2G9FA

Crystal structure of intein-tagged mouse pngase c-terminal domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
180
structure length
180
Chain Sequence
ERKEILFIPSENEKISKQFHLRYDIVRDRYIRVSDNNTNISGWENGVWKMESIFRKVEKDWNMVYLARKEGSSFAYISWKFECGSAGLKVDTVSIRTSSQSFESGSVRWKLRSETAQVNLLGDKNLRSYNDFSGATEVTLEAELSRGDGDVAWQHTQLFRQSLNDSGENGLEIIITFNDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords peptide N-glycanase
publication title Structural and biochemical studies of the C-terminal domain of mouse peptide-N-glycanase identify it as a mannose-binding module.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 49
structure length 180
sequence length 180
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04721 PAW PNGase C-terminal domain, mannose-binding module PAW
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1020 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2g9fA00
2G9FA 2G9GA 2I74A
chains in the Genus database with same CATH superfamily
2EXJA 3IIIA 1VAVA 1CIYA 1ULPA 2R7EB 4GA9A 4LUMA 5FFOC 3WG3A 2XHNA 1JZ3A 2C1FA 4BQ1A 3H7JA 2VXRA 2X10A 4DNYA 5C9AA 3O1MA 3EHKA 3ZXAC 4AEDA 1NA1B 3A0KA 3RJRA 4E4ZA 3OGVA 2ES3A 3LE0A 5CB7A 4LXLA 5BNPB 1G9AA 2NYYA 2A6WA 3E6CC 2QUOA 4I0AA 1RINA 1S0DA 4ARXA 1JZ2A 1MQTA 3HJRA 4IEWA 4Y4RA 1JODA 2DV9A 1YQ6A 1BQPA 3MF6A 1XSRA 3KVAA 3PMEA 3LIHA 1DIWA 5GLUA 4YSFA 1W06A 5JSPA 4MV2A 4QHOA 5EV7A 1PZ9A 3AKSA 4YFWA 3MHZA 3N9MA 2BNOA 2BZDA 1E5SA 2HBTA 3A22A 1N1YA 3H50A 4K6BA 2WBKA 4LA3A 4N7UA 5A6QA 4OUMA 2QBXA 4NHKA 4FPKA 3MO4A 4MH0E 4XTMA 4FCAA 2HWB3 2DVAA 1LECA 3TEYA 1HQLA 2G1MA 2XQXA 3C8XA 2Y6KA 1HRI2 4XHXA 2R49A 2R041 1ZZ7A 3H3ZA 4WM7C 3VBFA 4LR4A 2W08A 3HN1A 4Z82A 3VV1A 3DN7A 5GZGA 4JAAA 2Q4SA 3NAPC 3POBA 2DCZA 3VZJA 3GM8A 2CNAA 4OYUA 1S55A 4FXGB 3EYPA 4Y4YA 4FTSA 3S7IA 5IVJA 5FK8A 2NMOA 3GXUA 4Y5Z0 1QJY1 3VD7A 1OURA 4TYSA 3O7OA 5FZAA 2ZAAA 5EFUA 2WO1A 3VBUB 4DXRA 1RJ7A 4EWDA 2ZHKA 5A7WB 4UW4A 1F2NA 1RTVA 3VBRB 4ZONA 3T08A 4URTA 1VBA1 4DIQA 3BIEA 4INDA 5IW0A 3OPTA 1RUG3 5K0UC 2D7FA 3WF4A 4EQVA 3H3UA 5L7OC 2RR12 3H8RA 3C3VA 3AZWA 3P5BA 3ECQA 3WP3A 3ZDSA 1WUVA 2WZR2 4HSJA 4NPMA 4ZZ5A 2P5BA 1VBB3 1QQP3 3LPFA 4CCLA 1H2KA 2OQ7A 3AKTA 1SDWA 1Q8PA 3E5XA 1DGWX 2J1SA 4AFBA 1W8TA 1XNCA 3VBSB 1Q3EA 1CAWA 1A78A 2BGPA 1BK0A 2DBNA 4Y3OA 5DAXA 1AYN3 5A3OA 2WT2A 2YYOA 2K46A 5FLJA 3ROUA 1N3QA 1ND2A 4QM9A 4XQDA 5KXBA 3JB4C 4MADA 4Y5SA 4FFHA 3AXEA 4NRQA 3MW2A 5CIRA 2XJUA 3OGJA 4OI4A 4XOGA 5FYVA 4AW7A 4E4SA 5JZGC 2ZGMA 4X6RB 3KZ4C 3D82A 1WW7A 4YM1A 2ORZA 1PMIA 2FQPA 4MLOA 4XFHA 1XE0A 1VALA 2LRPA 3QOPA 3J9SA 4UT5A 2ORXA 3VKNA 3ALQA 3RPQA 1Q8VA 2JX9A 4UAPA 4XDQA 3TWIA 3AP5A 3C7EA 2VQAA 4IEZA 1MPXA 3FFQA 1DQ4A 1HRV1 4P08A 4XJZA 1AYM1 1NE6A 5LBCA 4MVTA 3VZLA 1US2A 3KCXA 1JZ8A 3MFAA 4QPIB 1ULGA 3SKJE 3VBOC 3GDBA 4AHYA 4UW5A 4NMIA 1K5JA 3MIFA 1Q8SA 1VBE1 2FDHA 1ULDA 1DHKB 4Q0PA 2VMHA 4ASKA 4CCOA 4AOCA 1HRI3 1JHNA 3NKTA 5KHHA 1O3TA 4N43B 1PMJX 2PHFA 1W8OA 1OMIA 1S2BA 3GF6A 5GZDA 2A1XA 3ZFGA 1I1EA 1O4TA 3ZFEB 4R9CA 1BBT1 1B35A 1PVXA 1VAKA 4ITCA 5JMCA 1OUXA 2ARCA 1LHVA 4LHNA 2A75A 4LO6B 4JRLA 3ZFFC 4E2GA 1QXJA 1XQNA 3BIWE 4YGDA 5E6HA 3ZVXA 5FOJB 1EV11 2J1TA 2W47A 3FMGA 3CQOA 4YGCA 2WN2A 2K2SA 1VBA2 2Y0IA 4CDQA 4CUAA 5EHDA 4CCCA 2XWJB 4UW3A 2E6VA 2R30A 2ZMNA 4A41A 5FYTA 3ZSKA 2DCYA 2QCSB 3A21A 3QBQA 3TEXA 4FO9A 4JRAA 1UZWA 5EXOA 2ZGLA 1MZ6A 1UKRA 4AI0A 3T09A 4CEYC 2D5HA 4NHMA 2PHTA 2ZX1A 1WCSA 2TNFA 3CBNA 2EAAA 4C90A 3FUQA 2XJVA 3E97A 3HNYM 2WSVA 3S5AA 3ZYRA 2VY0A 4BQ5A 4QHZA 1REEA 2RR13 2YC2A 4YFZA 2WZR3 5CKQA 5I91A 1FPN1 2MEV1 4YWAA 1SFPA 1JYTA 2Q8EA 2BYVE 2SBAA 4DOUA 1RVF1 1VPHA 1WW5A 5FPLA 2Q0AA 2Z42A 3T4VA 4PBOA 2W2IA 3CL1A 3ME2A 2XPJA 1YIFA 2VC9A 2RS31 3QCWA 1MVQA 4LUKA 2QE3A 5FO7B 4KWJA 2F4LA 2RDNA 1LHOA 1W9YA 3PUQA 1PMHX 1UOBA 2CGOA 2XJRA 2RJ2A 4AHZA 1U0AA 4YGEA 5FYBA 2DCKA 2E7AA 5FPZA 2CGPA 1MACA 4J1XA 3VLBB 1HRV2 1K5MC 1LTEA 2X05A 1AYM2 3IDEA 2Y8KA 4XFIA 1MS4A 2DUOA 3PUHA 1COV1 4GKYA 4L8QA 4M3CA 4XFGA 5LWBA 5J1XA 3C2UA 3K51A 4MO3M 5T5PA 3LPGA 3PU8A 2GNDA 2HWC1 2D97A 2WAAA 1OSGA 3NL1A 1O59A 1K42A 3H8UA 3MICA 1S2KA 3KD4A 2DVFA 1QXPA 2YGLA 1SLCA 3GALA 1JOJA 3D8CA 3IN9A 2OQ6A 4OCTA 1UZVA 4OHWA 4OHYA 1W04A 1GP6A 4HKWA 4RFT0 4LBJA 1IG3A 1RUJ1 2DBIA 1JZ5A 4FOQA 4YVWC 2CDOA 4WM8C 1YFXA 2VW0A 4IE6A 4QKFA 1BBT2 1DGRA 4IEUA 4FP3A 1OI6A 2VW1A 2OPWA 3E1F1 2BP6A 2Y6HA 2VTFA 3BVCA 3CZJA 1AL22 4IE5A 4JV4A 2D6LX 1IKPA 2BW8A 1EV12 4U36A 1ND3A 4XF0A 3KLSA 1V6OA 4MGKE 3PUSA 4NHLA 2E33A 3OOXA 1PX4A 4GH4B 1G7YA 2PHWA 3N9PA 5D21A 3K46A 1CAVB 2KD7A 4XFBA 1Q8OA 4P00B 1RUE3 2WNUC 1BJQA 3U14A 1YQCA 2ZS6B 5C8CB 4CPBA 2YMZA 2C5DA 4BM8A 2XLGA 2ZHMA 4LKFA 2RDQA 4P9IA 3USUA 2BFUS 1OLME 1GYKA 1V70A 1VBA3 3PIJA 3B93A 3NVCA 3OJBA 1JHJA 1AR91 2D6NA 3DF0A 2OZJA 2ZX2A 3B5LB 3WF0A 4IEYA 1W6QA 4GULA 3H8XA 2R16A 5DN2A 2VZOA 1AVBA 5LY2A 2W68A 4Z07A 5K4LA 1QY4A 1FPN2 2MEV2 4XJ8A 3ZYGA 4XBNA 1RUF1 1RVF2 4XDOA 1PK6A 4IETA 1YHFA 3T2PA 4LHKA 1GZWB 2Q8DA 1QNWA 5GZFA 4ATFA 1HX6A 1E5IA 4YARA 4KI5M 5IK5A 2RS13 1IQAA 4NE9A 4IGOA 1Y43B 1YI7A 5FR3A 1W8NA 2WA3A 4XF9A 2O8QA 5KHIA 1AX1A 1YI9A 1SHWB 4FPOB 3HQUA 1LODA 1SBFA 3FUOA 4KH9A 1YFYA 1HLCA 4KG8A 1UIKA 3AP6A 5LASA 4D8MA 2OIIA 1VP6A 1COV2 1POV0 3LA7A 3PVEA 4IGQA 2JDAA 1UXXX 2WJSA 1L7RA 4ES8A 2HWC2 2QQUA 3PUIA 1U5YA 3G6JB 3M2MA 4Y1YA 2YFZA 1CX1A 2CTVA 5IUQA 2DVDA 3CLPA 4DS0A 1HRV3 5DG1A 1NCRA 1AYM3 2Y38A 1WZXA 2B4KA 5AFEA 1IQDC 2HEVF 1RUJ2 2UY8A 5KC5A 3RZZA 2ZGPA 1IGOA 3KT1A 1EY2A 4TLGA 5IT6A 2B39A 1LOEA 4FTBA 3DYPA 2Y6LA 3EO6A 1PIV3 3VHPA 3EJKA 1EUTA 2IVJA 3R4SA 4A3XA 4X6QB 2ZMKA 3V64A 4BXSV 3JQXA 1YUDA 2E31A 4IESA 3DKQA 4OHZA 3I2FA 3KF3A 1VR3A 3RI9A 1RB8G 5F2WA 5FPBA 2Y33A 2A7AA 4HLTA 4QB6A 1XNAA 3PL0A 5SV5A 1BBT3 5BNNC 5FZ4A 3POFA 3W21A 3AKRA 3WF3A 1AL23 2A5ZA 1EV13 2MPFA 2C9AA 4A3ZA 2PHRA 3POGA 3FX3A 3AYCA 4ORFA 1N47A 4YG0A 1AR92 4K40A 5FPUA 1LHWA 2CWSA 1JBCA 1NAEA 5ERLA 2VCAA 4Q4V1 4WZCA 5BNOC 5FZEA 5JLVA 1O6UA 2R6QA 2YUEA 2D40A 3KS7A 4JDMA 2XL9A 2PHXA 2PMWB 4XURA 1JZ4A 4IEQA 5C9AC 4AEDC 2HBUA 1RUF2 2FMYA 2VNRA 4NHXA 3MLJA 2IXKA 4N9IA 1MQTC 4AHWA 5FUIA 3OTFA 5CNAA 2VUCA 4HVOA 5JR2A 3VKOA 2CDPA 3POSA 1FPN3 1NLSA 1O8SA 2MEV3 3J26N 3M3EA 4WM7B 1CVNA 4CXYA 1RVF3 2VJXA 4RS5C 4C91A 1PGSA 4HKOA 5LEJA 3NAPB 5LA0A 1TME2 3M70A 4YPJA 5I93A 3OY8B 3WDVA 2W9XA 1YFUA 1GBGA 2VOXA 3FHQA 3CO2A 1CD3G 4CPBD 1KS4A 4AFMA 3K3OA 4EV0A 3FC0A 1UW8A 5APAA 4H2AA 3S7EA 3LEKA 4XZUG 3T1MA 2R1BA 4WVVA 2WT1A 2PAMA 2K9ZA 4IV3A 4L9BA 4HSLA 5B4NA 3V0BA 3K2OA 4FP2A 4AWDA 4GWNA 2G9FA 1XU1A 4B8EA 3KV4A 1JZ6A 1PO21 1KDMA 1COV3 2WLPA 5FCCA 1WA4A 1FYUA 3LKJA 5FO9B 4UFLA 2CYFA 4GB32 4IEPA 4YW1A 2VL4A 4COZA 3W5NA 4IE0A 4YG3A 4OQ9A 5K0UB 5M0TA 1LB2A 4JVAA 4XEZA 1BYHA 2GN3A 5FY5A 2W87A 5L7OB 1VLNA 3BU7A 3T3YA 4JQTA 5FZCA 2WNOA 1HQWA 1UY4A 1ZM1A 2X53S 1D4VB 3AXDA 4XBLA 1RUJ3 2AEYA 5LW9A 4YW3A 3ZSLA 4Q0UA 2JXAA 2DFBA 1W03A 5A32A 3FE5A 4AHXA 1W9FA 3EXUA 4Q27A 1W8WA 1MZ5A 3GHMA 3UGGA 4CRQA 3WW4A 2IZWA 3I54A 4P02B 2GDFA 3WEZA 4AL9A 2UWAA 2WZ8A 3ZR6A 4L99A 1OA2A 3LIGA 1UAIA 1UY2A 2PHLA 2X5IC 4N53A 4KU7A 1DQ6A 5DZGA 3P3PA 2XG3A 4Q4V2 1WBFA 2JDYA 5JZGB 3I3QA 4IL7A 3KCYA 3ZSJA 1UY1A 1JU4A 5F5QA 3D0SA 4B4PA 1Y7BA 3ES1A 2B8MA 3JB8A 2EIGA 4XZPA 2B9VA 3VDAA 2JD9A 3RYRA 1AR93 1ND2C 2XJSA 2BOIA 1K12A 2VZTA 4QQOA 3OEAA 2ZGSA 1AJKA 1PVC1 3O1TA 5I0DA 1ZZ6A 1RUOA 4ZXEA 4DRVA 4BQ4A 3C7FA 4HK8A 4UFKA 1J1LA 3AX4A 1SFNA 2ZGUA 1W3XA 4NIHA 3RNSA 5KXCA 3FBYA 4P9XA 1RUF3 1LJ7A 2LUWA 3VBOB 4K9SA 4Q4W3 3ACFA 2CY6A 1R64A 2O1QA 2BDRA 2JWPA 2W5FA 3BALA 4YZ4A 1W9WA 4CDWA 1CJDA 2VZ3A 4COUA 1UX7A 4LBLA 5A7SA 3O1UA 3FWEA 4GMP1 2ZGOA 4HT1T 1R091 1C5HA 1V6LA 4Q2FA 2JDPA 2VBPA 2XH6A 4D94A 3NNJA 1URXA 3VZKA 1TME3 4BWOA 1GZCA 1CAUB 1N3OA 1P8JA 3ZFFB 2YDEA 2WC2A 1ASJ1 4MGTA 1MS1A 2WR9A 4O7XA 4C0BA 4AVBA 5CISA 1WW4A 1IS4A 2VG9A 4Y24A 4BB3A 2R32A 4HOOA 5FJKA 4P9LA 2ZA9A 3K4AA 3V65A 3HOBA 3ZFGC 1ODMA 1IPSA 1OQ1A 3DXUA 5C4WC 3ORJA 4PDWA 3OBZA 4CEYB 4LO4B 3RJ2X 4RQPC 2VQTA 4RL7A 5FPXA 5A3LA 4G4FA 4JGYA 2X29A 1ZZCA 2XDVA 4LLOA 4LO7A 3IAQA 2KA3A 1OF4A 2JG9C 1STMA 4GB33 3WF2A 4BQXA 5IHRA 4CDQC 4E8CA 2BUKA 4CXXA 2VZVA 3IPVB 1GOFA 1ZRIA 2OUHA 4CCJA 1D4M1 1J1TA 4FFFA 4CCNA 3S5QA 5FDBA 1PO11 5C3QA 3ZLIA 3UNPA 2Q8CA 3NKGA 1G86A 4FSJA 1UIJA 1O3QA 1T2XA 3TYJA 3GNEA 2ZEYA 1JH5A 3N35A 3M3OA 3PTYA 2NQYA 3Q8AA 4KBZA 3AP7A 3GGLA 2JKXA 1UN1A 3SH4A 3NRUA 1UPSA 3FLRA 3HNMA 1SQ4A 4QAWA 2WO2A 4DXSA 5HCHA 2PAEA 5A33A 1NQDA 1TNFA 1XNTA 4Q4V3 1K5MB 1PVC2 4FAHA 3SNMA 2DCJA 2ZX3A 1CZSA 3OUJA 3VZNA 2G9GA 2HJIA 1KGYA 1QJX1 5FZFA 3B94A 4AI2A 3A0NA 3NSTA 5F32A 2Y0OA 3DECA 4Y22B 1WCQA 2RJKA 3OUIA 1JOPA 3WW1A 2E53A 4UF0A 3TN91 1AXKA 1OF3A 2W1UA 1L7LA 4I02A 2PFWA 4QB2A 1UOJA 5HV4A 1NLQA 5FP3A 1S2EA 4H14A 3LOBA 3MGUA 4QQPA 2YXSA 3PMSA 3ZOIA 2VNVA 4YVWB 4WM8B 3IMNA 1IOAA 2QDRA 3I59B 3KV5A 4IV1A 4D69A 5LK7B 1VAMA 2C26A 2GC0A 5LA1A 2RVAA 1LGCA 1QDCA 1W0OA 1S0BA 1ASJ2 5FQ0A 4K1YA 4Q1PA 3BTYA 1C1LA 4AVVA 3KB5A 4B29A 2GSYA 3H1MA 1DZQA 2CAVA 2OW4A 5EJ3A 1MS8A 4QD2A 4LJHA 5FZ9A 5GM0A 1OLMA 1S4CA 5CYYA 2WNUB 5DABA 1MS9A 2VOTA 4Q29A 4AG4A 1HJGA 4FVVA 4R52A 3WP4A 3O1OA 2EICA 3NV1A 4V1PA 3VGIA 4H3WA 1PX3A 4MHUA 2D43A 1SEFA 1H2NA 3MUY1 4ISRA 1JW6A 1LNSA 4BA6A 1QHDA 1ZRCA 3WD5A 1CAXA 3VD9A 1ND3C 3BCWA 4MSVA 4YLZA 4XXPA 1H8TA 4YM0A 4RHV1 5FZ1A 2B7YA 5IFTA 2ZGKA 1D4M2 4QU2A 4RD7A 4AAPA 3T0DA 1OQDA 1RMU1 2W52A 1PO12 1HN1A 2WT0A 3LEGA 2J1AA 3JQWA 5A6ZA 2HEYF 5A3PA 1CWPA 5FWEA 1I6XA 1NXMA 2FCTA 3LD8A 1ENRA 2WINB 3R4DB 3IZOA 1TE1B 2W95A 2AC1A 1RUD1 3S30A 2WSUA 2HLEA 1J58A 4AFDA 3SLIA 4E4HA 5KR7A 1LEMA 1X82A 3D5OA 4BHPA 3J8F1 3SC7X 2QFEA 3LA3A 4QQ2A 4ZS3A 5JXHA 1GOGA 4N9HA 2ILMA 2QZ2A 1NA1A 1YIPA 3QACA 1PK6C 2YFUA 1J3PA 5FZMA 5CZKA 3O0VA 3WINE 4AGVA 1JYVA 4DRRA 3RZHA 4AZZA 2VUJA 4M3CF 3FHAA 4NUBA 2D5FA 5E1RA 4QKDA 4YYOA 5FAXA 1GNZA 1YJKA 3I3DA 3M8LA 4WVMB 4FAGA 3VD5A 2VVEA 1I9RA 4UW6A 4QX0A 2DDUA 4L92A 3OUHA 4JHZA 4YM3A 5B4XA 1GOHA 2ZXQA 4RR3C 3TN92 3VD4A 1PVC3 2C0ZA 3VDDC 4DO0A 2ZGTA 1HN0A 5FY4A 3POYA 3PTRB 4CU7A 3UL2A 1O5LA 1W2TA 4BH9A 4HN1A 3SQOA 1MS3A 5A7PA 4TZDA 5EYXA 1JMUB 4KWKA 1I5ZA 2X09A 4R9DA 4AGRA 2OXBA 1ALYA 2VE1A 5I0UA 5JDBA 2ERFA 1VRH1 4FPEA 2PELA 1GNHA 2R073 4H55A 4KMQA 4QU1A 4GMP3 5A80A 5K9YA 1NCRC 1RL3A 2J1VA 3HNBM 3LSEA 4W50A 5A7QA 4Q0QA 4A45A 1GU3A 5BNNB 2WQ8A 1OFSA 1AXZA 1SLAA 4CP0A 2VCCA 1W6NB 3OCPA 3NV2A 1NCQC 1VMHA 4IUGA 1ASJ3 1F4AA 3VBUA 4NPLA 2Y34A 1BMV1 4LBKA 5A7WA 3ENRA 1CPNA 1YNAA 3AZZA 4RHV2 3VBRA 4ZU7A 4AVCA 1LU2A 4N90A 5BNOB 3TEWA 2WWJA 1W0NA 4AEMA 4D6QA 1RMU2 4AVAA 2ARAA 2XKOA 1F9KA 3UKVA 2WFPA 4HFSA 3I2OA 1NZIA 2AYHA 2P37A 2YPDA 1BK1A 1R083 3CDZB 4PIXA 4AEDB 1WCUA 2W39A 2P3YA 3B9IA 4R8HA 2XBO1 4KGGA 3T2TA 1RUD2 1MQTB 2IXIA 3WDWA 4IXLA 1D4M3 1ST8A 2QNKA 2EXIA 3CIHA 4QX1A 4YGBA 5G05L 2Q8OA 1Y9MA 1JU3A 1PNGA 1PO13 5LBEA 1YXWA 1LOAA 2WYFA 2ADEA 3DYMA 3J8F2 4YVSC 3VHRA 5A70A 4RS5B 3VBSA 1U5IA 1XE8A 1EPZA 2DU0A 2QZ3A 3OGSA 2OYZA 4DINB 1SDDB 1ONAA 5LA9A 1B09A 3BUCA 3ZXGA 4PQ9A 1XOYA 4JKMA 4QQLA 1JYNA 3AZVA 3WHUA 3TEZA 1U5ZA 5A6YA 4S2DA 5F3GA 5E8AA 4XYXA 2Z79A 3R0RA 2JDMA 3KSCA 3HMYA 3THPA 1H6YA 2DVBA 1RJ8A 2P3IA 3HEIA 2BJSA 2VNOA 5FXWA 3BI3A 3PNAA 2AH2A 1W3VA 5L9BA 2OT7A 2JIGA 4YRDA 3BTXA 1Z7S1 3WDTA 1HXS1 5FIXA 5GZEA 4BYYA 3WDYA 2JG8C 3OBTA 4KU8A 1YO8A 4UFIA 1C8M1 1ZX5A 4L11A 4BZ4A 3TN93 2EVXA 4QXBA 4IV3C 1J83A 1FV3A 1VRH2 3LOIA 1UF2C 3VZMA 1IS6A 4O9GA 2XJQA 4JKLA 1A3KA 3AJZA 2Y26A 1G9CA 4YNIA 3JZVA 5T3NA 2VXJA 2VCBA 3KGZA 3AYAA 4AAXA 1JTZX 3MLKA 3IIAA 4FPLA 3ZXLA 3DCQA 4P5YA 2BVBA 4FOYA 4RYDA 4N43A 1DGLA 3VKFC 5AFBA 4D3WA 1ENXA 1GUIA 1APNA 4XHBA 4Y5TA 1BMV2 2ZPXA 2R042 1ZZ8A 3I2IA 4HZFA 4NRPA 2TUNA 1Q8QA 2X5IB 3ACGA 5F3CA 4FQ4A 1Q43A 3LEMA 3ETPA 5K7PA 1ZBA1 1ZA7A 2GMPA 4J25A 4C1WA 4BMBA 2C9KA 2UURA 3CJIC 2DWRA 3FLTA 5FPVA 4CDXC 4EN0A 2Z5WA 2OVUA 1QJY2 2QKDA 3AZXA 4XF4A 5IVYA 2CGNA 2QQKA 3W59A 1FMD1 2D6PA 4AGGA 2ZHNA 1ND2B 2XBO2 3WDXA 4Y20A 2QQPA 4RHV3 3P1IA 2ID4A 1KD7A 5J09A 4XW3A 5IATA 3I2JA 1OVSA 1RMU3 4UOJA 2VMGA 3PHMA 3RG0A 1E5HA 4NRMA 5FOBB 3N7LA 3LDKA 1GR3A 4MZUA 2WRAA 3IMMA 3U10A 3SH5A 1U12A 4XF3A 1TG7A 5CFCA 5HPOA 1XYOA 4EJRA 2D6KA 4I09A 4GALA 4P9GA 2R061 1RUD3 2BU9A 1G6NA 5EJZB 3ZIXA 2NMNA 2YBKA 4QXCA 5F2SA 1X50A 1JYIA 3BODA 1QOTA 4WZFA 4HANA 4A4AA 1QNYA 4FT8A 3J8F3 4V2VA 5FP4A 3ZYIB 5C7GA 3VUOA 3HPNA 4DZGA 3WG1A 3UESA 2J7MA 2GMEA 3A7QA 4LE3A 3R05A 4QPWA 3DPRC 4GZ9A 4BU2A 4EZHA 2G4IA 2ZTNA 5ABJC 1QMJA 5D8AC 4QT6A 4CCEA 5J36A 4NWWA 4EZ4A 1Z7S2 4YW5A 4OUSA 3U78A 1LRHA 4ZHNA 2J1RA 1NY71 2BERA 5DUWA 4GAZA 3ZFGB 1WCKA 4SBVA 3D3AA 3TNPB 1XYNA 2GALA 2H6BA 5C4WB 4TXWA 2GAUA 5EWSA 1X9TA 4KWUA 3FN9A 3NV3A 4RQPB 1W0PA 2JIJA 3GZUC 3WCSA 4AEJA 5EPAA 1S0JA 4PJYA 1E57A 2JG9B 2VTXJ 4KQ7A 3B00A 4CDQB 3ILFA 4QM8A 3VB9A 1LR5A 4D7SA 1VRH3 1G9DA 5DPNA 1C8NA 1DU3D 3OSDA 4PDWC 1ODNA 1SBEA 2VZ1A 3IKWA 4L0PA 1VE0A 4ET7A 2QQOA 5F5CA 1RUI1 1ZBA2 4CZSA 1WA6X 3PLQA 1VBE2 1W8UA 4NAMA 5FZ7A 4BQ2A 1VRBA 1MS0A 2XUEA 3VKLA 1D2SA 3MYXA 1NOVA 2V5YA 3Q8BA 3WG4A 4ARYA 1SLLA 1FMD2 2R043 1CN1A 5H9RA 1W2NA 3JXSA 2PQSA 5L73A 4HPKB 3WNOA 3PVNA 3K3NA 3POIA 3VD3A 4BK4A 2DVGA 4B7EA 2JJ6A 2B5HA 4WV8A 3THCA 2I74A 4QPGA 2YHJA 3WNXA 2RE9A 2J22A 3ATGA 4TWTA 5FY8A 4RN5A 1QJY3 5IK7A 4DUXA 3ZDVA 3H3LA 3AK0A 2CHHA 5K8SA 2XBO3 3UGHA 1JS9A 2R062 1QKQA 3LEIA 4FOWA 4RGGA 1XE7A 5DAQA 5T55A 4AVSA 3GBGA 3POWA 1GZWA 4LT5A 2WNEA 2HH9A 1DYPA 2YG0A 5JR7B 3LSDA 2JE7A 4BQYA 2UU8A 4LQRA 4M3CB 2VECA 2VTXA 1XNDA 2IC1A 3B7MA 1MVEA 1X8MA 3LDBA 2A3WA 3QH6A 3IT8A 1QH6A 3IDAA 1OOPC 5C3PA 2J42A 3NQHA 1CJPA 4KBBA 1H1IA 2LM3A 3RVHA 2SLIA 2GU9A 1KQRA 3AMPA 2A6ZA 2H6CA 5GLZA 1IZ3A 1NY72 4XFAA 4CP9A 4YZ2A 1LGNA 2BGCA 3M3IA 4M0HA 4AQ6A 5C5UA 3T2OA 1J84A 2RS32 4IV1C 4LKEA 5JIUA 4OVEA 2WYSA 1RITA 2HWE1 1POQA 2E51A 4NPRA 1ZRDA 5IYYA 1Z7S3 4OI0A 1XC6A 2CU5A 3CU7A 1ND3B 2AEZA 2MHFA 4K20A 4RGKA 5F3IA 3ZKYA 4C1XA 5KHGA 3OPZA 2Z2SB 4JTNA 4AI8A 3AVSA 2V72A 2XL7A 1DFQA 1WW6A 1XNBA 2C6SA 3KHBA 1XU2A 3JUUA 4CEWA 3SHRA 3I97A 2PQQA 2NPIA 4W8JA 3ZN6A 3ZX7A 4CP1A 3RMXA 3VBHC 1OLQA 1W9SA 1OPMA 1HV0A 2XJTA 4BJ0A 1FOD1 3MPPG 3USUB 3KT4A 1UKGA 3MDPA 3NNGA 1NUKA 4OLLA 1H1AA 4F8AA 2WO3A 1G9BA 4CDUC 3SITA 1N1TA 2RDSA 4CU9A 5FWJA 1KFXL 1OD3A 3NMBA 1Z78A 1KITA 4LBNA 1OUSA 5F37A 1W6OA 2DUQA 4B4RA 4XBQA 1J59A 3LQCA 3DL3A 5FY9A 3BOPA 1O3SA 1K3IA 1PK6B 4XETA 1ZBA3 2VUDA 2Y6GA 1VBE3 3WQ0A 1OPOA 2EF6A 2BBAA 3I2KA 4I01A 4LULA 1AUYA 1J3RA 2VM9A 4GMP0 1FMD3 2XLAA 4A44A 1LOBA 5E88A 3I3MA 4NWVA 3HD8B 3UKNA 2P17A 1L3JA 3H7YA 4RR3B 4K7JA 4XUPA 3WW3A 4QGMA 4M0NA 1BZWA 3WNKA 3ES4A 1QEXA 3VDDB 2XKPA 3KHCA 4L2NA 1Y9QA 1QJEA 3MEPA 5TSWA 5BNQA 5BUVA 4AFAA 2DTYA 3ETQA 4XQWA 4OHVA 2W1WA 3WQ7A 3ACLA 3OEBA 2VULA 3POEA 5JPNB 4COWA 4TN7A 3EBRA 1OVPA 5SV8A 4IQPA 2IUWA 2R063 1PGL1 4WM7A 1S0CA 1KRIA 4XF1A 1GSLA 5FZGA 2JECA 5JPMB 3JCIA 1NCRB 3NAPA 5CADA 2PHUA 5A1FA 1GQHA 3LFMA 3OY8A 5T5OA 1QH7A 4TSVA 2CL2A 2F4PA 1SPPB 3FZ3A 1LHNA 2O8OA 2VUAA 2XUMA 1F4HA 1N1VA 1NCQB 2HWE2 2OUJA 2Q1ZB 2BVVA 4ZU4A 4F7ZA 3RWNA 4MXWA 1Q56A 1UMIA 4ES9A 3N7KA 2AR6A 5IWFA 4MYEA 5GLTA 2VZRA 4U2AA 1GKBA 2RS33 1YFWA 4ASLA 3K77A 3H42B 2A6XA 5K0UA 1XJAA 4QKBA 5FMBA 1O91A 3Q9OA 2V4VA 2ZKLA 5L7OA 3S6PA 1FOD2 1H9WA 2V09A 3GBWA 3OG2A 3VBFC 1UCXA 2GNBA 1A34A 3NJVA 2W0XA 5CKMA 1W8ZA 2TEPA 4YZ1A 4OZXA 5JCTA 4META 2ZKNA 3GCWA 4YVSB 2LW8A 2V4AA 1PZ8A 2KM2A 4WBBA 1TNRA 4LPLA 5AC91 2HWC3 5FYZA 3CJXA 1OC1A 4MOAA 2UYAA 5FZOA 3T4HB 4JGZA 4A7KA 2FDKA 2JENA 2NN8A 5FYIA 5L9RA 2JD4A 1FI2A 3ILRA 3O1VA 2VMEA 4Q26A 5JZGA 2VOKA 1Q5OA 4Y33A 1VBD1 4JC1A 2FCUA 4BQ3A 4L97A 2PXJA 3ELNA 4LTAA 3HBZA 2RDRA 5DXDA 2VBBA 5FK7A 1AZDA 1H4HA 1H0BA 3SCHA 2PLV1 3E6DA 4LBQB 1F5JA 4FPFA 2JG8B 3I2DA 3HT1A 4X8PA 4PI2A 3KMHA 4GJYA 4J6GA 3IB3A 4IV3B 1W6MA 2FDJA 2GMMA 4Q4Y1 3V0BB 3VBOA 5JI9A 5F6KA 2VVDA 3DV8A 5J3UA 2XOMA 1V6JA 2VOVA 1FXZA 4LKSA 1O3RA 4XMIA 2JDHA 3OYWB 2WZEA 3URFA 2YPJA 3X29B 5F9TA 1CONA 2NLRA 3AMMA 3J4UH 4OMCA 5LA2A 4HG6B 1WLTA 1ZVFA 4UBGA 5IVEA 2GP5A 3SXWA 4D7TA 4JHTA 2JB4A 3RZGA 5CG8A 1EP0A 1UYZA 1CAUA 1O8PA 1WBLA 3MLLA 5BPXA 2D3RA 3MW3A 1GQPA 2ETEA 2RMU1 1JN2P 4CVUA 1SFYA 2F17A 3CJIB 3G7DA 4CDXB 2HWE3 2VOWA 3ACIA 1ENSA 3WUDA 1EYBA 4N43C 4BDVB 4E4DX 2D3SA 2O14A 5E16A 3WY6A 4Y1UA 4CXWA 2XVGA 4A6SA 2WWUA 5HCBA 2RHPA 4PLOA 5FV3A 1A6CA 3ZMOA 3WSOA 5FLHA 2BPA2 4FQZA 1PO22 3RSJA 5J96B 1MEC1 1LKNA 4A7YA 3GJBA 4GWJA 1HKDA 3IPVA 3WDUA 2J1EA 1S0FA 3ZXKA 3H1YA 1PHMA 2JDKA 1LU1A 5LATA 1FOD3 1QOOA 1ULOA 5AVPA 5GZCA 4QDRA 2WS91 4AEKA 3INAA 4KG0A 1IG0A 2WO7A 4I0WB 4E2SA 5A3MA 1ZREA 1GV9A 2YC0A 3QD6A 5F3EA 1WD3A 5FMOL 1IPJA 2ZAHA 3B9CA 5FKBA 3BPZA 4HBNA 4DUVA 1B35C 5HCAA 3SKVA 5KHKA 2IFWA 3GZTB 4RFRB 4XIOA 1C28A 1VBD2 3D4KA 3LA2A 1EAH1 1GWMA 2H0BA 3WNPA 2HWB1 3IWZA 5CFCC 3DPRB 3PJQA 5ABJB 1FT9A 5D8AB 4D6SA 4Y1ZA 4QGLA 1ZRFA 2I2SA 4PIYA 4MHRA 1W6PB 1MZFA 3CKHA 3WX5A 4NIGA 4FI9A 3AP4A 1AXYA 3DGTA 4XE9A 1K5MA 1REDA 3ZR5A 4W4ZA 5FXXA 3ZN4A 4HL0A 3VDCA 2XVKA 1UYYA 3N7MA 3TBDA 4ZZ8A 4IW3A 4UI9L 4UFHA 4Y22A 3U1XA 3HN3A 2DURA 1UMZA 2P34A 1BXHA 2EA7A 1QJZA 2Y6JA 3WLUA 2ZHLA 2PAKA 4B1LA 1NXD1 1C5IA 1NE4A 4LMFA 2LS6A 5ANNA 5GALA 1ZRRA 1FNYA 3MV01 4YVWA 5FLIA 1DQ2A 3U4SA 4NVPA 4PDWB 3LFIA 4S2GA 5FJHA 3WOGA 5JXJA 1RUG1 4GIQA 1QIQA 4NIDA 2DTWA 5G04L 1ZNPA 2LTNA 5DUUA 5FKCA 4BMEA 2RMU2 1JUHA 5JOZA 5KXEA 1OT5A 1PNFA 3ABZA 4Q5OA 1JYXA 5LRSA 5C6CA 2ZEWA 2BRTA 3AMHA 3D6EA 4HETA 4P5HA 2PYTA 4P9YA 1VBB1 2E7TA 4YW7A 1QQP1 5LEKA 4BCUA 1WCDJ 2ZCWA 5A3NA 2P3KA 5EQUA 1MZEA 3WXPA 1R092 2ZOEB 5KWRA 1DZRA 4LBOA 5FZKA 3M3QA 4S2HA 1WD4A 2RJLA 2E9QA 4XVHA 4ZXKA 5CFDA 4XJAA 5C70A 2GZWA 3MIEA 4XUNA 4CCKA 4Z2AA 1BVVA 1IPKA 2GNMA 1MEC2 1QJFA 1SG3A 4GXLA 5T52A 3CEWA 5LBBA 5A3TA 3NJXA 4HKLA 1HB2A 3AP9A 3UJOA 2VW2A 1DLCA 1ZZBA 4BQWA 5J48A 2WS92 5H9PA 4AQTA 5H9QA 4JTOA 2ZX4A 5A33B 3QLQA 2B46X 1OQEA 1REFA 5CKNA 2EIDA 3WQ1A 4AFCA 3U0ZA 5ISLA 4Q0SA 4AI9A 2YBSA 1PO23 3GBFA 2QQJA 4UYBA 4DQAA 4QPGC 2QTWB 5T50A 2BNNA 4F3JA 3C7GA 1EAH2 5I0TA 2ENRA 1MS5A 2GH2A 4ATEA 5HI0A 5I8TA 1YRZA 1TZOA 2HWB2 1YC61 3JU9A 1ULFA 3N9QA 5IVBA 3KM5A 3NW4A 3V0AA 1OOPB 1UU4A 1PZ7A 1LOFA 3HQXA 4OFGA 4UF0B 2GP3A 2WNVA 2BTVC 3SEEA 1H1MA 1DYKA 3NJYA 2FZ1A 1OA3A 2FHRA 2E7QA 3AFKA 1OXCA 3O0WA 3RYKA 2EALA 4IV1B 5FP7A 1CPMA 2EXHA 2VNGA 4DB5A 4NIAA 4BLIA 2XLFA 2ZX0A 3TB0A 4DPNA 5IFPA 4GWIA 2XB6C 4QMAA 4NR1A 1V6KA 2HKXA 3OF1A 4MGIE 1JOBA 5FQ0B 1HB1A 4X8NA 3ZYJB 3N4MA 1W2OA 4I3GA 3VHNA 1QXRA 3AKPA 5BNPA 2JDZA 2QQIA 3RI8A 1NLRA 3PURA 1GFF2 2VBDA 2VZQA 3O5SA 1AL0G 3VBHB 3KCCA 1QJX2 1IS5A 2FMDA 3GCXA 2ADDA 3AMNA 3VN4A 1AR81 5KHJA 1M06G 1BLZA 2W1QA 4JKKA 3SCGA 2ZZJA 1YQ5A 4JDNA 5KC6A 4BISA 2JEMA 4CDUB 2YBPA 1XYPA 1D0HA 1CX4A 3NJZA 2AGSA 2CV6A 3AYEA 3ILNA 4Z1VA 1SLTA 1HW5A 4CEWC 5BNNA 4XAEA 4RA0A 1GP4A 1GQGA 5F5AA 1UZZA 4XIKA 3MZHA 2RMU3 2TBVA 4LLFA 3VHOA 1H4GA 3PJYA 5FZ6A 2MNGA 1CZVA 3THDA 1SZBA 1XSQA 5BNOA 2VR4A 4PLMA 1R093 2D98A 3I3BA 1YQ2A 2ZGRA 4FBFA 4O61A 3T0AA 3U11A 5F6LB 3RGBA 2ZBJA 2OKXA 5A3WA 2KXLA 1JZ7A 2Q5TA 2P3JA 1MEC3 3HQRA 2DCTA 2BGOA 4JCKA 5C33A 3DUIA 3ZYFA 4LK6A 4BK5A 2HEWF 4FFIA 4PIZA 1X33A 3F95A 5FZ0A 2WS93 5FXZA 1FATA 4LHSA 2PHDA 2G19A 1AHSA 4EROA 1I3HA 4RS5A 4BPZA 1OD5A 5C9AB 1AX2A 2Y6FA 5AVAA 2UY9A 1EAH3 4R4ZA 1RIRA 3ZPOA 3N9LA 3FFZA 1Z0HA 5FZHA 3AL5A 3AKQA 3GYDA 3BTZA 4QX8A 5JSRA 1KS5A 3K4DA 4E9KA 1W2UA 5DZEA 1WWYA 3LB9A 4CSWA 1ENQA 4AR2A 4XJUA 4PQQA 5F7UA 1D2QA 3I3EA 4D6RA 5CAZA 2YGMA 1TEIA 1UNBA 4NJ4A 4ZS2A 5A3UA 5IVVA 1W39A 2C4XA 3JD71 3M4FA 3RZLA 2ZGQA 1CESA 1DYOA 3GJAA 5JXGA 3AZYA 4PF5A 5J37A 4BLJA 2FZ2A 3ZSMA 5CG9A 2W3JA 5EZWA 1AR82 2QQVA 4TLFA 3EMRA 1S0IA 4COVA 2H0VA 1RUE1 3VBFB 4C8DA 3BOWA 3MI8A 3RDIA 3GZAA 1E5RA 2WDBA 2QQNA 3BGAA 1TMF1 2VCMA 2FDFA 4E8DA 1C57A 1QJX3 1W2AX 3WG2A 5KBFA 1RUH1 1SACA 1BKZA 3LAGA 4NOTA 5FTTC 3P6BA 3TOJA 3WZ1A 1UWWA 5CU1A 1NX9A 4I0BA 4AQ2A 2F6BA 2D6MA 2X5IA 2P6HA 3VL9A 4QPIA 1LOGA 1NYWA 3ZYPA 1CQ9A 2VQ0A 1H2MA 2W1SA 5IVCA 4LEJA 4YZ5A 2Q30A 3LCPA 2J1UA 3O1SA 4FPJA 2NZ9A 2ARBA 4FFGA 4XABA 1OKOA 1UU6A 5FRAA 2YU2A 5FUPA 5BXXA 3SMHA 1R1ZA 3A4UA 3IAPA 1V0AA 4ONUA 2RS11 3THTA 1H6XA 1XPWA 1GZ9A 4UBHA 3N9NA 4M4PA 1DQ5A 2FCVA 4KL1A 5FBJA 4FOVA 1DGWA 1O5UA 2D93A 4JGZC 3ZFEA 3TRSB 2XVLA 2P1BA 3OGRA 4QWNA 3O0XA 3VDBA 4BIFA 1RUNA 5ANQA 1C1FA 5JOYA 2EIEA 2CWMA 2QQMA 1VBC1 2JB8A 3K4ZA 4GKXA 3AC0A 4AE2A 1YLLA 4EE2A 3U07A 4YM2A 5DAWA 2ZABA 1CAWB 2DYCA 5C3RA 1GMMA 5BY5A 5JI7A 4I2OA 2IFRA 4LOTA 4HN0A 4N53C 4MXVA 4QKNA 1NZCA 3T0BA 5C3OA 4PLNA 4Q4X1 2A73B 3BN6A 1SLBA 4ZPIA 4D0QA 4B4QA 3DYOA 4R4XA 4UFJA 1PIV1 1RHI1 3JD72 4D7YA 2NP0A 3ASIA 3E5UA 1GLHA 5GLWA 4EWAA 2BFUL 1XBFA 3HT2A 3UV9A 4KNCA 2WZR1 2D44A 2W92A 4HVRA 4XMAA 1WLCA 3GZEA 5EP9A 2WFF1 1UXZA 3KV9A 1RUE2 1BHGA 5C4WA 3UETA 5EIYB 2JDNA 4NROA 4RQPA 1W8HA 3LDRA 4Q8KA 1AL21 1VIWB 1F5FA 2JG9A 4EN8B 1BEV1 1TMF2 1LOCA 3EQEA 5IAVA 2AREA 4CDWC 1KFUL 1N1SA 5FZDA 3ZYHA 2A6YA 4DEVA 4CUBA 1HXS2 4QX2A 1AR83 1RUH2 2VD7A 3HWJA 4EN7B 1RUC1 1C8M2 1W05A 3B02A 1AR61 5LBFA 4Y20B 3AJYA 2A3XA 4BIOA 3UKTA 3R4UA 1B35B 2YC4A 3APBA 1DCSA 4QPYA 3OD4A 1JYCA 2QQWA 3K48A 4Z2WA 4LOSA 4EWEA 1UY0A 1OH3A 5LZ6A 1LAJA 1UD1A 3WNMA 3UGFA 5CFCB 1I5PA 2RS12 2FD8A 4CE8A 3EB7A 3SH3A 4LITA 4ZKTB 4HPKA 2P4EA 3NNMA 3K75B 3ZPYA 2A71A 4S2FA 1VMFA 4FPGA 4M4RA 1Y4WA 3WHTA 1TQ5A 2WUHA 5T5LA 2G9ZA 2BWCA 4HONA 4JGYC 3IM0A 4ZY9A 3RYPA 2VMCA 5A6XA 1VBC2 2D3PA 5T54A 5L9VA 2XONA 5FZIA 4AK3A 1WLDA 4GH4A 4WVWA 2YZ4A 3B01A 1CAVA 1RXGA 1CIWA 4QX3A 3AYDA 1NKGA 5C8CA 3ZM8A 4HK9A 3ZMNA 2WL1A 1QDOA 5IVFA 2Q1MA 3TAYA 4CUCA 4CA9A 3MUZ1 4Q4X2 4YW2A 5EYYA 4Z92B 2YU1A 4AXOA 3POJA 1ZBE1 3PIGA 3D0JA 1X7NA 3ZXDA 1PIV2 1RHI2 2VZUA 4XJ9A 3MW4A 1OBNA 3Q8EA 3MPBA 5GKAC 2GH8A 2HWF1 3WUCA 1IHMA 1H9PA 2QVSB 1LEDA 2ZEXA 3Q8CA 4XCBA 2AZ5A 3WCRA 3RZKA 1O4ZA 1RGSA 4XFFA 1D7PM 5LK5A 1N3PA 2QQLA 3RFRA 2ZMLA 2WFF2 4K8FA 4NAOA 1WMEA 3W9AA 2EXKA 1GNYA 5JSOA 5C3SA 3MIBA 3CZUA 2LALA 1AX0A 1HJFA 2XXZA 3JD73 5J98B 5CEHA 2AACA 1QWRA 4XQ4A 4RSUA 1BEV2 1W99A 4G3YC 4QDSA 3ST7A 3RMYA 1KJRA 5H9SA 5FY7A 4IEXA 1IS3A 4O65A 1QOSA 4W65A 4AI1A 4A7ZA 1RUC2 3NV4A 1OFNA 4UFMA 3ZKUA 5BV6A 1AR62 4XUQA 5JVVA 1XRUA 1VB4A 1UYXA 3OBRA 3BKZA 2FBEA 3AMQA 4MX3A 2A3YA 2B9UA 1TMF3 2R0FA 1OLRA 1XNKA 4K21A 4QPGB 5FXVA 3VL8A 5CFDC 3OD0A 3HVDA 4Q1RA 4E27A 1HXS3 1RUH3 3PVOA 4JZRA 1Y9GA 2I45A 5HV0A 1H2LA 5LY1A 2W94A 1UU5A 1C8M3 2IVIB 3J7NA 1SMVA 2JE9A 3A23A 1R1A1 1UYPA 3KQ4B 5FYHA 3DKWA 4LNVA 1WGPA 3USSA 4GJZA 4Q4W1 1DQ0A 1UX6A 1QJU1 1Y3TA 2RS51 2ZGNA 4ISQA 3RZJA 4MGYE 5I0SA 3I49A 1KEXA 5DUVA 1RUI2 5FO8B 4C0HA 4HMZA 1H8TC 1W6QB 2VU9A 4FXKB 1G8WA 2Y64A 2VMIA 4NO4A 4B7KA 1DGRN 2W91A 3ZXEA 4JX0A 3KV6A 1UQXA 3N36A 3BYWA 1C4RA 1LOFC 2E26A 4RR3A 4XILA 3OGGA 1LGBA 5FP9A 1BVP1 1UMHA 2WNVC 4OULA 3VDDA 3UYJA 1TME1 2UWBA 2OX0A 1KJLA 4IEVA 3O14A 2HYKA 5DZFA 2KR2A 3I2HA 1W90A 2VZSA 1JYWA 4NIIA 4CP9B 4DEQA 3W5MA 1S1AA 1AF9A 1VBC3 4MUVA 5HXMA 3OB8A 4MG2A 1WMXA 4XTPA 2XWBB 1ZBE2 2FDGA 2XJPA 3AL6A 3KT7A 1DZTA 3M3CA 1TVGA 5C8WA 4CU6A 1X8EA 2BV4A 4W6WA 2XMLA 3CNAA 5GJ6A 3L2YA 2HWF2 2CAUA 4RGAA 4PBPA 5JIAA 1O7FA 3B69A 1GZTA 3O12A 2IWGB 4OZOA 1NA1C 3BU0A 3JBG1 3IBMA 4XDPA 3IDCB 5F8PA 4XUOA 5BNPC 4Q4X3 2UWCA 4OUEA 4CEWB 1SPPA 3T30A 4GB31 5FREA 3ZN6B 1A8MA 2JDUA 4XJWA 5FYSA 1K45A 2JE8A 2WN3A 1NCQA 1RHI3 3ACHA 5L36A 3SEPA 1V6IA 5EJ1B 2BEOA 4A42A 5I8SA 3WP5A 4XPVA 3MIDA 2W46A 5I0RA 2WQ4A 5GLVA 3MF9A 5T5JA 4XUTA 1VMJA 4NHYA 5FUNA 3ZIWA 1ZYBA 4BOWA 3NNFA 5B2GB 4CCMA 3LWCA 1QU0A 2WFF3 1WMFA 2GN7A 1W6OB 2DU1A 4QX5A 5L19A 2V73A 5LCWL 3NNLA 1OHFA 4QX7A 1HB4A 4M01A 4PT6A 1BEV3 3I7DA 2WWSA 4KGQA 4QQHA 3WR0A 2PA7A 5IK4A 3J7LA 1RUC3 4COYA 1AR63 4YVSA 2Z69A 5JAXA 1R1A2 3B3QE 3DXTA 3UK9A 1LESA 1PGW1 1W9TA 1C3HA 2NM1A 3I8TA 4Q4W2 3U75A 4AI3A 1QJU2 2CSGA 5JUVA 1DG6A 2RS52 5FMCA 1G9FA 1US3A 4YZ3A 5F5IA 3VBUC 2XGXA 3ZSEA 3T2QA 1YCIA 1DQ1A 1FX5A 1V9U1 3BB6A 2EAKA 4GWMA 1CR7A 3VBRC 4URAA 2HWD1 5DDJ1 1CGPA 2FDIA 3BPSA 4V2WA 1SCRA 1KXGA 4MGSA 1OA4A 1PM4A 2WKKA 5JOXA 3FLPA 2OA2A 3UJQA 2VPVA 5LRRA 2VMDA 1RUI3 4QXHA 5DAVA 3SISA 5F1RA 1DLLA 1VJ2A 3L2HA 4XCAA 2L9LA 5FMDA 4LBQA 2VH9A 4LKDA 3R6SA 4FTEA 4Z8BA 2JG8A 2QJVA 4NN0A 3WT3A 4O9EA 4DUWA 1AR71 2GC1A 4H7MA 4MXWB 2ARXA 1FNZA 3CF6E 1NG0A 4SLIA 3MFCA 4FPCA 2RM21 2IXCA 5DG2A 3VBSC 4K8RB 3M1HA 4K3UA 3JBG2 1RC6A 1V6NA 3AFGA 4JQRA 2DFCA 3H9AA 1UZYA 2R0HA 5FZ3A 1LENA 1HQNA 3ZO0B 3OYWA 2VGDA 1ZBE3 3HAGA 3W58A 2D6OX 1UOGA 1HB3A 2I07B 4XC9A 2WIIB 5DQ0A 3LZZA 3V56A 4LE4A 3ZN5A 1PGL2 2HWF3 3S57A 4FPHA 4W6YA 4CCDA 3KVBA 4LK7A 2YROA 4CYDA 4DXTA 4XACA 2VVFA 4B3NA 2XR4A 4QGNA 4QXKA 3FL7A 3CJIA 4BXFA 4R9AA 3RQ0A 4CDXA 1IKQA 4LHLA 3ZXJA 2AENA 1GP5A 2ET1A 3KF5A 1CZTA 4YW4A 5FZOB 4JGZB 4P9WA 1L7QA 4IE7A 5FYMA 2OPKA 3MIHA 1ZZ9A 1SCSA 2P2KA 4CU8A 4QPIC 4QHBA 1VB2A 2JKBA 4LIUA 1DP0A 2IXHA 4ZU5A 5FYUA 3ZFFA 5BYNA 4EYUA 4IDZA 3TNQA 1YQ8A 2WZPP 2GC2A 1EPWA 4Q8LA 4GD4A 5ACA1 1POV1 3WF1A 5A32B 4IERA 4PCRA 2VAUA 3GHNA 5CA6A 1OH4A 1F35A 1PGW2 4H7LA 3SCFA 5JOWA 2YB7A 4DFSA 3ITQA 2ZZQA 3WNLA 4HVQA 5HXVA 4UWDA 3ZFEC 4ASMB 2Z4FA 1NT0A 4Y1VA 5FYCA 4N53B 4CEYA 1V9U2 2WA4A 4LO5B 1S0GA 5D2AA 4CUGA 2HWD2 1GANA 1JI6A 5DDJ2 1PM7A 1R1A3 1MR5A 3MV11 1HV1A 1W6MB 1ULCA 3DPRA 1QJU3 3LGRA 4XFCA 2RS53 5AC92 4A2UA 5ABJA 5D8AA 5HBAA 3FBMA 5F39A 1M4WA 1WKYA 1W6PA 3KGLA 2ZEZA 4XAAA 2O0OA 3U4XA 3FHIB 5FYYA 2R071 3O1RA 2K0GA 4AYUA 3VKMA 3AM2A 3PUAA 2YY1A 1FV2A 3H0OA 1V6MA 1AR72 3J7HA 5FZLA 3WV6A 2A6VA 1OKQA 2OZ6A 2N7GA 2PTMA 3I4IA 1YYNA 3MIGA 2IXJA 1H8VA 4YG6A 2BBVA 1V00A 2RM22 1GWLA 1RXFA 4R9BA 3WP6A 3HIFA 1HDKA 1YEWA 3DEMA 5A7NA 4AVTA 4CDWB 4K1ZA 4UXAA 1LCLA 2PLV2 1DDLA 2JICA 1WLWA 3WW2A 2GNTA 3N7JA 5A1LA 4OI2A 4CP2A 4B1MA 1H30A 5FY0A 2Y60A 1W8FA 2WLQA 3LF7A 2E63A 4FPYA 4Q4Y2 1X36A 3BTAA 1QF3A 3JBG3 1R081 1ULEA 4PF1A 3WVJA 1KDKA 1SLIA 4OHXA 4DMIA 3RZMA 4XXAA 2A70A 4P9JA 1S0EA 2GC3A 4YW6A 1UO9A 3ZXFA 1NQJA 1XXNA 2ATFA 4LIVA 5DAPA 4OMDA 5JMOA 4P14A 1T6GC 3IDBB 4LBQD 4WVZA 3VZOA 4WM8A 4LO8A 1YJLA 2XQRA 3I59A 3W20A 4E2QA 5FBZA 4OI1A 4IE4A 2QDNA 3RRDA 2BNMA 3H8OA 4JGYB 2YV8A 3C7HA 3HBKA 4GQ7A 4M3CE 4DY3A 4F83A 5ACA2 2C24A 1HIXA 1RYYA 2IXLA 2XHKA 3RS6A 3U37A 5FZ8A 3WNNA 4Q0VA 4A6OA 2WABA 1ZA4A 5FP8A 2RV9A 1U5XA 2B42B 2WNUA 5HCFA 3O1PA 3N3HA 2VO5A 1UY3A 3AB0A 3C7OA 5FY1A 2BQPA 3OPWA 3CHXA 1AYN1 2OS2A 2VMFA 4MGQA 5CBLA 5J7MA 1W28A 1F8VA 2ZACA 2UYBA 3N9OA 3PVBB 4PHZA 1JXNA 4KWLA 1OOPA 4GH4C 4HXCA 4MGZE 4EN9B 5DMYA 5DUXA 3S0MA 1GICA 4DXZA 4PI0A 3AVRA 1V9U3 3E5QA 5C8CC 2R072 5JXIA 1JUIA 4N7IA 3T1LA 3E6BA 2HWD3 2DF7A 5DDJ3 4AF9A 2B45X 3PDQA 2AUYA 4LORA 3J7MA 2VZPA 1LULA 1AJOA 1T6BX 1BCXA 5AC93 5E89A 4J1WA 3FJSA 4AQSA 5KXDA 3OBAA 1UL9A 1LHUA 4Y1XA 3P3NA 4W6XA 3HR9A 1WMDA 3M7AA 2WQZC 3PU3A 1GWKA 2P6CA 2X8KA 1EUUA 1AR73 1VBD3 1QGLA 3H1WA 5D1IA 3ON7A 4G9SB 5JWPA 4CTEA 2RM23 3VBHA 2PN5A 4WVMA 4M00A 5FMOS 1R082 1HRI1 5FPAA 5CFDB 1DBNA 4Y26A 5C5TA 3WQBA 2RG4A 1YWKA 3L9JT 5I8YA 3RWKX 2PLV3 4CDUA 1UZ0A 2R1DA 3KWVA 1J3QA 5IK8A 2E32A 3KQRA 3QH7A 4TTGA 1UPIA 4LBMA 4N8MA 2EIBA 1D0GA 2WAOA 4DY5A 4Q4Y3 1DF0A 2BOJA 2BWAA 2V5DA 1FAYA 1XB9A 3I2GA 5C71A 3F2ZA 5LB6A 1RUG2 1UOFA 2ZJCA 3CMGA 4IEOA 4LA2A 1X9PA 2Q1FA 1CAXB 3ZYBA 1F15A 5FZBA 4BE3A 4EN6B 3NWKA 4QB1A 2LROA 4JDOA 5A7OA 1A8DA 1H8TB 3V0AB 1VBB2 5CVRA 1QQP2 5IJRA 5IAXA 2ET7A 2WNVB 1ACCA 4I3PA 4I30A 1W6NA 3NO8A 4QDQA 1SBDA 1F31A 3MBWA 4OQ8A 4IGPA 2RR11 5ACA3 1POV3 5A1AA 2VQUA 1AYN2 3Q8FA 2DUPA 1O4YA 2HYXA 3UT0A
chains in the Genus database with same CATH topology
2EXJA 1VAVA 4GA9A 3WG3A 4LUMA 5FFOC 2C1FA 4BQ1A 3H7JA 2VXRA 4DNYA 5C9AA 3EHKA 3ZXAC 4AEDA 1NA1B 3A0KA 3RJRA 4E4ZA 5CB7A 2ES3A 5BNPB 1G9AA 2NYYA 2A6WA 3E6CC 2QUOA 4I0AA 1RINA 1S0DA 1MQTA 4IEWA 2DV9A 1BQPA 3MF6A 3PMEA 1DIWA 5GLUA 4YSFA 5JSPA 4MV2A 5EV7A 1PZ9A 3AKSA 4YFWA 2BNOA 4K6BA 3H50A 1N1YA 4LA3A 4N7UA 4OUMA 4NHKA 4FPKA 4MH0E 4XTMA 4FCAA 2HWB3 2DVAA 1LECA 1HQLA 1HRI2 4XHXA 2R49A 2R041 1ZZ7A 3H3ZA 4WM7C 3VBFA 4LR4A 2W08A 3HN1A 4Z82A 3VV1A 3DN7A 5GZGA 4JAAA 2Q4SA 3NAPC 2DCZA 3VZJA 2CNAA 1S55A 4FXGB 4Y4YA 4FTSA 3S7IA 2NMOA 4Y5Z0 1QJY1 4TYSA 3O7OA 2ZAAA 5EFUA 3VBUB 1RJ7A 4EWDA 2ZHKA 4UW4A 1F2NA 1RTVA 3VBRB 4URTA 1VBA1 4INDA 1RUG3 5K0UC 2D7FA 3H3UA 5L7OC 2RR12 3C3VA 3AZWA 3WP3A 3ECQA 3ZDSA 1WUVA 2WZR2 4HSJA 1VBB3 1QQP3 1H2KA 3AKTA 1SDWA 1Q8PA 3E5XA 1DGWX 4AFBA 1XNCA 3VBSB 1Q3EA 1CAWA 1A78A 1AYN3 2WT2A 2YYOA 3ROUA 5FLJA 5KXBA 1N3QA 1ND2A 4QM9A 4XQDA 3JB4C 3AXEA 4AW7A 3MW2A 5CIRA 2XJUA 3OGJA 4OI4A 4XOGA 4E4SA 5JZGC 2ZGMA 4X6RB 3KZ4C 3D82A 1WW7A 4YM1A 1PMIA 2FQPA 4MLOA 4XFHA 1VALA 3QOPA 3J9SA 3VKNA 3ALQA 3RPQA 1Q8VA 2JX9A 4XDQA 3TWIA 3AP5A 2VQAA 4IEZA 3FFQA 1DQ4A 1HRV1 4XJZA 1AYM1 1NE6A 4MVTA 3VZLA 3KCXA 3MFAA 4QPIB 1ULGA 3VBOC 4AHYA 4UW5A 3MIFA 1Q8SA 1VBE1 1ULDA 1DHKB 4Q0PA 2VMHA 1HRI3 1JHNA 3NKTA 5KHHA 1O3TA 4N43B 2PHFA 1OMIA 1S2BA 3GF6A 5GZDA 3ZFGA 1I1EA 1O4TA 3ZFEB 4R9CA 1BBT1 1B35A 1PVXA 1VAKA 4ITCA 5JMCA 4LHNA 4LO6B 1LHVA 2A75A 4JRLA 3ZFFC 4E2GA 1QXJA 1XQNA 3BIWE 4YGDA 3ZVXA 5FOJB 1EV11 3FMGA 4YGCA 4CDQA 2K2SA 1VBA2 2Y0IA 2XWJB 4UW3A 2E6VA 2R30A 2ZMNA 3ZSKA 2DCYA 2QCSB 3QBQA 4FO9A 4JRAA 5EXOA 2ZGLA 1MZ6A 1UKRA 4AI0A 4CEYC 2D5HA 4NHMA 2PHTA 2ZX1A 1WCSA 2TNFA 2EAAA 4C90A 3FUQA 2XJVA 3E97A 2WSVA 3ZYRA 2VY0A 1REEA 2RR13 4YFZA 2WZR3 5I91A 1FPN1 2MEV1 2BYVE 2SBAA 4DOUA 1RVF1 1WW5A 2Q0AA 2Z42A 4PBOA 3CL1A 3ME2A 2XPJA 1YIFA 2RS31 3QCWA 1MVQA 4LUKA 2QE3A 5FO7B 4KWJA 1LHOA 2CGOA 2XJRA 4AHZA 1U0AA 4YGEA 2DCKA 2E7AA 5FPZA 2CGPA 1MACA 4J1XA 3VLBB 1HRV2 1K5MC 1LTEA 1AYM2 3IDEA 4XFIA 1MS4A 2DUOA 4L8QA 1COV1 4GKYA 4M3CA 4XFGA 3C2UA 3K51A 5T5PA 2GNDA 2HWC1 2D97A 1OSGA 3NL1A 3H8UA 3MICA 1S2KA 3KD4A 2DVFA 1QXPA 2YGLA 1SLCA 3GALA 1JOJA 3D8CA 3IN9A 4OHWA 4OHYA 4HKWA 4RFT0 4LBJA 1RUJ1 4FOQA 4YVWC 4WM8C 1YFXA 2VW0A 1BBT2 1DGRA 4IEUA 4FP3A 1OI6A 2VW1A 4JV4A 1AL22 2D6LX 1IKPA 2BW8A 1EV12 4U36A 1ND3A 4XF0A 3KLSA 1V6OA 4MGKE 4NHLA 4GH4B 1G7YA 2PHWA 1CAVB 4XFBA 1Q8OA 1RUE3 2WNUC 1BJQA 2ZS6B 5C8CB 2YMZA 2C5DA 4BM8A 2XLGA 2ZHMA 4P9IA 3USUA 2BFUS 1GYKA 1V70A 1VBA3 3B93A 3NVCA 3OJBA 3DF0A 1AR91 2D6NA 2OZJA 2ZX2A 3B5LB 4IEYA 1W6QA 4GULA 2R16A 1AVBA 2W68A 4Z07A 1QY4A 1FPN2 2MEV2 4XJ8A 3ZYGA 4XBNA 1RUF1 1RVF2 1PK6A 4IETA 1YHFA 4LHKA 1GZWB 1QNWA 5GZFA 4ATFA 1HX6A 4YARA 5IK5A 2RS13 1IQAA 1Y43B 1YI7A 5KHIA 2WA3A 4XF9A 2O8QA 1AX1A 1YI9A 4FPOB 1LODA 1SBFA 3FUOA 4KH9A 1YFYA 1HLCA 4KG8A 1UIKA 3AP6A 2OIIA 1VP6A 1COV2 1POV0 3LA7A 3PVEA 2WJSA 4ES8A 2HWC2 1U5YA 3G6JB 3M2MA 4Y1YA 2CTVA 5IUQA 2DVDA 3CLPA 4DS0A 1HRV3 5DG1A 1NCRA 1AYM3 2Y38A 5AFEA 2UY8A 2HEVF 1RUJ2 5KC5A 3RZZA 2ZGPA 1IGOA 3KT1A 1EY2A 5IT6A 2B39A 1LOEA 4FTBA 3EO6A 1PIV3 3VHPA 3EJKA 3R4SA 4A3XA 4X6QB 2ZMKA 3V64A 3JQXA 1YUDA 4IESA 4OHZA 1VR3A 3RI9A 1RB8G 2A7AA 4HLTA 5SV5A 1BBT3 5BNNC 3AKRA 1AL23 2A5ZA 1EV13 2MPFA 2C9AA 2PHRA 3FX3A 3AYCA 4ORFA 1N47A 4YG0A 1AR92 4K40A 1LHWA 2CWSA 1JBCA 4Q4V1 4WZCA 5BNOC 5JLVA 2YUEA 2R6QA 2D40A 3KS7A 4JDMA 2XL9A 2PHXA 4IEQA 5C9AC 4AEDC 1RUF2 2FMYA 2VNRA 3MLJA 2IXKA 4N9IA 1MQTC 4AHWA 3OTFA 5CNAA 4HVOA 3VKOA 3POSA 1FPN3 1NLSA 2MEV3 3J26N 3M3EA 4WM7B 1CVNA 1RVF3 4RS5C 4C91A 1PGSA 4HKOA 5LEJA 3NAPB 1TME2 3M70A 5I93A 3OY8B 3WDVA 1YFUA 1GBGA 2VOXA 3CO2A 1CD3G 1KS4A 4AFMA 4EV0A 3FC0A 1UW8A 3S7EA 3T1MA 2R1BA 4WVVA 2WT1A 2PAMA 2K9ZA 4IV3A 4L9BA 4HSLA 3V0BA 4FP2A 4AWDA 4GWNA 2G9FA 1XU1A 4B8EA 1PO21 1KDMA 1COV3 2WLPA 5FCCA 1WA4A 1FYUA 3LKJA 5FO9B 2CYFA 4GB32 4IEPA 4YW1A 1LB2A 4COZA 4YG3A 5K0UB 4JVAA 4XEZA 1BYHA 2GN3A 5L7OB 1VLNA 3BU7A 1HQWA 1ZM1A 2X53S 3AXDA 1D4VB 4XBLA 1RUJ3 4YW3A 4Q0UA 2JXAA 2DFBA 5A32A 3FE5A 4AHXA 3EXUA 4Q27A 4CRQA 1MZ5A 3GHMA 3WW4A 2IZWA 3I54A 2GDFA 2UWAA 4L99A 1OA2A 5DZGA 1UAIA 2PHLA 2X5IC 4N53A 4KU7A 1DQ6A 3P3PA 2XG3A 4Q4V2 1WBFA 5JZGB 4IL7A 3KCYA 3ZSJA 5F5QA 3D0SA 4B4PA 1Y7BA 3ES1A 2B8MA 3JB8A 2EIGA 4XZPA 3RYRA 1AR93 1ND2C 2XJSA 4QQOA 2ZGSA 1AJKA 1PVC1 1RUOA 1ZZ6A 4DRVA 4HK8A 1J1LA 3AX4A 1SFNA 2ZGUA 3RNSA 5KXCA 3FBYA 4P9XA 1RUF3 1LJ7A 2LUWA 3VBOB 4K9SA 4Q4W3 2CY6A 2O1QA 3BALA 4YZ4A 4CDWA 1CJDA 4COUA 4LBLA 3FWEA 4GMP1 2ZGOA 4HT1T 1R091 1C5HA 1V6LA 4Q2FA 2XH6A 4D94A 1URXA 3VZKA 1TME3 4BWOA 1GZCA 1CAUB 1N3OA 3ZFFB 2YDEA 2WC2A 1ASJ1 1MS1A 4C0BA 4AVBA 1WW4A 1IS4A 2VG9A 4Y24A 2R32A 4P9LA 2ZA9A 3V65A 3ZFGC 1OQ1A 5C4WC 4PDWA 4CEYB 4LO4B 3RJ2X 4RQPC 4RL7A 5FPXA 5A3LA 4G4FA 4JGYA 2X29A 1ZZCA 4LLOA 4LO7A 2KA3A 2JG9C 4GB33 4CDQC 2BUKA 3IPVB 2OUHA 1D4M1 1J1TA 5FDBA 1PO11 3NKGA 1G86A 4FSJA 1UIJA 1O3QA 3TYJA 3GNEA 1JH5A 3N35A 3M3OA 3PTYA 2NQYA 3AP7A 3SH4A 1UN1A 1UPSA 3FLRA 1SQ4A 2PAEA 5A33A 1NQDA 1TNFA 4Q4V3 1K5MB 1PVC2 4FAHA 3SNMA 2DCJA 2ZX3A 3VZNA 2G9GA 2HJIA 1QJX1 3B94A 4AI2A 3A0NA 3NSTA 2Y0OA 4Y22B 2RJKA 3WW1A 2E53A 3TN91 1AXKA 4I02A 2PFWA 3LOBA 4H14A 3MGUA 4QQPA 2YXSA 3PMSA 4YVWB 4WM8B 3IMNA 1IOAA 2QDRA 3I59B 4IV1A 4D69A 5LK7B 1VAMA 2GC0A 1LGCA 1QDCA 1W0OA 1S0BA 1ASJ2 5FQ0A 4K1YA 4Q1PA 1C1LA 4AVVA 3KB5A 4B29A 2GSYA 3H1MA 1DZQA 2CAVA 2OW4A 5EJ3A 1MS8A 4QD2A 5GM0A 2WNUB 1MS9A 4Q29A 4AG4A 4FVVA 4R52A 3WP4A 3VGIA 3NV1A 4V1PA 4H3WA 2D43A 1SEFA 1H2NA 4ISRA 1JW6A 4BA6A 1ZRCA 1QHDA 3WD5A 1CAXA 1ND3C 3BCWA 4MSVA 4YLZA 4XXPA 1H8TA 4YM0A 4RHV1 2B7YA 2ZGKA 1D4M2 4QU2A 4RD7A 1OQDA 1RMU1 2W52A 1PO12 2WT0A 3JQWA 2HEYF 1I6XA 1NXMA 1ENRA 2WINB 3R4DB 1TE1B 1RUD1 3S30A 2WSUA 1J58A 4AFDA 3SLIA 1LEMA 1X82A 3D5OA 4BHPA 3J8F1 2QFEA 3LA3A 4QQ2A 4N9HA 2ILMA 2QZ2A 1NA1A 1YIPA 3QACA 1PK6C 1J3PA 3WINE 4AGVA 3O0VA 4DRRA 2VUJA 4M3CF 5E1RA 4YYOA 2D5FA 5FAXA 1GNZA 1YJKA 3M8LA 4WVMB 4FAGA 2VVEA 1I9RA 4UW6A 4L92A 4YM3A 4RR3C 3TN92 1PVC3 2C0ZA 3VDDC 2ZGTA 3POYA 3UL2A 1O5LA 4BH9A 4HN1A 1MS3A 4TZDA 5EYXA 4KWKA 1I5ZA 4R9DA 4AGRA 5I0UA 1ALYA 5JDBA 2ERFA 1VRH1 4FPEA 2PELA 1GNHA 2R073 4H55A 4GMP3 5K9YA 1NCRC 1RL3A 3LSEA 4Q0QA 5BNNB 1OFSA 1AXZA 1SLAA 4CP0A 1W6NB 3OCPA 3NV2A 1NCQC 1ASJ3 3VBUA 1BMV1 4LBKA 3ENRA 1CPNA 1YNAA 3AZZA 4RHV2 3VBRA 4ZU7A 4AVCA 1LU2A 4N90A 5BNOB 4AEMA 1RMU2 4AVAA 2XKOA 1F9KA 3UKVA 2WFPA 4HFSA 2P37A 2AYHA 4AEDB 1BK1A 1R083 4PIXA 2W39A 3B9IA 4R8HA 2XBO1 4KGGA 3T2TA 1RUD2 1MQTB 2IXIA 3WDWA 4IXLA 1D4M3 4YGBA 2QNKA 2EXIA 2Q8OA 1PO13 1PNGA 1YXWA 1LOAA 3J8F2 4YVSC 3VHRA 4RS5B 3VBSA 1U5IA 1XE8A 1EPZA 2DU0A 2QZ3A 2OYZA 4DINB 1ONAA 1B09A 3ZXGA 4PQ9A 4QQLA 3AZVA 3WHUA 1U5ZA 4S2DA 5E8AA 4XYXA 2Z79A 3R0RA 3KSCA 3HMYA 3THPA 2DVBA 1RJ8A 2P3IA 2VNOA 3PNAA 2AH2A 4YRDA 1Z7S1 3WDTA 1HXS1 5GZEA 4BYYA 3WDYA 2JG8C 3OBTA 4KU8A 1YO8A 4BZ4A 1C8M1 1ZX5A 4L11A 3TN93 2EVXA 4IV3C 1FV3A 1VRH2 3LOIA 1UF2C 3VZMA 1IS6A 4O9GA 2XJQA 1A3KA 3AJZA 2Y26A 1G9CA 4YNIA 3JZVA 5T3NA 3KGZA 3AYAA 1JTZX 3MLKA 3IIAA 4FPLA 3ZXLA 2BVBA 4FOYA 4N43A 1DGLA 3VKFC 5AFBA 4D3WA 1ENXA 4XHBA 1APNA 1BMV2 2ZPXA 2R042 1ZZ8A 4HZFA 2TUNA 1Q8QA 2X5IB 4FQ4A 1Q43A 5K7PA 1ZBA1 2GMPA 4C1WA 4BMBA 2UURA 3CJIC 3FLTA 2DWRA 4CDXC 4EN0A 2Z5WA 2OVUA 1QJY2 2QKDA 3AZXA 4XF4A 2CGNA 3W59A 1FMD1 2D6PA 4AGGA 2ZHNA 1ND2B 2XBO2 3WDXA 4Y20A 2QQPA 4RHV3 5J09A 1KD7A 4XW3A 1RMU3 2VMGA 3PHMA 3RG0A 5FOBB 3N7LA 1GR3A 4MZUA 3U10A 3SH5A 1U12A 4XF3A 5CFCA 1XYOA 4EJRA 2D6KA 4I09A 4GALA 4P9GA 2R061 1RUD3 1G6NA 3ZIXA 2NMNA 1X50A 1JYIA 3BODA 1QOTA 4WZFA 4HANA 1QNYA 4FT8A 3J8F3 3ZYIB 3VUOA 4DZGA 3WG1A 2GMEA 4LE3A 3R05A 3DPRC 2G4IA 2ZTNA 5ABJC 1QMJA 5D8AC 4QT6A 5J36A 4NWWA 1Z7S2 4YW5A 4OUSA 1LRHA 1NY71 5DUWA 3ZFGB 1WCKA 4SBVA 3TNPB 1XYNA 2GALA 2H6BA 5C4WB 2GAUA 5EWSA 3NV3A 4RQPB 1W0PA 3GZUC 3WCSA 4AEJA 1S0JA 4PJYA 1E57A 2JG9B 4KQ7A 3B00A 4CDQB 3ILFA 4QM8A 1LR5A 4D7SA 1VRH3 1G9DA 1C8NA 1DU3D 4PDWC 1SBEA 3IKWA 1RUI1 1ZBA2 4CZSA 3PLQA 1VBE2 1MS0A 3VKLA 1D2SA 3MYXA 1NOVA 2V5YA 3WG4A 1SLLA 1FMD2 2R043 1CN1A 5H9RA 5L73A 4HPKB 3PVNA 2DVGA 4B7EA 2JJ6A 2B5HA 4WV8A 2I74A 4QPGA 2YHJA 3WNXA 2RE9A 3ATGA 4TWTA 1QJY3 5IK7A 3AK0A 5K8SA 2XBO3 2R062 1QKQA 4FOWA 4RGGA 1XE7A 4AVSA 5T55A 3GBGA 3POWA 1GZWA 4LT5A 2WNEA 1DYPA 5JR7B 3LSDA 2JE7A 2UU8A 4M3CB 2VECA 1XNDA 2IC1A 3B7MA 1MVEA 1X8MA 2A3WA 3QH6A 3IT8A 1QH6A 1OOPC 1CJPA 4KBBA 1H1IA 2LM3A 2SLIA 2GU9A 1KQRA 3AMPA 2A6ZA 2H6CA 5GLZA 1IZ3A 1NY72 4XFAA 4YZ2A 1LGNA 2BGCA 3M3IA 4M0HA 4AQ6A 4IV1C 2RS32 5JIUA 4OVEA 1RITA 2HWE1 4NPRA 2E51A 1ZRDA 1Z7S3 4OI0A 3CU7A 1ND3B 2MHFA 4K20A 4C1XA 5KHGA 3OPZA 2Z2SB 4JTNA 4AI8A 2XL7A 1DFQA 1WW6A 1XNBA 1XU2A 3JUUA 4CEWA 3SHRA 2PQQA 2NPIA 3ZN6A 3ZX7A 4CP1A 3RMXA 3VBHC 1OLQA 1OPMA 1HV0A 2XJTA 1FOD1 3MPPG 3USUB 3KT4A 1UKGA 3MDPA 4OLLA 4F8AA 1H1AA 1G9BA 4CDUC 3SITA 1N1TA 1KFXL 4LBNA 1Z78A 1KITA 1W6OA 2DUQA 4B4RA 4XBQA 1J59A 3DL3A 3BOPA 1O3SA 4XETA 1PK6B 1ZBA3 1VBE3 3WQ0A 1OPOA 2EF6A 4I01A 4LULA 1AUYA 1J3RA 4GMP0 1FMD3 2XLAA 1LOBA 5E88A 4NWVA 3HD8B 3UKNA 2P17A 1L3JA 3H7YA 4RR3B 4K7JA 3WW3A 4QGMA 4M0NA 1BZWA 3ES4A 3VDDB 2XKPA 4L2NA 1Y9QA 3MEPA 5TSWA 5BNQA 5BUVA 4AFAA 2DTYA 3ETQA 4XQWA 4OHVA 3WQ7A 3ACLA 5JPNB 2VULA 4COWA 3EBRA 5SV8A 4IQPA 1PGL1 2R063 4WM7A 1S0CA 1KRIA 4XF1A 1GSLA 2JECA 5JPMB 3JCIA 1NCRB 3NAPA 5CADA 2PHUA 1GQHA 3OY8A 5T5OA 1QH7A 4TSVA 2CL2A 2F4PA 3FZ3A 1LHNA 2O8OA 2VUAA 2XUMA 1N1VA 1NCQB 2HWE2 2OUJA 2Q1ZB 2BVVA 4ZU4A 4F7ZA 3RWNA 4MXWA 1Q56A 4ES9A 3N7KA 2AR6A 4MYEA 5GLTA 4U2AA 1GKBA 2RS33 1YFWA 4ASLA 2A6XA 5K0UA 1O91A 3Q9OA 2ZKLA 5L7OA 3S6PA 1FOD2 1H9WA 2V09A 3GBWA 3VBFC 1UCXA 2GNBA 2W0XA 2TEPA 4YZ1A 4OZXA 5JCTA 4META 2ZKNA 4YVSB 1PZ8A 2KM2A 4WBBA 1TNRA 5AC91 2HWC3 3CJXA 2UYAA 4JGZA 4A7KA 2JENA 2NN8A 2JD4A 1FI2A 3ILRA 4Q26A 5JZGA 2VOKA 1Q5OA 1VBD1 4JC1A 4L97A 3ELNA 4LTAA 3HBZA 5DXDA 1AZDA 1H4HA 1H0BA 3SCHA 2PLV1 3E6DA 4LBQB 1F5JA 4FPFA 2JG8B 3I2DA 3HT1A 4X8PA 3KMHA 4J6GA 4IV3B 1W6MA 2GMMA 4Q4Y1 3V0BB 3VBOA 5JI9A 5F6KA 2VVDA 3DV8A 5J3UA 1V6JA 2VOVA 1FXZA 1O3RA 4XMIA 3OYWB 3URFA 2YPJA 3X29B 5F9TA 1CONA 2NLRA 3AMMA 3J4UH 1WLTA 1ZVFA 4UBGA 3SXWA 4D7TA 5CG8A 1EP0A 1CAUA 1WBLA 3MLLA 5BPXA 2D3RA 3MW3A 2ETEA 2RMU1 1JN2P 1SFYA 3CJIB 3G7DA 4CDXB 2HWE3 2VOWA 1ENSA 3WUDA 1EYBA 4N43C 4E4DX 2D3SA 5E16A 3WY6A 4Y1UA 2XVGA 5HCBA 2RHPA 4PLOA 1A6CA 3ZMOA 5FLHA 2BPA2 4FQZA 1PO22 3RSJA 5J96B 1MEC1 1LKNA 4A7YA 1HKDA 3IPVA 3WDUA 1S0FA 3ZXKA 3H1YA 1PHMA 1LU1A 1FOD3 1QOOA 5AVPA 5GZCA 2WS91 4AEKA 3INAA 4KG0A 5A3MA 4I0WB 1ZREA 4E2SA 1GV9A 2YC0A 3QD6A 5FMOL 1WD3A 1IPJA 2ZAHA 3B9CA 3BPZA 4HBNA 1B35C 5HCAA 5KHKA 2IFWA 3GZTB 4XIOA 1C28A 1VBD2 3D4KA 3LA2A 1EAH1 2H0BA 2HWB1 3IWZA 5CFCC 3DPRB 3PJQA 5ABJB 1FT9A 5D8AB 1ZRFA 4Y1ZA 4QGLA 2I2SA 4PIYA 1W6PB 1MZFA 3WX5A 3AP4A 1AXYA 3DGTA 4XE9A 1K5MA 1REDA 3ZN4A 4HL0A 2XVKA 3N7MA 3TBDA 4Y22A 2DURA 1UMZA 2P34A 1BXHA 2EA7A 1QJZA 3WLUA 2ZHLA 2PAKA 1NXD1 1C5IA 1NE4A 5GALA 1ZRRA 1FNYA 4YVWA 5FLIA 1DQ2A 4NVPA 4PDWB 4S2GA 3WOGA 1RUG1 4GIQA 2DTWA 1ZNPA 2LTNA 5DUUA 4BMEA 2RMU2 1JUHA 5JOZA 5KXEA 1PNFA 5LRSA 5C6CA 3D6EA 3AMHA 4HETA 4P5HA 5LEKA 2PYTA 4P9YA 1VBB1 2E7TA 1QQP1 4BCUA 1WCDJ 2ZCWA 2P3KA 1MZEA 3WXPA 1R092 2ZOEB 5KWRA 1DZRA 4LBOA 3M3QA 4S2HA 1WD4A 2RJLA 2E9QA 4ZXKA 5CFDA 4XJAA 2GZWA 3MIEA 1BVVA 1IPKA 2GNMA 1MEC2 4GXLA 5T52A 3CEWA 4HKLA 3AP9A 3UJOA 2VW2A 1ZZBA 5J48A 2WS92 5H9PA 4AQTA 5H9QA 4JTOA 2ZX4A 5A33B 3QLQA 2B46X 1OQEA 1REFA 3U0ZA 3WQ1A 4AFCA 4Q0SA 1PO23 3GBFA 4DQAA 4QPGC 5T50A 2BNNA 4F3JA 1EAH2 5I0TA 2ENRA 1MS5A 2GH2A 4ATEA 5HI0A 5I8TA 1YRZA 2HWB2 3JU9A 1ULFA 3KM5A 3NW4A 3V0AA 1OOPB 1UU4A 1PZ7A 1LOFA 3HQXA 4OFGA 2WNVA 2BTVC 1H1MA 1DYKA 2FZ1A 1OA3A 2FHRA 2E7QA 3AFKA 3O0WA 3RYKA 2EALA 4IV1B 4DB5A 1CPMA 2EXHA 2VNGA 4BLIA 2XLFA 2ZX0A 3TB0A 4DPNA 2XB6C 4QMAA 4NR1A 1V6KA 2HKXA 3OF1A 4MGIE 5FQ0B 4X8NA 3ZYJB 3N4MA 4I3GA 3VHNA 1QXRA 3AKPA 5BNPA 2JDZA 3RI8A 1NLRA 1GFF2 3O5SA 1AL0G 3VBHB 3KCCA 1QJX2 1IS5A 2FMDA 3VN4A 3AMNA 5KHJA 1M06G 1AR81 3SCGA 2ZZJA 4JDNA 5KC6A 2JEMA 4CDUB 1XYPA 1D0HA 1CX4A 3NJZA 2AGSA 2CV6A 3AYEA 3ILNA 4Z1VA 1SLTA 1HW5A 4CEWC 5BNNA 4RA0A 1GQGA 1UZZA 4XIKA 3MZHA 2RMU3 2TBVA 4LLFA 3VHOA 1H4GA 3PJYA 2MNGA 5BNOA 4PLMA 1R093 2D98A 4FBFA 2ZGRA 3U11A 5F6LB 2ZBJA 2KXLA 2Q5TA 2P3JA 1MEC3 2DCTA 4JCKA 5C33A 3DUIA 2HEWF 4PIZA 1X33A 2WS93 1FATA 4EROA 2PHDA 1AHSA 1I3HA 4RS5A 4BPZA 1OD5A 5C9AB 1AX2A 5AVAA 2UY9A 1EAH3 4R4ZA 1RIRA 3FFZA 1Z0HA 3AKQA 3GYDA 5JSRA 1KS5A 4E9KA 1W2UA 5DZEA 3LB9A 1ENQA 4XJUA 1D2QA 5CAZA 2YGMA 1TEIA 1W39A 3JD71 3M4FA 2ZGQA 1CESA 3AZYA 4PF5A 5J37A 4BLJA 2FZ2A 3ZSMA 5CG9A 4COVA 5EZWA 1AR82 4TLFA 1S0IA 2H0VA 1RUE1 3VBFB 3BOWA 3MI8A 3RDIA 3GZAA 1TMF1 1C57A 1QJX3 3WG2A 5KBFA 1RUH1 1SACA 1BKZA 3LAGA 4NOTA 5FTTC 3TOJA 3WZ1A 5CU1A 4I0BA 4AQ2A 2F6BA 2D6MA 2X5IA 3VL9A 4QPIA 1LOGA 1NYWA 3ZYPA 1CQ9A 2VQ0A 1H2MA 4LEJA 4YZ5A 2Q30A 3LCPA 4FPJA 2NZ9A 2ARBA 5FRAA 1UU6A 5BXXA 3SMHA 1R1ZA 3A4UA 3THTA 4ONUA 2RS11 1GZ9A 4UBHA 1DQ5A 4KL1A 4FOVA 1DGWA 1O5UA 2D93A 4JGZC 3ZFEA 3TRSB 2XVLA 3O0XA 4BIFA 1RUNA 1C1FA 5JOYA 2CWMA 1VBC1 4GKXA 4AE2A 1YLLA 3U07A 4YM2A 2ZABA 1CAWB 2DYCA 5BY5A 5JI7A 4I2OA 2IFRA 4N53C 4HN0A 4MXVA 1NZCA 4PLNA 4Q4X1 2A73B 1SLBA 4B4QA 4R4XA 1PIV1 1RHI1 3JD72 4D7YA 2NP0A 3ASIA 3E5UA 1GLHA 5GLWA 4EWAA 2BFUL 3HT2A 3UV9A 4KNCA 1O4YA 2D44A 4HVRA 4XMAA 1WLCA 2WFF1 5C4WA 1RUE2 4RQPA 4Q8KA 1AL21 1VIWB 1F5FA 2JG9A 4EN8B 1BEV1 1TMF2 1LOCA 3EQEA 2AREA 4CDWC 1KFUL 1N1SA 2A6YA 1HXS2 1AR83 1RUH2 3HWJA 4EN7B 1RUC1 1C8M2 3B02A 1AR61 4Y20B 3AJYA 2A3XA 4BIOA 3UKTA 3R4UA 1B35B 3APBA 4QPYA 3OD4A 1JYCA 3K48A 4Z2WA 4EWEA 1UD1A 5CFCB 2RS12 3SH3A 4ZKTB 4HPKA 3ZPYA 2A71A 4S2FA 4FPGA 3WHTA 1TQ5A 5T5LA 2BWCA 4JGYC 3IM0A 3RYPA 1VBC2 2D3PA 5T54A 4AK3A 1WLDA 4GH4A 4WVWA 2YZ4A 3B01A 1CAVA 1CIWA 3AYDA 5C8CA 4HK9A 3ZMNA 2WL1A 1QDOA 2Q1MA 3TAYA 4Q4X2 4YW2A 5EYYA 4Z92B 4AXOA 1ZBE1 3D0JA 1X7NA 3ZXDA 1PIV2 1RHI2 4XJ9A 3MW4A 3MPBA 5GKAC 2GH8A 2HWF1 3WUCA 1IHMA 1H9PA 2QVSB 1LEDA 3WCRA 2AZ5A 1O4ZA 1RGSA 4XFFA 5LK5A 1N3PA 2ZMLA 2WFF2 4K8FA 1WMEA 3W9AA 2EXKA