2G9FA

Crystal structure of intein-tagged mouse pngase c-terminal domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
180
structure length
180
Chain Sequence
b'ERKEILFIPSENEKISKQFHLRYDIVRDRYIRVSDNNTNISGWENGVWKMESIFRKVEKDWNMVYLARKEGSSFAYISWKFECGSAGLKVDTVSIRTSSQSFESGSVRWKLRSETAQVNLLGDKNLRSYNDFSGATEVTLEAELSRGDGDVAWQHTQLFRQSLNDSGENGLEIIITFNDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords peptide N-glycanase
publication title Structural and biochemical studies of the C-terminal domain of mouse peptide-N-glycanase identify it as a mannose-binding module.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 49
structure length 180
sequence length 180
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04721 PAW PNGase C-terminal domain, mannose-binding module PAW
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1020 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2g9fA00
2G9FA 2G9GA 2I74A
chains in the Genus database with same CATH superfamily
3G6JB 3WX5A 4HFSA 4L11A 4XFBA 5AVPA 5DAPA 3WNLA 3T2OA 1IG3A 4WVMB 3ZYHA 2GMMA 1GANA 3JUUA 4IEZA 1FT9A 3K4ZA 2CDOA 3MDPA 4LIVA 4XDPA 4AVCA 4NHXA 1Y9GA 2XBO3 4HONA 2AZ5A 2YYOA 1HB3A 3O1PA 3MUZ1 4FXGB 2HWF3 4L97A 4R4ZA 4CDWA 4K21A 2OQ6A 4L8QA 3BTXA 1OC1A 2NPIA 4Z2WA 5LCWL 2VW0A 1W3VA 5CAZA 4X6QB 4RQPA 4RS5B 4AQTA 5C4WA 1AF9A 1OVSA 1PNFA 1H8TB 5I0SA 1APNA 3PURA 2D93A 2WFF2 3ZFFA 1A34A 1BVVA 1MZEA 2XJVA 5IVCA 4FPYA 1YFYA 1REDA 1LOEA 3HBZA 2E31A 4Q4V1 1RB8G 5FPLA 3ZFGB 3DV8A 2VOXA 4P08A 2WZR1 4QDSA 3U78A 3ZKYA 5IVVA 5JSOA 4Q0PA 5FZCA 1TME2 5IK5A 3N9QA 4CCKA 3NAPB 1IG0A 2EALA 1PIV3 2CNAA 1JYCA 1UYZA 1O4ZA 1WUVA 4BM8A 5KWRA 2YU2A 3MV01 3HD8B 1C8M3 2DCKA 3J7HA 1NYWA 4H3WA 5FP9A 3WDYA 4QDQA 1DQ1A 1W99A 5C9AA 4CEYC 2J1VA 3DEMA 3BVCA 2WN2A 3N3HA 4XZUG 4GA9A 4Y5TA 4CP2A 3C3VA 5A7SA 2AENA 2OZ6A 5CFDC 4UW5A 5CIRA 4FFHA 1AYN1 2PAEA 5CU1A 1K42A 1GLHA 2E33A 2ZMKA 4DQAA 1J58A 2J1SA 2OPKA 2WZEA 2SLIA 1GKBA 4OUSA 3ZYPA 3E6CC 1KEXA 2RM22 1OFNA 5FXXA 5JDBA 2IFWA 3OPWA 1ENRA 4L2NA 3U37A 4ASLA 4AHXA 5LEJA 1ZA7A 4N8MA 1FNYA 4LKDA 2QUOA 1GICA 2VR4A 1ZRRA 4WVVA 2QDRA 5C8CC 3ACHA 4OI4A 5DAQA 2JDMA 4CSWA 2FBEA 3VHOA 1JYXA 5FFOC 1HRV3 2MEV1 4XAAA 2R043 5FJKA 3DN7A 4YG6A 3LOIA 1C5IA 2ZGRA 3HMYA 5FLHA 1AR81 5EV7A 4P02B 5EXOA 5C5TA 2JDKA 1ZBE1 2BGPA 4XOGA 4AFMA 3I2OA 5JMCA 3TNQA 4GD4A 4FOQA 1NLQA 5ANNA 4IXLA 2XB6C 3AXEA 3WNOA 4AZZA 4OLLA 3MGUA 3IIAA 1I6XA 3QH7A 4KWKA 1RUE3 4Q0QA 5CZKA 5JI7A 1E5SA 4QKNA 5I0UA 3PVNA 3PUIA 4NE9A 5KHHA 2GP5A 5ANQA 1GQPA 1G8WA 1ZRFA 1ONAA 1PO22 3ZYIB 1MVEA 2ZCWA 3T08A 4COVA 3POGA 5HBAA 1PVC1 4B8EA 2ENRA 1DGRA 4BIFA 4XQDA 3LFIA 3WF4A 4CEYB 1XE0A 3O1MA 2XVGA 3WY6A 5CFDB 2VMFA 2JECA 3THTA 1WBLA 1AL22 2BNNA 2HWD2 3H8UA 1MQTA 2YBKA 3O0XA 4OQ9A 1HB1A 4QU2A 4IEVA 4F7ZA 2LTNA 3VHRA 2UURA 2P1BA 2L9LA 1D0GA 3POYA 2I2SA 2LM3A 2VZSA 2VZTA 4JV4A 3T0AA 3BU0A 4AHWA 5F2SA 1DZTA 4AEMA 1XSRA 2GNDA 2DFBA 2ES3A 3PUHA 4W50A 3ZSMA 1LJ7A 1QF3A 1WCQA 5C8CB 1BXHA 5JPMB 1CZSA 1O3RA 4KL1A 4MGIE 3LPGA 5AC93 4MHUA 1E5HA 3JD72 4QPGA 1C57A 3GBFA 2HBUA 3MO4A 3ZSEA 2VBBA 4P9WA 5FYMA 3C7EA 1LHUA 3N9NA 4OHWA 3JB8A 3CHXA 5FZOA 3UK9A 3VHNA 5K7PA 1PGSA 2BERA 2E26A 3KQRA 1YFUA 2PELA 1YQCA 3P3NA 3ZKUA 1DIWA 4ZKTB 2AC1A 2MPFA 2XL7A 2XUEA 4LA2A 4YZ1A 2ZGOA 4HKOA 1QJX2 1WLDA 2WRAA 3KV6A 1D4M1 5LA9A 4COZA 4DFSA 5CFCA 5JXGA 2RS32 3V65A 3AP5A 4QGLA 1PMIA 1G6NA 3AVRA 3M3OA 3OY8B 2W92A 2X05A 3TBDA 1XPWA 3SISA 3SH5A 3ZYBA 1DQ6A 1VBB3 2VGDA 1QU0A 3ZXDA 3D5OA 4LO4B 3MBWA 5IHRA 2RR13 4OHVA 4XE9A 1ULFA 3GF6A 3O7OA 4GWIA 1OQDA 5A7NA 4CCEA 2Y6LA 3MIBA 3T30A 1CR7A 3NJXA 3FWEA 3MICA 3U1XA 4XQWA 1LEDA 3OGRA 4K20A 3VBRA 4MGSA 1AYM2 1WLTA 1CIYA 1QY4A 1RJ8A 2CGOA 4R9BA 4DB5A 1R1A3 1B35A 5F2WA 3C2UA 2VL4A 1S0GA 3P6BA 3PVOA 1H6YA 1OOPA 2QZ2A 5HXVA 3TB0A 2WL1A 4DUWA 1LCLA 1W9FA 2CGNA 1XU2A 2LUWA 2Q1MA 2HEVF 2R49A 3I3QA 1HV0A 3I59A 1TMF2 3R4UA 4QB1A 3EQEA 4ITCA 4BLJA 4XDOA 1XNKA 4C1XA 1O3SA 1OF3A 4P9JA 5J37A 3WW2A 2QQOA 4YYOA 4CDUC 5IT6A 1H1AA 2D40A 1MS8A 1WZXA 5HCHA 4EN9B 2HYXA 5FLJA 1EV12 4AAXA 2A5ZA 3J8F1 2WZ8A 4YW3A 4QHZA 4OZXA 1SCRA 4HXCA 5EJZB 4R4XA 2JIGA 3ME2A 1WMEA 4IW3A 3WF3A 2XKOA 4QX2A 4QQLA 3IB3A 2X10A 3PHMA 4J25A 4RFRB 1LOGA 2D3RA 1BBT1 4N90A 1W8HA 5BNPA 1FNZA 5C71A 2VZPA 3BCWA 2QVSB 4QX7A 4FAHA 2BZDA 5JXJA 1ACCA 4H7MA 3LQCA 1UZVA 2PHDA 4MV2A 1RYYA 4Y22A 2XMLA 5FRAA 3WQBA 3AK0A 4AOCA 1WA6X 4K8RB 5F5QA 1JZ5A 1V6KA 2D5FA 4CCJA 2Y6JA 2CWSA 4I30A 1QXPA 2RS11 3CBNA 1OQ1A 2JDUA 2P3IA 2VCBA 3E5QA 4LEJA 4ZPIA 2W47A 2OS2A 4XF4A 1RUF2 5DG2A 3W59A 3WW1A 4EROA 5IAXA 1GZ9A 3TEYA 2HWB3 2Z42A 1SFNA 2ILMA 3PLQA 5T5OA 2RS53 4FOYA 1W0NA 4UOJA 2GMEA 2WC2A 4IV3C 1S0FA 3T4HB 4RD7A 3OBZA 3L2HA 2BNMA 2YDEA 1V6JA 3K3NA 5K0UC 2B5HA 2OT7A 1YLLA 3JQWA 4O9GA 1RUI2 2NZ9A 5FAXA 4DO0A 1CX1A 2QBXA 4HVOA 4J1XA 3HJRA 4NHMA 4Y5Z0 5DXDA 1BMV2 4Y5SA 3DUIA 4MGZE 3N7LA 1CAVA 1JUIA 1WLCA 3C7HA 1XBFA 3BGAA 3WSOA 3O1UA 4LBQB 4NHKA 4HSJA 1HXS1 4QX3A 2HWE2 5L7OA 4CDUB 1O8SA 4BIOA 3HN1A 2VZ3A 4XF1A 4MLOA 1NLSA 2CTVA 1FPN3 2OA2A 1OA2A 3IDEA 4XHBA 1PZ9A 5LBBA 4RR3C 4KNCA 2BBAA 1J3RA 1GWMA 4XFAA 2DBNA 2YXSA 1RXGA 1QNWA 2IWGB 2YB7A 3GDBA 3LZZA 5F6LB 5J09A 2VZRA 2VM9A 1GWKA 2WT2A 5C3OA 2XGXA 5IK4A 1RMU3 1NQDA 5A7WA 1QJU1 3NWKA 1JW6A 4JCKA 1BKZA 1W0OA 4I3PA 1SLBA 2WINB 2WFPA 4JC1A 3ILFA 2NMOA 3AYEA 4LO5B 4JDOA 3LB9A 1OXCA 3H8RA 3JU9A 4ES9A 2QQWA 4FP3A 5F3EA 3DCQA 1T2XA 3CO2A 5GZDA 2ZKNA 3SCHA 1W2AX 1E5IA 2VC9A 4CP1A 3SCGA 2JIJA 4CUAA 2HBTA 4CPBA 2VH9A 3KV5A 2YPJA 4IV3B 1ULEA 3V0AB 4JDNA 3ZN6A 1OVPA 1A8DA 5FP8A 2TNFA 1XB9A 4UBGA 1RUC2 3M2MA 3WUDA 1GBGA 2ZGKA 1G86A 3WG4A 1ODNA 2FDIA 4X8PA 1NZCA 4M00A 4GB33 2AR6A 3IT8A 3KF3A 3BB6A 4ATEA 2R0HA 1TNFA 1VBC2 2J42A 4HG6B 1UYYA 1PMJX 3I54A 1JYVA 2W08A 1LECA 4HVRA 4HANA 5FYTA 2W95A 2G4IA 5AFBA 3RZJA 2MNGA 2YV8A 4LHKA 1VBE2 3LFMA 4IETA 1AR91 2RJLA 1MEC1 5JZGB 4XF0A 4IUGA 2WA4A 4Y4RA 5FPZA 1Q56A 2RV9A 3MEPA 4RR3B 3ECQA 4L92A 4DXRA 5FZ1A 2Q1FA 1TE1B 5DAXA 4MYEA 4GWMA 5EWSA 4F83A 3WHUA 3GHNA 4B4PA 3EHKA 2OYZA 5HI0A 5BNNC 1POQA 1W6NA 1MZ6A 3EJKA 4KGQA 3WNNA 4IL7A 2H6BA 3LGRA 1QHDA 4R9DA 3FE5A 3UGFA 3R05A 3ACGA 4JVAA 4AI9A 2ZZQA 1UPIA 3QLQA 4ZZ8A 1COV2 2VVDA 5FDBA 3ZIXA 5IATA 2BGCA 4UW6A 3MI8A 4IERA 4GMP0 4Z2AA 3DGTA 4R9CA 4GH4A 4QPIC 4XILA 4AFBA 1W0PA 3I2HA 4P9LA 3T09A 2FDFA 2TBVA 4URTA 5FMBA 2XJSA 4NPLA 4HBNA 4LPLA 2XHKA 1WBFA 4BJ0A 2ZEWA 4NIGA 1QJY2 4M3CF 1W6PA 1SBDA 4EZHA 1OFSA 3BYWA 2C5DA 3KV4A 4Q4X2 4YSFA 1MACA 4Q4V3 3K3OA 1Z7S2 3QBQA 4OYUA 3MF6A 2WZR3 1ZRCA 3KLSA 2LROA 3OBAA 2PMWB 2ZGLA 1BK1A 1F31A 2NQYA 4N43A 4OVEA 1WA4A 4TN7A 5FZLA 1XC6A 4DY3A 3D82A 1IPSA 1CZVA 2C26A 1Z78A 5T54A 2GC2A 3FJSA 3ZFEC 3WNMA 4EV0A 3V64A 4PDWC 2DVGA 3OD4A 2ZEXA 5GALA 5LWBA 4XTMA 2ET1A 3MLJA 4HMZA 2R062 3WQ7A 4D7TA 1CZTA 1F5FA 3M3CA 5JOZA 1AYN3 5GLZA 2XH6A 3S30A 1O6UA 2B42B 2UYBA 3KHBA 5BNNB 3MYXA 2RG4A 4NOTA 1A8MA 5L9RA 3ZM8A 4ASKA 4ET7A 4OULA 2K9ZA 2WIIB 1KITA 3QD6A 2D5HA 2WS93 2CV6A 4K40A 1S55A 2J1UA 2VQ0A 2GP3A 1OQEA 3FUQA 4W6YA 2MEV3 4GMP1 5FYYA 4KQ7A 2VCAA 1VAVA 1GV9A 3HR9A 5ERLA 1DGWA 1ZBE3 4LTAA 3CL1A 4UF0B 2QQVA 1TME1 4HKWA 2DV9A 4AF9A 2Q30A 1KS5A 1W06A 3KHCA 2ZKLA 1TZOA 3KQ4B 3HEIA 3POJA 3NNMA 2FHRA 3ZXFA 3T2QA 3WCSA 3USUB 1UO9A 5I8YA 4C1WA 4S2DA 3TEZA 4KWLA 1JU4A 3OPZA 5I93A 2D43A 3W5MA 1KD7A 3DPRB 2OW4A 3RQ0A 1ASJ1 4NHYA 5IFTA 4R9AA 4OFGA 4XZPA 3RVHA 4PBOA 4WM8A 3SMHA 3ZFEB 1PMHX 1W9WA 3ZMNA 4PDWB 1PVC3 4AEJA 2GNMA 3CIHA 4JKMA 1W6MB 4CA9A 4Q1RA 2A7AA 2VO5A 4AGGA 1DQ2A 3VZMA 4MG2A 1C4RA 2XONA 5FZ3A 5IW0A 2AEYA 1RUD2 1WMFA 2C1FA 1FOD1 4YVWC 3WQ0A 1HN0A 1V9U1 4LOTA 2ZX3A 4QX1A 5J96B 2H0VA 4L9BA 2JD4A 5LY1A 4LO6B 3FUOA 1TVGA 2JDYA 1I1EA 2Z2SB 2ZEZA 5GLTA 2BTVC 2D6LX 1L7QA 1OKOA 2P2KA 2QQJA 1J3PA 3HT2A 3L2YA 4CCNA 1G9CA 1G9BA 1W2TA 3IM0A 2PFWA 1HQLA 3GZTB 4IV1C 4BYYA 3VDDC 4B1LA 1TEIA 4XPVA 5IUQA 3FHIB 4AVTA 4DRRA 2R0FA 4BK5A 3VUOA 2FCVA 3AMNA 2XLAA 4Q0UA 3LEKA 4CDQC 2DWRA 4J6GA 1NY72 1X33A 3B7MA 2YU1A 3NV1A 4JGZC 3AZWA 1TNRA 4EZ4A 3ZXJA 4FPOB 4YRDA 4Y20B 1OPOA 1QIQA 2JE9A 1UZZA 2EICA 2JEMA 3WF1A 2VU9A 4LBLA 5F3CA 5KXDA 5LATA 2JG9C 1D4M3 5K4LA 4JGYA 2XVLA 3FZ3A 1F8VA 4DY5A 4EQVA 4CCDA 1NE4A 2HWD1 4XIKA 4B4RA 2FD8A 1O91A 4XFGA 4DXTA 1ND3A 3JBG2 1RHI1 4P5HA 3BPZA 5BNOC 2B7YA 1W6OA 3B93A 4FPLA 2A1XA 3E6BA 1Q8OA 1RUH1 1OSGA 2IXHA 4N9IA 4RL7A 3NKTA 5DZGA 2B45X 1CIWA 2WNVC 4A3XA 4YVWB 5A1LA 1QOOA 3WD5A 3POBA 1K5MA 5A33B 4D69A 4MUVA 2WWJA 2J1AA 2RJ2A 1RVF2 1N47A 1AX1A 1CPMA 2W9XA 3GBGA 2I74A 2HJIA 3I2FA 1UY2A 4JKLA 4O65A 3TN91 1H2NA 1SCSA 1FYUA 1OH4A 2H0BA 3KV9A 4XCAA 4E2GA 5DAWA 1I5PA 2KR2A 4IV1B 1SLAA 1ZVFA 2ERFA 3VDDB 4DUVA 3O1RA 4YPJA 2XBO2 4OI1A 3WR0A 3WOGA 3CKHA 2HWF2 2R1DA 4Q5OA 1ZBA3 2ZS6B 4MX3A 4CDQB 4BZ4A 4JGZB 2RS31 3ZYJB 3N7KA 2QCSB 1R64A 1YIFA 3N9PA 1GP5A 2HWC2 3J8F3 2VG9A 5FO7B 4A7KA 2VVFA 3IMNA 3VKOA 1W8FA 3VN4A 3UNPA 1R083 1DYPA 2EIDA 3VBFB 4BA6A 2JG9B 3SITA 1H2KA 4YZ3A 2H6CA 3SLIA 1BBT3 2V4AA 4D6QA 3I2DA 4Y3OA 4YW2A 1H1MA 4BMEA 1X9PA 2NN8A 1ZM1A 5F39A 3T1LA 1GWLA 3LDBA 3ZR6A 3M8LA 4A7ZA 3FN9A 5BNOB 2GN3A 3AP7A 4KGGA 5FPBA 1PIV2 2RS13 4BQWA 1ZZ7A 2ADEA 4LK7A 2VECA 3OYWB 1V6MA 2WNVB 1S1AA 2R30A 3OGVA 1C8M2 4FQZA 4QHBA 1UMZA 4JX0A 2VNOA 4NIAA 1TMF1 2Y60A 3GM8A 4YW6A 2P6HA 3RPQA 3VD5A 2QDNA 1ND2B 5FYZA 5GZFA 4FTSA 2Q8CA 2HKXA 3FX3A 3HOBA 4D6SA 1XYNA 1R1ZA 1TQ5A 2UYAA 1RL3A 1AXZA 4QX5A 5FQ0A 3MV11 5FBZA 3CMGA 5T5LA 2VZUA 1UXZA 5A6XA 4MZUA 1JYTA 5G04L 1EV11 1H0BA 1HXS3 1XE8A 4WVMA 4AHYA 3RDIA 1LOFA 1KJLA 1YI7A 4B29A 2XKPA 4GQ7A 4E27A 1FXZA 5EZWA 2D44A 1W8ZA 1MS5A 1BEV1 1QOSA 1VBA1 2NMNA 1HRV2 2ZHKA 1SPPB 3A0KA 3AKRA 4LBNA 1OD5A 2R042 3WT3A 3HNMA 1LULA 4CP9B 2FCUA 5B4NA 1V70A 3VB9A 4FSJA 1UY1A 1W9TA 4HSLA 1G9DA 4LR4A 4RS5A 3ETQA 4A6OA 2W94A 4BB3A 4CRQA 1R091 3NNGA 2GSYA 1CESA 1Q8VA 3AL5A 1H8TA 1SDWA 2BGOA 3ZDVA 1QJU3 3O1SA 1RUE2 3OGJA 3JXSA 4PBPA 1RUF1 3DL3A 5IFPA 2UU8A 3J7MA 3ZFFC 4FFIA 2D6NA 1QDCA 1YEWA 4ONUA 5FZKA 1DGWX 4XJUA 4Y1ZA 3ZFGA 3LEIA 3EB7A 1O8PA 5F37A 1YJLA 5JXHA 3NAPA 3POSA 2WWSA 4CPBD 1RUJ1 4FPKA 1WD4A 4I01A 1RUI1 4Q0VA 2ZTNA 5A6ZA 3DYPA 5DN2A 3OG2A 2R1BA 1K45A 1PM4A 4PCRA 1ZA4A 3AMPA 3A21A 1VBD1 4QQOA 1M4WA 3UJQA 1EPWA 2VZQA 3H9AA 4PIZA 4UBHA 5F32A 1P8JA 2VAUA 2IZWA 3HT1A 4AGRA 5C8WA 3VL8A 4P00B 1GZWB 1LB2A 3D6EA 1LGBA 1O3QA 5FYHA 4H14A 2ZHMA 4LBKA 2XDVA 2PHWA 1AR93 1MEC3 1V6NA 4NPMA 2C4XA 4F3JA 3K4DA 5EYYA 4OZOA 4XIOA 3AMHA 5EFUA 3KSCA 4MSVA 4HVQA 3ASIA 5AC92 1HLCA 3H3LA 5DZEA 2B9VA 2QFEA 2YC0A 2IC1A 4KBBA 5L9BA 1ZZCA 2ET7A 1D7PM 3D4KA 2O8QA 3POFA 1L7LA 3AZZA 4AFCA 5A3WA 5A3UA 2WYFA 5CADA 1U5IA 1VJ2A 2BU9A 2X53S 3FLRA 1BJQA 4CUGA 3HNYM 4QDRA 1OURA 2PHUA 2ARXA 3M3EA 4K1ZA 3UT0A 4AI0A 3B02A 5BNQA 2YPDA 4E4SA 4YZ2A 2B46X 2YGMA 1VRBA 3PTYA 1ULGA 1BCXA 1XXNA 1VBB2 2G1MA 5GJ6A 3ES4A 2WAAA 3KGZA 4NRPA 1BVP1 1H2LA 1WMDA 2DU0A 3VKFC 1N1YA 3WF2A 2XJUA 2RR12 5JWPA 3A0NA 3SC7X 1UKGA 2VUDA 3KS7A 5C3PA 4CEYA 2JKBA 5A1AA 3R4DB 5JMOA 5EJ3A 1LHOA 4HK8A 1WW6A 1X8MA 5CFDA 2PYTA 1DGRN 1R1A2 1VBE1 2X09A 1KXGA 2QQNA 3GZEA 4JZRA 5FO8B 3O1TA 5H9RA 4CDXC 2G9GA 3MFCA 2D6OX 1H9PA 1QH7A 3PUAA 3AP9A 4IEWA 5A3NA 3RYKA 2AREA 3RZGA 3UGGA 3HAGA 4HN1A 2WNUC 5BY5A 1XNCA 4YFWA 5C8CA 3V0BB 1D0HA 1H4HA 1POV0 3D0SA 2TUNA 4QQPA 3ZX7A 2PLV1 4FTEA 4GALA 2JDZA 2DCTA 1QQP2 2JKXA 4BQ1A 1NA1C 4LBMA 3WVJA 4QXKA 3M1HA 1C8NA 2NYYA 4YW4A 5IYYA 1XNAA 4XYXA 4XAEA 3WNKA 2HEWF 4NHLA 1SLIA 3U4SA 5EIYB 3AJYA 3GHMA 2ID4A 4XFIA 5EP9A 1F15A 3I3BA 3P5BA 5CNAA 4MH0E 2W1SA 2Y33A 4WM7C 4LK6A 4CCCA 1UQXA 3HQRA 4FPEA 4PIXA 4P9XA 1Y7BA 1GSLA 1NCQC 1ULPA 4Q4X1 3VKMA 4OI0A 3O1VA 3ACLA 3OY8A 3FLPA 5FCCA 1EAH3 1FMD1 4Q8KA 3S6PA 1Z7S1 4N53C 5FMCA 2RDSA 4CXXA 3URFA 2PHTA 2QQMA 3H50A 2XR4A 1GOHA 3B5LB 2VCCA 1PM7A 4KG0A 3RSJA 4M0HA 2HWB2 5F3GA 2QQIA 2EIEA 1MZ5A 1UX6A 3NJZA 1DDLA 1SMVA 1FV3A 2JG8C 1AL0G 2RS52 4TSVA 1UOGA 1SFYA 2C6SA 2ZHLA 4AFAA 1SBFA 4CDXB 4DPNA 4QXHA 1NAEA 2BW8A 3IDCB 4FPJA 2R061 2IVJA 2K0GA 4XABA 1GZCA 1B35C 3DXUA 2OKXA 1X8EA 3K77A 2EIGA 2ZMLA 1ASJ3 1H8VA 4Q4W3 5J98B 2WNUB 1OOPC 1VMFA 2LW8A 5FP4A 1EP0A 4XJ9A 5FYCA 4DXZA 3D0JA 2XOMA 5DPNA 2GALA 1X9TA 3BOPA 5FLIA 2ZGPA 4FVVA 3VL9A 4AQ6A 3KF5A 4ZU5A 1FOD3 1JXNA 1QJZA 3BOWA 1AUYA 1NA1B 2AACA 1V9U3 3AJZA 4LE4A 1FPN2 5B4XA 5LY2A 4A45A 5HCAA 1IKQA 4LLOA 2C9KA 2JDHA 1POV1 5BNPC 2JDAA 1UF2C 2SBAA 3RZLA 3SEPA 3WDTA 2BBVA 5JOWA 3RGBA 4E4DX 3OD0A 4WM7B 1UU5A 5ACA1 1RMU2 2ZHNA 4LNVA 5A3TA 1NCQB 1NUKA 4BXFA 5H9SA 4EWDA 5GZEA 4XUPA 3B94A 4BMBA 1UMIA 1LGCA 3N9OA 1JHNA 2Z4FA 1D2SA 1OI6A 4ISQA 3RZHA 3T2TA 3AKTA 4N53B 3HQUA 2J1RA 2FCTA 2X5IC 4O7XA 4BQYA 3MZHA 5T5JA 1PGL2 3W20A 5A3LA 1WLWA 5C3QA 5C70A 3AMMA 4ZHNA 3I7DA 1UX7A 3HNBM 3AZYA 4CEWC 3G7DA 2JG8B 4XFHA 1O5LA 2E32A 5EJ1B 3WF0A 4LULA 2JICA 4H2AA 4Y1UA 1NG0A 2GNTA 3SCFA 4YGCA 1US2A 2VD7A 1WWYA 3PU3A 3BODA 2XUMA 1AX0A 1DQ5A 4KI5M 1NCRC 2ZEYA 1PX4A 4GB32 2ZX4A 1LOBA 3GZAA 3VBUC 1JBCA 2P4EA 2WT0A 5JXIA 1RHI3 3VZKA 1BLZA 2LRPA 2YY1A 3FHAA 3NL1A 3RYRA 1O59A 1ZZ9A 2GNBA 1F5JA 1RUH3 4SLIA 4B4QA 5KHIA 1XNBA 3S5AA 2JDNA 3AP4A 2PTMA 4B1MA 4BXSV 1PK6C 5C7GA 4LBQA 4QXBA 3MHZA 3UESA 3ELNA 5T3NA 2WO3A 1UYXA 3JQXA 3WNXA 5DDJ1 5FZHA 2BRTA 2HLEA 3CLPA 4CDUA 2I07B 2XJQA 1WGPA 4FFFA 1O3TA 3H1MA 4IDZA 2VW2A 4WVZA 3MW4A 5FZ6A 3BN6A 3Q9OA 5LA0A 4MO3M 3AKPA 3TN93 4GWNA 4BQ5A 4EWAA 1VALA 2UWCA 5FZ8A 2RMU1 1ENXA 3GJAA 5KR7A 4E2SA 1DHKB 3PVEA 3PVBB 1GFF2 5D8AC 2BEOA 3U11A 3S5QA 4AI8A 3ZIWA 2VNVA 3QOPA 4Q8LA 4COYA 5IVJA 1RIRA 3T4VA 2B39A 1PVXA 5IK7A 2VMEA 4J1WA 3WP4A 1FATA 4HPKB 3B00A 1F35A 2X5IB 1NXMA 3OBRA 4QPYA 4QX0A 2WDBA 1Q8PA 5BYNA 2D6MA 2OPWA 3EO6A 4XW3A 5BPXA 5A70A 4CEWB 2JE8A 1JHJA 5L73A 1PNGA 4OHZA 3GGLA 2PN5A 3JBG1 3R6SA 1Y9MA 2W39A 4YW5A 1HW5A 1LENA 4JRLA 1PHMA 3AZXA 2AGSA 1O7FA 1UZ0A 3POIA 5LB6A 2BPA2 2C0ZA 3PMSA 2ZGSA 4IV3A 1NCRB 3UGHA 3V0AA 4AW7A 2KA3A 4Q4V2 3VKNA 1CAXB 3VBUB 4C0BA 1AXYA 3EBRA 1PX3A 2F17A 3UL2A 2PQQA 4JTNA 1RVF1 4CU6A 1XU1A 2DVDA 2J1TA 1UL9A 2W68A 4P9YA 4YW7A 2A6ZA 3RNSA 2ARBA 4QX8A 4AVSA 1PK6B 2R071 3CU7A 4YVSA 4GKXA 3IZOA 4IGOA 2CU5A 1C3HA 3HPNA 4IE7A 2W87A 3ETPA 1V6LA 3WLUA 4X6RB 1H4GA 4NROA 2J7MA 2V73A 4W65A 5JZGA 1HDKA 2ZX1A 3FLTA 3IBMA 5EPAA 4GZ9A 1MPXA 1AYN2 1H30A 3I3DA 4QMAA 3UKVA 2DUQA 3M4FA 3UKNA 5K0UB 4RR3A 2V5DA 3BIEA 4KU8A 3AKQA 4QU1A 3IWZA 3N9MA 5ISLA 3PJYA 3VBSC 5D2AA 5D8AB 4RN5A 2HWC1 4QXCA 4XDQA 5FUPA 2WS92 1Q5OA 1W39A 3WXPA 1AR61 1PO11 4GULA 2YROA 4B3NA 3RYPA 2WBKA 2GDFA 3ILRA 4Y4YA 4Q4Y3 5SV5A 1VBA3 1BEV3 2TEPA 3TRSB 3ZMOA 2MEV2 4YGDA 2QQUA 3RI8A 3PNAA 3WNPA 2Y34A 4GH4C 1HN1A 2BQPA 3W9AA 2ZGTA 2ZGMA 1IOAA 2WN3A 1ZBE2 2WKKA 4QKBA 1GMMA 5A7QA 3WG3A 4E8CA 1QXRA 1R093 4ZS3A 3F2ZA 2VBDA 1WW7A 1AHSA 2ZBJA 4D7SA 5IVYA 1L3JA 1HRI1 5F3IA 1AR71 2VY0A 4QQHA 5FZ9A 2ZZJA 5A6YA 1LU1A 3PUQA 4EN0A 2PQSA 2XJPA 3CJIC 1J59A 4LIUA 3BKZA 1W6QB 1ZRIA 2RE9A 1U5XA 5EYXA 4RHV1 4ES8A 1RUJ3 1PVC2 1RUI3 1RUG1 4N43C 1AJOA 1ALYA 2W3JA 4AI2A 4CU9A 1GUIA 1XSQA 1VRH1 3K4AA 2OUJA 3RZZA 3WDVA 3OEAA 4HOOA 3FC0A 4O61A 4YZ5A 1CGPA 4XETA 4PI2A 3H1YA 1VBD3 1LAJA 4K6BA 1V00A 4M4RA 3RJ2X 5FY0A 5IVFA 1MR5A 5BNNA 3VBSB 3I3EA 3K48A 2R041 3W5NA 4FXKB 4LMFA 4NVPA 1JOPA 2WO7A 5GKAC 4LQRA 5C3RA 2CAVA 1VE0A 4M4PA 4P5YA 4G3YC 1OUXA 4DEQA 1DYKA 4UFHA 2OUHA 3BUCA 2BV4A 2EXIA 1N1SA 1S2EA 3THDA 1RUE1 1AXKA 3TEXA 3JB4C 1XE7A 2EAAA 5FIXA 1LU2A 5IVBA 3QACA 4PLNA 2AYHA 3W21A 2J22A 3MIFA 1J1TA 3E5XA 3WDXA 4CVUA 2QNKA 2Y6HA 4K7JA 4UF0A 5IAVA 4AVBA 1W8UA 5LBCA 1BZWA 2XXZA 3ZXKA 4A42A 1D4M2 3LOBA 3OUHA 2GC3A 4TLGA 1IS4A 4QPIB 1JZ3A 1Y4WA 4K9SA 2GH2A 1SLTA 2WFF1 3I4IA 3USUA 4AWDA 1F4HA 1Z0HA 4G4FA 3CJIB 4BDVB 5ABJC 4I2OA 2CWMA 1VR3A 3WUCA 4Y1XA 3NV3A 4YM0A 1UIJA 5FZGA 5J36A 5KHKA 1AR83 2BFUL 3NRUA 3DPRA 2WSUA 3PUSA 2P34A 2F4PA 4XJZA 5FMOL 5FR3A 2EAKA 1GNYA 3ZFEA 1W9SA 3VKLA 2BVVA 2UY8A 2YHJA 4PDWA 2WQ8A 1W6MA 3ROUA 3P1IA 1LHVA 1WCKA 2UWBA 3CDZB 1W9YA 5DMYA 3LF7A 3AYCA 3CQOA 3VLBB 5FP7A 2ETEA 4NWWA 4OI2A 5FZFA 3UYJA 4NAMA 5FZIA 3KMHA 4FPFA 1CAWB 1HB2A 1WCDJ 5JSPA 2ZAHA 2WNEA 3UKTA 3L9JT 5A3PA 4IGQA 5I0DA 3N7MA 3H8OA 1JZ2A 2C24A 3MUY1 4LHNA 2RM21 4LT5A 1A78A 1FX5A 2DBIA 2DURA 2WQZC 2PLV3 4W8JA 5E16A 1ZBA2 1CVNA 4HKLA 4QB6A 2HYKA 5GLUA 5I0TA 5JPNB 4AVVA 2DUPA 2RDRA 2LALA 3FBYA 3OBTA 2DU1A 2X29A 2ZJCA 4JQTA 1UZWA 3EYPA 4M3CB 4UXAA 1VBB1 2AUYA 3J8F2 4ZXEA 1UPSA 4A4AA 5D21A 5A7OA 1R082 4ZU7A 3WHTA 1H2MA 2Q5TA 4Y20A 4N9HA 2A3WA 1IS3A 1MS0A 4IE5A 4NWVA 2VJXA 1BBT2 1SACA 3IPVB 2GZWA 3OB8A 1W3XA 5L9VA 5ABJB 5KBFA 3AYAA 4PI0A 4D3WA 1OA4A 4JTOA 3HBKA 3VBOC 3MIDA 1FMD3 1SLCA 1XQNA 3B01A 1NZIA 3E5UA 3TNPB 2FDKA 1DG6A 2E6VA 1YQ2A 2YBSA 4XJWA 2RS12 4DNYA 1J84A 5GZGA 4E4ZA 1SBEA 1X7NA 3SQOA 4R52A 3VDAA 4FPGA 1CWPA 1ND3C 5CYYA 1REFA 1PO21 4S2HA 4Z1VA 4KBZA 3ZDSA 4YLZA 4YVWA 1W8TA 5M0TA 4RGKA 5A33A 4IQPA 1LEMA 4XFFA 2OXBA 5JI9A 4QWNA 1AL21 3ZO0B 2W1WA 1JYNA 1MZFA 2VZVA 1N1TA 1QQP1 2JJ6A 4HK9A 5F5IA 5T55A 4BCUA 3PTRB 2OQ7A 2CGPA 4W6WA 5DUVA 2Q0AA 1EPZA 2KXLA 4H55A 3I3MA 2P3YA 1HXS2 1DFQA 3HIFA 1QJEA 1GU3A 4XBQA 4IV1A 1JS9A 3VDDA 4UAPA 1UXXX 2GU9A 1D4VB 3ZOIA 1JYIA 4QGMA 4DRVA 1UY4A 5AFEA 4G9SB 4CDQA 1GP6A 2VQUA 2ATFA 4LORA 5I8SA 3VD3A 1W8OA 4CUBA 3TOJA 4JGZA 2WQ4A 4XEZA 3JD71 4CU8A 3DXTA 1YC61 3O0WA 3W58A 2WABA 3H3ZA 3ZN5A 1EUTA 4BQ3A 4AEDC 5IVEA 1X36A 5ACA3 2G9FA 3VBFA 4LJHA 2JG9A 1QJU2 5L36A 1GNHA 1S0IA 3TWIA 3ZVXA 5APAA 3TYJA 4W4ZA 3VBOB 2DCYA 2P3KA 1T6BX 1UIKA 4RSUA 4QKFA 4BLIA 1QJX1 2RS51 2WR9A 3GBWA 1H1IA 1UY3A 3VDCA 1LTEA 5HV4A 1F2NA 1OLQA 4CXYA 5J7MA 5BNOA 4PF5A 4XMAA 3LEGA 3VZJA 2MHFA 4Y33A 1WW4A 5CISA 3SEEA 3OYWA 1Q8QA 2WNVA 5A7PA 4XTPA 3AP6A 4MXWB 5DQ0A 4XBNA 1UY0A 4BQ4A 2Y26A 3OJBA 1XNTA 2ZX2A 4QKDA 1AYM1 1ND2A 2KM2A 3U10A 2B9UA 1N3PA 2ZGQA 5A32B 3VBHC 1S0JA 2Q1ZB 5E88A 3WDWA 1IGOA 1JU3A 2FMDA 4YW1A 4LBQD 5F8PA 4NR1A 1V6IA 1LGNA 1AR92 1MEC2 3I2GA 4Z82A 4PF1A 1QNYA 2JB4A 5CKMA 1HX6A 1XYOA 5FKCA 3SNMA 3E97A 2Z5WA 4IGPA 1K3IA 2UWAA 5DDJ3 4K8FA 3BALA 4MVTA 1GP4A 5L19A 1SDDB 5FPAA 1SPPA 4ARXA 4CP9A 5F5CA 3B9IA 3T3YA 4AEDB 4CZSA 5C5UA 5FKBA 4HLTA 4SBVA 2DYCA 4QGNA 2A6VA 2RMU3 5FUNA 3MW3A 5IJRA 1PGL1 1E57A 1GYKA 2K2SA 4NAOA 1UWWA 1PZ7A 4E8DA 1ENQA 4GJYA 5FYBA 2JX9A 1U0AA 2YZ4A 3KT4A 3LPFA 4UYBA 2VCMA 1SG3A 3VD9A 3LA7A 4UWDA 1W90A 1OF4A 2Y6GA 4TWTA 3SH4A 4Z92B 2ORXA 3WINE 4CDWC 1RJ7A 4GB31 3ZFGC 1WKYA 4LA3A 4ZU4A 3POEA 2VMIA 3SKVA 4RQPC 3VDBA 5C4WC 2WO1A 3OCPA 4JHZA 2DCJA 4LUKA 5FYVA 2A6YA 2Q8EA 2GC1A 4D7YA 2R16A 4R8HA 1W04A 5CBLA 1QWRA 4ATFA 3CEWA 5KC5A 1CAUB 4LKEA 3VBHB 1KRIA 2CL2A 1RVF3 4OUEA 5BUVA 2XJRA 2WZPP 2YFUA 2B8MA 3Q8BA 2P5BA 5HXMA 4GJZA 3MIHA 1VMHA 2R073 1RINA 2QTWB 5F6KA 1GZWA 1B09A 1IKPA 2I45A 4EE2A 1BMV1 1DYOA 3LAGA 3M3IA 1FAYA 2PA7A 4E2QA 4NN0A 3K46A 2EVXA 4LXLA 1JYWA 2FDGA 3H8XA 3J7NA 4IE4A 1KQRA 2HWE1 4DEVA 5C9AC 2EA7A 1O5UA 4XACA 3ZSJA 5JIUA 1JH5A 2W2IA 4HL0A 2IFRA 4U2AA 1N3QA 3GYDA 3RS6A 5SV8A 1G9FA 3GXUA 1OH3A 3OEBA 4MGTA 1VB2A 4I3GA 4ORFA 2W5FA 2HWC3 1S4CA 1XRUA 4JAAA 5A1FA 4Z8BA 1AR63 1PO13 5LRRA 4FBFA 5I8TA 4S2GA 2YC4A 2XQXA 3LIGA 1V6OA 4CCMA 1EAH2 3KB5A 5FYUA 4CDWB 4FOVA 2RJKA 3MIEA 3PDQA 4Q1PA 4Y26A 2R7EB 3POWA 3ZYRA 4RQPB 3O0VA 2ARAA 4X8NA 5FZAA 5C4WB 5FJHA 3RZMA 2XL9A 4FOWA 3ZFFB 1HRI3 3PIJA 1AR73 1OLRA 4HT1T 4UFKA 1V0AA 1JI6A 3O1OA 4Z07A 1DP0A 1HIXA 5G05L 5FOBB 1JOBA 2K46A 3U14A 3B69A 2QKDA 4BU2A 1JTZX 2PHLA 3A22A 3ABZA 4FO9A 1RUC1 3PMEA 4BWOA 1ASJ2 3NVCA 4Q4W2 5KXBA 1UU4A 3NMBA 3WG2A 2BWCA 4RHV3 4BH9A 4DZGA 1UN1A 5KHJA 2VZ1A 1RUG3 1VBC1 1YNAA 2P6CA 2ZPXA 3BIWE 1YQ6A 2JD9A 5T52A 4KG8A 2DFCA 4LHSA 2WWUA 1EY2A 4OHXA 3GCWA 4YGEA 3WCRA 4AQ2A 1VRH3 4PJYA 5F5AA 2XJTA 2NM1A 1FOD2 4JHTA 4JRAA 5H9PA 4CYDA 2E63A 5C9AB 1MS4A 1V9U2 2FQPA 2GC0A 2WS91 5AVAA 3ZXLA 2VTFA 4XMIA 1OUSA 5CKQA 2FMYA 3N36A 2WJSA 4PLMA 1ENSA 4A41A 1MQTC 4Y1YA 2YG0A 2ZXQA 1QGLA 2XG3A 4COWA 2GH8A 4Q2FA 5FYIA 1KJRA 2Y6KA 5FY4A 1IS6A 2D98A 4FFGA 4L99A 2EXJA 5JCTA 5C3SA 2XHNA 1Q43A 1SQ4A 1ZZBA 3OUIA 5BXXA 3ZXAC 4F8AA 2OIIA 5JAXA 1COV1 2VMCA 5FZ7A 1STMA 5LEKA 1CPNA 4K1YA 2NP0A 3OGGA 4HN0A 5LK5A 4RYDA 4YG3A 4QPGC 2D6KA 1RXFA 1QDOA 4AL9A 5GZCA 2ORZA 5JVVA 1UW8A 3CZJA 2A70A 5FV3A 1SEFA 3H7JA 4AR2A 4IE0A 1JZ4A 1OA3A 4FP2A 1DF0A 2DTYA 4XBLA 1PGW2 4GKYA 1KGYA 1ODMA 5LK7B 1QJY1 4YM1A 2Y0IA 2W1QA 2EF6A 1YHFA 1WCSA 4QAWA 1OKQA 2YUEA 3I97A 4UW3A 2WFF3 3WP6A 2EXHA 1ZZ6A 3JCIA 4MXVA 5CFCC 1QMJA 4A3ZA 4CDXA 2D6PA 3LIHA 3RJRA 4GMP3 5JR7B 3NW4A 3USSA 3K2OA 1CX4A 1O4YA 1RHI2 1YJKA 2ZX0A 3BPSA 5DABA 5A6QA 3BU7A 4XVHA 2V5YA 4AEKA 1K12A 1LNSA 1RUH2 1TME3 4H7LA 4KWUA 2WNUA 4LBJA 3T0DA 4MGYE 3N9LA 4XUOA 4LITA 3CNAA 3I2JA 4LLFA 4UFMA 4BK4A 5CG9A 3VBRC 3AM2A 1NA1A 2YBPA 1IPKA 4AQSA 1MQTB 2DCZA 3LSEA 3IMMA 1US3A 4YFZA 3ALQA 3R0RA 3RG0A 2VE1A 2DVAA 2DVFA 2ZGNA 5DG1A 5KHGA 3TN92 1Y43B 2E7TA 2XVKA 3WP3A 2O8OA 4KU7A 5JR2A 4IESA 1FI2A 1LODA 2E9QA 2RM23 4WM7A 3Q8CA 5DAVA 3RMYA 1W2NA 4FAGA 4NJ4A 1JZ8A 1NCQA 4GAZA 3VZOA 1AZDA 3DYMA 3NSTA 2PAMA 2BYVE 1ZYBA 3MPPG 1YXWA 4QPGB 3I8TA 4EN8B 3D8CA 4N53A 1U5ZA 4AFDA 5HV0A 2XWJB 3WZ1A 3DF0A 1AVBA 1XJAA 5FPXA 2IXKA 5FZOB 4QM8A 4D0QA 1GNZA 1ZREA 1LHNA 1PZ8A 2A3XA 2VULA 3WDUA 1DLCA 3HN3A 3R4SA 5LASA 4NIIA 3RWNA 2JG8A 4YM3A 3LE0A 4AI3A 3KCCA 5FWJA 1DU3D 5CFCB 4BISA 3LDRA 3NNJA 1LKNA 2A6XA 2WNOA 1EUUA 4OUMA 1BQPA 4NRMA 2DVBA 1VIWB 2GN7A 2VMDA 2VUJA 2VQAA 1VAMA 3ZXEA 3U07A 3LWCA 5J1XA 3SH3A 3KT7A 3NJYA 2O0OA 2VMGA 3J4UH 1YRZA 3ITQA 3J9SA 3MPBA 4GIQA 5JIAA 5J48A 4FPCA 1VMJA 4PQ9A 1W8NA 2WA3A 5E89A 5JUVA 4FTBA 4LHLA 1PO23 2DDUA 3FL7A 3INAA 5FY9A 1JZ7A 3S7EA 1RGSA 1BYHA 3LSDA 3VBRB 4BQXA 4DXSA 4WVWA 5FOJB 2PHRA 1LHWA 4HZFA 1B35B 1AL23 4YZ4A 2VPVA 2HWD3 4YGBA 4AG4A 1RUD1 1ZBA1 1QQP3 4LO7A 3NKGA 3AMQA 1OOPB 4I0AA 2V72A 3KGLA 2XLFA 4N7IA 1VLNA 2A3YA 3IDAA 3B9CA 1NOVA 2D3SA 2G19A 2BDRA 5DUUA 3I59B 3ZPOA 3DYOA 1W28A 3FBMA 3VV1A 3SHRA 1R081 1LOCA 1QJFA 1ZX5A 5FY8A 3H1WA 4Q4Y2 5FXWA 1VBA2 1BEV2 4UFJA 4AAPA 4GWJA 4C90A 4EWEA 3OSDA 1YFXA 4AXOA 4UFLA 5L7OC 3AVSA 1RUOA 4HPKA 2WLPA 1LESA 2CSGA 3GCXA 4COUA 2X5IA 5E1RA 3JD73 1KFUL 2OX0A 4BHPA 3RRDA 1R092 4CEWA 1NY71 4DUXA 3N7JA 4XUTA 5FY1A 5CB7A 5JOYA 5K8SA 5GLVA 3OF1A 2Z69A 4CTEA 1Q8SA 4OQ8A 3PU8A 3JZVA 3NV2A 1OHFA 3KVBA 4ZZ5A 2E7AA 1SLLA 4BE3A 4XXAA 1NCRA 1OD3A 1A3KA 1QJX3 2D7FA 5BNPB 5CKNA 4XUNA 1CAXA 3VBUA 2NLRA 2RS33 3LEMA 3B3QE 2VOWA 3ATGA 4CCLA 3AXDA 2Y6FA 4IEUA 4Y22B 3T0BA 3X29B 4C8DA 4HETA 2B4KA 1IPJA 3AC0A 5HCBA 1RUJ2 1S2KA 3ILNA 3AL6A 2Q8DA 4META 1Y3TA 1E5RA 2X8KA 4JKKA 4P9IA 1PK6A 5LRSA 3ZSKA 1W05A 2QZ3A 5E8AA 3KZ4C 3ORJA 2N7GA 4B7KA 4YVSC 2QQKA 3H0OA 2VZOA 3TEWA 3ZYGA 1TG7A 4XURA 1OT5A 4UFIA 1A6CA 1VBD2 1AYM3 5B2GB 1UKRA 1UZYA 2WZR2 1YIPA 4BQ2A 5HPOA 3T2PA 5JZGC 5K0UA 1X50A 4ZS2A 3RZKA 4MGQA 3NNFA 2WT1A 1NXD1 1HQWA 1W2UA 3DECA 1S0EA 4XF9A 2RDQA 4Y24A 1UYPA 5D8AA 2A71A 5A3OA 1FV2A 1CAVB 2VBPA 3Q8FA 4LBOA 2BOIA 4CCOA 1TMF3 2YGLA 5KXCA 3I49A 2O1QA 4TLFA 4UI9L 4KMQA 3C7FA 3IKWA 1JN2P 5L7OB 4ISRA 1S0BA 4IEYA 2FZ2A 1N1VA 2YC2A 2JWPA 2XBO1 5FK7A 5GM0A 4CUCA 3NJVA 2VTXJ 2HWF1 4B7EA 3E6DA 1DLLA 3U0ZA 4AK3A 1REEA 4XFCA 2OZJA 4K3UA 4Q26A 1ULCA 3MIGA 1EV13 4XF3A 2CHHA 2DUOA 5FO9B 5J3UA 3VGIA 2C9AA 5A7WB 4V1PA 2AEZA 3E1F1 1I3HA 4WV8A 1JZ6A 3QCWA 3AKSA 5A80A 1VPHA 1IQDC 1HKDA 5C33A 3J26N 4NIHA 4CP0A 3GALA 4LO8A 3VZLA 2IXJA 4BPZA 1G9AA 1AR82 4QQ2A 3WW4A 2R6QA 3KVAA 1YQ8A 2Z79A 3AX4A 4RFT0 3MLLA 1W6QA 1IS5A 1J1LA 3BTAA 5FTTC 3PL0A 3ZSLA 3HWJA 3MW2A 4L0PA 3PIGA 4YVSB 1PIV1 4BOWA 1DCSA 1UD1A 3UJOA 3WEZA 1RUF3 5CVRA 4E9KA 4IEXA 3AFGA 4TXWA 1C8M1 4IEPA 4MADA 3ZN6B 2Y38A 1LR5A 4I0WB 3Q8AA 1ZNPA 1YI9A 3ZXGA 2DF7A 3ES1A 5T50A 3IN9A 2FDJA 4INDA 5JSRA 2QJVA 5F1RA 1UOFA 3OTFA 2VXJA 4C0HA 3VBSA 1RITA 3MF9A 4OHYA 5CA6A 4FT8A 3ACFA 2ZOEB 4PHZA 1NLRA 1RTVA 2EXKA 2RHPA 2VUCA 2BWAA 3A7QA 1MVQA 3O14A 3M7AA 4Q0SA 5EQUA 2VQTA 1VAKA 4FPHA 4LUMA 3RMXA 2PLV2 3BI3A 2W0XA 4I02A 3UETA 2WYSA 5DUXA 5EHDA 4WBBA 4TYSA 3N4MA 1QXJA 2HWE3 4IEQA 4XUQA 1MS3A 1VP6A 4PIYA 3PJQA 2BNOA 4M0NA 3FFQA 4XQ4A 2ZAAA 5D1IA 1YWKA 4AGVA 2CY6A 3WV6A 3EMRA 4NMIA 3OPTA 1HRV1 2A6WA 1UAIA 3LD8A 4NIDA 4XCBA 1S2BA 5FZBA 2VW1A 1ST8A 1W6NB 5LBEA 2JE7A 5FZMA 1VB4A 2Y64A 5FZ0A 1GZTA 4QPIA 4GH4B 2VMHA 1FMD2 3O5SA 3ZPYA 1S0CA 2E7QA 3CJIA 3NNLA 1AX2A 1UU6A 1W2OA 1GR3A 1BHGA 1CJPA 2CYFA 3GJBA 3IAPA 2ZGUA 4Y1VA 3THCA 5LA1A 1W6PB 1QH6A 2ZACA 1NQJA 2CAUA 3DPRC 3NQHA 1UOBA 4ASMB 3LA3A 2EIBA 4ZONA 1OLMA 1YUDA 4QHOA 3WP5A 1U12A 1I5ZA 4A7YA 2R32A 4AHZA 4MGKE 1CQ9A 1HQNA 3NO8A 3CF6E 4KH9A 1RUC3 3AFKA 4O9EA 3BTYA 3GZUC 1NKGA 4DS0A 1CAWA 1WW5A 4N43B 4LKSA 1RUNA 1VBC3 5H9QA 2PHXA 2QE3A 2PXJA 2VTXA 3IAQA 4UT5A 2VXRA 4LOSA 3S0MA 5HCFA 3P3PA 3V56A 4WM8C 3FFZA 5C6CA 2YFZA 1GOGA 3ZYFA 5FZDA 1VBE3 3ZN4A 4TTGA 5KC6A 1OMIA 3HQXA 4A44A 1F4AA 5AC91 4JDMA 4KWJA 5BV6A 2QQPA 3AZVA 4AVAA 1F9KA 1DZRA 3FMGA 4AE2A 4M3CA 1EAH1 3H7YA 1GOFA 1I9RA 3K75B 3C7OA 4D8MA 2P3JA 5ACA2 1M06G 1WMXA 1OBNA 1L7RA 3VD4A 2ZABA 4C91A 1OLME 2VVEA 1O4TA 3IPVA 1JMUB 4DINB 4NPRA 2Q4SA 1COV3 1W8WA 5FZEA 3VZNA 3WW3A 5ABJA 1CN1A 2VUAA 5FYSA 2F6BA 1IHMA 1H6XA 2W46A 1XYPA 4Q27A 3KM5A 4MHRA 4WZFA 3LDKA 3KCXA 2IXCA 3V0BA 4Q4W1 3TAYA 5JLVA 2RR11 1QJY3 1LOAA 1ULOA 2JDPA 1CD3G 1K5JA 1G7YA 2W52A 4RA0A 2IUWA 4Q4X3 4YM2A 1IQAA 3LA2A 1EYBA 2ZA9A 5FREA 1BK0A 2A75A 4JGYC 3RI9A 2JXAA 4MOAA 5FUIA 4DIQA 5FK8A 1HJFA 1R1A1 1Z7S3 3ON7A 4Q29A 5TSWA 1ZRDA 2FZ1A 4M3CE 4EN7B 2JB8A 1UMHA 2V09A 1C1LA 3S57A 4URAA 4WM8B 1MS1A 2UY9A 4YARA 3AYDA 2BUKA 1XNDA 3N35A 4XJAA 4YG0A 3SXWA 1ULDA 3RFRA 2XLGA 5DDJ2 2VOTA 4D94A 4XC9A 5LA2A 3T1MA 3SKJE 1K5MC 2R063 1QOTA 3MLKA 3KCYA 2KD7A 4OCTA 4FQ4A 5LZ6A 4UW4A 4ZY9A 3OUJA 5DZFA 3WQ1A 5FXZA 3H3UA 1MS9A 2RMU2 5FMDA 1H9WA 4XHXA 4QT6A 4AI1A 1SZBA 2BFUS 4V2WA 4WZCA 4IEOA 1OPMA 3ZLIA 4P9GA 5FMOS 1C28A 1PGW1 1HJGA 2O14A 3VBFC 2ARCA 5I0RA 3VBOA 4QB2A 3LCPA 5FPUA 1N3OA 1SHWB 1POV3 2IXLA 3I2KA 2W91A 2P37A 4M01A 3ACIA 3LKJA 4N7UA 4D6RA 3GNEA 1Y9QA 5IK8A 5FP3A 1CJDA 2HEYF 3HVDA 1XOYA 4YWAA 3AB0A 4I0BA 1DBNA 3THPA 4QPWA 3U4XA 2WUHA 4JQRA 2IVIB 2RDNA 4DOUA 5IWFA 3OOXA 4P14A 4A2UA 5FBJA 4MXWA 2WSVA 4JGYB 2HWB1 2Y0OA 1T6GC 2PAKA 2E51A 5F9TA 3H42B 5E6HA 3MFAA 3BTZA 3OGSA 1NX9A 2XWBB 4NUBA 1IZ3A 1ND2C 1WCUA 2LS6A 2VNRA 5FWEA 2BP6A 2G9ZA 5A32A 1ND3B 4OMCA 2J1EA 5A3MA 1DQ4A 2R072 4ARYA 1UCXA 5FY5A 1W6OB 4PT6A 2P17A 5FY7A 3RWKX 3I2IA 2WO2A 4CU7A 1YFWA 1KDKA 4FCAA 4PQQA 5KXEA 3ST7A 4ZXKA 5JOXA 2GMPA 3A4UA 2AH2A 3M70A 4S2FA 5GLWA 1K5MB 4TZDA 4A6SA 1QKQA 3UV9A 1NT0A 1QEXA 3NV4A 1RUD3 5DUWA 1UNBA 2VOVA 1FPN1 2E53A 1HV1A 4RGGA 2BOJA 2ZMNA 4AEDA 3KWVA 3S7IA 1D2QA 2XQRA 5LBFA 4QM9A 3DKWA 1KS4A 4XXPA 1AJKA 3K51A 2DTWA 2WLQA 1PO12 1AR62 1URXA 2OVUA 1WD3A 2RVAA 2D3PA 2GAUA 2F4LA 2PHFA 3A23A 3CZUA 1RMU1 3APBA 5T5PA 1JOJA 1LOFC 2WAOA 2Y8KA 3U75A 4EN6B 2W1UA 1ZZ8A 2IXIA 3KD4A 1W03A 1J3QA 4LKFA 2JENA 1Q3EA 1C5HA 5FPVA 3CJXA 4YNIA 3D3AA 4I09A 5I91A 4PLOA 3VD7A 4QD2A 4RS5C 5LW9A 1LRHA 3FHQA 3C7GA 1HRI2 1YCIA 2VOKA 3M3QA 1AR72 2CDPA 3EXUA 4GXLA 2YMZA 2BJSA 3DKQA 3C8XA 5FZ4A 1H8TC 3Q8EA 3J7LA 4CE8A 3KT1A 4OMDA 4RGAA 1UOJA 1NE6A 5F7UA 4DMIA 1CAUA 1DZQA 3VBHA 4EJRA 1JODA 1KDMA 2A73B 3IDBB 1YO8A 3O12A 3QH6A 1S0DA 4RHV2 5CG8A 1SFPA 1RUG2 4CXWA 1GQGA 1RC6A 1GQHA 4IE6A 2D97A 2VNGA 3WG1A 2QQLA 3JBG3 1C1FA 2HH9A 4U36A 3NAPC 1KFXL 1VRH2 2ADDA 4W6XA 4NO4A 5FXVA 1YYNA 2V4VA 3ENRA 1YQ5A 2BVBA 1HB4A 2XPJA 3VHPA 1DGLA 4V2VA 3ZR5A 1CONA 4AYUA 1X82A 3F95A 4Q4Y1 5CEHA 2FDHA 1JUHA 1J83A 4FI9A 4XJ8A 1DQ0A 4LE3A 4E4HA 2Q8OA 4EYUA 5K9YA 3IIIA 5FQ0B 4NRQA 1U5YA
chains in the Genus database with same CATH topology
3G6JB 3WX5A 4HFSA 4L11A 4XFBA 5AVPA 4WVMB 2GMMA 1GANA 3JUUA 4IEZA 1FT9A 3MDPA 4AVCA 2XBO3 2AZ5A 2YYOA 4FXGB 4L97A 2HWF3 4R4ZA 4CDWA 4K21A 4L8QA 2NPIA 4Z2WA 2VW0A 5CAZA 4X6QB 4RQPA 4RS5B 4AQTA 5C4WA 1AF9A 1PNFA 1H8TB 5I0SA 1APNA 3ZFFA 2D93A 2WFF2 1BVVA 1MZEA 2XJVA 4FPYA 1YFYA 1REDA 1LOEA 3HBZA 4Q4V1 1RB8G 3ZFGB 3DV8A 2VOXA 5JSOA 2WZR1 4Q0PA 1TME2 5IK5A 3NAPB 2EALA 1PIV3 2CNAA 1JYCA 1O4ZA 1WUVA 4BM8A 5KWRA 3HD8B 1C8M3 2DCKA 4H3WA 1NYWA 1DQ1A 5C9AA 4CEYC 3N3HA 4GA9A 4CP2A 5CFDC 3C3VA 2AENA 2OZ6A 4UW5A 5CIRA 1AYN1 2PAEA 5CU1A 1GLHA 1G9BA 2ZMKA 4DQAA 1J58A 2OPKA 3E6CC 4OUSA 2SLIA 1GKBA 3ZYPA 2RM22 1OFNA 5JDBA 2IFWA 1ENRA 4L2NA 4ASLA 4AHXA 5LEJA 1FNYA 2QUOA 1GICA 4WVVA 1ZRRA 2QDRA 5C8CC 4OI4A 2FBEA 3VHOA 5FFOC 1HRV3 2MEV1 2R043 3DN7A 4YG6A 3LOIA 1C5IA 2ZGRA 3HMYA 5FLHA 1AR81 5EV7A 5EXOA 1ZBE1 4XOGA 4AFMA 5JMCA 3TNQA 4FOQA 4IXLA 2XB6C 3AXEA 4OLLA 3MGUA 3IIAA 1I6XA 3QH7A 4KWKA 1RUE3 4Q0QA 5JI7A 5I0UA 3PVNA 5KHHA 1G8WA 1ZRFA 1ONAA 1PO22 3ZYIB 1MVEA 2ZCWA 4COVA 5HBAA 1PVC1 4B8EA 2ENRA 1DGRA 4BIFA 4XQDA 4CEYB 2XVGA 3WY6A 5CFDB 2JECA 3THTA 1WBLA 1AL22 2BNNA 2HWD2 3H8UA 1MQTA 3O0XA 4F7ZA 4QU2A 4IEVA 2LTNA 3VHRA 2UURA 1D0GA 3POYA 2I2SA 2LM3A 4JV4A 4AHWA 1DZTA 4AEMA 2GNDA 2DFBA 2ES3A 3ZSMA 1LJ7A 1QF3A 5C8CB 1BXHA 5JPMB 1O3RA 4KL1A 4MGIE 5AC93 3JD72 4QPGA 1C57A 3GBFA 3ZSEA 4P9WA 1LHUA 4OHWA 3JB8A 3VHNA 5K7PA 3UK9A 1PGSA 3KQRA 1YFUA 2PELA 3P3NA 4ZKTB 1DIWA 4LA2A 2MPFA 2XL7A 4YZ1A 2ZGOA 4HKOA 1QJX2 1WLDA 4COZA 4DFSA 1D4M1 5CFCA 2RS32 3V65A 3AP5A 4QGLA 1PMIA 1G6NA 3M3OA 3OY8B 3TBDA 3SISA 3SH5A 1DQ6A 1VBB3 2VGDA 1QU0A 3ZXDA 3D5OA 4LO4B 2RR13 4OHVA 4XE9A 1ULFA 3GF6A 3O7OA 1OQDA 3MIBA 1CR7A 3FWEA 3MICA 4XQWA 1LEDA 4K20A 3VBRA 1AYM2 1WLTA 2CGOA 1QY4A 1RJ8A 4R9BA 4DB5A 1R1A3 1B35A 3C2UA 1S0GA 3PVOA 1OOPA 2QZ2A 5HXVA 3TB0A 2WL1A 1LCLA 2CGNA 1XU2A 2R49A 2LUWA 2HEVF 2Q1MA 3I59A 1HV0A 3R4UA 1TMF2 4BLJA 3EQEA 4ITCA 1XNKA 4C1XA 1O3SA 4P9JA 5J37A 3WW2A 4YYOA 4CDUC 5IT6A 1H1AA 2D40A 1MS8A 4EN9B 5FLJA 1EV12 2A5ZA 3J8F1 4YW3A 4OZXA 1SCRA 4R4XA 3ME2A 1WMEA 2XKOA 4QQLA 3PHMA 1LOGA 2D3RA 1BBT1 4N90A 5BNPA 1FNZA 3BCWA 2QVSB 4FAHA 4H7MA 4MV2A 2PHDA 4Y22A 5FRAA 3AK0A 5F5QA 1V6KA 2D5FA 2CWSA 4I30A 1QXPA 2RS11 3E5QA 1OQ1A 2P3IA 4LEJA 5DG2A 4XF4A 3W59A 1RUF2 3WW1A 4EROA 1GZ9A 2HWB3 2Z42A 1SFNA 2ILMA 3PLQA 5T5OA 2RS53 4FOYA 2GMEA 2WC2A 4IV3C 1S0FA 4RD7A 3L2HA 2BNMA 2YDEA 1V6JA 5K0UC 2B5HA 3JQWA 1YLLA 4O9GA 5FAXA 1RUI2 2NZ9A 4Y5Z0 4HVOA 4J1XA 4NHMA 5DXDA 1BMV2 3DUIA 4MGZE 3N7LA 1CAVA 1JUIA 1WLCA 4LBQB 4NHKA 4HSJA 1HXS1 2HWE2 5L7OA 4CDUB 4BIOA 3HN1A 4XF1A 4MLOA 1NLSA 2CTVA 1FPN3 2OA2A 1OA2A 3IDEA 4XHBA 1PZ9A 4RR3C 4KNCA 1J3RA 4XFAA 2YXSA 5J09A 1QNWA 2IWGB 5F6LB 3LZZA 2WT2A 2XGXA 5IK4A 1RMU3 1NQDA 1QJU1 3NWKA 1JW6A 4JCKA 1BKZA 1W0OA 4I3PA 1SLBA 2WINB 2WFPA 4JC1A 3ILFA 2NMOA 3AYEA 4LO5B 4JDOA 3LB9A 3JU9A 4ES9A 4FP3A 5GZDA 3SCHA 3CO2A 2ZKNA 4CP1A 3SCGA 2VH9A 2YPJA 4IV3B 1ULEA 3V0AB 4JDNA 3ZN6A 1A8DA 2TNFA 4UBGA 1RUC2 3M2MA 3WUDA 1GBGA 2ZGKA 1G86A 3WG4A 4X8PA 1NZCA 4M00A 4GB33 2AR6A 3IT8A 4ATEA 3BB6A 2R0HA 1TNFA 1VBC2 3I54A 2W08A 1LECA 4HVRA 4HANA 2G4IA 5AFBA 2MNGA 2YV8A 4LHKA 1VBE2 4IETA 1AR91 2RJLA 1MEC1 5JZGB 4XF0A 2WA4A 5FPZA 1Q56A 3MEPA 4RR3B 3ECQA 4L92A 1TE1B 4MYEA 4GWMA 5EWSA 4F83A 3WHUA 3GHNA 4B4PA 3EHKA 2OYZA 5HI0A 5BNNC 1W6NA 1MZ6A 3EJKA 4KGQA 4IL7A 2H6BA 3LGRA 1QHDA 4R9DA 3FE5A 3R05A 4JVAA 5FDBA 2ZZQA 1UPIA 3QLQA 1COV2 2VVDA 3ZIXA 2BGCA 4UW6A 3MI8A 4IERA 4GMP0 3DGTA 4R9CA 4GH4A 4QPIC 4XILA 4AFBA 1W0PA 4P9LA 2TBVA 4URTA 2XJSA 4HBNA 2XHKA 1WBFA 1QJY2 4M3CF 1W6PA 1SBDA 1OFSA 2C5DA 4Q4X2 4YSFA 1MACA 4Q4V3 1Z7S2 3QBQA 3MF6A 2WZR3 1ZRCA 3KLSA 2ZGLA 1BK1A 1F31A 2NQYA 4N43A 4OVEA 1WA4A 4DY3A 3D82A 1Z78A 5T54A 2GC2A 3FJSA 3ZFEC 4EV0A 3V64A 4PDWC 2DVGA 3OD4A 5GALA 4XTMA 2ET1A 3MLJA 4HMZA 2R062 3WQ7A 4D7TA 1F5FA 3M3CA 5JOZA 1AYN3 5GLZA 2XH6A 3S30A 2B42B 2UYBA 5BNNB 3MYXA 4NOTA 1A8MA 4OULA 2K9ZA 2WIIB 1KITA 3QD6A 2D5HA 2WS93 2CV6A 4K40A 1S55A 2VQ0A 1OQEA 3FUQA 4W6YA 2MEV3 4GMP1 4KQ7A 1VAVA 1GV9A 3HR9A 1DGWA 1ZBE3 4LTAA 3CL1A 1TME1 4HKWA 2DV9A 4AF9A 2Q30A 1KS5A 2ZKLA 2FHRA 3ZXFA 3USUB 5I8YA 4C1WA 4S2DA 4KWLA 3OPZA 5I93A 2D43A 1KD7A 3DPRB 2OW4A 3RQ0A 1ASJ1 4R9AA 4OFGA 4XZPA 3SMHA 4PBOA 4WM8A 3ZFEB 3ZMNA 4AEJA 4PDWB 1PVC3 2GNMA 1W6MB 4Q1RA 2A7AA 4AGGA 1DQ2A 3VZMA 1C4RA 1RUD2 1FOD1 1WMFA 2C1FA 4YVWC 3WQ0A 1V9U1 2ZX3A 5J96B 2H0VA 4L9BA 2JD4A 4LO6B 3FUOA 1I1EA 2Z2SB 5GLTA 2BTVC 2D6LX 2P2KA 1J3PA 3HT2A 3L2YA 1G9CA 3IM0A 2PFWA 1HQLA 3GZTB 4IV1C 4BYYA 3VDDC 1TEIA 4XPVA 5IUQA 3FHIB 4AVTA 4DRRA 2R0FA 3VUOA 3AMNA 2XLAA 4Q0UA 4CDQC 2DWRA 4J6GA 1NY72 1X33A 3B7MA 3NV1A 4JGZC 3AZWA 1TNRA 3ZXJA 4FPOB 4YRDA 4Y20B 1OPOA 2JE9A 1UZZA 2JEMA 2VU9A 4LBLA 5KXDA 2JG9C 1D4M3 4JGYA 2XVLA 3FZ3A 1F8VA 4DY5A 1NE4A 2HWD1 4XIKA 4B4RA 1O91A 4XFGA 1ND3A 3JBG2 1RHI1 4P5HA 3BPZA 5BNOC 2B7YA 1W6OA 3B93A 4FPLA 3E6BA 1Q8OA 1RUH1 1OSGA 2IXHA 4N9IA 4RL7A 3NKTA 5DZGA 2B45X 1CIWA 2WNVC 4A3XA 4YVWB 1QOOA 3WD5A 1K5MA 5A33B 4D69A 4MUVA 1RVF2 1N47A 1AX1A 1CPMA 3GBGA 2I74A 2HJIA 3TN91 1H2NA 1SCSA 1FYUA 2H0BA 4E2GA 4IV1B 1SLAA 1ZVFA 2ERFA 3VDDB 2XBO2 4OI1A 3WR0A 3WOGA 2HWF2 2R1DA 4CDQB 1ZBA3 2ZS6B 4MX3A 4BZ4A 4JGZB 2RS31 3ZYJB 3N7KA 2QCSB 1YIFA 2HWC2 3J8F3 2VG9A 5FO7B 4A7KA 2VVFA 3IMNA 3VKOA 3VN4A 1R083 1DYPA 3VBFB 4BA6A 2JG9B 3SITA 1H2KA 4YZ3A 2H6CA 3SLIA 1BBT3 3I2DA 4YW2A 1H1MA 4BMEA 2NN8A 1ZM1A 3T1LA 5BNOB 3M8LA 4A7ZA 2GN3A 3AP7A 4KGGA 1PIV2 2RS13 1ZZ7A 2VECA 3OYWB 1V6MA 2WNVB 1S1AA 2R30A 1C8M2 4FQZA 4QHBA 1UMZA 2VNOA 1TMF1 3RPQA 2QDNA 1ND2B 5GZFA 4FTSA 2HKXA 3FX3A 1XYNA 1R1ZA 1TQ5A 2UYAA 1RL3A 1AXZA 4QX5A 5FQ0A 5FBZA 5T5LA 4MZUA 1EV11 1H0BA 1HXS3 1XE8A 4WVMA 4AHYA 3RDIA 1LOFA 1KJLA 1YI7A 4B29A 2XKPA 4GQ7A 4E27A 1FXZA 5EZWA 2D44A 3AFKA 1MS5A 1BEV1 1QOSA 1VBA1 2NMNA 1HRV2 2ZHKA 3A0KA 3AKRA 4LBNA 3WT3A 1OD5A 2R042 1LULA 1V70A 4FSJA 4HSLA 1G9DA 4LR4A 4RS5A 3ETQA 4CRQA 1R091 2GSYA 1CESA 1Q8VA 1H8TA 1SDWA 1QJU3 1RUE2 3OGJA 4PBPA 1RUF1 3DL3A 2UU8A 3ZFFC 2D6NA 1QDCA 4ONUA 1DGWX 4XJUA 4Y1ZA 3ZFGA 1YJLA 3NAPA 3POSA 2WWSA 1RUJ1 4FPKA 1WD4A 4I01A 1RUI1 4Q0VA 2ZTNA 2R1BA 4PCRA 1ZA4A 3AMPA 1VBD1 4QQOA 1M4WA 3UJQA 1EPWA 3H9AA 4PIZA 4UBHA 2IZWA 3HT1A 4AGRA 5C8WA 3VL8A 1GZWB 1LB2A 3D6EA 1LGBA 1O3QA 4H14A 2ZHMA 4LBKA 2PHWA 1AR93 1MEC3 1V6NA 4F3JA 5EYYA 4XIOA 5EFUA 3AMHA 4HVQA 3KSCA 4MSVA 5AC92 3ASIA 1HLCA 5DZEA 2QFEA 2YC0A 2IC1A 4KBBA 1ZZCA 2ET7A 3D4KA 2O8QA 3AZZA 4AFCA 5CADA 1U5IA 1VJ2A 2X53S 3FLRA 1BJQA 2PHUA 2ARXA 3M3EA 4K1ZA 4AI0A 3B02A 5BNQA 4YZ2A 4E4SA 2B46X 2YGMA 3PTYA 1ULGA 1BCXA 1XXNA 1VBB2 5GJ6A 3ES4A 3KGZA 3VKFC 1BVP1 1H2LA 1WMDA 2DU0A 1N1YA 2XJUA 2RR12 5JWPA 3A0NA 1UKGA 3KS7A 4CEYA 2JKBA 3R4DB 5EJ3A 1LHOA 4HK8A 1WW6A 1X8MA 5CFDA 2PYTA 1DGRN 1R1A2 1VBE1 1KXGA 5FO8B 5H9RA 4CDXC 2G9GA 3MFCA 2D6OX 1H9PA 1QH7A 4IEWA 3AP9A 3RYKA 2AREA 3HAGA 4HN1A 2WNUC 5BY5A 1XNCA 4YFWA 5C8CA 3V0BB 1D0HA 1H4HA 1POV0 3D0SA 2TUNA 4QQPA 3ZX7A 2PLV1 4FTEA 4GALA 2JDZA 2DCTA 1QQP2 4BQ1A 1NA1C 4LBMA 3WVJA 4QXKA 3M1HA 1C8NA 2NYYA 4YW4A 4XYXA 2HEWF 4NHLA 1SLIA 3AJYA 3GHMA 4XFIA 5CNAA 4MH0E 4WM7C 4FPEA 4PIXA 4P9XA 1Y7BA 1GSLA 1NCQC 3VKMA 4Q4X1 4OI0A 3ACLA 3OY8A 3FLPA 5FCCA 1EAH3 1FMD1 4Q8KA 3S6PA 1Z7S1 4N53C 3URFA 2PHTA 3H50A 3B5LB 1PM7A 4KG0A 3RSJA 4M0HA 2HWB2 3NJZA 1MZ5A 1UX6A 1DDLA 1SMVA 1FV3A 2JG8C 1AL0G 2RS52 4TSVA 1SFYA 2ZHLA 4AFAA 1SBFA 4CDXB 4DPNA 2BW8A 3IDCB 4FPJA 2R061 2K0GA 1GZCA 1B35C 1X8EA 2EIGA 2ZMLA 1ASJ3 1H8VA 4Q4W3 5J98B 2WNUB 1OOPC 1EP0A 4XJ9A 4DXZA 3D0JA 2GALA 3BOPA 5FLIA 3VL9A 2ZGPA 4FVVA 4AQ6A 4ZU5A 1FOD3 1JXNA 1QJZA 3BOWA 1AUYA 1NA1B 3AJZA 1V9U3 4LE4A 1FPN2 5HCAA 1IKQA 4LLOA 1POV1 1UF2C 2SBAA 3WDTA 2BBVA 5JOWA 4E4DX 3OD0A 4WM7B 1UU5A 5ACA1 1RMU2 2ZHNA 4LNVA 1NCQB 5H9SA 4EWDA 5GZEA 3B94A 4BMBA 1LGCA 1JHNA 1D2SA 1OI6A 4ISQA 3T2TA 3AKTA 4N53B 2X5IC 3MZHA 5T5JA 1PGL2 5A3LA 1WLWA 3AMMA 3I7DA 3AZYA 4CEWC 3G7DA 2JG8B 4XFHA 1O5LA 4LULA 2JICA 3SCFA 4Y1UA 1NG0A 2GNTA 4YGCA 3BODA 2XUMA 1AX0A 1DQ5A 1NCRC 4GB32 2ZX4A 1LOBA 3GZAA 3VBUC 1JBCA 2WT0A 1RHI3 3VZKA 2YY1A 3NL1A 3RYRA 2GNBA 1ZZ9A 5KHIA 1F5JA 1RUH3 4SLIA 4B4QA 1XNBA 3AP4A 2PTMA 1PK6C 4LBQA 3ELNA 5T3NA 3JQXA 3WNXA 5DDJ1 3CLPA 4CDUA 2I07B 2XJQA 1WGPA 1O3TA 3H1MA 2VW2A 4WVZA 3MW4A 3Q9OA 3AKPA 3TN93 4GWNA 4EWAA 1VALA 2UWCA 2RMU1 1ENXA 4E2SA 1DHKB 3PVEA 3PVBB 1GFF2 5D8AC 2BEOA 3U11A 4AI8A 3ZIWA 3QOPA 4Q8LA 4COYA 1RIRA 2B39A 1PVXA 5IK7A 3WP4A 4J1WA 1FATA 4HPKB 3B00A 2X5IB 3OBRA 1NXMA 4QPYA 1Q8PA 5BYNA 2D6MA 3EO6A 4XW3A 5BPXA 4CEWB 5L73A 1PNGA 4OHZA 2PN5A 3JBG1 3R6SA 2W39A 4YW5A 1HW5A 1LENA 4JRLA 1PHMA 3AZXA 2AGSA 1O7FA 2BPA2 2C0ZA 3PMSA 2ZGSA 4IV3A 1NCRB 3V0AA 4AW7A 2KA3A 4Q4V2 3VKNA 1CAXB 3VBUB 4C0BA 1AXYA 3EBRA 3UL2A 2PQQA 4JTNA 1RVF1 1XU1A 2W68A 2DVDA 1UL9A 4P9YA 2A6ZA 3RNSA 2ARBA 4AVSA 1PK6B 2R071 3CU7A 4YVSA 4GKXA 1C3HA 1V6LA 3WLUA 4X6RB 1H4GA 2V73A 4W65A 5JZGA 1HDKA 2ZX1A 3FLTA 3IBMA 1AYN2 1H30A 4QMAA 3UKVA 2DUQA 3M4FA 3UKNA 5K0UB 4RR3A 4KU8A 3AKQA 3IWZA 3PJYA 3VBSC 5D8AB 2HWC1 4XDQA 3WXPA 2WS92 1Q5OA 1W39A 1AR61 1PO11 4GULA 2YROA 4B3NA 3RYPA 2GDFA 3ILRA 4Y4YA 4Q4Y3 5SV5A 1VBA3 1BEV3 2TEPA 3TRSB 3ZMOA 2MEV2 4YGDA 3RI8A 3PNAA 4GH4C 2BQPA 3W9AA 2ZGTA 2ZGMA 1IOAA 1ZBE2 2WKKA 3WG3A 1QXRA 1R093 1WW7A 1AHSA 2ZBJA 4D7SA 1L3JA 1HRI1 1AR71 2VY0A 4QQHA 2ZZJA 1LU1A 4EN0A 2XJPA 3CJIC 1J59A 1W6QB 2RE9A 1U5XA 5EYXA 4RHV1 4ES8A 1RUJ3 1PVC2 1RUI3 1RUG1 4N43C 1AJOA 1ALYA 4AI2A 1VRH1 2OUJA 3RZZA 3WDVA 1CGPA 3FC0A 4YZ5A 4XETA 3H1YA 1VBD3 4K6BA 1V00A 3RJ2X 1MR5A 5BNNA 3VBSB 3K48A 2R041 4FXKB 4NVPA 5GKAC 2CAVA 4G3YC 1DYKA 2OUHA 2EXIA 1N1SA 1RUE1 1AXKA 3JB4C 1XE7A 2EAAA 1LU2A 3QACA 4PLNA 2AYHA 3MIFA 1J1TA 3E5XA 3WDXA 2QNKA 4K7JA 4AVBA 1BZWA 3ZXKA 1D4M2 3LOBA 2GC3A 1IS4A 4QPIB 4K9SA 2GH2A 1SLTA 2WFF1 3I4IA 3USUA 4AWDA 1Z0HA 4G4FA 3CJIB 5ABJC 4I2OA 2CWMA 1VR3A 3WUCA 4Y1XA 3NV3A 4YM0A 1UIJA 5KHKA 5J36A 1AR83 2BFUL 3DPRA 2WSUA 2P34A 2F4PA 4XJZA 5FMOL 2EAKA 3ZFEA 3VKLA 2BVVA 2UY8A 2YHJA 4PDWA 1W6MA 3ROUA 1LHVA 1WCKA 2UWBA 3AYCA 3VLBB 2ETEA 4NWWA 4OI2A 3KMHA 4FPFA 1CAWB 1WCDJ 5JSPA 2ZAHA 2WNEA 3UKTA 3L9JT 3N7MA 4LHNA 2RM21 4LT5A 1A78A 1FX5A 2DURA 2WQZC 2PLV3 5E16A 1ZBA2 1CVNA 4HKLA 2HYKA 5GLUA 5I0TA 5JPNB 4AVVA 2DUPA 2LALA 3FBYA 3OBTA 2DU1A 2X29A 2ZJCA 4M3CB 4UXAA 1VBB1 2AUYA 3J8F2 1UPSA 1R082 4ZU7A 3WHTA 1H2MA 2Q5TA 4Y20A 4N9HA 2A3WA 1IS3A 1MS0A 4NWVA 1BBT2 1SACA 3IPVB 2GZWA 5ABJB 5KBFA 3AYAA 4D3WA 1OA4A 4JTOA 3VBOC 3MIDA 1FMD3 1SLCA 1XQNA 3B01A 3E5UA 3TNPB 1DG6A 2E6VA 4XJWA 2RS12 4DNYA 5GZGA 4E4ZA 1SBEA 1X7NA 4R52A 4FPGA 1ND3C 1REFA 1PO21 4S2HA 4Z1VA 3ZDSA 4YLZA 4YVWA 5A33A 4IQPA 1LEMA 4XFFA 5JI9A 1AL21 3ZO0B 1MZFA 5T55A 1N1TA 1QQP1 2JJ6A 4HK9A 4BCUA 2CGPA 4W6WA 5DUVA 2Q0AA 1EPZA 2KXLA 4H55A 1HXS2 1DFQA 3HIFA 4XBQA 4IV1A 3VDDA 2GU9A 1D4VB 1JYIA 4QGMA 4DRVA 5AFEA 4G9SB 4CDQA 5I8SA 2ATFA 3TOJA 4JGZA 2WQ4A 4XEZA 3JD71 3O0WA 3W58A 3H3ZA 3ZN5A 4AEDC 1X36A 5ACA3 2G9FA 3VBFA 2JG9A 1QJU2 5L36A 1GNHA 1S0IA 3TWIA 3ZVXA 3TYJA 3VBOB 2DCYA 2P3KA 1UIKA 4RSUA 4BLIA 1QJX1 2RS51 3GBWA 1H1IA 1LTEA 1F2NA 1OLQA 5J7MA 5BNOA 4PF5A 4XMAA 3VZJA 2MHFA 1WW4A 3OYWA 1Q8QA 2WNVA 4XTPA 3AP6A 4MXWB 4XBNA 2Y26A 3OJBA 2ZX2A 1AYM1 1ND2A 2KM2A 3U10A 2B9UA 1N3PA 2ZGQA 5A32B 3VBHC 1S0JA 2Q1ZB 5E88A 3WDWA 1IGOA 2FMDA 4YW1A 4LBQD 4NR1A 1V6IA 1LGNA 1AR92 1MEC2 4Z82A 3WDYA 1QNYA 3SNMA 1HX6A 1XYOA 3E97A 2Z5WA 5DDJ3 2UWAA 4K8FA 3BALA 4MVTA 5L19A 4CZSA 3B9IA 4AEDB 4HLTA 4SBVA 2DYCA 4QGNA 2A6VA 2RMU3 3MW3A 1PGL1 1E57A 1GYKA 2K2SA 1PZ7A 1ENQA 2JX9A 1U0AA 2YZ4A 3KT4A 3LA7A 4Z92B 4TWTA 3SH4A 3WINE 4CDWC 1RJ7A 4GB31 3ZFGC 4LA3A 4ZU4A 2VMIA 4RQPC 5C4WC 3OCPA 2DCJA 4LUKA 2A6YA 2GC1A 4D7YA 2R16A 4R8HA 5CBLA 1QWRA 4ATFA 3CEWA 5KC5A 1CAUB 3VBHB 1KRIA 2CL2A 1RVF3 5BUVA 2XJRA 2WZPP 2B8MA 3MIHA 2R073 1RINA 5F6KA 1GZWA 1B09A 1IKPA 2I45A 1BMV1 3LAGA 3M3IA 1FAYA 2PA7A 4E2QA 4NN0A 2EVXA 1KQRA 2HWE1 5C9AC 2EA7A 1O5UA 3ZSJA 5JIUA 1JH5A 4HL0A 2IFRA 4U2AA 1N3QA 3GYDA 3RS6A 5SV8A 1G9FA 1VB2A 4I3GA 4ORFA 2HWC3 1XRUA 4JAAA 4Z8BA 1AR63 1PO13 5LRRA 4FBFA 5I8TA 4S2GA 1V6OA 1EAH2 3KB5A 4CDWB 4FOVA 2RJKA 3MIEA 4Q1PA 4Y26A 3ZYRA 3POWA 4RQPB 3O0VA 4X8NA 5C4WB 2XL9A 4FOWA 3ZFFB 1HRI3 1AR73 1OLRA 4HT1T 4Z07A 5FOBB 1HIXA 3B69A 2QKDA 1JTZX 2PHLA 4FO9A 1RUC1 3PMEA 4BWOA 1ASJ2 3NVCA 4Q4W2 5KXBA 1UU4A 3WG2A 4BH9A 2BWCA 4RHV3 4DZGA 1UN1A 5KHJA 1RUG3 1VBC1 1YNAA 2ZPXA 3BIWE 5T52A 4KG8A 2DFCA 4OHXA 4YGEA 1EY2A 3WCRA 4AQ2A 1VRH3 4PJYA 2XJTA 2NM1A 1FOD2 4JRAA 5H9PA 5C9AB 4CYDA 2E63A 3V0BA 1MS4A 1V9U2 2FQPA 2GC0A 2WS91 5AVAA 3ZXLA 4XMIA 2FMYA 3N36A 2WJSA 4PLMA 1ENSA 1MQTC 4Y1YA 1QGLA 2XG3A 4COWA 2GH8A 4Q2FA 1KJRA 1IS6A 2D98A 4L99A 2EXJA 5JCTA 1Q43A 1SQ4A 1ZZBA 5BXXA 3ZXAC 4F8AA 2OIIA 5JAXA 1COV1 5LEKA 1CPNA 4K1YA 2NP0A 3OGGA 4HN0A 5LK5A 4YG3A 4QPGC 2D6KA 5GZCA 1QDOA 5JVVA 1UW8A 2A70A 1SEFA 3H7JA 1OA3A 4FP2A 1DF0A 2DTYA 4XBLA 1PGW2 4GKYA 5LK7B 1QJY1 4YM1A 2Y0IA 2EF6A 1YHFA 1WCSA 1OKQA 2YUEA 4UW3A 2WFF3 3WP6A 2EXHA 1ZZ6A 3JCIA 4MXVA 5CFCC 1QMJA 4CDXA 2D6PA 3RJRA 4GMP3 5JR7B 3NW4A 3USSA 1CX4A 1O4YA 1RHI2 1YJKA 2ZX0A 3BU7A 2V5YA 4AEKA 4H7LA 1RUH2 1TME3 2WNUA 4LBJA 4MGYE 3CNAA 4LLFA 5CG9A 3VBRC 3AM2A 1NA1A 1IPKA 4AQSA 1MQTB 2DCZA 3LSEA 4YFZA 3ALQA 3R0RA 3RG0A 2DVAA 2DVFA 2ZGNA 5DG1A 5KHGA 3TN92 1Y43B 2E7TA 2XVKA 3WP3A 2O8OA 4KU7A 4IESA 1FI2A 1LODA 2E9QA 2RM23 4WM7A 3RMYA 4FAGA 1NCQA 3VZOA 1AZDA 3NSTA 2PAMA 2BYVE 1ZYBA 3MPPG 1YXWA 4QPGB 3I8TA 4EN8B 3D8CA 4N53A 1U5ZA 4AFDA 2XWJB 3WZ1A 3DF0A 1AVBA 5FPXA 2IXKA 4QM8A 1GNZA 1ZREA 1LHNA 1PZ8A 2A3XA 2VULA 3WDUA 3R4SA 3RWNA 2JG8A 4YM3A 4AI3A 3KCCA 1DU3D 5CFCB 1LKNA 2A6XA 4OUMA 1BQPA 5BNPC 2DVBA 1VIWB 2GN7A 3ZXEA 2VUJA 2VQAA 1VAMA 3U07A 3LWCA 3SH3A 3KT7A 2O0OA 2VMGA 3J4UH 1YRZA 3MPBA 3J9SA 4GIQA 5JIAA 5J48A 4FPCA 4PQ9A 2WA3A 5E89A 4FTBA 4LHLA 1PO23 3INAA 3S7EA 1RGSA 1BYHA 3LSDA 3VBRB 4WVWA 5FOJB 2PHRA 1LHWA 4HZFA 1B35B 1AL23 4YZ4A 2VPVA 2HWD3 4YGBA 4AG4A 1RUD1 1ZBA1 1QQP3 4LO7A 3NKGA 3AMQA 1OOPB 4I0AA 3KGLA 4N7IA 2XLFA 1VLNA 2A3YA 3B9CA 1NOVA 2D3SA 5DUUA 3I59B 3FBMA 3VV1A 3SHRA 1R081