QA 1QTWA 4C1NA 1I0BA 1AJ2A 1CGWA 2ZUWA 4NZ3A 1TV8A 1F4AA 4GZ7A 3S9IA 1SO6A 1GEHA 4XD5A 2NUYA 3WQFA 1N1AA 4W8AA 3DFYA 3G0UA 2VFFA 2XP5A 4C6JA 2VFIA 3RM9A 1K77A 3DENA 1Z89A 1F2JA 3ZR4A 3A4AA 2HEJA 3T8QA 3HN3A 3WMLA 2OPJA 4LUTA 7TIMA 1MYRA 3VDCA 2QUVA 3USBA 3WNPA 3EKGA 4MWAE 4A3YA 3O5KA 3PTQA 4CD7A 1MW0A 1X8CA 1OFDA 1MUWA 4UFLA 5AY7A 3R7MA 4TW7A 3DUGA 3VM5A 3KBJA 1A49A 5AC6A 1LLWA 2WVUA 4Y2WA 1NWSA 5HQEA 2QULA 3FAPA 2YA0A 1RK6A 3OHIA 2QXWA 1G4EA 4V15A 3MDUA 5HNUA 3NA8A 2RAGA 3JYMA 4PCSA 3I6CA 3NXLA 1QRQA 1KV5A 1UMYA 1I2OA 3PZ9A 3W2JA 1REQB 1AJZA 2UZ5A 3AZRA 1XLAA 3VNKA 4PMZA 2VM8A 1U5JA 5I3HA 1C92A 2F6UA 2A6LA 4AHOA 4R9OA 3RLUA 3FVDA 1ZSXA 1E6SM 4IFKB 2D0FA 1UR4A 4XBJA 3RU6A 4PFMA 1K1DA 2G5WA 3EPOA 1UPPA 1D9EA 4UWMA 4MNLA 5LHEA 1E6NA 2XG9A 1FBAA 5AYIA 3UETA 4DELA 3ZSSA 5A6KA 3EDDA 1NEYA 2A2IA 3PJXA 1CNVA 1K4GA 5BYWA 2JKAA 3NYZA 4DI8A 1XIMA 2QCMA 2QEZA 2DT1A 5LKYA 4F2BA 5PTDA 3DBPA 1DWAM 2WXDM 1E5NA 1M9HA 2Z1BA 1K6AA 4GJJA 1W32A 3W53A 4ADSA 3UWYA 1WAUA 1W5PA 1WOAA 3DFTA 4B5SA 3M6YA 1TR9A 4S3FA 3PAJA 1IE7C 3CLMA 1PX8A 2V6AA 3W29A 1H7XA 1UR3M 4GUFA 1Y65A 4RNJA 5I2UA 3UJ2A 1VENA 2PMQA 1HKIA 3G18A 1XKYA 4IF2A 1W5QA 5I3KA 1J79A 2GK1B 4BJHA 4W9OA 1DIEA 4QCEA 3QM3A 4XBSA 3WUGA 4PMNA 2XFYA 3SY1A 1B31A 4O13A 4BCEA 5TBOA 4PL1A 4L5ZA 1VBRA 3S5OA 3KOYA 4RL3A 1JDEA 4C6PA 3VNIA 1CB2A 4HPJA 3GAKA 3HA1A 2DG3A 1UOZA 3OOBA 4A29A 3ARVA 3N13A 4EXAA 3PZIA 2BY0A 1I75A 1W1VA 3DFNA 4HHMA 4OE7A 3PPFA 4QT3A 4G9PA 3W3OA 8A3HA 1DHKA 3BK0A 3QH2A 4WHBA 4YXGA 1PKLA 3UR5A 4FMVA 1LL7A 2PAJA 5EKYA 2RURA 1FWGC 3PZUA 4LGXA 4QS5A 4OFCA 3ZS4A 1E4LA 3STFA 3ES7A 2VGBA 4DZAA 2I9EA 4FIRA 4HPXA 5U4NA 3GD6A 1Z48A 1VPXA 4QNWA 3M46A 1KWKA 1OYCA 1HP5A 2MLXA 3K4WA 2OWWA 2J75A 4BQ4A 5BZAA 5C2XA 5AC7A 4ZQNA 1KQZA 2FYMA 4EXBA 4LFYA 1DXEA 3O9NA 2I7GA 3M6DA 5CPNA 1B3ZA 1H09A 1DTUA 6CGTA 3S46A 4GI8A 1VCVA 1RVGA 4HU4A 4ICNA 4QG6A 4IP5A 4OV4A 1ZU8A 4R27A 1JIBA 1CGXA 4B91A 3WQCA 1LG2A 1OGBA 3FNDA 3HPAA 2BY1A 1I8JA 3MMTA 4C02B 4MYAA 2R1PA 1S2VA 1L9WA 5AB3A 3GHRA 3GVVA 1TJ2A 3UVAA 3EMQA 2YDSA 1VGAA 4N2YA 2MANA 4C6BA 2NUXA 1FKSA 2GJXA 3CWHA 4FNUA 2BX7A 3Q37A 3LZ5A 3P93A 4ODPA 4KESA 5JMUA 3NOEA 4D8LA 3NQVA 4LCSA 2DSUA 2NWSA 3T7VA 1OCQA 2PDJA 5G2IA 3W7GA 1UWUA 3B06A 1FH7A 4UB9A 4UTFA 3GG8A 5AZ0A 3VXGA 1C9DA 1O4UA 1FKWA 5CC6A 1KRAC 1ML1A 4XAFA 5L6UA 1M6JA 2B7QA 4YCOA 1TELA 2O7SA 1FXQA 1AODA 2MPHA 3T44A 3L0KA 2OXNA 1IWPA 3LQGA 4IG2B 1T7LA 3WUEA 4S3AA 1KBLA 1V3HA 2YXOA 4C1LA 2Z7KA 2XVGA 3P0WA 3A23A 2AGKA 4AZCB 1SZRA 2W3ZA 1HF6A 1OADA 4MB5A 2LLEA 1T8QA 4UQAA 5DCBA 4AHPA 1TV4A 2MNTA 3CQIA 2ZR5A 4BI5A 1OB0A 3W82A 1EWEA 3G1YA 3IS4A 1KC7A 3KAGA 3HPSA 4PCPA 3NQCA 1BYAA 5A2AA 1TKKA 5F4WA 2P10A 5CGMA 1BWVA 2PDPA 4BZYA 4IHCA 5KZ6A 4PMOA 4F0HA 1XG3A 1J5TA 1L0PA 3TONA 1JZ8A 2QCFA 1RP8A 2ZVRA 3AJ7A 3WUFA 3RFWA 1BXCA 5FSEC 2GGGA 2FDSA 3CUIA 4H8HA 3IIXA 4M56A 1TA3A 1IZKA 3KS6A 3CT7A 1U33A 3SCOA 4U31A 3FKRA 3LBCA 2V67A 4XZNX 3K1GA 4B5TA 2GQ8A 1R3RA 3C56A 4QJ1A 1WXYA 5D2XA 3BLFA 4HYRA 1IGSA 2DUZA 2O92A 3ZWSA 2ZDRA 4PMJA 3QBUA 4XZWA 4KQNA 3CAQA 1YE6A 2WQDA 1HL8A 1IT7A 5AYZA 1J01A 1FWSA 3GUGA 1XR2A 3EB3A 2O9OA 1FWDC 4LV4A 1NFGA 1BQCA 4INFA 3LY0A 1K8XA 4IQCA 3LDVA 1IXOA 2VDGA 1AQMA 4FSAA 4G56A 4AHQA 2ZRXA 1R3YA 3W2MA 1AQHA 1O5QA 4G2DA 1D7FA 3EX6A 2BOEX 3GU0A 3WQOA 1QNSA 3R0KA 1QHPA 4O1AA 3VIMA 1JZ5A 1MMFA 2XSXA 4LVBA 4MWAC 1US3A 2Y8VA 1I9CB 4G5DA 4J27A 1R47A 1TZ9A 1OX5A 3PZQA 4W93A 4E2BA 4JTIA 3RLGA 2KZHA 3G77A 3W2NA 2YFNA 4JAWA 3EIPA 2WHMA 3MV11 2VO5A 1UBPC 2WSYA 1TCDA 1TWWA 1OEPA 2FIQA 4YLWA 3I7QA 4N7QA 3U5UA 3NGFA 1VKFA 4HD5A 1NSGA 3EDKA 5AC8A 3MP4A 3HFTA 2CZEA 1PS9A 2NX1A 4FIQA 1HKJA 2IKGA 3LN3A 3QQWA 1WNOA 2ZQ0A 4C6IA 4V1YA 3GC4A 3SRDA 5BXTA 4KBXA 4OZOA 5BXSA 1NFBA 3R4IA 5J5DA 5HQMA 1EHNA 4HOXA 4FF7A 1WDSA 1YKWA 1S5VA 1TJPA 4N42A 2JGYA 3IANA 4XO7A 3W6YA 1QT1A 1V8EA 3WLMA 1JVWA 1Q5MA 4FNRA 1JDFA 1UZHA 2FZNA 2FTYA 1Q2RA 3BAYA 3MO7A 3RMEA 1RH9A 3O07A 3UI5A 3RO8A 2ASHA 3CQ0A 4XUGA 4XAYA 2DW7A 1V02E 3KBSA 1XX1A 3W1MA 4EKJA 1TV5A 4TX6A 4J28A 4NHVA 2A1YA 2DSVA 2E6DA 1Z9AA 1PZ0A 2EPKX 4G7EA 3SN4A 4U5KA 3TC7A 3KHDA 3WNKA 1KFLA 4B5WA 1KXTA 4DYJA 1XPGA 4CNNA 1VEOA 3VKJA 2MUCA 1U1UA 5CPOA 3USZA 5LNUA 4GQ0A 1SJCA 1J4HA 6ALDA 2YGYA 2TYSA 3OZPA 1F76A 3LTSA 1GOMA 5CPQA 2PF0A 1P7TB 1WDPA 4PCFA 4TQTA 3LZ3A 2J66A 3UZWA 4DO7A 3EB4A 3UU0A 1NVMA 3SIZA 3E2QA 2CEQA 4UR7A 2FH8A 1OVDA 1J10A 4CCDA 1SSDA 4EWND 4FPSA 1IGWA 1EYEA 3H4WA 2D3NA 6ENLA 4A8RA 1L1PA 3ITYA 4TOQA 3MANA 4LS0A 3UBPC 2AQVA 4MDPA 4GA8A 4D6IA 3IJDA 5TIMA 1CXKA 3MI3A 1ISXA 3VKDA 1QPOA 7REQB 4LPCA 4EXQA 1PDZA 1T40A 4W4QA 1JNDA 1BQGA 1E9ZB 5BROA 4HU0A 3RUBL 1JDDA 5LA2A 1EYMA 2VR5A 4FNTA 1YQ2A 3WH6A 4HK7A 3EX2A 3O5IA 3I6EA 4AZIA 2WVSA 1FKDA 2MLZA 4A2RA 2BVYA 3P7YA 5EU9A 1HP4A 2A4AA 4QNEA 5EGRA 3LV6A 2XH4A 1Q4WA 3ODKA 3A6OA 5G2WA 4QFUA 3KDNA 6A3HA 4NZ1A 1EDTA 2ODOA 4E38A 4FLQA 1B9ZA 3L67A 1KCXA 3PUDA 1ZCCA 1BG9A 4L1GA 4REQB 2H90A 4D6EA 3R6IA 4AYGA 3GIQA 3F4VA 4NX0A 4Y9PA 4O16A 1U1JA 1VFUA 2WWDA 4HZ8A 2JGQA 3Q58A 3NOYA 3OBKA 5M17A 4CD4A 3TN3A 1PE1A 5CSRA 3F2DA 1W17A 5AHIA 3GVRA 1JCLA 1W5NA 4JTEA 1TE6A 3R25A 3BSMA 1S5WA 3P2VA 2JIEA 2M2AA 2YIHA 2OGJA 3EOSA 3HGSA 3BW4A 1QW9A 4ZXOA 1J96A 1V3KA 4ZXLA 1ZQ5A 3TW7A 4DQWA 2DSZA 5DFAA 4MVAA 4DRNA 1F8MA 1X7FA 3LHWA 1EDGA 1XW8A 4HSNA 2HV5A 5CEWA 2CLEA 4US6A 9XIAA 3OGSA 1TTPA 6PTDA 1FHVA 1ITCA 1TRIA 8XIAA 4DJEC 3PG9A 1QNOA 4I5UA 1GZJA 1SMAA 2WJDA 2XH2A 2OU4A 3ENLA 3RLHA 4EX4A 3UZXA 1W9DM 3TDFA 1V7YA 3QMTA 3GU9A 3TVAA 2ZXDA 2ZXQA 1FKIA 3ABSA 3HV8A 4KH2A 3CUJA 4UTKA 2WB5A 3FS2A 3T81A 3WIJA 3OA3A 1XCWA 3TV8A 1R87A 5T91A 2B7PA 3IJLA 4LF1A 5HANA 2FGBA 1UC4A 3GNPA 1OT2A 3JR2A 3D3AA 5FEXA 3U2ZA 1VJSA 1R86A 1V6WA 1TPDA 4NKCA 3VDGA 1XM3A 2FKEA 2FB2A 4DRMA 3CWOX 1BF2A 1TSIA 4I9TA 4JFKA 2GFTA 1JZ4A 4ZOCA 4QHRA 4PRTA 1FKRA 5C71A 3NWRA 1SW7A 3AXIA 3LU2A 4AD1A 3AZTA 4TMCA 3QOMA 1JCMP 2WJFA 4ZB0A 2NQ9A 3GTXA 2I5GA 5HJLA 3TC3A 4J3UA 1JPDX 3M9YA 1A5MC 1P43A 3QTGA 1XLEA 3K30A 1OY0A 2PTXA 2R6OA 4EK7A 5C9ZA 4GVHA 4NAEB 3M0HA 1UP0A 3TTQA 3EX3A 5A6BD 2ZRYA 3QLDA 1WQ5A 3IUHA 4O18A 3R0UA 3MDYB 3VGHA 4QIUA 1VCGA 1FWNA 1I1WA 1FCVA 1H1ZA 3CL6A 3B8WA 2E9LA 3FJLA 3PJUA 1X1OA 3CPUA 2V0TA 3GO2A 5CPMA 4D6CA 3GH5A 2INZA 3TYUA 3H2EA 4IM4A 3R58A 4ATDA 3D3FA 4DWSC 2DZWA 2AL2A 5HWCA 1V6YA 4XB3A 4OWGA 3EDEA 4ZOBA 3IGSA 4R7WA 5LA1A 1VP5A 1W6TA 4US5A 1PYMA 1P0NA 4LB4A 4UOJA 1XGZA 2DQWA 3EMCA 5M03A 3ZWTA 1K7XA 3VYLA 2GQAA 9CGTA 5K4ZA 2WZEA 5CZSA 2I5IA 4RE0A 1R3TA 4ODKA 3BGAA 3T42A 3VKBA 3TROA 3ANUA 2GWGA 2WWCA 2R14A 3HGRA 2F21A 2QJNA 2OR2A 1MRAA 3QHMA 3TXZA 4PMDA 4YWIA 3SM0A 4C1KA 1JZ7A 3WL1A 4DJDC 3M5ZA 4MZYA 4MY9A 4MZ8A 4K1WA 1TIWA 3TTOA 3S1UA 3AHXA 3DHUA 1J11A 3QEZA 2ZTJA 2ICSA 4I6VA 1EUAA 5HUAA 4WOZA 2O4QA 1D8WA 3WH5A 4JTLA 3HZ3A 1B2YA 3KX6A 2HPMA 1UZDA 4W5UA 2V5JA 5GNZA 4O1BA 5I07A 5K9XA 3S0CA 2E8YA 1GKRA 4LV9A 4DRHA 3S9ZA 1A5KC 5CPTA 1HQTA 2J6VA 3SCNA 2VZOA 3AS2A 4MAVA 1EJWC 5B80A 5A6JA 1FDZA 4ASTA 3THDA 1XSIA 3KXQA 1KM2A 3R89A 3KRSA 4KS0A 1B3YA 3G5EA 3CL7A 1Y5VA 3GBDA 4HYWA 2BGQA 3C4UA 2VCAA 4OHQA 1OBAA 1N82A 5CBIA 3PRDA 1LBMA 4UTTC 3W70A 4PBEA 3M5XA 4DRKA 2WNNA 3B3DA 4B5NA 3CO8A 2ZZ6A 2YBTA 2XGZA 3BPWA 2YB4A 2QKFA 1FH9A 4L65A 2PI6A 4U3AA 3AYTA 2PWEA 3WJWA 1MO0A 1I60A 4IMFA 4LUYA 4Q4PA 3L2IA 4LWWA 4PFHA 1VZWA 4XD4A 5CJ5A 2A7RA 4YVPA 2HNHA 1UC5A 1V6VA 5DY2A 1UUOA 1Y5XA 1K02A 2XWDA 1YXDA 6REQB 1LLOA 2HXTA 2O0TA 4UTWC 1TA3B 3ZYZA 1RBLA 2W66A 5D2WA 1KBJA 4N6FA 5F4SA 4WK9A 3IAQA 4NNCA 3VUPA 4TXEA 4IPIA 1TTIA 1Q8AA 3WQDA 1T41A 1UP2A 4Q33A 2D22A 2DSKA 4GHRA 1P0DA 3K13A 1KM3A 1XPYA 4BF7A 2JF7A 3T4CA 2J77A 3E2SA 1L2UA 2PDWA 3U48A 2Q01A 3WMCA 1GWJA 4X3ZA 1S1RA 5CG7A 2VC7A 1UMLA 4ZENA 1DXIA 5A1AA 4I7UA 4CNOA 3TIMA 3WQVA 1DIKA 1UOKA 3LRLA 1V7AA 1N8IA 1TZZA 4MY1A 4XWUA 2E77A 3RGTA 1GUVA 4PBFA 2I17A 3NZQA 3V5OA 3S3GA 2EPNA 3AFBA 1DKWA 3FXYA 1US0A 4NI8A 3P8IA 4MUPA 1E5JA 3B4UA 3E0LA 4D9PA 3FJ4A 4K1GA 2RUCA 4HMNA 3TW6A 1LQAA 2X41A 1K8CA 4PL2A 2YL6A 3S5YA 3TYDA 3W26A 1TV7A 1F3EA 1O95A 4PZVA 2QDEA 2BVTA 1PTDA 4ODQA 3WQWA 4GUIA 4UTJA 2ZXAA 3NYDA 4ZODA 3MI2A 3W74A 1L6FA 2WYSA 3G0XA 2Y8KA 2CXEA 3GSMA 2DIJA 1FWFC 3VNDA 1BRLA 4HZMA 3E5BA 2OT1A 4N0RA 1NM9A 1LL4A 2XP6A 3GZAA 3ANVA 4ML9A 4U86A 2PD9A 1GORA 4XZ9A 4ZQRA 1R7AA 1BKSA 4XISA 3IPWA 3TW9A 4M1BA 4XG1A 1DIOA 1YMYA 4QITA 4GY1A 3QKEA 4DO4A 1X8FA 1XDMA 2XVKA 3FK4A 5JXQA 4MOZA 3W7NA 4DM2A 1U83A 1Q6FA 3RILA 2DZUA 3LQLA 4C7FA 3EWZA 4ACYA 3WBYA 1Q63A 2ISSA 1PCKA 3VILA 5CSYA 2E68A 5K9CA 4JHMA 3U7VA 1NP2A 5TF0A 3WDIA 2FGLA 2V9DA 2WKJA 2XP3A 3GR4A 4ZPTR 1FWEC 3NQDA 4MHBA 1X6NA 3KADA 2VUYA 3BZJA 2V63A 3M4HA 4LVAA 4GYPC 2VMFA 3MSDA 2E09A 1IZJA 2WMIB 3B8VA 4AVOA 3EKLA 1HFBA 1JQVA 3FJNA 1OD0A 4L6DA 1V3MA 1PKYA 5I79A 1RVKA 2ETNA 1WBJA 4GH3A 3QFEA 4IZGA 4DRPA 3EXTA 5BWFA 1TRDA 4RDZA 4B15A 1H0GA 3UY7A 1OWQA 1GJWA 2HQAA 4RJEA 5K3VA 3T40A 4AUBA 4Q8NA 4N19A 3TFXA 1UIPA 3EOEA 1H7PA 3WQPA 4GIVA 3DC0A 3E0FA 4UCGA 1FKLA 5DXXA 1JDCA 2D2JA 3L4XA 1XH0A 4HGXA 2ZZ4A 2PBOA 3W7HA 5HMFA 4GQBA 4BA0A 2JBMA 3N4AA 1E56A 4QE5A 2EEXA 1M65A 2F2KA 5ECUA 3PPGA 3CHVA 1J2WA 3TNBA 1XYLA 4FX6M 1OFPA 2E9MA 4LTSA 1XL9A 5D04C 4BF9A 4PUMA 4NIRA 3REQB 3WLTA 1XIIA 1A47A 4DPQA 1XRFA 4XSLA 4K7YA 2GUBA 2Y7FA 3HTWA 3MO4A 3IIVA 3WBEA 2AKMA 5G1MA 3N3TA 4GX8A 4AFYA 4A8IA 3QGKC 3BE7A 3VE9A 3GHUA 1W3NA 2HDJA 3OU8A 2OZ0A 4O1FA 4K6AA 4W87A 3HFYA 1X97A 2NVAA 5C0QA 1UR1A 2PFHA 4ILSA 2JQXA 1PBKA 1VBUA 3G3MA 1TWDA 1BKFA 3LHYA 5ABHA 2G4FA 3GXTA 3LMYA 5MKGA 1QK0A 4PMXA 4IMCA 1UD4A 3TFCA 2PODA 4IT1A 4GIRA 3FJ6A 2UY2A 5ABFA 3H7VA 4ZFCA 3W0KA 2CWNA 4CN1A 1R85A 3I7RA 1XC4A 1XYMA 4LY4A 3GK0A 4U5IA 3PNUA 5F2MA 2OOGA 3RIKA 3DFPA 4M6QA 4G6CA 4F4RA 5BW6A 4YTQA 1PV8A 4S38A 5BOEA 4BWLC 4Q22A 4X63A 3WH7A 2C1IA 4GVFA 3N6QA 1W1A1 1SW0A 4W84A 5CG0A 1T11A 1DV7A 2XUCA 1BWLA 5E6YA 3O5GA 2WMJA 1C91A 3NQMA 4S3EA 1M04A 1RCOB 4L6OA 4QS6A 4YTUA 1IQ8A 3GDBA 1H0IA 4IH3A 3UWEA 1HG3A 5E70A 1XBZA 3VDAA 2RDXA 3A3HA 3FHAA 4O2TA 3VZXA 1DWHM 2XIBA 2OT0A 2V81A 4IGHA 1F3TA 1R30A 4PSRA 2EPOA 4Q7NA 2PF8A 4IL2A 4EAYA 4MNKA 1KFBA 1IWBA 1OHLA 3DOPA 1ZBWA 1W3JA 1OFRA 4WY0B 2E0PA 3WQ5A 3GDKA 3AJXA 4NAFA 5LIYX 3WO8A 1VYPX 3SCVA 1TPEA 3PZVA 3KACA 1J0KA 2BSLA 2I14A 3PWGA 2IKIA 4Q8PA 3NSMA 4LVDA 1HIZA 3QC3A 3MQTA 2ZUVA 2VEPA 4DYKA 4JY9A 3HMCA 3TC6A 4HNOA 3GFXA 1FQ0A 3LPOA 4DJED 1ZENA 3PR2A 1JEZA 2WMKA 3MMWA 4QDMA 1JCNA 3XINA 2DVTA 1C8VA 4WSHA 2NWRA 4IP4A 1GZGA 4WDUA 1Z32X 2V82A 1MW2A 1W3LA 4JOMA 3TJXA 4LRSA 3TJIA 3OG3A 1GG0A 3SFKA 1A5SA 3WUBA 2PDLA 3O0FA 2VZVA 4HN4A 5C70A 4V33A 3U57A 1B5TA 3TAOA 3E3HA 3FGCB 3IAPA 1OG6A 1MI3A 1S5MA 2ZKMX 5EYWA 3WD3A 3AYVA 4RDYA 5I3JA 3C2YA 3SGUA 2GVJA 2Y7GA 4GPNA 1EIBA 2V69A 1A7XA 1CXFA 4PUWA 1EGVA 4H01A 3RCNA 1EYWA 1W9UA 4CNSA 3THUA 4CNUA 2YCLA 3GG0A 2JIWA 4OECA 1KKRA 1OABA 4GNKB 3OW1A 1ROUA 5FAGA 4YVVA 4H8VA 1DJHA 1S2CA 1R3SA 1JXKA 1JCJA 2PDQA 4FZIA 4LCRA 3P80A 3U0HA 2I1OA 4GX9A 5DLCA 1HJQA 1O12A 4AD5A 4E8CA 2HTMA 3VOHA 3GTYX 1QOQA 4GKTA 5FJPA 2ZWYA 1XBXA 2RJGA 5CKSA 2P0IA 2PTWA 3BGJA 3A4WA 1KRCC 1RY0A 2HSAA 4UTLA 4AZ6A 2CLMA 4Q6JA 4QQ3A 5D30A 4CKQA 4UTMA 5B7ZA 3T0DA 1H62A 3AXXA 4F40A 1SJAA 3T8LA 1DPMA 1IEXA 3T0BA 3CV1A 4DBEA 5REQA 1IXQA 1MQQA 4UMBA 3MP5A 4XVEA 4I5XA 4LAUA 4S2CA 5BXRA 1QHOA 1IIHA 3FY1A 1QBAA 3AHVA 3N6HA 1VIWA 1TPB1 1D3GA 4B5VA 3VTRA 3BOLA 3UWVA 1K03A 4DWSD 5FF2A 2X7VA 2YR1A 2CHNA 3FFSA 1EEPA 3CASA 4HNUA 1JXJA 1NY1A 4RV8A 3W7LA 3N2CA 1OSEA 2BFGA 2HCVA 2ZVIA 3ARPA 3II1A 2J47A 5G5IA 2DP3A 1WZKA 2Z1VA 4H19A 4O52A 1XLGA 2W63A 2H9AA 1TG7A 3KCLA 2DU2A 2J7HA 3H12A 3VKAA 4QRNA 4GFIA 3AXHA 4JN8A 5H8PA 2G95A 1LWIA 1VFSA 1M3UA 1TPC1 5F2GA 3S83A 2Y62A 1MZHA 3R1ZA 3SI9A 3IGUA 4KWVA 4DVOA 1BXBA 3EEZA 1T8XA 1FWJC 2DEPA 3KFTA 5BRBA 2XP4A 2J7FA 1G9HA 4DJDD 5E09A 3HQPA 5CPLA 1ENUA 1IZCA 3SQSA 1J93A 4AC1X 5EMKA 3OHMB 3ZFHA 2WHJA 1HZYA 3KAFA 4W89A 3R11A 1E1CA 2BZNA 1IEQA 4D6GA 3S5SA 4QJ4B 2Y2WA 3LLXA 4E2VA 3LGGA 1R9XA 3R0DA 3MW7A 1UJPA 4Q6XA 1IIGA 4GACA 1S2TA 3FSTA 2C13A 2GDVA 1OF8A 4OGZA 5J8LA 3TSMA 1IR1A 5HPOA 2VD8A 2XIQA 1UBSA 1WKDA 4QE4A 4XVDA 3DGBA 2ISFA 2FDMA 2SFPA 3HQ1A 4PYSA 4WCJA 4J9JA 3VC5A 2BHZA 1JUBA 1F8AB 1NP0A 4DWDA 1A50A 2A7NA 4K7VA 3T07A 4ZTXA 4FXFA 4AWEA 2O7QA 1LDCA 4IQLA 4Z2GA 3W27A 2BVDA 1UH4A 3E1F1 4Y7EA 1YDYA 3KVKA 5JBFA 1W1YA 1LOQA 4AY7A 2VRKA 4NG3A 3DX5A 4Z2HA 3M0KA 2QDGA 1PX4A 4GK8A 4D72A 2D24A 4WGXA 5IFPA 2E67A 1TJRA 3O6AA 1XINA 3MTWA 4LNCA 1SM9A 2ZE3A 3EA3A 3L12A 3L5AA 3PBYA 4J4NA 3L23A 4F8XA 1GHSA 1AD1A 8XIMA 1HKVA 3ITLA 2WM1A 3KP1A 2GOUA 5CAHA 4NU7A 2VD9A 2GDUA 4RZ5A 1QNQA 4NZJA 1JAEA 4JFLA 3VD4A 1FX6A 3DECA 1QO2A 4KCUA 3HQOA 1Q6HA 4TW8A 3TX9A 1UH3A 5CZ0A 1CB7B 2G8ZA 4GYFA 1XQLA 5C54A 3APYA 3GVGA 3QF0A 2ZQVA 1EP3A 5XINA 3QFWA 4N9EA 3Q45A 3GDTA 2DUXA 2RDTA 3BMWA 4FNQA 1EOKA 4I7VA 3L2LA 5CSSA 5RUBA 3NM1A 2A21A 4Q4QA 1DXFA 2QF7A 2PV1A 4XV0A 1GYLA 2ZQTA 3C2FA 3ZR5A 4XD3A 2VFEA 4JFWA 1KV8A 1E4IA 2OYKA 4GIEA 1SFSA 4J1OA 5CH9A 3OZMA 2D2OA 3T0CA 1QATA 5BOOA 3C0LA 4KEMA 2YBUA 3QW4B 3PTDA 4GKLA 2FZMA 3SY8A 7ODCA 3CZGA 3IRSA 3F2CA 1A80A 2D2HA 1LUCA 3C0JA 5HMDA 4QT2A 1I2RA 4DBDA 3EWUA 3AMCA 5BU9A 1FY6A 2KR7A 2ITKA 1JZ3A 1Z7AA 3EOUA 2YA1A 3CIXA 2Y7EA 3FEMA 3OLDA 1YPIA 1HKWA 3FAWA 2DIKA 1TR1A 4QLJA 3AWOA 2C71A 3QQ0A 1BGAA 2G50A 2UZ9A 3N2OA 2VRJA 1B3VA 3LNPA 1FTXA 5D2YA 2IPWA 2Z24A 1ITXA 3JYJA 5HOSA 2DT2A 4WLCA 3AS3A 2V3FA 3M7WA 2XISA 3F03K 4TTUA 1VHCA 3VNYA 4F3HA 5FJUA 4Z1AA 4ACZA 4ZMGA 2WSKA 1E6ZA 1W9BM 3LCXA 3QGVA 4LALA 4HNCA 2ANUA 3ZJKA 1SO3A 2VL4A 4Z1CA 1A0DA 4GY7A 3FDKA 3UERA 3IIOA 3NL5A 3ABZA 3H22A 1JYXA 1T96A 3K4DA 5AKQA 3B0YA 3R94A 4AWSA 3B9AA 2ZR6A 1KCLA 1WDDA 1RR2A 3BO9A 4KEZA 4M24A 3WQ6A 3DFQA 1O60A 2QLYA 4H2HA 5M1TA 4DJFC 2NT0A 4RXGA 2FKPA 4QM1A 4I6KA 3UNDA 1F4HA 1TPWA 2CERA 5D05A 2YW4A 1SPQA 4YMZA 3ARUA 3K1DA 2R24A 1KBBA 4MGVA 1XUUA 3QR3A 1WDQA 2VDHA 1A5LC 3UWZA 2PEVA 1ME7A 1WZLA 3GW3A 1KBKA 3C6CA 2VEGA 3N2BA 5EB8A 2XN0A 1RALA 4X22A 3V7PA 4C6OA 1QPFA 4F79A 1VFFA 2C3ZA 2ZUUA 5B7YA 1W2PA 1F3WA 1B1YA 4CD6A 4BEQA 4RDWA 1YNPA 1GVEA 1W3TA 4UNIA 2FVKA 2E5BA 5I06A 1RHCA 4QGCA 3HV9A 4MSSA 3MWAA 4PRWA 3EOLA 3NL3A 3O5EA 1A5CA 3T2PA 4FNSA 1PUDA 3BTNA 2PPGA 2OEJA 4B2DA 4FS9A 4O1EA 5GVJA 1HUVA 2GUYA 1HL2A 2UWFA 2CITA 3NO3A 2GGIA 3IVUA 4G7FA 2KI3A 3GBEA 5G4WA 3U4FA 3TCEA 3TQKA 1PHQA 3GG1A 1ITUA 2J8TA 4WQ6A 1VF8A 2X1RA 1D7HA 3H53A 3QHOA 1E73M 1LJYA 3O5MA 2ZRWA 1MSSA 3WLSA 5EPDA 3TYAA 2GJPA 4M80A 5E1QA 1H7RA 3BV4A 4R5EA 4Q8OA 1B4EA 1KXQA 3RK8A 4GGHA 4YU1A 3BARA 4AD2A 1N7KA 1VEPA 3E02A 1K9TA 3RR1A 2A85A 2WAGA 2Y0FA 1XGDA 2FPVA 1JD7A 1EPXA 3RM4A 1CTNA 4GCXA 3NR0A 4UCFA 1XWYA 2OZ8A 3B7XA 3O6DA 1GT8A 2RH9A 5I3IA 2PV2A 5AVNA 2FZBA 4R33A 2Z2BA 3I4KA 4YCPA 3S5ZA 2DVXA 1REQA 5HDRA 3O16A 3T05A 2V5DA 1UZ4A 1R3WA 2G3FA 1SJDA 2VZUA 4UUIA 2ZOXA 2QDHA 4IFKA 2XM2A 1XCXA 3EBVA 4FB7A 1EWDA 4UOQA 3TMQA 2ZX8A 2ZZ2A 1E1FA 4FHAA 3LI0A 3MUCA 2OEMA 3FA4A 5DELA 3PWIA 1YHTA 1V4YA 3L5LA 1RPXA 4YIWA 1O5XA 5LIUX 4NYUA 3H2NA 3N17A 4F9DA 3C2EA 4UFHA 7ENLA 5EMJA 3V36A 3QTPA 3T2OA 5I00A 1U5HA 3L4YA 3S2MA 1UR9A 1TJ0A 5A8PA 1PSCA 1CECA 3E2VA 1R2SA 2WQPA 3WLLA 2A3LA 5DBUA 5HW6A 5A5WA 5G1TA 3WNOA 2CZFA 4W8BA 4X9YA 3W23A 3L7RA 1BKHA 1O6IA 2PRHA 4H9ZA 3ARZA 2QJMA 3SJNA 4Q4RA 4NX5A 2VWSA 3LX9A 5DRIA 5ABEA 3B05A 2GK1A 1B57A 1E0TA 4U28A 1WAWA 2AQWA 1CGYA 1R9ZA 1BFNA 2OB3A 4DUWA 2NQHA 2QJJA 2Y88A 1BTCA 5I77A 3C0SA 5IFTA 4G1KA 2HBXA 2HE8A 4NNRA 4C6FA 3NJ3A 2ACRA 3JUGA 1FVPA 4ZO9A 3LXBA 1FWTA 1NDYA 1P6WA 3ITCA 1KD0A 2ACUA 2VCCA 4UQBA 3GDMA 3MCMA 1XLJA 4Q4SA 1NWUA 4HMEA 1F07A 1ZZMA 2ZQUA 4A4AA 2X8RA 4ODRA 5T26A 3BAIA 3A21A 3EDJA 3GTHA 3GHSA 1W8SA 4ZO8A 3WD1A 1WKEA 3GX9A 2PWGA 3H2CA 4U10A 1OINA 1JPMA 4HA0A 2A3AA 1E9YB 4C91A 4OT7A 3RMJA 2WNWA 6XIAA 3BH4A 5GPGA 2OZ3A 3PULA 4L9XA 4NVTA 4UDMA 3TOPA 1JI1A 1A5OC 2VOTA 4WR3A 3SDOA 3W87A 3QOKA 2PCEA 1KT0A 1X1ZA 1T99A 3DH7A 3JRKA 3AU6A 3B8SA 3FHQA 1PKMA 4JQ4A 1V0LA 1BAGA 1TQJA 3SRKA 1QI5A 3PG8A 4J5NA 4GGBA 4H00A 5JIPA 4URIA 3LSCA 4GWEA 3B9OA 5AN7A 5HUPA 3WF1A 3LBMA 3BXWA 3SCWA 3T55A 3NSNA 1E6XM 1PIFA 4WKFA 4P8WA 5D9NA 2WSRA 2OQHA 4EPEC 3KOXA 3WK3A 4HZ6A 1XHGA 3SCTA 1Q6EA 4P7OA 3VI2A 4JIEA 1WYIA 3APGA 1VFHA 1RAKA 4WJ8A 2HPIA 3BAXA 5T9CE 2FHBA 4NZCA 2I57A 3O63A 1ZBVA 4JKMA 3FYYA 5A8MA 4AWTA 2C16A 3TA6A 5B8IC 1LRQA 1YADA 2RJHA 1TVLA 3P61A 2ATMA 4XTDA 5I3FA 3OQ8A 2PZNA 3RG6A 3EB2A 2CYGA 1PJ9A 4JFMA 2VVNA 3SQLA 3O6YX 1RV8A 1HX0A 2EG8A 3UEQA 4Z1DA 5A69A 4CQ8A 4IIEA 1F8IA 2R1NA 1J4RA 1XLLA 4NXSA 2X0HA 2Z7GA 3NDOA 2PSNA 3NPXA 5ABTA 3UZ5A 2NLYA 4O17A 1ZLPA 3GAYA 4IG2A 2QZRA 2XIJA 4Z1YA 3LOTA 1FKGA 4NQ1A 5JU6A 4AD3A 1IHIA 3SEPA 5AVHA 3GU1A 2BGSA 3K46A 2GOKA 4AZCA 4DN1A 2C7FA 5F1UA 3IGHX 2WVTA 1SU5A 4NILA 2XFRA 4DRSA 4DZIA 1DORA 3Q94A 4EF9A 2PDXA 4J3SA 4LX4A 3H2OA 2DH3A 2RUQA 1WKFA 1OZQA 3U6WA 4GVIA 4IIFA 1P5QA 2HJPA 3ECQA 5CC3A 4DYEA 3RCYA 3NQ8A 2CCRA 3AIWA 4HMCA 4AY8A 4HNNA 4EPKA 4HA4A 2HVOA 4BEUA 4L3NA 1CPUA 1FWWA 4KRUA 4D71A 4AVNA 5FJOA 3VIGA 3NVTA 3GKAA 3G24A 5HPCA 2HS8A 4I9AA 4HMDA 5A6BA 4N9DA 3UJRA 1OM0A 1DQWA 4AIBA 4QJ5B 3H54A 3CBWA 3A12A 3TYCA 3H26A 3L0NA 2WLZA 2OLSA 2ZBTA 2WSPA 3C61A 3T2QA 2EJAA 3FCPA 1Q66A 3FIGA 3DKLA 1AL8A 1XV8A 2QT3A 4QR6A 3CHDA 1SFTA 2OO0A 3AALA 4O0ZA 4DNHA 2DG4A 3WMBA 1UD3A 1FCQA 1L8NA 1X1NA 1FHLA 1VFTA 1IEIA 1TE1A 3OG2A 1GONA 1LM1A 3W37A 1V0KA 4QSHA 1MZRA 4L56A 5SWUA 3EWXA 3C0QA 2JK2A 1OFBA 2MF9A 4ZE4A 3TOYA 3NTPA 3GFZA 1TREA 3ZMRA 3W2LA 3BMBA 3STGA 1XIFA 2PDFA 5C2GA 2ISWA 1UD6A 4LC8A 1QPKA 4IQ2A 2HROA 3O8AA 1AFSA 1ZPTA 1LCOA 4GD0A 3WQ4A 3UXDA 3AROA 5FI8A 5CJNA 2O9PA 5CBJA 4Y6GA 3ES8A 4KWUA 3HB9A 3BQ5A 3ITXA 2VQTA 3I4EA 4ERGA 1VC4A 1QDSA 2Q09A 3L2MA 3APTA 3PZMA 5BU6A 1C8QA 2YDRA 3W7PA 3VGEA 1MEIA 5AZ1A 3BJSA 4PC8A 3CL8A 2PWFA 2HXUA 1G4TA 3EZ4A 3AMDA 1XYFA 1ZHAA 4A8LA 4DF2A 3GXFA 1F3XA 4A3QA 1ZRQA 3CV7A 2VGIA 4ITZA 1KGUA 4AXKA 5KZDA 2ZA1A 1DQXA 4LUSB 2FGZA 4UMAA 1Q4NX 2WC4A 2KGJA 8CGTA 4RDVA 2QUNA 1UKTA 1Q6UA 4AMCA 2HWGA 4QE1A 1DTNA 3DG6A 2GVLA 2OWXA 1UUQA 3VO0A 5KITA 3UG4A 3GZ3A 5C8BB 2W92A 5CSUA 2ZUTA 5KMYA 3NQEA 1ZGDA 4JHOA 5I09A 4LVFA 3OIHA 3MS8A 4JS3A 3KLLA 5EFDA 3SCRA 2F6XA 1I2QA 4D6HA 3P5YA 2CKRA 4UIOA 1CIUA 3G1HA 4LEFA 4C6KA 3WF4A 2GSEA 3KOZA 5FJRA 4D6FA 1FHDA 2IF4A 4OJYA 3LSBA 3UR7A 5DXYA 1YBQA 3IK2A 1M7XA 1EIXA 1RZMA 2ZYFA 3SIMA 3GDLA 1DYSA 1GW1A 2HISA 2PBCA 5EMUA 1JNEA 2IPJA 1OCNA 5FIPA 3I3DA 5IHSA 3MUXA 3E12A 5D2TA 5J5RA 4MFEA 2XWEA 1W31A 1RUSA 2Q02A 2X40A 3M7SA 4GMEA 3UI4A 1FFQA 1S2WA 1AH4A 1XFCA 4HOZA 4GI4A 3S5NA 4GC3A 1VBGA 4Z17A 2ZICA 4Q32A 3E74A 4DJFD 3M64A 5XIMA 2ZUMA 3RJYA 4LSBA 4PSPA 1U79A 1VQTA 2BV9A 4HSOA 1Q6QA 4CGTA 3MVTA 1N8WA 4WEVX 3VM7A 5A94A 1SSGA 3WDRA 3FN9A 1R0MA 2BNJA 3LCHA 3N1AA 5GJPA 2HZGA 5EFFA 3G1RA 4JTRA 4U85A 1D7KA 5LIWX 2O56A 3WENA 1VIZA 5EL1A 3A47A 1GG1A 3NEHA 4GYKA 9XIMA 3O5RA 4KCVA 4N4PA 4H2CA 4XZLX 4OUIA 4XZMX 3KCOA 2PTZA 5D09A 1FRBA 3VGBA 2MLYA 4W88A 1MNSA 2E9BA 3GR7A 2ZUNA 4O15A 3UVIA 4ENLA 2YCEA 1O1ZA 3AI0A 1LRNA 3YPIA 2EPMX 1UB3A 3L4TA 2F7FA 3PJTA 2DGAA 4NJKA 2Z26A 1KLYA 4H4IA 3RX2A 1SFLA 4JFTA 1E55A 8RUCA 4NZ5A 1A5AA 1L6GA 2E3ZA 1ONWA 4FR6A 5DEZA 2PURA 1K7EA 4IOTA 4REQA 1DEDA 3DIPA 3VCNA 4IUOA 1TV2A 3CWNA 5A6TC 3NURA 4IPXA 4CUCA 2A0NA 1S5NA 2FAPA 4O1DA 3AIQA 2NUWA 4PMUA 4DIPA 1JFHA 3GC5A 2PP0A 3WJYA 1SR9A 1FFRA 4BHYA 4GZIA 1GJUA 4U2YA 2VEIA 4KWSA 2OOFA 5MF5A 4LAKA 2HRWA 2J6XA 2GUUA 4UNLA 2X42A 3C3UA 2HS6A 3NIYA 3NO5A 4RX0A 1Z69A 4MJ4A 1PZ3A 4F48A 2GQ9A 4HCHA 2JF6A 1XXXA 4J3XA 2CLPA 1PINA 3VKCA 3LM7A 1OFAA 1FA2A 2C8NA 3SY5A 4H1ZA 1TPFA 3Q67A 4UTHA 3W7RA 4F0RA 1ADOA 3OZYA 2BG5A 2O9TA 2PZ0A 1XKJA 2CU0A 3NAVA 4MY8A 4EOUA 1EQ3A 5HW8A 4L80A 2RGLA 3B4YA 3RCMA 4IXXA 2QMKA 1WB0A 1LTDA 2FHFA 3BMXA 4HJFA 4IX0A 1LT7A 1VRXA 4A22A 3OOQA 4LQ1A 4TMBA 3WX7A 3QYSA 4UQDA 4NT0A 4JD4A 2W61A 4S39A 3N19B 1QMLA 3FYPA 3SGGA 1FCBA 4AX7A 1XIEA 4J7RA 3WDQA 1ADDA 2VYOA 1HJUA 1H7OA 4PTXA 4A3RA 3EOOA 1GQKA 5EBUA 4CQDA 4JNYA 3QZ6A 1QWGA 3P74A 1WKYA 1GYNA 4O4VA 1DWGM 5DT5A 2X7WA 1PKNA 3SURA 5D32A 4WY0F 3KOWA 3VNJA 4U2ZA 4IPJA 2CWXA 2GGJA 1XQKA 3LUOA 1PZ2A 4JHZA 4QISA 2OG9A 2IUZA 3A4JA 4JR5A 4GRSA 4A2SA 4L64A 4KMQA 1G69A 1GEQA 1V79A 3IV8A 2DUAA 4IISA 3ZT7A 2QCEA 4ECLA 3EY6A 3BWWA 4UFJA 3NQBA 1YIXA 3RX3A 4O53A 4Q4MA 5JBEA 3MKCA 1XYZA 3WQ8A 4TUFA 4PB3A 4U3CA 3CUFA 4PB4A 1OX4B 1FKBA 2CLIA 1OC7A 1JCHB 5H6HA 3WEZA 4NAEA 1DVJA 4PMQA 3N29A 4OBTA 3VGDA 4BFAA 4TVCA 5HTGA 2QNEA 4XTIA 3DDMA 3AHTA 1XISA 1EGMA 3B40A 3LXCA 1UYQA 4U33A 4S3GA 1EFZA 3IJ7A 3HJZA 3NZRA 1EF2A 5HA7A 2WBGA 1O66A 2KFWA 4CD5A 4AZGA 1OIFA 5DANA 2BDQA 2OYLA 2J78A 4MJZA 4CD8A 3HU7A 4Q4KA 3TE9A 4Z2KA 1AUSL 2FZ8A 5BXPA 1RLDA 4I8DA 4O8AA 2Z1SA 1O94A 3URQA 2BXZA 4Q8QA 4V27A 1VYSX 1YDOA 1GVIA 2QW5A 3BG9A 1X96A 2V8ZA 4RK8A 3W1PA 1B0IA 3BLDA 4DI9A 3H6OA 3CMGA 3W7IA 4E4PA 2WKGA 3ARXA 1R9HA 3SN0A 3W72A 1DL3A 4KPLA 1SR0A 3ALGA 4EPBC 3R5EA 1QXLA 4IPPA 3GNDA 4O4WA 1V3LA 3DG7A 4QCFA 1GPWA 4LRTA 4IT4A 1FOBA 3QMSA 1Z6KA 1ZP3A 3VX1A 4O54A 1Z8AA 4IIDA 3AC0A 3B0XA 3VOFA 1ZAHA 3LLDA 2H3BA 1G01A 1QJWA 4LUIA 1C90A 4PMYA 2E4TA 4H9VA 3KBVA 1HJSA 3VIOA 1DJNA 3LERA 4E8GA 1LG1A 3C2OA 4PCNA 4GISA 2BVWA 5A6MA 3STPA 1CZ1A 4DJEA 5AYYA 5HATA 2GVYA 4O50A 2BODX 3CXOA 1YX1A 4IJCA 3T6CA 4FAPA 2EO7A 1H3GA 3ITVA 4PH6A 1Q6OA 3BANA 2VEFA 2ESCA 4JN7A 3BSHA 4M7SA 4PEEA 3WJXA 3IJ9A 4I8YA 4JIIX 4WUIA 5CCZA 1HW6A 4LYKA 3CV6A 4UQ9A 1EX5A 2KX9A 3ARQA 4BQ2A 5DT7A 4JYFA 2RKXA 3IUDA 4JTHA 4R0XA 1Z41A 1ONRA 3UJSA 4IXHA 3TK7A 5D03A 3V5FA 3M1ZA 1UCWA 3ZOAA 3GC2A 3HGJA 3LG3A 2PU0A 4QTGA 1JRCA 1QW8A 2EPHA 1MWOA 1R3VA 3UG5A 3EPNA 3KW3A 1FH8A 4ZS6A 1HGYA 1W5MA 4H7CA 1WXZA 2FHCA 3S2NA 3TU9A 4Q8VA 3FV9A 1D7IA 3U8GA 4GZJA 1F9CA 2BXYA 1QASA 2PLJA 2WHKA 3GY1A 4QX4A 3H2MA 4R88A 3PHAA 3M0MA 4MAZA 3WEOA 2B0MA 5FJJA 4HN8A 4Y9NA 3MY9A 4YS1A 3UD6A 2YKKA 5HMEA 3H23A 1V77A 6REQA 3EGJA 2ZZ5A 2J7EA 2XPKA 4OV9A 4MPQA 3KM8A 4HPHA 3LS9A 5EMYA 1AG1O 4PUUA 4NY2A 1JPKA 5D9OA 4DXVA 5LNRA 2J27A 1C7TA 1XCFA 5EA9A 1WE5A 4X9SA 3NCOA 1TZ7A 1ADSA 2R1MA 1HT6A 4LC6A 3IEBA 1Q65A 5FJTA 3PZNA 5DIUA 5LIXX 4AY1A 1QOXA 5IBXA 4AH7A 3WLHA 1JG9A 4HCLA 2D1ZA 1JI2A 2FB3A 4N6EA 5D37A 4F66A 3HF3A 1EJ7L 4DWSA 1POJA 5HNNA 3S1WA 4WX2A 5FEWA 3DERA 3AIUA 5D33A 4DT4A 3GVWA 4BF5A 3QY7A 1X6UA 1LQ2A 3WG6A 3MV01 1H60A 3TDBA 1M7OA 1YNQA 2O55A 3OGRA 1JDAA 3N4EA 1C3FA 2E5CA 1WUFA 2J9XA 2VZTA 3ZZ1A 3UZJA 4JKLA 3DKJA 3CJPA 1LOSA 2KE0A 2H8XA 2PRLA 2QQ6A 2AKZA 5F2LA 2OTDA 3FLUA 3C52A 2F61A 5G4EA 3HOJA 4ZVJA 1QPNA 3B8UA 5JUVA 2PGFA 3BL3A 4JGDA 1RCQA 3P6LA 4R9XA 1J6OA 3AMGA 2X2YA 4DJDA 4LCQA 1VFOA 2BP1A 5E0FA 1R5YA 4RUBA 1E70M 4YHGA 1KXHA 4ICCX 1QPRA 5AHFA 5I02A 2FVLA 2XIIA 3L4WA 4FA3A 3N12A 4P7QA 3QW3A 1GOOA 1KR1A 3GXIA 1FP8A 4PN2A 2Y4SA 5TAOA 5DIVA 4YYCA 1B9BA 4AX6A 3O05A 1WUEA 4GNJA 5JH1A 4P7LA 3VZZA 5DX7A 3D46A 2ZDSA 1G4PA 3TTSA 5LNWA 1Q8JA 1LBFA 3EWBX 2GGHA 2OSYA 1L6SA 1FWHC 4JX5A 4LBUA 2Z1WA 1YDNA 4L6HA 3SCPA 4DY1A 2I56A 1YBQB 4C5YA 1DJXA 1THFD 5AOUA 4GFSA 2X1IA 3U3HA 4R7JA 4EF8A 4UTTA 2PV3A 2OEKA 4WXZA 3A13A 1JF5A 3E96A 3ONBA 1DWFM 1DOSA 1DE6A 2WMIA 1KO0A 4OTKA 5BOFA 2QCCA 4NASA 1PDYA 3CUHA 2W67A 4B16A 1J6YA 4D2JA 1KTBA 2PUZA 1DE5A 1KTCA 5CAKA 3PZGA 3H21A 4A8NA 3HPZA 4NJGA 2QCGA 4XO6A 2XFWA 3LYEA 3JXVA 1AL7A 3WDHA 5A8QA 1CLVA 2RGMA 2X0YA 4B90A 4O19A 1KCKA 3WBWA 3LM3A 3AHZA 3U2EA 4RE4A 1PHWA 4AD0A 1XIJA 3GR8A 5A2CA 3QPYA 1CGVA 4N4QA 1Q6RA 4NZFA 3W01A 1GVSA 2CC0A 1YW1A 1RLCL 3ABQA 1JF6A 3MC5A 3UXKA 2NV9A 2P0OA 1I0DA 3ZT5A 5HKGA 5I23A 1S2AA 3NZGA 3PUEA 4EPDC 3UGRA 4JTKA 1KT1A 1NOWA 4TU1A 1GGOA 2YL5A 9RUBA 5FA5A 5U7SA 1SGJA 3REQA 3OBEA 5HWBA 5CZJA 2WCAA 4HYVA 2NW0A 4MIMA 3URNA 3O5DA 5LYRA 2OODA 1ZCNA 4B5UA 3B0UX 3UCQA 4O1CA 2L2SA 4B4HA 3ITGA 3SFWA 2DV0A 1JGIA 1SZGA 1FCUA 4JFVA 1P48A 5C2CA 4G2PA 4DZ5A 3RXZA 1GJPA 5EBAA 3TJ4A 1B54A 4PGLA 4XK2A 1KM0A 4Y9MA 4E8DA 5K4XA 3QJAA 2K8IA 4RE2A 4MWAB 4OOZA 3KL3A 2G3NA 2EHHA 4QSFA 2VX6A 3QSRA 2PPOA 1Q85A 1G0CA 2GWNA 1K9DA 3CH9A 4I7WA 2Y89A 3NUKA 3LHVA 2JALA 4D1IA 3ZJ7A 2B81A 4C7DA 4NSBA 4QROA 1OC6A 5IOBA 4EACA 3BCFA 4FI4A 3OLIA 1TQXA 4KEVA 3BURA 3OTRA 3KRUA 2EF9A 2C0HA 4ROQA 5HULA 4TIMA 2UV8G 3ZQ9A 3OJGA 3CAWA 3PSVA 1KWGA 2XSAA 2V68A 3H4XA 2G0WA 4PMVA 1I1XA 1W0MA 4XAPA 2Y78A 3N9RA 3RR4A 3CIWA 1IT0A 3OYXA 3OLEA 5DBTA 1WV2A 3QV9A 4F2UA 4HB7A 3TZFA 4GXWA 1VYRA 3B8TA 2X2GA 2KO7A 1BLIA 5H8MA 1JJKA 3OPSA 3VE7A 1ELSA 3N15A 1ISVA 4HTYA 4E3TA 1AW1A 1NH6A 1F73A 1SZNA 3K4AA 3W1XA 4WY0A 4PUEA 1NDVA 2QJIA 2Z28A 5C55A 4H83A 4Z2IA 2PB1A 1JUEA 2HK0A 3H55A 4W9TA 1E44A 2CFFA 1BPLB 2I5QA 3B8IA 1FD9A 2MNRA 5BMXA 1EO5A 5G2HA 5E9XA 5DN1A 4Y8EA 3UXIA 3N34A 2CBVA 4GYPA 3PBWA 4QP0A 4GLEA 1AK5A 1EGZA 2CHRA 3WLQA 1DJQA 2VJXA 1EC8A 1OT1A 1ZK6A 3AZSA 2C19A 5BRPA 3TNOA 3ZLHA 4JFJA 3L9CA 5LXXA 3PUOA 3BG3A 4TTGA 1J0IA 3S2LA 1LT8A 2IMRA 3ZJ8A 1TMQA 4W7VA 2REQB 4WGHA 1WP6A 4E5TA 1BL4A 4DZHA 2QGHA 3KBMA 3WLJA 4GGQA 1FXPA 1GVYA 1P6BA 2L5HA 2BOGX 3PUGA 3HG2A 4M6UA 1YE4A 3CTLA 2XP7A 1FWBC 4ICMA 1HNYA 1TUXA 3FGCA 2FJUB 2ABAA 1UROA 2W91A 1ZCOA 3ITOA 2J74A 4MKVA 1K7FA 4O57A 4R7OA 4FF5A 4EVZA 1C29A 1GZ1A 3M43A 3E5PA 2OFNA 1B30A 4RCXA 1D2KA 3WQGA 3AIVA 3MSGA 5HK4A 5AFDA 1ME8A 1LZOA 1V6TA 2PWHA 3H4GA 3UCCA 4JFIA 4XZIA 4OVXA 2VELA 5FOOA 2YL9A 1VJZA 2Y63A 1GOQA 2QUTA 4M8UA 4WVXA 2PDHA 3CT2A 4YVXA 1ZNNA 1WZAA 3CC1A 1V93A 1DBTA 1V51A 3H9RB 2ZE0A 2CPUA 4O28A 4ZQMA 1J12A 4LNYA 2VKZG 2CW6A 3FA3A 1RD6A 1AH0A 3IJQA 4LBRA 3VNLA 5ENLA 1W56A 1KFEA 1POKA 3QV8A 2RQSA 2Q5AA 4RLIA 4D6JA 2VFHA 4GJIA 1E4NA 3MDWA 4HU3A 5IRPA 4PUKA 3N4FA 5CGQA 1OQFA 3AUJA 1LYXA 3C8NA 3VKKA 1E6RA 4J2MA 5C5YA 1KCZA 3MUY1 1P1XA 2V2CA 3ARRA 3AXKA 2VX7A 3WF2A 1J9YA 3JZUA 4HHPA 3UQAA 2YLLA 3HIJA 1Q7ZA 4KQZA 1KFWA 3WQEA 5I3DA 2PTDA 4X0NA 4F9JA 2YCIX 2XZ7A 3LPFA 5LXEA 1MUMA