2G9HD

Crystal structure of staphylococcal enterotoxin i (sei) in complex with a human mhc class ii molecule
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
213
Chain Sequence
IGVGNLRNFYTKHDYIDLKGLIDKNLPSANQLEFSTGINDLISESNNWDEISKFKGKKLDIFGIDYNGPCKSKYMYGGATLSGQYLNSARKIPINLWVNGKHKTISTDKISTNKKLVTAQEIDVKLRRYLQEEYNIYGHNSTGKGKEYGYKSKFYSGFNKGKVLFHLNDEKSFSYDLFYTGDGVPVSFLKIYEDNKIIESEKFHLDVEISYVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of staphylococcal enterotoxin I (SEI) in complex with a human major histocompatibility complex class II molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 67
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2g9hD02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2g9hD01
1EU3A 1LLRD 1KTKA 1YN5A 4L63B 1V1PB 1JR0D 1RDPD 1JWSD 4RHRA 4RGOS 1F77A 1S5DD 3CHBD 1LT4D 1S5CD 3V05A 1FGBD 1FD7D 1PRTD 3DWQA 1EEID 1KLGD 1B44D 4BWGB 1BCPF 1ET9A 1ET6A 1EU4A 1I4PA 4L6TB 1FNWA 1TS4A 1G8ZD 1DYQA 2O2LD 1PZID 2R61A 5ELEA 4DXGA 4C56C 1SE3A 3MC0B 1ESFA 4RFBA 1PRTF 4DXFA 1PTOH 1LT5D 5FKAC 1FNUA 1JWUD 2SEBD 4OHJA 1SEBD 4K6LA 3KLSX 1PTOC 1SBBB 1JWMD 1LTSD 1M4VA 3BVZA 1LT3D 3BZDB 4O1NA 1HA5A 5FK9C 1I4HA 1PZJD 1SE2A 4ZYSA 1LTAD 3GP7A 2Z8LA 2J4XA 3BYYB 1S5ED 1S5BD 3EA6A 3R8BA 3O13A 1XXGA 2XN9C 4RGNA 1PZKD 4RH6A 1T5XD 1JCKB 1SJED 1LTRD 1LO5D 1TS5A 1V1PA 5I4DA 2RDGA 2QEJC 1JQYD 1MD2D 1STEA 2AQ3B 2WV6D 5D3DA 1EFID 5TSSA 3BVGA 3R2IA 1YN3A 1PRTB 1TS3A 2XRQD 4NZLB 1BCPC 1FNVA 5ELBA 4Z9CB 1CHPD 1D6EC 1YN4A 1TY2A 1LTTD 1RCVD 2AQ1B 2IJ0A 2QILA 1B1ZA 1BCPD 2XNAC 1LTID 2NTTA 3BVMA 4UDUC 2IPKD 3W2DA 4RGMA 1I4RA 1HTLD 1KLUD 1PRTC 3MFGA 1V1OA 4RHSA 2NTSA 3DWAA 1D5ZC 1LT6D 1LTBD 1RF2D 1AW7A 1D5MC 5D3IB 1PTOF 1CQVA 2CHBD 1I4GA 1PYWD 1TS2A 1UUPA 2AQ2B 1AN8A 2TSSA 3SEBA 1QILA 2ICIA 2XRSD 3OWEB 1L0XB 1RD9D 1BXTA 1ENFA 2RDHA 1EEFD 1CT1D 1TY0A 1PTOB 4RGTA 3URYA 2G9HD 1LTGD 1SXTA 1CK1A 1D5XC 3BYTB 1EWCA 5ELCA 1PTOD 1S5FD 1BCPB 3R2TA 1SJHD 1UNSA 1I4XA 3DWPA 4RCOA 4TSSA 5ELDA 3EFXD 1L0YB 5ELFA 1DJRD 1SE4A 1HXYD 1XTCD 1I4QA 1GOZA 1CHQD 1HQRD 3TSSA
chains in the Genus database with same CATH superfamily
1SN8A 2BB6A 1VCBA 3HOYB 4R4OA 2WB1B 4X65Q 4MH8A 2WAQG 3VYSA 3GTPH 4RHRA 1E7VA 2H88B 1KQSA 3KUPA 4KV6A 5IY0A 4JI0Q 4BKSA 1MGSA 2C7MB 3CKIB 3CHBD 3Q69A 3AB5A 5IOIA 1FGBD 2PI2A 3MZ5A 3RPFC 3P75A 3S1MB 1EO6A 1QOFA 2KKCA 2SNSA 4UP8A 1FNWA 5BN3A 3KF8B 4KGRA 1L5PA 1Y1VB 4DBGA 1XEEA 2LRUA 4GDKA 3KFUA 2F0FA 2O2LD 5LXHA 2G4SA 1SIJA 4GKJL 3MXNB 1C0AA 4K2LA 2FMCA 3D4DA 1R7SA 1II3A 4LF7Q 4QJFA 1KXLA 2J7QB 1SNPA 1T0YA 1K53A 4C3JG 1BO0A 1PFBA 3CC4A 1BR9A 3I4NB 2F0QA 3OG5A 2OQKA 5EBDA 2EY5A 4RG1A 1KRHA 3ZTDA 3GV3A 1UGJA 2CKZB 2FFKB 4GLXA 3KQ4A 2K5WA 1L6UA 4A93G 4KN7C 5JVG3 2JZZA 4C3IB 1GAQB 1STAA 1WX9A 3NWTA 3GTLH 2F3VA 1S5ED 4DPGA 1WCMG 3STBC 4BBRB 4BY1H 1WFYA 3Q3JA 4DV4L 1LV9A 1IXRA 4A3IG 4B08A 5EE3A 2RF4A 3HEJA 1HUMA 5CV5A 2RDGA 5I2YA 3KJOA 3UI3A 4WJWA 1IBLQ 3HOYH 1LYLA 2K05A 4FA6A 4DUZQ 5D3DA 5IGDA 4L5RC 1ZXHA 2QMTA 3A1QA 3HG9A 4YWGG 2KO3A 4HJ8A 4LLGM 1MHXA 1FL0A 2XK5A 3BDLA 1IBMQ 5E6OA 5LXIB 2E2HB 2WDQB 3VTVA 4GN1A 1E2WA 3R93A 4L5QA 1H8CA 3VYTA 1Q46A 2IPKD 3NTIA 1J19A 1L2NA 4GB9A 2Q2UA 1PA6A 2OOBB 2EOTA 2VNUD 1N60A 3OOCA 1HPCA 3MJWA 4WAFA 1GUNA 3QIAA 4ZAIA 5M3MB 3I5JC 4ZUJA 1WGYA 1CSQA 1EF5A 1JW9D 2REXA 2WB1G 1FIQA 4ICUA 4F8CB 1STGA 3P4RB 4FF1A 1X3QA 2BGFA 1CA5A 1IBKQ 1YX5B 3TEZA 2Z1CA 1TKYA 1D3ZA 2INNE 2IO2B 4US8A 2ICIA 1TU2B 1C1YB 2JZPA 4JI6Q 3QC8B 3UQAA 1L0XB 3LB8C 3PO0A 2KJ6A 3R3MA 2B3GA 4RGTA 2JA8H 4I6LB 3J81E 3BJUA 5AZGA 3J7ZC 3KUDB 4X3KA 2Z0DB 4B6WA 1EWCA 2Y5CA 3ZJTA 2CHXA 4JBMA 3PUXA 2BTEA 2PIAA 2VH1A 4XZ4A 1XLPA 4EVOA 2F0VA 4J3OD 2ASQA 4KGTA 2PEAA 4H02A 1GB1A 1E90A 2YTYA 3NHEB 4DU9A 3CSFA 4CQNA 3T8MA 3TP5A 1EY8A 2FCQA 5LMUL 2KJRA 2UXBL 3T1HL 1UE6A 1BUIC 1Y8RC 3K9OB 1UBIA 4L63B 3V3XA 3ZXRA 1I94L 3NK9A 1G291 2VY3A 2V4DA 3G6JB 4JC0A 1S5DD 1GUTA 2Z9HA 2KQSA 1VDZA 3JSVB 5CMDA 1LT4D 2F0EA 2BYTA 2W3SA 5KHOA 3U7ZA 3GTJH 2FE8A 4DR4Q 1VZ7A 3VR2A 2BH2A 2MLBA 4MTNA 2WXNA 2HUGA 3JC66 4TKOB 4KMUC 4A3KB 1VQIA 5C5LA 4LNIA 3M85A 4EZLA 3R3OA 3EVQA 4POGA 2O2VA 2RPQA 2NVQB 4HPPA 4W9FA 4WJNA 1XMQL 2B2TA 1B50A 1SNDA 4ME3A 4C56C 1OGWA 3MAQA 5CC4A 1FPYA 2DY7A 2R92H 4I6PA 3QCAA 2WDRB 4PMWA 5FKAC 1FNUA 3ULPA 1OQQA 1B53A 2ZVOA 2KQ4X 2JA6H 3U4ZA 4JWSC 1M4VA 1TQOA 2V4IB 3NS8A 1RODA 1NUCA 5L37A 3GP7A 3OMGA 2KQ3A 3W1GA 3AMUA 1LM8B 2J4XA 3LYYA 1ESRA 5IYBH 2LSSA 3RZDH 3EA6A 4NJ6A 2XN9C 2D5GA 1P7EA 2V4LA 4HDOA 1KLVA 1H9JA 2Q2TA 4RA8A 5HFYA 5EE9A 4GLVB 3KBGA 4ARCA 1JQYD 3KH0A 1B3AA 3IKJA 4BY7H 2M4NA 4A3OA 2VUMG 3PGEA 3GTKB 4TQ1A 4K5VA 2YU9B 1YN3A 3H8HA 2F0GA 1T0SC 4XX5A 5CBEE 2WXJA 1DZ1A 2DZJA 2ZM6L 2KFKA 5D94A 3S1RB 1DOXA 4N9TA 1LTTD 2K8CA 1CZGA 2JWUA 2EYJA 1K8GA 3ZIMA 1L0WA 1HTPA 4YY3Q 5M5YB 2LHEA 4PG3A 3ZJYC 1HTLD 1VJKA 2BF8B 1VQBA 5EGTA 1PH8A 3GTMH 3RCZA 4GSWA 4LF6Q 4FXGC 2KWVB 4HMIA 4LFBQ 1CFMA 4ME5A 3Q22A 3DVNV 2A6ED 2TMPA 2FUHB 5J17A 2FJ2A 4DNIA 2JYOA 1N61A 2B39A 3EC8A 4LNNA 2XBBC 1EQVA 5IP7H 1WVLA 2PQEA 4TRDA 4IN3A 4KK7A 2PVOD 1FYCA 4ACFA 1R4NI 2NN6I 5JJIA 4RWSC 4AUQC 2MBOA 5ELOA 3NVYA 4NKLA 1B9MA 1SYCA 1UZXB 1GO3E 1V97A 1EEFD 1KAAA 4HTHA 3W5OA 4A3CH 1C4AA 1I6HH 1FXTB 4MGKE 2JUOA 1CK1A 3VA7A 2WP9B 1VQ9A 3S1MH 5D14A 3AEEB 3DLLA 3RNEC 1N33Q 4YWMA 5KEEA 2ZW1A 1DXMA 2I5LX 1H9SB 1VZ6A 4LCDE 2M2LA 3W3AA 2DZIA 3ML8A 4GNXC 3DVNU 3NOBA 1X3EA 1Y56A 2DBYA 3B2FA 1GJZA 1W6JA 1FCLA 1DJRD 4A93H 2QC8A 2GB1A 1PDXA 1BBWA 1HNZL 2WU5B 3IG3A 1QZEA 5AUIA 2VUMH 3BK2A 1VRAB 2F4IA 3I63C 2O2VB 2LUMA 2PMZB 2A1AA 2F4VL 1LQBA 1WFQA 4Y7NB 4USAA 1QCBD 4JI7Q 1A5RA 1XMQQ 4A3GB 1A3UA 2IT1A 2GBRA 2NR2A 3QO2A 1S5CD 2KA7A 2CU3A 1F9QA 1G2SA 1P3QU 3MEFA 1A8VA 1X6OA 4ODGA 1VQGA 1SB3C 2GLSA 3NG0A 4ANXA 5IGGA 3ZXVA 4G7HC 2E2JB 2PKOA 4RM8A 2JQRB 1HR0L 2HD5B 3KW5B 3N20C 1DYQA 4WJ3M 2G1EA 3NJTA 1SYDA 3S17H 4AQ7A 2LY7A 2FHTA 1WTWA 2UYZB 2ALYB 4HLEA 2A68D 2DENB 2CWAA 1KRTA 1VQ6A 2HT1A 4TQUS 3E3XA 5IIFA 1HZ6A 3DHHC 1LT5D 3W1SC 1QVFA 4XQJA 4IUQA 2KJHB 3JW0X 5IYCG 3PO3G 1PTOC 4MIUA 4U68A 1SDFA 3UE1A 4B3MQ 1GD7A 3S14B 3PO2B 2MBEA 2NBVB 4IUMB 4GKJQ 3JAMc 2L1AA 2WAQB 1QJOA 2W3RA 2MJDA 5M3MH 4BBNF 2N3SA 3RZWC 4PMCA 1X32A 3G6EA 3PSEB 1XXGA 4LF4Q 4W9GA 3A8KE 2WHIA 1RTNA 1LTRD 1LO5D 3CQZB 3IAS1 5C2TB 1E8ZA 1SFOB 3GS2A 4NQKE 3J81i 2NS5A 3NZUA 3AU5A 2L9HA 2DZKA 4L5TA 1N32Q 4X57B 1U0LA 4UHVA 2EYFA 5E3FA 4HJ9A 4OL7A 1LGRA 2WXMA 5DEHA 4QQBX 3PO2G 1V80A 2PNRC 3R7QA 3UDGA 3BDCA 5J18A 3RZFA 1F1HA 2GRIA 2PQAA 2KMCA 2OJRA 2KHSA 3RUIB 1LTID 3MTSA 2BKRB 1WM2A 2D0PA 2K1BA 3K7AH 4DUZL 2PPBC 2WXFA 2VB3X 1VQMA 3H3VC 1WGKA 2DYMA 2YVCA 1MPEA 5C0XH 3RN2A 1PH7A 1GB4A 1IPGA 4MT5A 1UBQA 2KOXA 4P2CB 4P6VF 4WJ4A 1EQTA 1WJ4A 4Q5VA 1UUPA 5AJ3Q 1R4NB 2AL3A 4F88A 3Q3NC 3I72A 2NZOA 1RFKA 1J9OA 2JX5A 3I4OA 4DXAB 1UE5A 1GKHA 2B29A 2LZ6A 2Z59B 3NTHA 5J22A 1UGMA 3AQQA 1DOLA 3IFTA 5CV8A 5ELCA 2PMZE 1IW7D 2VB2X 2V1CC 3S1NB 4DV6L 4KLKA 2F4VQ 3UGBB 3CW2C 3EFXD 2WACA 5E4WC 4DN4M 2NVQH 1NAPA 2KD0A 4JI8L 4HCSA 1FGUA 1SE4A 5G5HA 1XTCD 3K81C 4IG7B 1HQRD 1M1KC 4MH0E 1AP0A 3D32A 2EY1A 2KVMA 3T13A 2XEWA 3M4YA 1YN5A 2J7ZA 1A3VA 5C44B 1A2UA 5EPJA 4BBSB 1HR0Q 2KX3A 3I3TB 4YTMB 1OTCA 3SE0A 4IFDH 4IUPA 4LK0M 2BYEA 2NBUA 3KF8A 1WE7A 4JI4L 5KIXA 4IUNA 1AE3A 2D9UA 3A56A 2R93B 2DWQA 3TEYA 5FLXL 5JJZA 1GJXA 2Q8TA 4DK6C 1WJUA 2J0KA 4AP4C 2A5HA 1V6EA 4HN7A 1V8QA 2MP1A 3T1HQ 1E5WA 1XX8A 4F8MA 2HD3A 1G8ZD 1YQ4B 1CZWA 1ZEQX 3V96A 1KM7A 2KVZA 2WAQE 4F87A 1C7YA 1PDQA 3I73A 3AE6B 3T53B 2MBBB 2KTFA 2MCNB 3NBHB 1PH2A 1JJCB 4DR4L 1IYFA 1LABA 1HA6A 3NVZA 3H09A 3HZXA 3D31A 3NENA 3E6ZX 2GBNA 2PCFB 1HNXQ 1SEBD 3U52E 1A15A 2FXQA 2ES2A 4DR6L 2JT4B 2PI2E 2EYLA 4YTPB 1LT3D 3BZDB 2WLBA 3TUOA 1I35A 1H9KA 1I4HA 2MWSB 3SVMA 2VRRB 3ONSA 4NAMA 4W9CA 4DDGD 2Z8LA 3TIXA 4XXEA 3L13A 4N8FA 3QG1A 1S5BD 3KK7A 1F2MA 1GVPA 4DR1L 3STBD 4GGQA 1KAWA 4X66L 1XQQA 2R7ZH 3ZUNA 4P71A 5C4HA 2K5PA 4HR7B 2F0JA 2L5TA 3I56A 4DV5L 3X0WA 2K8BA 3W1SA 3LJ3A 2CW0C 3R7RA 3BVGA 3HVZA 2XRQD 2X6LA 3BWUD 4GOPA 4PK1A 2KDBA 3GTPB 4ZRKA 2IJ0A 1AYFA 1A6XA 4HJ5A 4JI5L 4NP5A 4RMFA 3DBSA 3L54A 2VL6A 5JHAA 2KCNA 2VH2A 1YBYA 4B3TL 3JSVA 1PRTC 2JXTA 2E3TA 3HRDD 3KDFA 4MJSA 4YCWA 3RZDB 3O65B 1VQHA 2OTJA 2JY6A 4WWPA 2I1KA 5FJ8H 1FVIA 3K59A 5CHWA 1EYAA 1EY7A 1QG7A 3DXJC 4LF9Q 1I4GA 2AQ2B 1WGDA 2CH4A 4GMVA 3FP9A 2CVRA 4AYBG 4CDEC 3B1LX 4M0WB 3OWEB 3Q6SA 4NB3A 3IL8A 1R4PB 3M4PA 5T1IA 2ZZPB 1OFFA 1HZ9A 1FFUA 3AEFB 2EYPA 1ONLA 4PS3A 1LTGD 4LFBL 4FXCA 4HWIB 1UWVA 4WQOB 3S16H 1OXVA 4XDCA 1PTOD 1FJGL 1BCPB 3VR3A 2E2JH 3AE3B 4JOIC 2B63G 3H7PA 1SE9A 1I4XA 3CAMA 4EGVA 3RNCC 1O7IA 3PUVA 3WANA 1EL0A 3C8YA 4YT0B 2ZEQA 5FLMH 4A3EG 5C3EH 3AMZA 3KLRA 2Q8RE 4MEMA 1B7YB 1ILPA 1F9JA 1X1MA 2NPTA 2AEHA 4YIJA 2M56B 2LFIA 4ALPA 3Q24A 4K5XA 3PIOA 2AYOB 4ZHOA 1ROEA 2VZKB 1D1KA 1JOQA 4S17A 1VCIA 4KIKB 3WOFA 2HCIA 3AXCA 5CR3A 2O6VB 1GUOA 2D2CC 4IWQA 2L0TA 2AL6A 2M19A 4BWGB 4A3BG 4A3IB 1ET9A 1WY8A 3K5MA 2O4XA 2K50A 3KDFB 3JAMi 1GC7A 3Q23A 1D2BA 1QKZA 1E0ZA 1HZBA 1S3OA 1J7AA 4OO1G 4A90A 3IXSA 2A19A 2WINB 2L00B 4EFOA 1KNEA 2B3AA 2VW9A 4DNRB 1IBXB 4DAYA 2KDFB 1YVCA 4MGYE 1Z2MA 2ZTDA 2LJIA 3GE3C 3EFUA 5CORA 3KLSX 2UU7A 5DM73 3Q14C 4GLSC 3D6WA 2EJMA 3F2BA 4J6HA 4R8IA 3HKZB 2L05A 2L0CA 3PTFC 5GAGC 2BE5C 3DBLI 3M7NA 1K3RA 4OONA 1TWAH 3CCSA 4FHKA 3J80i 1V5TA 3ZRFA 2FCNA 4HDQA 4BKTA 2L32A 2HIXA 1GXDC 4KKSA 2MQJA 3RZOB 1QT9A 3HUIA 3ND8A 4HCPB 1A3TA 1V1PA 3ZQ4A 3NQIA 5A2QE 5C3EG 1YHQA 1YJ1A 4P1BC 3NZ3A 4D2KA 4HSVA 2R2QA 3A5UA 3WAOA 5M3MG 4A75A 3EGRA 1KDAA 1IBLL 1C76A 4GDKB 1PYBA 2KCTA 5C44H 5E6PA 3ZNID 1GUSA 2AHOB 1F2LA 3KYCD 1L7YA 5FJ8G 1JJ2A 4LF9L 2DZMA 2R93H 4RGMA 1ASZA 3DVGX 1I3QH 1WCMH 2NVYB 1I4RA 4YHHQ 1Y1VH 1JT8A 2E75C 2VZKD 4NXNQ 2INCC 2EMSA 3A33B 3MFYA 1D5ZC 4LJPB 1LXDA 4DV1L 4BZAA 2D3GA 4FULA 5EAYA 1CTMA 2N1WA 4IO9A 4MDKE 1QE6A 4IURA 3A4SC 4BBNC 1TR5A 1WOCA 2Q5WD 3BK1A 4A3FB 1X9NA 4GOPC 2D07B 2EKEC 1GG3A 1ENFA 3BZCA 4ANWA 2UUCQ 5LMNL 1D7QA 4OZBA 1TKWB 4AJWA 4F7XA 1SXTA 1D5XC 3PUZA 2D62A 3NUCA 3GTLB 3N9YC 4XC2A 3ZDMC 2N88A 4EX5A 1UNSA 3GZNB 1NSNS 1SNQA 2EDGA 4RCOA 4IJLA 4HXDA 4PMBA 2CQAA 4AYBE 2K1FA 4AH6A 3WWVA 1PH9A 3M3YB 4NW2A 4LTUA 2JQOA 3BIID 4KHPL 4K5WA 2R7ZG 2DLBA 3PIP3 1R4MI 1WSPA 1EY0A 3AFQA 3DBRI 3GB1A 1EU3A 1LLRD 1EUJA 3I90A 2M8SA 4BKGA 1VMCA 2F1MA 1EFWA 1MI2A 4H2AA 5CV9A 1BF4A 2J0TD 1K83H 1P16A 1K0RA 5C4JH 2LGYA 2I46A 2YU9H 3CMMB 1MKHA 4TKNA 5EKKA 3N3KB 3DBRB 5AUKA 5BYRA 2E5LQ 2KYWA 1UEBA 3TS0A 2R7DA 4IFDG 3V05A 1RYJA 3ALBA 3N1XC 2RQXA 1NJIC 3GTGH 3DWMA 1KLGD 3I57A 1K51A 3PHWB 1T3QA 4FDBA 3DVGY 2GVBA 1ZXIA 2MJ3A 1SMYC 4WFN3 4NAWB 3ML9A 2DUDA 4WQMA 1MJDA 1TWCH 3FKYA 4R3DA 2IX3A 2KLGA 2R61A 1HFNA 2K4KA 2QDBA 4FXKC 1TBEA 1HHVA 4MTKA 1FD6A 2EYOA 4CDFC 2GI9A 4N9F4 4B0EA 1XPOA 1CKNA 3MXGA 3MJ5A 2LVQA 2F0WA 4R8NA 3N32A 4BOZB 3PZDA 2EZVA 2I5MX 3SFEB 1SBBB 1TTNA 4LDTD 3AN1A 4Q0FA 5C4XH 1GNUA 1PZJD 2EMTA 5J39A 1EF1A 4L2YA 1AH9A 4MM3A 1K52A 4DNTB 3N1YC 3O13A 4A3MG 1S40A 2OJWA 2F52A 4L8JA 4S0RA 3IVFA 1MVKA 3PV0A 1VQ8A 4RNAA 3ICEA 2LGDA 3G48A 2D3CA 3DPDA 2WS3B 1NR2A 1PH3A 2AQ3B 3H9DA 1Q8KA 4YHHL 4CDDC 4DR3Q 3AE4B 3PLUA 3KWLA 1XT9B 4NXNL 2EJGC 1R9TB 3KVFB 5TSSA 1PH6A 2WXRA 3UDFA 3R2IA 4JI2Q 3MXUA 2IWHA 4DV1Q 2R3ZA 5FLMG 1YN4A 2L76A 2NVXH 3QWZB 3BZKA 3HOZB 1RAXA 2B63B 3OYYA 1DD2A 2Y5BB 1HNWQ 3QOJA 5EDSA 1QB5D 2BE5D 2KEDA 4A3BH 4WIPA 1V1OA 3ZVVA 2JK8A 4QY7A 2LGXA 4OVVA 2MGSA 5M5WB 4A3IH 3VR4A 3OAWA 5C1ZA 1E22A 3P42A 3VRBB 1NMGA 3EN2A 2N7DA 1XNRL 2EXDA 4AJYB 1N5WA 3E9HA 3PF4A 1AN8A 1HCZA 1HH2P 1B70B 4EEWA 3AV8A 2G3QB 2XSCA 4CKEA 3SR6A 3I4MB 2M0AA 1PTOB 5JEAG 1FFVA 1TZ1A 1XMOQ 4JI3L 1CSPA 4S3SA 1PUTA 1Q3LA 4KY6A 5IYDH 2F0PA 4NJCA 3U9OA 4QUFA 1YJIA 2HDLA 1C4PA 4JK1C 3PRMB 4TUUA 1U4RA 4K8JA 1NYRA 1HEZE 4R1JA 2VQFL 4A3BB 3KJPA 2KDEB 3VH3B 2O5IC 1XO3A 1HXYD 1B9NA 2BA1A 3QQ8B 2NVTB 3H15A 2WWZA 4YL8A 5JEAH 2BCOA 1KTKA 2UXCQ 2LVPA 4HCEA 3Q3FA 1YIWA 3RNBC 4BY1G 1WH3A 1RDPD 3FKIG 2KN5A 5KNDA 3A74A 3RUZA 3TZDA 4B0MA 2D2QA 2IW3A 2PO4A 1LUZA 1TKEA 5JH5C 3X23A 3A9JB 4XE0A 1A2TA 2KHIA 1Y69U 2JA5G 1JB3A 2BA0A 3KF6B 5G3LD 3CP0A 4JPBW 5IYCH 4C3HH 4JI7L 3PO3H 4K7WA 3L4PA 4C2MB 3T56B 2LASA 2F0IA 2QKIC 4R4CA 3VTWA 2B2WA 3L10B 1X3GA 2KACA 4LAAA 2C9WB 3CCMA 2ATWA 4IQZA 1NY4A 2K32A 4M01A 4JYAQ 3PREA 2PNHA 4NJ7A 4BFRA 1YHBA 4KY5A 4EE2A 5I9OA 3D4WA 4XQQA 1MG4A 2ZTEA 5KHQA 2ZVNA 5EPKA 2E2IH 3K80C 1B4OA 3DUZA 4YWKA 1NI2A 4LW1A 2F3IA 3QAQA 4KKUA 4DV7L 2F0DA 3UE0A 4BAXA 1K73C 2VQEL 1JWMD 1QVGA 3BVZA 3N52A 4A3EH 2NVUI 2OHFA 3NELA 4JBKA 3CCLA 4IOAA 3HOVG 3Q3OC 1YNJD 4P1CC 4ZQ3A 4HEA1 2DN8A 3A5ZB 3R8BA 4W9JA 1IGDA 1EUVB 2M1MA 1SJED 3FILA 4DFAA 3TMPB 1SRUA 2K5VA 4NDXA 4A3LG 1BUVT 1I6VC 1BQQT 1PGXA 4C3JB 1SLJA 1LACA 4I65A 4KGSA 3S2DB 2HIVA 1YJJA 4DKAC 2ONQA 5FLXc 4NXML 1AE2A 1H9RA 4I7AA 2GBJA 2JPHA 5CTRC 4NZLB 2G9DA 3FMCA 4A3JG 4MM3B 3CRKC 4LNKA 2RCNA 1B1ZA 3C3LA 2L0FA 5FO8B 4DHZB 4A3FG 2N7EA 2Z0SA 3W2DA 4C1NK 5M5XH 2K22A 5JPNC 4IDIA 2EELA 4UP9A 3UDIA 3Q8DA 2FNJB 3PRPB 1X54A 1O80A 1MG8A 2W55A 3HOWG 1STNA 5C5MA 3Q8EA 1XMOL 3A54A 4GN5A 1J5EQ 1E2ZA 4PYUA 3EJIA 2B2VA 2D11A 1ZOYB 2CHBD 1I7HA 1P8LA 2F3WA 4EQPA 3C1FA 1WTHA 3J80c 1V8CA 1L4ZB 2KWDA 2PVGC 1V9PA 2K6AA 2LS01 5C3XA 4GNXA 2A8VA 3GZNI 1C9OA 2QW7A 3HOVH 2ENBA 3QR8A 3DM1A 2ID0A 3H91A 1PHJA 3MEHA 4IPCA 2JWZA 3EFCA 1XWEA 3P4PB 2I07B 1G6JA 3PQIA 1I50B 4L23A 1SJHD 2R92G 1TWHH 3RZOH 1WR6E 5M5XB 3DWPA 4PZ7A 1HTOA 2ZTCA 4IALA 1TWFH 5E1FA 3CCJA 1LTLA 2K8HA 3NE5B 4EQ5A 5J2RA 2UUCL 1ISNA 1UH6A 4W9DA 1OO9B 5KYIA 1AARA 4OELB 4AQYQ 1AZPA 2Q8IB 1PMRA 3WALA 1ILQA 4LUVA 2IBIB 2RSUA 3AH7A 3HVDA 1VQ7A 2LRWA 2LXCA 4YCUA 2K39A 3W5UB 1V2YA 2GA4B 5CHFA 3T9LA 1J6QA 4ASWC 1MSHA 2CH4W 1TYGB 1J8IA 2VXWA 2UXDL 3NP8A 4JI4Q 1V81A 5L95C 3EQLC 1SYEA 3RMHA 2ZCBA 1IL8A 1L2FA 3PHXB 5HY6A 4DV7Q 2MBQA 4CJ0B 3QIJA 3C19A 1DGSA 3S15B 3QA8A 4U673 2FAZA 1HTQA 1XTDA 5ELEA 1DM0B 1XCQL 3GTKH 4ID6A 3U50C 1FXAA 1YQ3B 3CD6A 2J52A 1EY9A 2HQEA 2SDFA 2Z6KC 3K6OA 5HGTA 2LHDA 5G2NA 2XVSA 3MHSD 1N62A 4K6LA 1Q1OA 4ZLTF 3NY5A 4TMAB 2RHQB 4HJAA 3NUHB 4HMJA 3N1ZC 3OJ4B 1ASYA 4DR6Q 2G45B 3DBLB 2Q2HA 2JF5A 4CYEA 3V6CB 2K5NA 1TIID 3BDOA 3KF6A 4NXMQ 2CJOA 2WGSA 1UELA 3W9CB 2DJGC 4IPGA 3OTOQ 4P16A 3CF5A 2BH8A 1L1OC 2CFMA 1T5XD 1JCKB 3RT3B 2JYEA 3UIPB 1WI5A 3AB9A 3RLOA 5I4DA 4ZYNA 4DV4Q 1U4AA 2WXOA 4AYBB 1STEA 1CQFA 2N55A 1B8AA 2A68C 4X66Q 1Q5WB 3CPWA 2FCSA 3B2GA 3LGJA 1JOKA 1N6ZA 1S1QB 1UWMA 4V0BA 2KWCA 3I4LA 2JA9A 4WWOA 1WYGA 1WRIA 1QZGA 2DNFA 4Z9CB 2BT6A 4ZDVA 1OXTA 3RLNA 1IBML 3W1BA 3P20A 2JA8G 4Q2JA 3D8GA 4K3CA 3VFKA 1NR4A 2XIWA 2V3PA 4URKA 3PO3B 1RL2A 3RYTA 1SSOA 2EY6A 2VZAA 3WIMA 5KNCA 2NTSA 4ABNA 5C3EB 1PH4A 4HIDA 3SU8X 1U4LA 2I0QA 1X55A 3T16A 4DAYB 3EUB2 1P7FA 4AS1A 4KHZA 5DNFA 3V62A 2SNMA 1PYWD 4PNYA 1RJTA 5E7NA 3L0WB 3A8IE 3PV1A 2LD9A 2KMAA 3NEMA 2KTRA 1IBKL 4YCVA 2KHWB 3K0XA 2BW2A 2GN5A 1TY0A 3HOYG 2KOLA 2K25A 3RFZB 2K9XA 3U9SA 4IC7B 4K7UA 1GUGA 3KLWA 4R4IA 4PT5A 3HK0A 4IUUA 4PZ6A 3HM6X 4FLHA 2CKHB 2QCPX 1J0GA 1VS0A 1FR3A 4KIKA 3TBIB 2PW5A 4MN3A 1M94A 1VF7A 3PIPA 4KV2A 2KC2A 4K2KA 2JA5B 1QOHA 5CHVC 1JE5A 4FJZA 1DCZA 2JN4A 5IP4D 3L17A 3HM3A 2MNAA 4DDID 4UPAA 5M5WH 3DEPA 4A3DH 3JVZX 3NZSA 1SAPA 1D1IA 4ARIA 1L0VB 3X3MA 1IP9A 1GUWA 2WDVB 4QL5A 3AE2B 1C8CA 1OEYJ 1X3PA 3SK8A 1X3FA 2LKVA 5JJKA 3ERSX 1M90C 1RRBA 2IZVB 3ZO5B 4A3PA 2VQFQ 4A3MB 4KDIC 4KX6B 3E9IA 3FKIH 3H7PB 3CU7A 2HDEA 4A8XC 3JAME 4BBRH 2M17A 1ET6A 4L6TB 5EBCA 1I3QB 2NVYH 3K9PB 2B8GA 3P4SB 2MA9B 1KD1C 3ER0A 2F0HA 3E0JA 2L15A 4KD4A 2DX5B 2Y0SB 2E6XA 4G0NB 2QSDA 4HK2A 1E7UA 2DHZA 5IYDG 2C5LC 3N6RA 2LI5A 5IKCM 2YTVA 1PTOH 2JA7B 3QWNA 1HZ5A 2OCEA 3MXPA 3I3CA 4HAEA 5DCNA 3ULJA 3APFA 3HKSA 3NWSA 4TVAB 2MH7A 1LTAD 2A69D 5C44G 5C0XG 2KC1A 3P63A 4ICVA 5C4ZA 4GKKQ 1TT5B 3FKIB 3PIO3 2EYHA 3S2HB 3T51B 1YZ6A 1VDVA 2PLPA 2E8GA 4IUVA 5DM63 5IP9G 4KHVA 3TRZA 1XLOA 3A55A 1XF5L 3TMEA 1MJCA 4UY8C 1EY4A 1KHIA 4JOIA 2CHWA 4XDDA 1WX8A 1FRDA 4QCLA 3BS1A 3LXFA 5F2DA 3AYHB 3VDYA 2IL8A 3TP7A 3VVWB 2WKCA 4CDCC 2W82A 3TP8A 2YYZA 3Q3MC 3TEHB 2SOBA 4LMQD 3L0OA 3QOLA 1VQ4A 5A35A 4WWMA 1KOTA 1ZYRC 2F0MA 4EZJA 3TEWA 4A4IA 1WIAA 1EIHA 4HVBA 4A3JH 5HHDG 4M8AA 3MWYW 3HOUH 1WTPA 3QK0A 1ZKOA 5L83A 4BS9A 2HE7A 4YY3L 2PPHA 3GTQB 2QDLA 4IFDI 3MA2B 3A4RA 4CKCA 3CC7A 4HIOA 1C3TA 4LJZC 4B3SL 2RSNA 1PTOF 4LF6L 3NBHA 2E2IB 1E9MA 2WX0A 2QHOA 3J9CA 5BO4B 1N34L 4LF5Q 4G7ZC 2TSSA 1QILA 2B8FA 1K28A 5M3FB 1Y8PB 2X69A 2MP2B 1R4QB 2QIEB 2HDMA 1CMXB 3DBHB 2XK5B 4LUOA 4GS3A 1CT1D 4A3KG 2BOSA 2LJ5A 2AX5A 3A1QB 3OJ3A 4OO1H 4WORA 5IGFA 1UAPA 3BYTB 3M4QA 1ZPSA 2ZJDA 2JP1A 3FPPA 2W9NA 4HKZE 5BYQA 3QJYA 2ZXPA 3M4OB 2K0PA 4HJKA 1O7LA 1RTOA 4OIJA 2N9XA 3GOEA 1V43A 1WJNA 2N8NA 1I4QA 2INDC 3TSSA 4AIMA 1AFPA 4TQ0A 3HOWB 1QOAA 2KWUB 5AEKB 1YQBA 2PMVA 3F8TA 2GBKA 1V1PB 1JR0D 4F7ZA 2MQHA 2BQQA 4YSXB 3MHBA 1YHAA 2WYQA 1D4BA 2MO1A 1VQPA 2OEDA 2Y0SE 2WU2B 1E1TA 1IYUA 2IDYA 4CKBA 3H6MA 2N1VA 4JLCA 3A0JA 3V2TA 1A0IA 2KCCA 3I2ZA 2KMMA 2HTHA 2E5LL 1B44D 4LDTB 2MO0A 3J81j 1FEHA 4N59A 1BCPF 4DHZE 2WXHA 1EU4A 1E7PB 3P1HA 4ZKCB 3MVVA 3CCQA 4DA2A 1NMFA 3PMFA 1WRDB 1PLFA 1VF5C 1VQDA 2A5UA 2BWES 2J0MA 4FYDA 2JRHA 2RHSB 4C7YA 1NENB 3I9V1 3MC0B 5KRUA 4ANUA 2GVAA 1EOTA 1ESFA 3AE7B 4GOCA 4JCVE 1NCVA 5KYLA 3VH4B 2KHJA 2YLMA 4HJ7A 2IX1A 3E9SA 1Y1WB 3C2PA 2IHEA 4YSYB 3BY4B 5EKIA 5IT9c 4OWWB 2V3SA 4ULLA 5M5YH 2JEBI 1U4MA 5FO7B 2IY1B 2PYKA 1WTQA 4K3BA 1O7YA 1F2RC 2XTIA 1NTGA 1WJJA 5IODA 3E56A 3BYYB 4NQLB 2A6HD 3M3YH 4DQOC 2K33A 4RGNA 1KRSA 3UDXA 1EM7A 1JRUA 1OQRA 2A6HC 1YMHE 1OXXK 3PZ7A 4OXPA 4AOFA 4NY0A 2INPE 4LF4L 1SNOA 2QEJC 2N9LA 1H9MA 1MD2D 1TWGB 5GXGB 2Z0EB 4M8NA 2B2TC 1RLFA 3EBEA 4H13C 4O0AA 4OGQC 3DHGC 3M63B 4LF8Q 2G4DB 1PRTB 5JEAJ 3OTOL 3X3NA 2J0JA 4A20A 1VQNA 1N32L 3B6YA 4A55A 2RBMA 3GTJB 3AI5A 5AZHA 4JI2L 5LMNW 2QILA 4ZHPA 3OIPA 3ZKJC 1EY6A 2ZNVC 2JJQA 2B2UC 5KGUA 4FF4A 3CCVA 1WM3A 3A9KA 4FADA 2KK8A 3NTKA 3J81c 3L7ZC 1QQRA 2F0NA 1XNQL 4K0KL 3RNGC 5I9PA 4C00A 2FMMA 1K8MA 4BBRG 1WXMA 2IY0B 4JVZA 4XYQA 4M0WA 2L12A 2KT7A 1EZ8A 2WQYB 2DJFC 3V60A 1CI3M 1TS2A 4ZOHC 2QCZA 3SEBA 4I6NB 5ISRA 1F9SA 1RD9D 2OT2A 3GDEA 3SK4A 1KABA 1RHPA 3DDCB 2B2WC 4MJSB 2DNCA 4BVUC 2OWOA 3UINB 3FEWX 3KLSA 5K36H 3PF5A 1E6EB 5M9OA 1S5FD 4B9XA 1TJEA 5HGQA 2PE9A 3GQBA 4CGYB 3QX1A 1G51A 4TSSA 1YNXA 4X64L 1V86A 1IUEA 2J53A 3M62B 3CXCA 4DV0L 2V1YA 1IKLA 5C23A 3KUCB 2RA4A 5C3JB 4E3CA 4FHJA 1MJEA 2HJ8A 1OXUA 3DWGC 4R4QA 2NN6H 1T0RC 3HFZB 3PPAA 5DLQE 1GOZA 1ICWA 4E74A 2KFJA 4M1UB 2L3ZA 3M7GA 2MFIA 4A3CG 3C1EA 2C7NB 2C7HA 2D3BA 4C3JH 1ZDXA 1PYSB 1V1QA 2UXCL 1BBUA 3DEOA 3IT6B 5DPRA 5EPLA 2QDFA 1KL9A 2JSVX 2L7RA 5CV7A 3M95A 1WYWB 4PQXA 1F52A 1FRRA 3NQTA 5C6AA 2BDNA 1JMCA 2L1BA 4OWTB 3CMEA 4P73A 1EEID 5J3BA 1FM0D 3FILB 5E6NA 2ASBA 1QNUA 4PZ8A 5DPTA 4DAVA 2KBNA 4RCNA 1Y8OB 2F0LA 1G2TA 1JORA 1E8XA 2LEKA 2A74C 1DGJA 2K6DB 4CJ2C 4II3B 1PRTF 2FIDA 4REZA 2JXXA 2Z6BA 2KANA 1FCCC 5HG2A 2FCMA 4EUTA 1TKGA 2OXPA 2YEPB 1O7ZA 2K3UA 2FIFA 4IPHA 3IFDA 1WTXA 5H8YE 1UD7A 5FK9C 1HNXL 3IAYA 2VQEQ 2HTME 2IO3B 3L2PA 4HJGE 3H1UA 1FMAD 2B2VC 2KCMA 3GTQH 1HJPA 2MBHA 2RPVA 5JAVA 1F2YA 2MJ8A 1PZKD 3KYDD 3K5NA 3VUWA 2CHZA 5D7GA 1OQYA 3D6CA 1WZ0A 3U58A 3AE5B 2C35B 3D0FA 1F9PA 1MI0A 4DR1Q 3Q6BA 2WV6D 2OEOA 5D65A 2H4OA 2JA6G 4GKKL 3P7JA 2WXKA 4II2B 2DGYA 5FO9B 2ZM6Q 1TT2A 5HKHA 4DV2L 4Y7NH 4K0KQ 3ZNGC 4DK1A 1JE4A 1VQFA 4DV5Q 1G91A 1BCPC 2WKDA 1GHKA 4OZCA 4HKQA 2X6GA 1CHPD 1DOIA 2BBCA 1XPRA 5K5PA 2AQ1B 3NPPA 3LNNA 3T1YQ 2K01A 3S1NH 1STYA 5IN7A 3NRZA 4XWTA 4LFCQ 3B9JA 3KWVA 5DPWA 5JHBA 4ZRZA 4XIGS 3H0GB 1NEKB 4HCNB 5FR6A 3U4VA 4JE3B 3SHLA 2F0KA 1Q1EA 3AEAB 3L08A 3IFWB 2MEKA 2LMCA 3NXWA 1TWCB 1ZDVA 2E76C 4WAAA 1QWYA 1J5EL 4BBSH 2BS4B 5GROA 4X64Q 4NMZA 4N8X1 1N36Q 2HHHQ 1EWIA 4DV0Q 1G6ZA 3GTOH 2XWJB 5ELNA 4W9IA 3AECB 1SMXA 1VMPA 2PZTA 1UWXA 4A76A 4JQWC 2CCZA 1N33L 2WIIB 4NPSA 2UU9Q 1P98A 3DCGA 3TZUA 1PV4A 2JA6B 4FN2A 4YSZB 1PGAA 4B3SQ 1LM0A 4JBWA 3S2HH 1DONA 3ETRA 4FO2A 1XLQA 3VRAB 1K9MC 3DMUA 1E3PA 2PQAB 1A63A 2RGFA 4DHJD 1XPUA 3CQZH 4M8MA 1AEXA 2AUKA 3OWFA 1SIFA 4C4VB 3L3OC 3QJZA 2DY8A 1CHQD 4XDXA 3P4QB 2JEAI 2D10A 2DYOA 2NUCA 1JJGA 3ZJVA 1BBXC 4AQYL 2H89B 3HKZE 3H94A 2E2HH 4K81A 3PT2B 3HHMA 1WXAA 3WDNA 2WNMA 1NVID 2PJHA 5LL6S 1HZCA 5JPMC 4DV3Q 1ML0D 1X65A 1L1OA 4MNOA 3K7AB 3IHPC 1TVXA 3GO5A 4RAUC 1K8OA 5BMGA 4QUCA 5JJLA 2WXGA 1BT0A 5CGKA 1XLNA 3OLMD 4A9AA 2BPSA 5EE0A 2R7ZB 1WD0A 1PGBA 1J7BA 1KNAA 3GTMB 2ZW0A 3RD2A 1E10A 4OZAA 3T3OA 4DR7L 3ONAB 2EY2A 3AE9B 3D3RA 1P0RA 2N78A 3RR5A 1SE3A 3Q8BA 2JXMB 1R9TH 1P9DU 3BG3A 2IYDB 2C9OA 3PUYA 3TDQA 5D6JB 4PV1C 4GNXB 2SEBD 4X3UA 1CKNB 2PW7A 2B63H 2DAFA 1LTSD 3K0YA 3PGZA 4A3LH 2RR9A 1PH1A 5K36G 3RNFC 2QJLA 2HCCA 3I70A 5HI1A 2N0SB 2MHVA 5A2QL 5IGBA 2I5HA 1ZGUB 4CJ1B 2ZPNA 4QF4A 4ANVA 4DUYQ 4H0LC 4OWXB 1H95A 3TP6A 1B9RA 1E24A 1KC8C 4HSPA 3HP3A 3SDZA 4OEMB 3T1YL 5I6WA 1PFMA 3AEDB 3KYHC 5CYUA 3I91A 2F0UA 2L8JA 2L83A 2K6QA 4LFCL 3G7LA 1I5FA 3PCOB 4DAPA 4JGHB 4MHEA 4WJOA 1HFGA 4A3DG 3U7DA 4C80A 1N63A 1AWDA 4KZCA 4KVGB 2J42A 2AUJD 3I4NG 4GDLB 1QOBA 4ZCKA 1RCVD 4R9WA 1WE6A 1NBWA 5D2MB 2CU1A 3BVMA 2KVRA 1XYIA 1HE8A 1ZYRD 1VQJA 1J7CA 2PE6B 1EYDA 5G55A 1QF6A 1KLUD 2NMQA 3TN2A 2K7VA 2UU9L 4BBSG 1YJ9A 5BR8L 4FF2A 1LTBD 3K5LA 3RN9C 1W3SA 1OEYA 4TV3A 3ZNHB 3UQBA 1RFAA 2DYBA 2M0XA 3AE8B 1YJNA 3VDZA 1JRPA 3PRZA 4G57A 5I2XA 4N6EB 4QAYA 2GBMA 2JSOA 2N49A 3VA5A 2XRSD 1Y1WH 4HPMB 3W1YA 1JALA 1BXTA 1KJTA 2PTLA 3FPUB 1EIFA 4HIKA 1ZW7A 1O78A 1NBFC 2IY5B 2WP8J 1EWYC 5LMNQ 5BYSA 3HOZH 3RULA 4JI8Q 4LWCA 1MBYA 3S9WA 3BU2A 5BN4A 1OXSC 5EJWA 3VXWA 2F0SA 1IYVA 4GXBA 5ELFA 1E7ZA 5JXVA 3K7UC 1EYGA 4P74A 2UWQA 3EHVA 2CQOA 4BY7B 1TIFA 4K1RB 4X65L 1YEZA 2LXJA 3TS2A 2RDBC 3T3NA 4KHPQ 4FBJB 1VR9A 3ND9A 5LHY1 3J7AV 4OO1I 4ZRQA 1QUQB 1WGHA 2BS3B 3U4EG 3VTUA 4QMGA 2KEEA 3I8ZA 2RCFA 1CM9A 1JOOA 2HJ1A 4K6DA 2LXKA 4KTAA 1SYGA 3D4RA 2F03A 4M02A 1BDOA 1MHHE 2IHFA 3RNAC 4K14A 3HOXG 1L4DB 1UEAB 2CR5A 3G4SA 4IWOA 2JZ3B 3CPFA 4IW0A 4FVMA 1I4PA 1YNJC 2A6EC 2Z6KA 5C0XI 1VQ5A 1KH0A 1SFOH 1C77A 4B9WA 3TJPA 1IZ6A 1NDDA 1HZAA 1PZID 4YWLA 1STHA 4IJHA 2JA5H 4LF7L 1SMYD 4OX9L 1WX7A 4DXGA 1HR0W 3U30A 3SFDB 1HRJA 4GN3B 2K5HA 3H3VH 1JICA 3OMCA 2RVLA 4DXFA 2MPMA 4DUYL 4JI1Q 1S3SG 5IT9L 2VUMB 2V9HA 4LK1C 4OHJA 4EQNA 3OW7A 5M3FH 4XQNA 5LNK1 2EXZA 4W9HA 4CHTB 1SNCA 4ZRPA 1HA5A 1Q8IA 4ZYSA 4JV5L 1SE2A 1WI0A 3KUZA 4KKIA 3DOWA 5H92C 4BXXH 2AWOA 3AEBB 4RF0A 5T1GA 1WGGA 3ZYYX 1E1OA 4WWNA 3U8ZA 1Z5SB 1SYBA 2K5DA 1K50A 3C0RB 3AE1B 3CSTA 3Q8CA 1Q1BA 3HOZG 1IYJB 3PLVA 4RMAA 4W9KA 4CO7A 1EIYB 1YNTE 4OW0A 3OHXC 1WZ3A 3U2SC 2O6VA 5I6YA 4K8IA 2E74C 3F2CA 2KAJA 4YXDB 2MHJA 2YEPF 2EJFC 4HEDA 3A8JE 4H44C 1XCTL 2Y0SG 2RDFA 2D0OA 1CKOA 3HOVB 2I38A 1WD1A 4DR3L 1KDCA 3I4NH 1D6EC 3APDA 3LDZE 3OPOA 2K04A 4FJYA 4C3HB 2RKSA 1TGZB 2ON8A 5CBAE 5BN5A 2KLCA 1GC6A 4A3EB 1XD3B 3S14H 1WYDA 4BY7G 4G50A 1V5OA 5C3WA 3HRZC 2LWPA 3MP9A 4ILWA 1XJVA 3Q8AA 4DV2Q 4ITKA 4OVUA 1IL2A 2BYVE 5TR5A 1MFWA 2Q2IA 1LT6D 1RF2D 4ZUIA 3SGIA 1VD2A 2LGIA 5D3IB 3FHWA 1CQVA 1EZ6A 4DWFA 2NBFA 4XYOA 2ZXRA 1OTRB 2M00A 4WJPA 2KDMA 5FLXE 4KJOA 3L9AX 2O6VD 2K75A 1N34Q 4LF5L 5G5GA 1JQ4A 2NZHA 3ENEA 4B3RQ 1C79A 4RKLA 2H5XA 4MSMB 5AZFA 4G4KA 2EE1A 5IA7A 2KZRA 3AU4A 3VUYA 1ZP0B 3R66C 1WXVA 3ABVB 5GMVA 4JI3Q 1A70A 2R93G 5DAUA 5LMUQ 4C3HG 3MHZA 4M00A 1MHWC 1L0YB 3S1QB 1B3QA 3J80L 1ICFB 4WRDA 2UXBQ 4G7OC 2KTRB 1CA6A 4DAMA 1YNND 3F2DA 4G11A 3RN5A 4KDLB 2DNEA 3MC8A 1I94Q 2NWGA 3ULLA 3PSIA 2H1EA 3RI7C 4FJVB 1JWSD 1N8RC 1TZOA 1ZUD2 4RGOS 2UUBQ 2JYTA 2JA7G 2KXJA 4OX9Q 3K57A 5JVH3 2EPBA 1RIPA 5JZEB 3C46A 1E2VA 4DR2L 3HOUB 1WCMB 3I55A 4J6IA 4NNJB 2Z4IA 3P2BA 5E4XA 2KECA 4JW0A 3VR8B 2KN4A 4XGAB 1X56A 4JI1L 4C3IG 1BNZA 2P5ZX 3A9JA 3NBIA 1C78A 3TBLD 3OW2A 3CCRA 1TS4A 3M4OH 4JWUC 5E6JA 3WA0A 3GE8C 2ZJPA 1CJEA 3SXHA 1TWGH 3K8AA 1JWBD 3VR6A 2MX2A 3T4AC 1WTVA 4W9LA 2K03A 1Q82C 4L5SA 4JYAL 1WJ6A 2X38A 3MXNA 3MC9A 3J7A5 2EQSA 1EYCA 4QIWE 2JA8B 4Y52H 2FUG1 1JWUD 3UI2A 2MRPA 5FR3A 2K28A 1PH5A 2X8XX 1QUQA 1K83B 2Z4HA 4GN4B 4J1MA 1IW7C 1U4PA 1NYQA 3VR5A 4N58A 4YTNB 4J8QA 3JAML 4DR7Q 1ENCA 1TWHB 4IUTA 3RLFA 4IFDJ 2NBWB 2OTLA 2EKIA 4WH4A 3K5OA 1Q7YC 1NE3A 1Y14B 3S1QH 4PYZA 3SD5A 4RH6A 4KSKC 3E5SA 1Z7TA 2B2YC 3WAPA 3IBEA 1AZQA 3L16A 3SK5A 4I7ZC 2K5QA 3ZJUA 4BA2I 2ICEC 3H6NA 1BVSA 1RWSA 2BVCA 1YIJA 1TS3A 2QF7A 2BB5A 4XYCA 4E6IA 1YJWA 3ZNZB 3AFPA 3GV6A 3CIRB 3PZ8A 1J8CA 3S16B 1ENAA 4HIMA 4LF8L 3LWUA 4KSLC 1YOVB 3SK6A 2NTTA 4UDUC 4A3MH 2AWTA 1BKBA 2OQ0A 4LUZA 1WMHB 2Y5PA 3K58A 2L55A 3HKZG 3S15H 1T6BX 3OIQA 1FXIA 3MFGA 3SDLC 4OVZA 4E71A 4A93B 1CZPA 2NZ1D 5EQ0A 5JOBA 1IKMA 2IO1B 1N5XA 5H1SE 2WDTB 3VAWA 5BMHA 1AW7A 3NSWA 1ZE3D 3F2UA 1D5MC 3QB3A 1XNQQ 2R92B 2G5DA 3J7AF 3HIZA 3ZTCA 3ITPA 4XWWA 4ZRIA 5G3LF 4KJNA 1T5EA 3B08A 5IE8A 2HQLA 3WOEA 1F0ZA 3LX0A 4X62L 3RNUA 4XTCS 3BINA 1T9HA 4GDLA 3AEVA 4P7IA 3GD7A 1Q86C 4H7BA 2BWFA 1SE8A 2ACZB 4ZK9B 1VQCA 2FINB 4DR5Q 4POFA 5BR8Q 4QIWB 1VQOA 5FOBB 4B9KA 2JU6X 2ZJQA 2D5DA 1E8WA 2NYZD 2N9PC 3H3VI 4RF1A 3PO2H 3R2TA 3PS6A 4APVA 2LXAA 4JBJA 2IO0B 1WTRA 1VZ8A 2EVBA 1Q81C 1HNZQ 3NS1A 4MGIE 4BXXG 1U9RA 1Z9FA 5J1ZA 1BMLC 2WFWA 3PUWA 5DPSA 3EIVA 1KIXA 1SYFA 4DR2Q 3HOXB 4GLAC 2KDIA 2CW0D 4HRSA 1I42A 1QLBB 5M3FG 1VQLA 1SR3A 2GOWA 3ZW3A 2KUMA 1YD8U 2KX0A 1E0BA 3S2DH 2ZNVB 2YTXA 2NVXB 1EQRA 3P1MA 1U5KA 3H7SA 1YI2A 3I4MH 2RMMA 1YX6B 3UF8A 4UP7A 1GPXA 4JG2A 1Z6HA 5EKLA 5LLIA 1FD7D 3G71A 3SHQA 3ZLZA 2A69C 3AU7A 2N4FA 4XT1B 4PS8A 2VS1A 4CHKA 2M9VA 2UXDQ 4US9A 2CJNA 3J7YW 1EY5A 2AMCB 5COYA 1N9WA 4P75A 3Q0AA 2WXPA 2N7JA 4P72A 5IWAQ 1QVCA 5LL6X 4WURA 2LUEA 4O2DA 4RFBA 2L52A 1L1OB 5MPOA 1IGCA 4IWPA 4DK3C 1S72A 4ZKBB 4RKBA 3HOUG 3M3JA 3CWIA 3KBXA 2LGSA 4JPSA 1SNMA 1CKMA 1I6HB 3ZGZA 4B3ML 4IOCA 2WXQA 4A3FH 3NVVA 3EROA 3IRBA 2JRIB 4B95A 5CX3A 4X3SA 2I2YA 1MSGA 3W5VB 1IHZA 4KY7A 4A3GG 1DOMA 2KENA 3DM3A 3H0GH 1SF0A 2V3NA 3TQYA 1Y1VG 4C4VA 4LNFA 1V9JA 5GADC 1VQEA 4JIOU 4C2MH 3CF6E 2QGQA 1EIGA 2PW9A 2C60A 4MELA 2NVTH 1R4MB 1TWFB 3NVWA 1JB7A 1C4CA 2NN6G 3S2AA 2RSOA 1F9RA 2BS2B 4IM3A 2LFNA 4JV5Q 4JL9A 1VQAA 3DHQA 1DOKA 2ZPYA 3B0AA 1YNNC 1Y1WG 1UE7A 2B2UA 1V49A 2K14A 3HOWH 4A3GH 4V190 4X6AH 5IP7G 3VYUA 1FNVA 1Q12A 5ELBA 1C4QA 2IGGA 2WXIA 4HPLB 1STBA 1HNWL 4HROA 1D8LA 1BCPD 2XNAC 1NI3A 2MSED 2SAKA 3FDTA 5IOCA 1EQQA 4N9PA 4JI6L 2LMCB 1JWAD 1K8RB 1Q0WB 4RHSA 1SROA 4LFAQ 4GIVA 1WTOA 4DR5L 3KOJA 3DWAA 1A62A 1MIUA 1XNRQ 1PXUA 5AJ3L 1PFDA 2N9EB 2W54A 3Q8FA 2WB1E 4K7SA 4LJOB 3DBHI 2F0TA 4PS7A 1H9SA 1JMLA 4DK0A 5GAEC 1QZHA 4KD3A 2JA7H 2WX1A 3UIOB 1EWHA 2RDHA 3URYA 1N36L 2HHHL 5T8IA 3AULA 3H0GG 3CCEA 1JROA 4LNOA 5KNBA 2UUAQ 4FF3A 2EIFA 5IGEA 4AWJA 4DV6Q 1TWAB 2FBWB 2KNBA 4BY1B 5C4XB 2I1JA 2WXLA 3V6EB 1PQSA 1Z47A 4OIKA 3CMAA 3A7LA 3CC2A 2QEXA 5CV4A 1RM6C 4CBVA 5IYBG 1E8YA 2ZXOA 4A3JB 4EQOA 3QARA 2AWNA 5IAAC 4KZ0A 2IGHA 3ZRCA 1SSNA 4G3XB 2QA4A 3TCAA 1SGHA 3I4MG 3DHIC 1IBXA 3EECA 1EOVA 4B3RL 3AM9A 4KN4C 1GUAB 5BMIA 3ZDTA 1Q10A 3ERQA 5CV6A 4EOYA 5NUCA 4BA1I 2KFKB 3WCQA 1PVOA 3J81L 4QB4A 2XGTA 3GTOB 1WGRA 1F77A 5IWAL 2MP2A 3NHHA 4L1BA 2C5CA 2JVCA 2A73B 4C7ZA 1BOSA 1H4RA 2XWBB 1M8AA 1PRTD 4FXDA 3DWQA 3QHTA 4DV3L 1ZXTA 5C0XJ 1F2RI 2B76B 2E2DC 5AFWA 3LWEA 4R4TA 5IGCA 3MTNB 1I50H 2KQ7A 2JE6I 1KFYB 2AKWB 3PVLA 3F1ZA 3TL5A 4IM2A 3TEXA 4KKTA 2UUBL 3N30A 4BKSD 4JI0L 3IT4B 3HS0C 3FC4A 2MJEA 4IM0A 2IX0A 2NPTB 2BYFA 3Q2AC 4EZKA 4DHJB 5EE1A 2D3AA 4EKUA 1LFDA 4LNQA 3V61A 2MW5A 3VYRA 3E0EA 5GQOA 3J80E 4F1SA 2KJXA 3VR9B 4A6QA 1G6PA 4QGUA 1KF6B 3S24A 3VUXA 4O1NA 1NNXA 1K8AC 4BOSC 2CWPA 1S4ZA 4RM9A 4DK5A 3ECIA 3FRPB 4MSQB 2R2OA 1JC7A 3APCA 2CS4A 2NCNA 2RD0A 1RKNA 2MUYA 1TS5A 2PZUA 1W6KA 1C48A 1UF0A 1FO4A 1WR1A 4KKJA 1QOGA 4IKGA 2ZJRA 3CRLC 1DOYA 1QNKA 2L4NA 2BDOA 1WF9A 4C1NI 1CUKA 5HURA 5C4JB 1EFID 1PFSA 1GM5A 4GZYC 1T0QC 4LFAL 3VHTC 4O42A 2DAJA 2K52A 4NAWA 5IO9A 4WJQA 2V0GA 5GAHC 1TY2A 2PZWA 4JI5Q 4ZRJA 4IPDA 3GTGB 3WAMA 4B3TQ 3HGBA 2B2YA 4A3KH 1B2TA 2IGDA 1W2BA 1K3BC 2L11A 3VQIA 3M9BA 2F0OA 4FP5D 1TXYA 1L6VA 1HQMC 1ACCA 4JX1C 3CCUA 4GOPB 1F2ZA 3HOXH 2Y3AA 3RMKC 1VLBA 2UUAL 3A7AB 4A3DB 5C4XG 2LVOA 4DF7A 3A9KB 1C9FA 3FAHA 4IZ8A 1VQKA 2BKFA 4XT3B 3FVQA 4GU2A 4J15A 2R7FA 2OF1A 4X3TA 2O5JC 1ZKHA 1WXSA 1KDBA 3TREA 1WXQA 2ZCCA 1FJGQ 4UAIA 2G9HD 1P1AA 1Y8NB 3DQVA 2YV5A 1WWTA 1WMHA 3S1RH 1UE1A 1Q90A 3OSOA 4FNFA 1PFNA 5IP9H 2N9KA 2R6GA 4DGZA 2A4ZA 4C3IH 2ZT9C 2GMIC 5ELDA 4NPNA 1K0SA 4W9EA 4X62Q 3S17B 3AEGB 3SR1A 4MZ9A 2EYMA 4IOIE 5IT9E 1YITA 2NB0A 3IAM1 3RD4A 1GHJA 1HUNA 3I7FA 4MACA 4MGZE 3JYUA 4KI0A
chains in the Genus database with same CATH topology
2BB6A 3HOYB 2WB1B 4MH8A 3VYSA 2H88B 4RHRA 3KUPA 4KV6A 1MGSA 3CKIB 3CHBD 3Q69A 3AB5A 1FGBD 3MZ5A 3RPFC 3P75A 3S1MB 1QOFA 2SNSA 5BN3A 1FNWA 4KGRA 1L5PA 1Y1VB 1XEEA 2F0FA 2O2LD 1SIJA 4K2LA 2FMCA 3D4DA 1R7SA 1II3A 1SNPA 1K53A 4C3JG 1BO0A 1PFBA 3I4NB 1BR9A 2F0QA 5EBDA 2EY5A 1KRHA 3GV3A 1UGJA 2FFKB 3KQ4A 2K5WA 1L6UA 4KN7C 5JVG3 4C3IB 1GAQB 1STAA 3NWTA 2F3VA 1S5ED 4BBRB 1LV9A 4B08A 5EE3A 3HEJA 5CV5A 1HUMA 2RDGA 5I2YA 3UI3A 4WJWA 2K05A 5D3DA 5IGDA 1ZXHA 2QMTA 3HG9A 4YWGG 4LLGM 1MHXA 3BDLA 2E2HB 2WDQB 1E2WA 3R93A 3VYTA 2IPKD 3NTIA 2EOTA 2VNUD 1N60A 3OOCA 1HPCA 4WAFA 1GUNA 3QIAA 4ZAIA 5M3MB 4ZUJA 1JW9D 1FIQA 1STGA 3P4RB 4FF1A 1X3QA 1CA5A 3TEZA 2Z1CA 1TKYA 2INNE 4US8A 2ICIA 1TU2B 2JZPA 1L0XB 3LB8C 3PO0A 4RGTA 3J81E 4X3KA 3ZJTA 1EWCA 2Y5CA 2BTEA 3PUXA 2PIAA 1XLPA 4EVOA 2F0VA 4J3OD 4KGTA 1GB1A 4DU9A 4CQNA 3TP5A 1EY8A 1BUIC 4L63B 3V3XA 1G291 3NK9A 2V4DA 3G6JB 1S5DD 1GUTA 1VDZA 2BYTA 5CMDA 1LT4D 2F0EA 2W3SA 3U7ZA 2FE8A 1VZ7A 3VR2A 2WXNA 2HUGA 4TKOB 4A3KB 4KMUC 5C5LA 3M85A 3R3OA 3EVQA 2NVQB 2B2TA 1B50A 1SNDA 4C56C 3MAQA 5CC4A 2DY7A 2WDRB 4PMWA 5FKAC 1FNUA 1OQQA 1B53A 2KQ4X 4JWSC 1M4VA 1TQOA 2V4IB 1RODA 1NUCA 3GP7A 3OMGA 2KQ3A 3AMUA 2J4XA 3LYYA 1ESRA 3EA6A 2XN9C 2D5GA 1P7EA 1H9JA 4RA8A 5HFYA 5EE9A 3KBGA 4ARCA 1JQYD 1B3AA 3IKJA 3GTKB 4TQ1A 4K5VA 2YU9B 1YN3A 3H8HA 2F0GA 5CBEE 2WXJA 1DZ1A 3S1RB 1DOXA 4N9TA 1LTTD 1CZGA 2JWUA 2EYJA 1HTPA 5M5YB 2LHEA 1HTLD 1VJKA 5EGTA 4FXGC 4HMIA 1CFMA 4ME5A 3Q22A 2A6ED 2TMPA 2FJ2A 2JYOA 1N61A 2B39A 1EQVA 1WVLA 2PVOD 2PQEA 4TRDA 4IN3A 4KK7A 1FYCA 2NN6I 4RWSC 3NVYA 4NKLA 1B9MA 1SYCA 1V97A 1EEFD 1KAAA 4HTHA 1C4AA 1CK1A 3VA7A 2WP9B 5D14A 3AEEB 5KEEA 2ZW1A 1DXMA 1H9SB 1VZ6A 2M2LA 3W3AA 1Y56A 2DBYA 3B2FA 1W6JA 1FCLA 1DJRD 2GB1A 1PDXA 2WU5B 5AUIA 3BK2A 1VRAB 2F4IA 2LUMA 2PMZB 4USAA 4Y7NB 1QCBD 4A3GB 1A3UA 2IT1A 3QO2A 1S5CD 2KA7A 2CU3A 1F9QA 1G2SA 4ODGA 1SB3C 5IGGA 4G7HC 2E2JB 2PKOA 2JQRB 1DYQA 2G1EA 1SYDA 4AQ7A 2LY7A 2FHTA 1WTWA 2A68D 4TQUS 5IIFA 1HZ6A 1LT5D 4XQJA 4IUQA 1PTOC 4MIUA 4U68A 1SDFA 3PO2B 3S14B 2L1AA 2WAQB 1QJOA 2W3RA 2MJDA 4PMCA 1X32A 1XXGA 3A8KE 1RTNA 1LTRD 1LO5D 3CQZB 3IAS1 5C2TB 1SFOB 3GS2A 2L9HA 2EYFA 5E3FA 2WXMA 4OL7A 5DEHA 2PNRC 3BDCA 2GRIA 2KHSA 1LTID 3MTSA 2K1BA 2PPBC 2WXFA 2VB3X 3H3VC 1GB4A 1WGKA 2DYMA 1MPEA 5C0XH 4MT5A 4P2CB 4P6VF 1EQTA 4Q5VA 1UUPA 4F88A 3I72A 1RFKA 1J9OA 2JX5A 3NTHA 5J22A 1DOLA 3IFTA 5CV8A 5ELCA 2VB2X 1IW7D 3S1NB 3EFXD 2WACA 5E4WC 4DN4M 1NAPA 4HCSA 1SE4A 5G5HA 1XTCD 1HQRD 1AP0A 2EY1A 2KVMA 3T13A 3M4YA 1YN5A 2J7ZA 1A3VA 5C44B 1A2UA 5EPJA 4BBSB 4YTMB 3SE0A 4IFDH 4IUPA 4LK0M 3KF8A 5KIXA 4IUNA 2D9UA 2R93B 3A56A 3TEYA 2DWQA 5FLXL 5JJZA 1GJXA 2Q8TA 2A5HA 4HN7A 1V8QA 2MP1A 1XX8A 4F8MA 1G8ZD 1YQ4B 1CZWA 1ZEQX 3V96A 4F87A 1PDQA 3I73A 3AE6B 3T53B 1LABA 1HA6A 3NVZA 3H09A 3HZXA 3D31A 3E6ZX 2PCFB 1SEBD 3U52E 1A15A 2EYLA 4YTPB 1LT3D 3BZDB 2WLBA 3TUOA 1H9KA 1I4HA 3SVMA 4NAMA 2Z8LA 4XXEA 3QG1A 1S5BD 3KK7A 1F2MA 5C4HA 2K5PA 4HR7B 2F0JA 2L5TA 3W1SA 2CW0C 3BVGA 3HVZA 2XRQD 2X6LA 3BWUD 3GTPB 2IJ0A 1AYFA 1A6XA 4NP5A 2KCNA 1PRTC 2JXTA 2E3TA 3HRDD 3RZDB 3K59A 1EYAA 1EY7A 1QG7A 3DXJC 1I4GA 2AQ2B 2CVRA 3OWEB 3Q6SA 3IL8A 1R4PB 5T1IA 3AEFB 1OFFA 1FFUA 2EYPA 1ONLA 1LTGD 4FXCA 1OXVA 4XDCA 1PTOD 1BCPB 3VR3A 3AE3B 1I4XA 4EGVA 3PUVA 1EL0A 3C8YA 4YT0B 3AMZA 3KLRA 2Q8RE 1ILPA 4YIJA 2M56B 2LFIA 3Q24A 4K5XA 1ROEA 2VZKB 1D1KA 1JOQA 1VCIA 3WOFA 2HCIA 5CR3A 1GUOA 2D2CC 2M19A 4BWGB 4A3IB 1ET9A 3K5MA 2O4XA 3Q23A 1D2BA 1QKZA 1E0ZA 1J7AA 4OO1G 4A90A 3IXSA 2WINB 1KNEA 1IBXB 4DNRB 4DAYA 2LJIA 5CORA 3KLSX 5DM73 4GLSC 3D6WA 2EJMA 4J6HA 4R8IA 3HKZB 2L0CA 2BE5C 3M7NA 2L32A 4KKSA 1GXDC 3HUIA 3RZOB 1QT9A 3ND8A 1A3TA 1V1PA 3ZQ4A 3NQIA 5A2QE 3NZ3A 4D2KA 4HSVA 3EGRA 1KDAA 1C76A 4GDKB 1GUSA 1F2LA 4RGMA 2NVYB 2VZKD 1I4RA 2E75C 3MFYA 1D5ZC 1CTMA 1QE6A 4IURA 1TR5A 2Q5WD 3BK1A 4A3FB 1ENFA 4OZBA 1TKWB 4F7XA 1SXTA 1D5XC 3PUZA 2D62A 3NUCA 3GTLB 3N9YC 2N88A 1UNSA 1NSNS 1SNQA 2EDGA 4RCOA 4PMBA 2CQAA 3M3YB 4NW2A 4LTUA 3BIID 4K5WA 2DLBA 3PIP3 1WSPA 3GB1A 1EY0A 1EU3A 1LLRD 3I90A 1VMCA 2F1MA 1MI2A 4H2AA 5CV9A 1BF4A 2J0TD 2I46A 5EKKA 5AUKA 5BYRA 1RYJA 4IFDG 3V05A 2RQXA 3DWMA 1KLGD 3I57A 1K51A 1T3QA 1ZXIA 2MJ3A 1SMYC 4WFN3 4NAWB 4WQMA 4R3DA 2IX3A 2R61A 1HFNA 2QDBA 4FXKC 1HHVA 1FD6A 2EYOA 2GI9A 4B0EA 4ZHOA 3MXGA 3MJ5A 2F0WA 4R8NA 2EZVA 3SFEB 1SBBB 3AN1A 4Q0FA 1PZJD 5J39A 4L2YA 1K52A 4DNTB 3O13A 4L8JA 1MVKA 3PV0A 4RNAA 2WS3B 1NR2A 2AQ3B 3AE4B 3KWLA 1R9TB 2EJGC 5TSSA 2WXRA 3R2IA 3MXUA 2IWHA 2R3ZA 1YN4A 3HOZB 2B63B 1DD2A 3QOJA 1QB5D 2BE5D 2KEDA 4WIPA 1V1OA 2MGSA 5M5WB 3VR4A 3P42A 3VRBB 1N5WA 1AN8A 1HCZA 3AV8A 2XSCA 4CKEA 3SR6A 3I4MB 2M0AA 1PTOB 5JEAG 1FFVA 4S3SA 1PUTA 1Q3LA 4KY6A 2F0PA 4NJCA 3U9OA 4QUFA 1YJIA 2HDLA 1C4PA 4JK1C 1U4RA 4K8JA 1NYRA 1HEZE 4A3BB 2O5IC 1XO3A 1HXYD 1B9NA 2BA1A 2NVTB 5JEAH 2BCOA 1KTKA 4HCEA 1RDPD 4B0MA 5KNDA 3TZDA 3RUZA 2IW3A 2PO4A 1TKEA 4XE0A 1A2TA 1Y69U 1JB3A 2BA0A 5G3LD 3L4PA 4C2MB 3T56B 2F0IA 2QKIC 2B2WA 2KACA 4LAAA 4IQZA 2K32A 4KY5A 4EE2A 5I9OA 3D4WA 4XQQA 5EPKA 1B4OA 3DUZA 4KKUA 2F0DA 1JWMD 3BVZA 3N52A 2OHFA 1YNJD 4ZQ3A 4HEA1 2DN8A 3R8BA 1IGDA 1SJED 3FILA 4DFAA 4NDXA 1BUVT 1I6VC 1BQQT 1PGXA 4C3JB 1LACA 4I65A 4KGSA 3S2DB 1YJJA 2ONQA 1H9RA 4NZLB 2G9DA 3FMCA 4MM3B 3CRKC 1B1ZA 3C3LA 5FO8B 3W2DA 4C1NK 2K22A 5JPNC 4IDIA 2EELA 1O80A 2W55A 1STNA 5C5MA 3Q8EA 3A54A 1E2ZA 3EJIA 2B2VA 1ZOYB 2CHBD 1I7HA 2F3WA 4EQPA 3C1FA 1V8CA 1L4ZB 2KWDA 2PVGC 2K6AA 2LS01 5C3XA 2ENBA 3DM1A 2ID0A 3H91A 3MEHA 1XWEA 3P4PB 2I07B 1I50B 4L23A 1SJHD 5M5XB 3DWPA 4IALA 5E1FA 3NE5B 1OO9B 5KYIA 1AZPA 2Q8IB 1PMRA 1ILQA 3AH7A 3HVDA 3W5UB 2GA4B 1MSHA 1TYGB 1J8IA 2VXWA 3NP8A 3RMHA 1SYEA 3EQLC 1IL8A 4CJ0B 3S15B 4U673 5ELEA 1DM0B 1XCQL 4ID6A 1FXAA 1YQ3B 2J52A 1EY9A 2HQEA 2SDFA 3K6OA 5HGTA 2LHDA 2XVSA 1N62A 4K6LA 4ZLTF 4TMAB 3NUHB 4HMJA 1TIID 3BDOA 2CJOA 3W9CB 4P16A 1T5XD 1JCKB 2JYEA 3AB9A 5I4DA 2WXOA 4AYBB 1STEA 1CQFA 2N55A 2A68C 3B2GA 1JOKA 1UWMA 4V0BA 3I4LA 1WYGA 1WRIA 4Z9CB 2BT6A 1OXTA 3P20A 4Q2JA 3D8GA 1NR4A 2XIWA 2V3PA 3PO3B 1SSOA 2EY6A 5KNCA 2NTSA 4ABNA 5C3EB 1U4LA 3T16A 3EUB2 1P7FA 4AS1A 4KHZA 5DNFA 2SNMA 1PYWD 4PNYA 1RJTA 3A8IE 2BW2A 1TY0A 2KOLA 3RFZB 2K9XA 3U9SA 1GUGA 4PT5A 4IUUA 2QCPX 1FR3A 3TBIB 2PW5A 4MN3A 1VF7A 4K2KA 2JA5B 1QOHA 1DCZA 3DEPA 1SAPA 1D1IA 4ARIA 1L0VB 3X3MA 1GUWA 2WDVB 3AE2B 1C8CA 1X3PA 3SK8A 2LKVA 4A3MB 4KX6B 3CU7A 2HDEA 4A8XC 3JAME 1ET6A 4L6TB 5EBCA 1I3QB 2B8GA 3P4SB 2F0HA 3E0JA 4KD4A 2Y0SB 2E6XA 2QSDA 3N6RA 2JA7B 1PTOH 1HZ5A 3QWNA 3MXPA 3I3CA 4HAEA 3NWSA 2MH7A 1LTAD 2A69D 3P63A 5C0XG 5C4ZA 3FKIB 3PIO3 2EYHA 3S2HB 3T51B 1VDVA 2PLPA 4IUVA 5DM63 4KHVA 1XLOA 3A55A 1XF5L 3TMEA 1EY4A 4XDDA 1FRDA 4QCLA 3BS1A 3LXFA 5F2DA 2IL8A 3TP7A 2WKCA 2W82A 3TP8A 2YYZA 2SOBA 4LMQD 3QOLA 5A35A 4WWMA 1ZYRC 2F0MA 3TEWA 1EIHA 5HHDG 4M8AA 3MWYW 1WTPA 1ZKOA 4BS9A 3GTQB 4IFDI 3MA2B 4CKCA 4LJZC 2RSNA 1PTOF 3NBHA 2E2IB 1E9MA 3J9CA 4G7ZC 2TSSA 1QILA 2B8FA 5M3FB 1Y8PB 2X69A 1R4QB 2QIEB 2HDMA 1CT1D 2BOSA 2AX5A 4OO1H 4WORA 5IGFA 1UAPA 3BYTB 1ZPSA 2JP1A 3FPPA 4HKZE 5BYQA 3QJYA 2ZXPA 3M4OB 2K0PA 1O7LA 1RTOA 4OIJA 1V43A 1I4QA 4TQ0A 3TSSA 1AFPA 3HOWB 1QOAA 2PMVA 1V1PB 1JR0D 4YSXB 3MHBA 1D4BA 2OEDA 2WU2B 1IYUA 2IDYA 4CKBA 3H6MA 3V2TA 2KCCA 2KMMA 1B44D 4N59A 1FEHA 1BCPF 2WXHA 1EU4A 1E7PB 3P1HA 4ZKCB 3MVVA 4DA2A 3PMFA 1PLFA 1VF5C 4FYDA 4C7YA 1NENB 3I9V1 3MC0B 5KRUA 1EOTA 1ESFA 3AE7B 1NCVA 5KYLA 2IX1A 3E9SA 1Y1WB 3C2PA 4YSYB 5EKIA 4ULLA 2JEBI 1U4MA 5FO7B 1WTQA 2PYKA 1O7YA 1F2RC 5IODA 3E56A 3BYYB 2A6HD 4DQOC 2K33A 4RGNA 1EM7A 1OQRA 2A6HC 1YMHE 1OXXK 3PZ7A 2INPE 2N9LA 1SNOA 2QEJC 1H9MA 1MD2D 1TWGB 5GXGB 2B2TC 4H13C 4OGQC 1PRTB 5JEAJ 3X3NA 4A55A 2RBMA 3GTJB 2QILA 4ZHPA 3OIPA 1EY6A 2B2UC 5KGUA 4FF4A 3NTKA 3L7ZC 1QQRA 2F0NA 5I9PA 2FMMA 1K8MA 4XYQA 4M0WA 2L12A 1EZ8A 2WQYB 1CI3M 1TS2A 4ZOHC 3SEBA 5ISRA 1F9SA 1RD9D 2OT2A 3SK4A 1KABA 1RHPA 2B2WC 2DNCA 3FEWX 3KLSA 5K36H 1E6EB 5M9OA 1S5FD 4B9XA 1TJEA 3GQBA 4CGYB 4TSSA 2J53A 1IUEA 1IKLA 5C3JB 2RA4A 3DWGC 1OXUA 2NN6H 1GOZA 1ICWA 4M1UB 3M7GA 3C1EA 1ZDXA 3DEOA 3IT6B 5EPLA 2JSVX 5CV7A 4PQXA 1FRRA 3NQTA 5C6AA 2BDNA 2L1BA 1EEID 1FM0D 3FILB 1QNUA 4DAVA 4RCNA 1Y8OB 2F0LA 1G2TA 1JORA 2LEKA 2A74C 1DGJA 4CJ2C 1PRTF 4REZA 1FCCC 5HG2A 1TKGA 2OXPA 2YEPB 1O7ZA 2K3UA 3IFDA 1WTXA 5H8YE 5FK9C 3IAYA 2HTME 4HJGE 1FMAD 2B2VC 2RPVA 5JAVA 1F2YA 2MJ8A 1PZKD 3K5NA 5D7GA 3D6CA 3AE5B 1F9PA 1MI0A 2WV6D 2OEOA 5D65A 2H4OA 3P7JA 2WXKA 5FO9B 1TT2A 4DK1A 1JE4A 1G91A 1GHKA 1BCPC 2WKDA 4OZCA 4HKQA 2X6GA 1CHPD 1DOIA 2BBCA 5K5PA 2AQ1B 3NPPA 3LNNA 2K01A 1STYA 3NRZA 4XWTA 3B9JA 3KWVA 4ZRZA 4XIGS 3H0GB 1NEKB 4JE3B 3SHLA 2F0KA 1Q1EA 3AEAB 2MEKA 2LMCA 3NXWA 1TWCB 1ZDVA 2E76C 1QWYA 2BS4B 4NMZA 1G6ZA 2XWJB 3AECB 1VMPA 2PZTA 1UWXA 2WIIB 3TZUA 2JA6B 1PGAA 4JBWA 1DONA 3ETRA 4FO2A 1XLQA 3VRAB 3DMUA 1AEXA 2AUKA 3OWFA 3L3OC 2DY8A 1CHQD 4XDXA 3P4QB 2JEAI 2DYOA 2NUCA 3ZJVA 1BBXC 2H89B 3H94A 2WNMA 3WDNA 1NVID 5LL6S 5JPMC 1ML0D 3K7AB 1TVXA 4RAUC 3GO5A 1K8OA 5BMGA 4QUCA 2WXGA 5CGKA 1XLNA 4A9AA 5EE0A 2R7ZB 1WD0A 1PGBA 1J7BA 1KNAA 3GTMB 2ZW0A 1E10A 4OZAA 3T3OA 3AE9B 3ONAB 2EY2A 3D3RA 1SE3A 3Q8BA 2JXMB 3BG3A 2C9OA 3PUYA 3TDQA 4PV1C 2SEBD 4X3UA 2PW7A 1LTSD 3K0YA 5K36G 2QJLA 2HCCA 3I70A 5HI1A 2N0SB 2MHVA 5A2QL 5IGBA 4CJ1B 4QF4A 4H0LC 3TP6A 1B9RA 4HSPA 3HP3A 3SDZA 5I6WA 1PFMA 3AEDB 5CYUA 3I91A 2F0UA 2L83A 3G7LA 4DAPA 4MHEA 1HFGA 4C80A 1N63A 1AWDA 2J42A 2AUJD 4GDLB 1QOBA 1RCVD 4R9WA 3BVMA 1XYIA 1ZYRD 1J7CA 1QF6A 1EYDA 1KLUD 2NMQA 3TN2A 2K7VA 4FF2A 1LTBD 3K5LA 3AE8B 1JRPA 4G57A 5I2XA 4N6EB 2JSOA 3VA5A 2XRSD 1JALA 1BXTA 2PTLA 3FPUB 1O78A 2WP8J 1EWYC 5BYSA 1MBYA 3S9WA 5BN4A 1OXSC 5EJWA 2F0SA 1IYVA 5JXVA 5ELFA 4BY7B 1VR9A 3ND9A 5LHY1 3J7AV 4OO1I 4ZRQA 2BS3B 3U4EG 4QMGA 2KEEA 3I8ZA 1CM9A 1JOOA 4K6DA 4KTAA 1SYGA 3D4RA 2F03A 1BDOA 1MHHE 4K14A 1L4DB 1UEAB 4FVMA 1I4PA 1YNJC 2A6EC 5C0XI 1KH0A 1C77A 4B9WA 1PZID 1STHA 1SMYD 4DXGA 3SFDB 1HRJA 1JICA 3OMCA 2RVLA 4DXFA 2MPMA 5IT9L 2VUMB 4LK1C 4OHJA 4EQNA 3OW7A 4XQNA 5LNK1 2EXZA 4CHTB 1SNCA 4ZRPA 1HA5A 1Q8IA 4ZYSA 1SE2A 4KKIA 5H92C 2AWOA 3AEBB 4RF0A 5T1GA 3ZYYX 1SYBA 2K5DA 1K50A 3AE1B 3Q8CA 1Q1BA 1YNTE 4OW0A 3OHXC 3U2SC 5I6YA 4K8IA 2E74C 2KAJA 4YXDB 2YEPF 2EJFC 4HEDA 3A8JE 4H44C 1XCTL 2RDFA 3HOVB 2I38A 1WD1A 1KDCA 1D6EC 3OPOA 2K04A 4C3HB 2RKSA 2ON8A 5CBAE 5BN5A 4A3EB 5C3WA 3HRZC 3MP9A 4ILWA 3Q8AA 4ITKA 1LT6D 1RF2D 4ZUIA 2LGIA 5D3IB 1CQVA 1EZ6A 2NBFA 4XYOA 2ZXRA 2M00A 2KDMA 5FLXE 4KJOA 3L9AX 5G5GA 1JQ4A 1C79A 4RKLA 4G4KA 2EE1A 1ZP0B 3ABVB 1A70A 5DAUA 3MHZA 4C3HG 1L0YB 3S1QB 3J80L 4G7OC 4WRDA 1CA6A 1YNND 2DNEA 2NWGA 2H1EA 1JWSD 1ZUD2 1TZOA 4RGOS 2JYTA 3K57A 5JVH3 2EPBA 3C46A 1E2VA 3HOUB 1WCMB 3VR8B 2Z4IA 5E4XA 2KECA 2KN4A 1BNZA 4C3IG 3NBIA 1C78A 4JWUC 1TS4A 5E6JA 1CJEA 3SXHA 1JWBD 3VR6A 3T4AC 1WTVA 2K03A 2X38A 3MXNA 1EYCA 2JA8B 2FUG1 1JWUD 3UI2A 5FR3A 2K28A 1K83B 2Z4HA 4J1MA 1U4PA 1IW7C 1NYQA 3VR5A 4N58A 4YTNB 4J8QA 3JAML 1ENCA 1TWHB 4IUTA 3RLFA 4IFDJ 4WH4A 2EKIA 3K5OA 4RH6A 3E5SA 1Z7TA 2B2YC 1AZQA 3SK5A 4I7ZC 2K5QA 3ZJUA 4BA2I 2ICEC 1RWSA 2BB5A 1TS3A 2QF7A 4E6IA 3GV6A 3CIRB 3PZ8A 3S16B 1ENAA 3LWUA 3SK6A 2NTTA 4UDUC 2Y5PA 3K58A 2L55A 1T6BX 3OIQA 1FXIA 3MFGA 4OVZA 4A93B 1CZPA 2NZ1D 5EQ0A 5JOBA 1IKMA 1N5XA 5BMHA 1AW7A 3NSWA 1ZE3D 3F2UA 1D5MC 3QB3A 2R92B 3T3NA 3J7AF 3ITPA 4XWWA 5G3LF 4KJNA 1T5EA 3WOEA 1F0ZA 3LX0A 4XTCS 3GD7A 4H7BA 2ACZB 4ZK9B 2FINB 4QIWB 5FOBB 2JU6X 2D5DA 2NYZD 4RF1A 3R2TA 1WTRA 1VZ8A 2EVBA 3NS1A 1U9RA 5J1ZA 1BMLC 3PUWA 4HRSA 1SYFA 3HOXB 2CW0D 1QLBB 2KUMA 1E0BA 2NVXB 3P1MA 2RMMA 1GPXA 1Z6HA 5EKLA 1FD7D 2A69C 3AU7A 4XT1B 2M9VA 4US9A 2CJNA 3J7YW 1EY5A 5COYA 3Q0AA 2WXPA 2N7JA 5LL6X 4WURA 4RFBA 2L52A 5MPOA 1IGCA 4ZKBB 4RKBA 4JPSA 3CWIA 3KBXA 3ZGZA 1SNMA 1I6HB 2WXQA 3NVVA 3EROA 4X3SA 2I2YA 1MSGA 3W5VB 1IHZA 4KY7A 1DOMA 1SF0A 2V3NA 1EIGA 2PW9A 1TWFB 3NVWA 1C4CA 2NN6G 2RSOA 1F9RA 2BS2B 2LFNA 3DHQA 1DOKA 1YNNC 2B2UA 4V190 3VYUA 1FNVA 1Q12A 5ELBA 1C4QA 2IGGA 2WXIA 1STBA 4HROA 1BCPD 2XNAC 1NI3A 2SAKA 3FDTA 5IOCA 4N9PA 2LMCB 1JWAD 4RHSA 4YSZB 1WTOA 3DWAA 1PFDA 1PXUA 3Q8FA 2W54A 2F0TA 1H9SA 1JMLA 4DK0A 4KD3A 1EWHA 2RDHA 3URYA 5T8IA 1JROA 5KNBA 4FF3A 5IGEA 1TWAB 2FBWB 2WXLA 4BY1B 5C4XB 1Z47A 4OIKA 3A7LA 1RM6C 5CV4A 4CBVA 2ZXOA 4A3JB 4EQOA 2AWNA 2IGHA 1SSNA 1IBXA 3AM9A 4KN4C 5BMIA 1Q10A 3ERQA 5CV6A 5NUCA 4BA1I 3WCQA 3J81L 4QB4A 3GTOB 1F77A 3NHHA 4L1BA 2C5CA 2A73B 4C7ZA 1BOSA 2XWBB 1M8AA 1PRTD 4FXDA 3DWQA 1ZXTA 5C0XJ 1F2RI 2B76B 2E2DC 5AFWA 3LWEA 5IGCA 2JE6I 1KFYB 3TEXA 4KKTA 3IT4B 3HS0C 3FC4A 2MJEA 2IX0A 5EE1A 3VYRA 3J80E 2KJXA 3VR9B 4A6QA 1KF6B 4O1NA 1S4ZA 3FRPB 1JC7A 1RKNA 2MUYA 1TS5A 2PZUA 1W6KA 1C48A 1FO4A 4KKJA 1QOGA 4IKGA 3CRLC