2G9HD

Crystal structure of staphylococcal enterotoxin i (sei) in complex with a human mhc class ii molecule
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
213
Chain Sequence
IGVGNLRNFYTKHDYIDLKGLIDKNLPSANQLEFSTGINDLISESNNWDEISKFKGKKLDIFGIDYNGPCKSKYMYGGATLSGQYLNSARKIPINLWVNGKHKTISTDKISTNKKLVTAQEIDVKLRRYLQEEYNIYGHNSTGKGKEYGYKSKFYSGFNKGKVLFHLNDEKSFSYDLFYTGDGVPVSFLKIYEDNKIIESEKFHLDVEISYVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of staphylococcal enterotoxin I (SEI) in complex with a human major histocompatibility complex class II molecule.
pubmed doi rcsb
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
molecule tags Immune system
source organism Homo sapiens
total genus 67
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2g9hD02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2g9hD01
1RD9D 2IJ0A 1TS5A 1KLUD 1F77A 1AN8A 1ESFA 1SXTA 2J4XA 3DWAA 5TSSA 3W2DA 2RDHA 1B1ZA 1S5BD 1V1OA 3TSSA 4ZYSA 1HQRD 4TSSA 1LTSD 1I4QA 5ELCA 3URYA 1LTAD 2R61A 1D5ZC 2RDGA 5ELFA 1CHQD 1S5CD 1SJED 1ENFA 1MD2D 1JCKB 1TS2A 1STEA 3MC0B 4O1NA 1G8ZD 3EFXD 3BYYB 1PRTB 4Z9CB 1YN5A 1LT5D 1L0YB 1EU4A 4NZLB 1V1PA 1JWSD 1KTKA 1GOZA 3R8BA 3EA6A 1M4VA 2AQ1B 4RGTA 1L0XB 4RGMA 1BCPC 5FK9C 1SE4A 1CT1D 1EWCA 1I4HA 1PTOH 2NTTA 4RH6A 1PRTC 1HXYD 1LTGD 4RGNA 1UUPA 1FGBD 1BXTA 1CK1A 2CHBD 1BCPB 2XNAC 3GP7A 1EEID 3BYTB 2XN9C 3MFGA 1PRTF 1LT4D 1AW7A 1DJRD 1D5MC 1LT3D 1RCVD 1YN3A 1V1PB 1FNVA 1PZJD 5ELBA 2ICIA 1BCPD 3V05A 1JQYD 1JR0D 3DWPA 1SE3A 1LTRD 1SJHD 1S5FD 3SEBA 1PRTD 2XRSD 1I4PA 4BWGB 4DXGA 3BVGA 2NTSA 1HA5A 4RFBA 1S5ED 2SEBD 1DYQA 1LO5D 1PTOC 4C56C 1I4RA 1D6EC 1I4GA 1JWUD 1LTBD 3CHBD 1BCPF 4RCOA 1TY2A 1QILA 1RF2D 4K6LA 1LTTD 1PTOB 1FD7D 1D5XC 5D3IB 5ELDA 4RHSA 2WV6D 2Z8LA 3O13A 3BVZA 1LLRD 2XRQD 4RHRA 3OWEB 4L63B 3R2IA 1LT6D 2QILA 1PTOD 4RGOS 1SEBD 1ET9A 1B44D 3BVMA 4UDUC 1T5XD 1TY0A 1YN4A 2G9HD 3BZDB 1CQVA 3KLSX 1UNSA 1TS4A 1KLGD 4OHJA 5FKAC 1PZKD 1SBBB 1CHPD 1EFID 1ET6A 1TS3A 1PZID 2AQ2B 2IPKD 1SE2A 1PTOF 3R2TA 1FNWA 4DXFA 4L6TB 5I4DA 2QEJC 1S5DD 1I4XA 1JWMD 2TSSA 1HTLD 1XTCD 1EEFD 3DWQA 1FNUA 2AQ3B 2O2LD 5ELEA 1RDPD 5D3DA 1EU3A 1XXGA 1PYWD 1LTID
chains in the Genus database with same CATH superfamily
4IJLA 2ZCBA 4P6VF 4KHVA 1TS5A 1KLUD 1Q7YC 1C4PA 5IYDG 1C78A 4XDCA 3AE2B 3T8MA 2NYZD 3PIO3 3VDYA 3I9V1 3F1ZA 3TBLD 3ZTDA 4X66L 2MHVA 3VYUA 2LHDA 1JJCB 2CS4A 1JCKB 3I4NG 1STEA 2CFMA 3EROA 4K7SA 1SIFA 1UEAB 2HD3A 1V49A 3N32A 1E8YA 1ENCA 1L6VA 2BOSA 1FJGQ 1RHPA 2WKDA 2IO3B 3F2BA 3BS1A 2ZPNA 1Y8OB 4E6IA 1M4VA 3F2DA 1L0VB 1X3GA 2G3QB 4YCVA 1FRDA 5EE9A 1E7ZA 3VXWA 1WTWA 1XPOA 5K36H 3Q14C 3EIVA 3A9KA 1VQJA 2N3SA 1EWCA 2ES2A 3WAOA 3VR6A 1X3EA 4XT3B 4F7ZA 3KDFA 4LNQA 1C77A 3P4SB 5EE0A 1VQKA 1AP0A 4KV6A 4A75A 1EQQA 1JRUA 2Q2HA 2I38A 4HJ5A 2K01A 3T56B 1LT3D 1RCVD 2RHSB 3X3NA 1STAA 1NEKB 1YQ4B 1FR3A 1M94A 2FAZA 3DBHI 3JSVB 1PXUA 3KYCD 3QARA 3UDFA 3FAHA 4PMWA 2CJNA 1SLJA 2AL6A 4QF4A 1WSPA 1ML0D 1VQBA 2LD9A 2JRIB 4OWWB 2WGSA 3J80E 1V2YA 3V6CB 2M2LA 2XRSD 1NMGA 2B3AA 4A8XC 1DOXA 4B9WA 2D5GA 4WQMA 1EIFA 3AEGB 4CKEA 3MZ5A 1FJGL 3K9PB 2KCMA 2M17A 3DEPA 3C19A 2JA6B 1PYBA 3EFUA 1RF2D 4DFAA 5GAHC 2L83A 1IYUA 1SGHA 4ME3A 2B8FA 4FJYA 2IL8A 3FMCA 3H8HA 4JX1C 1EOTA 5C4JB 3MA2B 1N33Q 1WGYA 3ML8A 2G9DA 1Q46A 3A7LA 2N7EA 3Q8DA 2UUAQ 2DLBA 3SR1A 1HNZL 2XBBC 5T8IA 1CFMA 3I4MB 2RSOA 2C60A 4W9DA 2FIDA 3J7A5 4WJWA 3KK7A 4X3KA 3NHHA 3A9JA 4HLEA 1Q1EA 1L6UA 5IP9G 2QGQA 4G4KA 2MX2A 4LF8Q 2L7RA 4LUZA 3OLMD 3SFDB 1FD6A 3PREA 1RWSA 3HM6X 3AB5A 1LABA 1N63A 1CZWA 1KLGD 3P75A 1SFOH 1KIXA 2A6ED 2VZKB 1U4PA 4HCSA 2DY8A 2J7ZA 2WB1G 1K8OA 1U9RA 4YWLA 1TKEA 2KVZA 2O2VA 5I4DA 3Q23A 1CZGA 5IOIA 3S15H 2Z6KC 3GZNI 4WQOB 1SFOB 1WD0A 4G50A 1KDBA 3M3YB 3PZDA 4JCVE 2OHFA 1FM0D 2VH2A 4MM3A 2IJ0A 4BXXH 1B1ZA 4DV0Q 4G7ZC 3OIPA 1SYCA 1JICA 2RA4A 1ZDVA 2WU2B 4P74A 3AU7A 5FO8B 2WXGA 1LACA 1N33L 1WXSA 2DENB 3AE8B 4EOYA 1NSNS 1KXLA 1CMXB 1TS2A 1NVID 2MJ3A 4KGTA 4M0WA 4IOCA 1IYFA 1HFNA 1PV4A 3H7SA 3ML9A 4I6LB 1WTRA 1RTNA 2IDYA 3MEHA 1KAAA 3RUIB 4TUUA 2F4VQ 3CF5A 3D3RA 3H6NA 2N7JA 3JAME 4REZA 3AYHB 3H9DA 4LF8L 1VQMA 2Z9HA 4WIPA 4A3MB 1NR2A 4MACA 2B2UA 4P2CB 2KLGA 2F0HA 3FKIH 3LWUA 1XWEA 2JA7G 1MJDA 3AECB 3OTOQ 1U5KA 5FK9C 5CGKA 3J81c 1SE4A 3D4DA 1Z7TA 3P4QB 2PPBC 4FDBA 1QE6A 3U50C 2PQAA 4KGRA 4O42A 3I8ZA 3NVVA 3VTWA 2PMVA 4K8JA 3GP7A 4IWPA 2CKZB 1UGJA 3BYTB 1II3A 1O7ZA 1FCLA 3S2HH 2K5PA 4W9JA 1KH0A 2CHWA 2L12A 3D8GA 3EHVA 2V9HA 3CAMA 4HCEA 2WKCA 5DM73 3NBHB 5IODA 4DV0L 1YN3A 5H8YE 1QOFA 1HH2P 1A5RA 5ELBA 4JI0Q 2ICIA 1BCPD 3RNUA 4DAYA 3FPUB 3K6OA 1LM0A 3K7AH 4ID6A 4H7BA 3AE1B 4WWOA 4J1MA 1K0SA 3SEBA 3K5NA 1F9RA 2A1AA 4Y7NB 5AJ3L 2FUG1 4JL9A 3FKYA 2LS01 1FIQA 1TYGB 2PMZE 2YEPB 2F4VL 3C0RB 4YXDB 3PRPB 1VMPA 3NTIA 4LF6Q 2Y5CA 2V3SA 4DUZQ 4X6AH 1TKWB 1Y8NB 1FXAA 1Y1VG 3OTOL 3VRAB 2KT7A 1D8LA 1V86A 3ERQA 2VUMB 2A6EC 3I4LA 2HTHA 2OJWA 3WANA 3MJ5A 1P8LA 5JJIA 2ZJQA 3NHEB 2M8SA 4A3GB 2R93B 5IGDA 1TTNA 4ACFA 1KABA 2KX3A 5IKCM 2LZ6A 3S16H 2O6VA 4EVOA 1DGSA 1W6KA 1VQOA 1XT9B 3SR6A 3QA8A 4BY7H 3QIJA 4HJ7A 5FR6A 3GDEA 3UDIA 3DPDA 1WX7A 3CCMA 4W9IA 3W1SC 2J7QB 4JI0L 4KK7A 2M4NA 4JI7L 3JW0X 5G5HA 2RMMA 2W54A 4GLAC 3QB3A 1J8IA 3GTMH 2L8JA 3V05A 2MHJA 3Q69A 4KSLC 1YVCA 5E3FA 5FO9B 1IGDA 3JSVA 3H94A 3PO3G 4LF9Q 1YD8U 1E1OA 2EELA 4DU9A 4A3BG 3E3XA 2A73B 1YQ3B 1E0ZA 1RDPD 4MTNA 4JI5Q 2LY7A 4OZBA 5C3EB 4YSZB 2DN8A 4LF6L 2KQ4X 4H2AA 2JSVX 3VYRA 1JALA 4XYQA 1VQ6A 4MZ9A 4OVZA 3QWZB 1ZYRC 2JEBI 3PUWA 4W9GA 1KQSA 2XTIA 5GMVA 3V61A 1MBYA 2NN6I 4IPCA 3AEDB 2ZM6Q 2RDGA 1BKBA 2VH1A 5BYRA 1S5CD 1SJED 4MSQB 2WXRA 3G7LA 2YTYA 4A3KG 1G8ZD 3NQTA 5GQOA 3Q0AA 2UXCQ 2Q5WD 3C8YA 3KYDD 3P4PB 1Q82C 2KHIA 4N6EB 1IUEA 3W1SA 1J7BA 2D3CA 2N0SB 1WYDA 1VZ7A 3AE9B 4ICUA 1V1PA 1GXDC 3H09A 3S1RH 1CZPA 2ACZB 2KDBA 4NY0A 4HJAA 3VTVA 3ER0A 4N59A 4ME5A 3GV6A 5JH5C 2I46A 1BCPC 1EUJA 2GBNA 4A76A 2HIXA 1WOCA 3S1RB 4USAA 1YJIA 2GN5A 4XYCA 2XWBB 5FLXL 1F2ZA 1XO3A 3HRDD 4DHJB 2HDMA 4TRDA 1YHAA 3PO2B 3CWIA 3WCQA 1EEID 5K5PA 5CV4A 2AX5A 2HDLA 1LGRA 3HOYB 3S1MB 1CKNA 2ICEC 3F8TA 3CCLA 4KDIC 1QNKA 2Q8TA 4JYAQ 4ZRQA 3TEYA 1BDOA 4AYBG 2PYKA 4J6HA 1SNPA 3S2DB 4ASWC 4OONA 4QMGA 1K28A 3AEAB 3APDA 1Y8RC 3BY4B 2Z4IA 3NP8A 5KIXA 2RPVA 4XDXA 3GE8C 3J80i 3KWVA 4BKSD 5I6YA 2BTEA 3K59A 2KBNA 1HZAA 1SR3A 1XLPA 2UXCL 3OJ3A 2K22A 5J3BA 1HUMA 2QDLA 3U7DA 4FF2A 3NTKA 1S5ED 4Q5VA 2INDC 2L15A 5C44B 3T1HL 2OT2A 2KCCA 2C9WB 2M00A 1GHJA 3W3AA 1JWUD 1EWIA 2C5CA 2KDEB 1SROA 1TXYA 1Q8KA 3DVNV 4EE2A 3IT6B 4HMIA 2FCNA 3OWFA 4AQYQ 4M00A 4HIOA 1HZ5A 1PMRA 3SDZA 1D5XC 1YJ1A 4BA1I 3BU2A 5ELDA 3L10B 4JI1Q 2B2WC 3BVZA 4IG7B 1QJOA 4NMZA 3QWNA 3W5OA 3L9AX 1KJTA 2RCFA 2LGDA 1AYFA 4YTNB 1CJEA 2AUKA 3A74A 3Q22A 2L3ZA 3ITPA 1B44D 3RMHA 4HEDA 4BBRG 2CU3A 2JWZA 1B53A 4JYAL 5D6JB 4DR5Q 2KCTA 2OWOA 1ZXTA 5G3LF 3A55A 1TS3A 2X6LA 4MIUA 4BOZB 1JWBD 2SDFA 5EKKA 4BBSH 1WF9A 2B76B 3NBHA 4RF0A 1OFFA 3Q24A 2JA8G 4JG2A 1ZDXA 1ZEQX 2AQ3B 3BZKA 3P7JA 4YIJA 3TEHB 4HEA1 1X65A 2VL6A 2NS5A 5HGQA 2YVCA 2KQ3A 4BBSB 1AWDA 2KDIA 3OHXC 2W3SA 5IP4D 3NK9A 1EWHA 1F77A 4IUPA 3QCAA 4AQYL 3MFYA 5GADC 3C2PA 4XTCS 1J19A 3AMZA 3FC4A 2RR9A 1LTAD 2D0PA 2O5IC 5BN3A 4JI1L 1A0IA 3PSIA 2FE8A 4PS7A 3BYYB 2PZWA 5EKIA 4Z9CB 3BJUA 1PDQA 1EU4A 1T5EA 4UHVA 3HHMA 1V80A 3JAMi 2GRIA 3SGIA 4J8QA 3NZ3A 3TCAA 4KTAA 1AEXA 3EA6A 3HOUB 4GOCA 4JPBW 4HPLB 1L0XB 1B3QA 4DR5L 2ZPYA 4P1BC 2K28A 3RZOH 3K0YA 4B3ML 1N6ZA 2EYPA 2WXFA 1GJZA 2NPTB 4KKTA 2UXDL 4K3BA 3RNFC 1PLFA 5JOBA 4G11A 1CTMA 4EGVA 2MJEA 1GUSA 1NDDA 4OZAA 4A3CG 5HKHA 3L16A 1JOOA 3RZOB 4RM9A 2DWQA 4A3EG 4ZDVA 1MVKA 3W5UB 1DZ1A 1L5PA 3AE7B 3HGBA 4IUVA 3TREA 1L1OB 2HUGA 4KIKB 2PTLA 1CA6A 5KHQA 1WD1A 4BBNC 1V8QA 2J42A 4X3SA 4A3DG 4DR1Q 2KKCA 4D2KA 2F0QA 1WM2A 4U68A 3D6CA 1WYGA 2CHZA 5CV7A 3ALBA 1S5FD 3ZXVA 1TWAB 4L1BA 2SNSA 3B1LX 4BWGB 3G6EA 3OYYA 4ILWA 1HZ9A 2KUMA 5M3MB 1DONA 2MCNB 1IBXB 1WXMA 2K0PA 3V3XA 3N1YC 3A5ZB 3CCSA 3DVNU 1X32A 4LK0M 3DBHB 4U673 1I4GA 4X65Q 1WCMG 4TVAB 1BUVT 3HOWB 4MDKE 1FPYA 3A1QB 4J3OD 4A3CH 3VUYA 3CPFA 4IPDA 2MPMA 3IVFA 3N30A 3NOBA 3UDGA 1FFVA 1PTOB 3MP9A 1F2MA 2XEWA 4ZRZA 4ZRIA 1EQVA 2LJ5A 5DPSA 1FXIA 5E4XA 4UAIA 1SMYC 3SK6A 4OEMB 4O0AA 1Y14B 1EO6A 5IP7G 2LI5A 1XYIA 1HNXQ 1WZ3A 4M8NA 4C3IG 1WIAA 1E2ZA 4KY7A 5HY6A 3UE1A 5FLMG 1MG8A 4X3UA 1ICFB 5IYBH 5L83A 2WXQA 2PO4A 3MXPA 2JEAI 5BMIA 2V1CC 3PV1A 2JYOA 2BE5C 1AZQA 2WXNA 1OTCA 4W9EA 3HOXG 1B9NA 1PZID 2FNJB 2WLBA 3IAM1 1J9OA 5AEKB 2A4ZA 2CWPA 4Y52H 2Y0SE 1QOBA 4PMBA 2IGHA 3J7YW 3KUZA 4US9A 3CQZH 3HP3A 2PNRC 2EE1A 4ZRPA 5ELEA 3SK5A 5CV9A 3TP7A 2Z59B 3SU8X 2BCOA 2CW0C 4X65L 1I6HB 4CDCC 1PFBA 5D3DA 1NYQA 2IGDA 3M3JA 4R3DA 1WVLA 1EL0A 1LYLA 5EE3A 2I07B 3T4AC 2MSED 4ZKCB 5ELCA 1TIFA 3RPFC 1D5ZC 2F3IA 3GZNB 4NAMA 4IUMB 4MSMB 4P7IA 2PW7A 1BVSA 3PHWB 1VQ5A 1JWAD 3Q6BA 3K5MA 1D1KA 1A3VA 1G2SA 5KYLA 4WJ4A 3OG5A 1VD2A 4JW0A 3D0FA 3HOZH 1I42A 1CA5A 2IX0A 4I7AA 4GNXB 5HHDG 2IWHA 1HNXL 2OEDA 4CKCA 1R9TH 2LFNA 2BS2B 1J7CA 4HMJA 3K80C 2ASQA 1YJWA 1FGUA 1NJIC 2JXMB 5I6WA 2LXJA 3NE5B 1GVPA 4DR6Q 5EQ0A 1CSPA 2JPHA 1DD2A 4AOFA 1R9TB 2MLBA 2KWDA 3KBGA 4IC7B 3RLOA 1BF4A 3DOWA 4BS9A 1F52A 1MHHE 1LTGD 3S1NH 1WJJA 3CW2C 1BXTA 1QZEA 1YITA 4RAUC 2GBJA 5C0XJ 2BA1A 2E74C 5M5WH 1UEBA 4HJ8A 3J7ZC 1OXTA 2N8NA 1IL8A 2YV5A 4JVZA 3L2PA 3TUOA 4OO1G 2LVPA 4C3HB 1K9MC 1ZPSA 1D5MC 3ONSA 1QQRA 1TVXA 3VRBB 4H02A 5M5WB 4DAMA 4LFBQ 1A6XA 2G4DB 4A3IH 2PZUA 4MHEA 4B3RQ 4I65A 5CHWA 1SE3A 2D2CC 4A3JG 4IJHA 3CXCA 3GTJH 1SJHD 1EM7A 2Y0SB 4MNOA 4FXKC 1I3QH 1XTDA 1Q10A 3AE6B 1E1TA 1WRDB 1STYA 2ZXPA 2KHWB 2PIAA 1F2RI 2E3TA 4WWPA 3KYHC 3S14H 1FEHA 2VZAA 1L1OC 4IPGA 4DGZA 1F9JA 1I3QB 3L13A 2JA5G 4V0BA 1WGDA 2KC2A 4K0KQ 3W1GA 1DOLA 4KMUC 4DR6L 2DNFA 1DOMA 1PFNA 1FD7D 2Q2IA 1TT5B 3N9YC 4A90A 1ASYA 4NQLB 4DAPA 1TWFB 4PMCA 1IBML 4EFOA 3CU7A 4JOIC 3KUCB 5JEAH 4PV1C 2B2TC 2K6QA 1PH2A 2F0MA 3R7QA 4DHZE 3OWEB 1GO3E 5G55A 4DDGD 3WWVA 4F7XA 3LB8C 1SEBD 2NPTA 2B39A 4NB3A 3M85A 3QJZA 4K7WA 4ANUA 4Q0FA 3RD4A 4AQ7A 2FMMA 5HFYA 3BZDB 4QY7A 4FBJB 4CBVA 5IGBA 3S17B 2E2IB 5C4XG 3J9CA 4HCNB 4LFBL 2JRHA 4B3RL 2IHFA 1EFID 2AQ2B 5BN5A 2R7ZB 4AWJA 4K14A 4L5RC 4KIKA 3PRMB 4ZRKA 2CR5A 3M62B 3PHXB 2KMCA 3HOVB 3A7AB 3CSTA 1ZOYB 3H0GB 4IWOA 1HTLD 1QG7A 3BDLA 3P2BA 5JEAJ 3AB9A 5M5XB 1WJUA 2G45B 4GDLB 1Q1OA 2LJIA 4R4IA 1GC7A 2LEKA 4WWNA 1XXGA 2FFKB 2GB1A 3NVYA 3CCVA 1VQLA 4K0KL 1IBXA 5IA7A 2M56B 4JOIA 4HRSA 4EEWA 1J7AA 1IW7D 2B2TA 4ZYSA 1IL2A 2XVSA 2JXTA 2OQ0A 1WH3A 2DZKA 4J15A 5KNCA 1BT0A 2WX1A 5A2QE 2HHHQ 1WTQA 1AZPA 3AEEB 3A1QA 1Q1BA 1MD2D 4A3FH 2L0TA 3CSFA 4EZKA 1S1QB 1N5WA 1C9FA 1PHJA 3ZJYC 1GPXA 2LRWA 2I5HA 1DCZA 3EJIA 1Y1WG 4P75A 1L0YB 2QDFA 2VW9A 2ONQA 3W1BA 4OZCA 3V96A 4A3FB 1WGGA 3WAPA 3R8BA 4KX6B 3HFZB 4CDEC 1I50H 4HCPB 4M8MA 2VXWA 3NZSA 1KL9A 5JJZA 2VQFQ 4FF4A 5IGCA 1IBLL 2CU1A 2KHJA 4DHZB 2K5WA 2PCFB 1I50B 3DHGC 1T6BX 3VR3A 5JHAA 4R4TA 2FCMA 4GNXC 5G2NA 1YMHE 3U8ZA 1K8MA 2VQEQ 4APVA 4C3JG 1YJJA 1BBUA 4B3TQ 3IXSA 1YBYA 1BNZA 1V97A 2GA4B 3PMFA 4WFN3 3AULA 4GKKQ 1B3AA 1FL0A 4HTHA 1UD7A 4YY3Q 5AZHA 5C6AA 3VQIA 2AWTA 3H6MA 3A54A 1HTPA 4KKSA 1WM3A 4GDKB 2HHHL 4GKJQ 4JBKA 2ASBA 2CHXA 2NVUI 2K9XA 5AZGA 4PK1A 3PGEA 2LMCB 5C3XA 3P1HA 3R3OA 1JE4A 2I1JA 1QZGA 1GJXA 3BVGA 1GUWA 5ELNA 1QNUA 2FIFA 1DYQA 1P7EA 3M7NA 1PGAA 2JZ3B 5IYDH 3AN1A 4QUFA 5CV6A 3R93A 3CCJA 1VDZA 3TP5A 4JBWA 2L1AA 3IFWB 1HNZQ 2KJ6A 2N9KA 3HS0C 3M9BA 3KH0A 1ILQA 3U2SC 1JORA 3I4NH 4GNXA 1XNQQ 2VQFL 2ZCCA 1AE3A 4H0LC 5E1FA 4JI2Q 1KRHA 5LMNQ 2DZJA 2IYDB 1CKMA 1GNUA 4XT1B 1PFSA 1UH6A 1WJ6A 3ONAB 1HFGA 1LXDA 5D2MB 3U9OA 4LF7Q 2JA6G 1ZXIA 3R3MA 1S3OA 4WH4A 1GHKA 2VQEL 1RIPA 4FO2A 3H3VH 1IGCA 1XD3B 1X6OA 2REXA 3H7PB 3N6RA 4II3B 1ICWA 4B3TL 2KEEA 5DLQE 2H88B 4XX5A 4HSPA 3GV3A 2CKHB 3HRZC 5AFWA 2W9NA 4GKKL 4I6NB 2JUOA 1IW7C 1MI0A 4YY3L 4R1JA 2WQYB 2K7VA 1VF7A 3I4MG 4BZAA 2RBMA 2L0FA 4GKJL 2PI2E 1SBBB 3R2TA 2RKSA 1PYSB 1X3FA 3UI3A 3PV0A 1ZKOA 4HAEA 3PVLA 1ACCA 2JE6I 3NVWA 3O65B 3UGBB 1RFAA 2DUDA 4IUNA 3N1ZC 3DWQA 2BPSA 2F0LA 5BN4A 2AMCB 2QSDA 1QWYA 3RLNA 2UU9Q 2ZJDA 1UZXB 1GC6A 1OTRB 5EAYA 4CQNA 2XGTA 5LHY1 3GB1A 1TU2B 1XNQL 1CUKA 5DNFA 2FBWB 4JI2L 4GB9A 3UI2A 5LL6X 4CHTB 5LMNL 4HVBA 3IFDA 1QOHA 2RD0A 1N61A 2IW3A 3M4OH 3EECA 5M5YH 4A3PA 1KFYB 4LF7L 1UGMA 4LUOA 3EFXD 3HKZE 5CYUA 3P4RB 2OCEA 5JHBA 3OPOA 3KQ4A 3KLRA 5C4ZA 4XGAB 3KOJA 4IFDG 3ZDTA 2KC1A 2KVRA 2K8HA 2RHQB 4EQPA 4JE3B 1GOZA 4MTKA 5M5YB 3HZXA 2HE7A 1HR0Q 2NBVB 1JOQA 3NZUA 2I1KA 3J80L 1HRJA 3GOEA 4XWTA 5GXGB 4FJVB 4XDDA 3I73A 4M01A 5IT9E 1X1MA 4BKTA 3K57A 2F03A 4LF4L 3LWEA 1ZUD2 4IUTA 1SMXA 4RH6A 3S15B 2KACA 4A3MG 2KANA 5FLXc 5C0XI 1BCPB 2J0TD 5IP9H 1IBKQ 1TJEA 3AV8A 2EKEC 4RNAA 3U9SA 1JMCA 3UDXA 4BFRA 2QEXA 1A2TA 4C00A 2UU9L 4CGYB 4US8A 1EY4A 1K50A 3MTSA 2ZTDA 5AJ3Q 4V190 3EN2A 1SNMA 2FXQA 3PLUA 4P16A 3ZXRA 1XPRA 3AEFB 4GLSC 2L9HA 1F1HA 3B08A 3BIID 5JVH3 2M0AA 3MJWA 3PQIA 4LJZC 4GDLA 1NBFC 1PFDA 3PPAA 3W5VB 4EZJA 2B3GA 1G291 2R7DA 2WDRB 3I2ZA 2N55A 3IG3A 4F8CB 1HTOA 1YNJD 2Z6KA 2DYBA 3HVZA 3N20C 1RJTA 3QK0A 4MGYE 2A5HA 4OWXB 4RCOA 3FKIB 2D62A 4MT5A 1HR0L 3QQ8B 2KCNA 3VYSA 1BBWA 3B9JA 3LNNA 4B95A 4K6DA 4K6LA 3RMKC 1NNXA 1EZ8A 1D3ZA 4DBGA 1OXUA 2JT4B 3U52E 3K5OA 1LM8B 1SRUA 3HKZB 2LXKA 5FR3A 4TQUS 3S2HB 4JI7Q 3W9CB 2MBEA 5H92C 1EY8A 1IBKL 1XX8A 4A3OA 2D0OA 4KJOA 1HNWL 4F8MA 1VCBA 3PRZA 4A20A 4QL5A 4KDLB 3A4SC 2NBFA 2JA7H 4A3GG 4IM0A 2R93G 2YEPF 1CQVA 2INCC 3BDCA 3VR5A 3K7AB 4IDIA 5JAVA 1O78A 1C8CA 1C48A 4RCNA 2W3RA 3GTKH 2CVRA 4YWMA 4K5WA 4HPPA 4QIWE 4QUCA 5CC4A 5EBCA 3PUXA 3TMPB 1C4QA 1FNWA 2DJFC 4IUUA 4KJNA 3ZLZA 3JAML 2UUCL 1PVOA 4L5SA 1TKGA 1HTQA 2LHEA 1I4XA 1JWMD 2TSSA 2F0VA 3EQLC 3QOJA 1C7YA 2LUMA 2KJXA 3GTKB 2EMSA 1F9QA 4ODGA 5E6PA 5CHVC 1EU3A 2K3UA 2LMCA 1RD9D 2RF4A 1GM5A 2N88A 2DY7A 1GAQB 4HWIB 3ZGZA 4LNNA 3H3VC 3I3TB 1V1OA 3H91A 3MXNB 4YSYB 1I4QA 3TP6A 3GTGH 1FCCC 2R61A 2R6GA 3L0OA 1NCVA 2QCPX 1V6EA 4XQNA 2IY1B 1G6PA 5C3EG 2OF1A 3S16B 4M0WB 5LNK1 4ANVA 1E22A 3CMEA 1XCTL 4M1UB 1PRTB 4BY7B 1MIUA 1NMFA 2UXBQ 2GBKA 4DWFA 3Q2AC 2WYQA 3NUHB 1Y1VH 3W1YA 2AQ1B 3RLFA 4HIDA 1SDFA 4LAAA 2Q2UA 1XNRQ 3GTMB 4K5VA 2KFJA 2JYTA 3H7PA 1GUNA 4EX5A 2NVQH 2AKWB 1WZ0A 2NVYH 4DK1A 3DM3A 1U4AA 1XLQA 5C23A 5HURA 1Y1VB 2MP2B 1I4HA 1O7LA 1UE1A 1UELA 2CJOA 1YNJC 2XNAC 1AARA 4L5QA 3TZUA 2NVQB 3U4ZA 4NPSA 3SXHA 4N58A 3C1FA 2RCNA 3SK4A 1YNND 4ZKBB 1R4NI 1EWYC 2VRRB 3PTFC 1LT4D 3ICEA 3PT2B 1SYDA 1K8RB 5KHOA 1H9SB 4HPMB 3ZKJC 2SNMA 3T1HQ 1FNVA 4OX9Q 1TKYA 2VB3X 4CDDC 3PO2G 1L7YA 3ZTCA 1JQYD 3SFEB 2WAQE 4QIWB 3DWPA 3PO3H 3HOYG 2N1WA 1SNQA 4F88A 4CHKA 1B50A 2D3AA 2KN4A 4A3BH 2I0QA 1D7QA 2MW5A 1PRTD 3VR8B 1BQQT 2D07B 1WR6E 3AM9A 1FVIA 3J81E 4FHJA 1IXRA 2K03A 1V5TA 2JN4A 1DM0B 3AFPA 3Q8CA 2F0FA 3PO3B 2UXBL 4LF5Q 1WYWB 4HN7A 4NW2A 2XIWA 2ZJPA 1K51A 2Z0DB 4MGZE 1TQOA 2DBYA 3RNGC 3HKSA 2WWZA 1TWGH 3I5JC 4FLHA 4R4QA 1XNRL 2KQ7A 2BWES 1V43A 2EOTA 4OELB 2V3PA 1HPCA 1G51A 2JY6A 5C44G 3R66C 4A3KH 5I9PA 1YOVB 1GB4A 3E6ZX 4ZAIA 2WNMA 3L54A 2N49A 2LKVA 2XRQD 1MSHA 4RMAA 4EUTA 4OL7A 2OTJA 4IWQA 4IN3A 2BBCA 3R2IA 4NJ7A 3A8IE 1F2YA 1LT6D 1UAPA 2TMPA 4AS1A 1R7SA 4AJYB 1V1QA 2RDFA 1G91A 2BDNA 1T5XD 1S4ZA 1IPGA 4A93G 1P16A 2L0CA 4TMAB 5KYIA 1HCZA 3B2FA 1VZ8A 4OX9L 3GTLH 2F0IA 2F4IA 2MJDA 4JQWC 2R7FA 1Q90A 1QCBD 2WIIB 4TKOB 3M4QA 1W3SA 1KNEA 1P9DU 5CHFA 2KECA 2KVMA 5DCNA 2GVAA 4L6TB 2EYLA 3GTLB 1WTVA 4DV3Q 4LFCQ 2PI2A 4CJ0B 2LASA 4LF5L 3J7AF 4A3LG 4BVUC 4DXAB 2K33A 3I57A 2GLSA 1B4OA 3LX0A 1Y69U 4BAXA 1K8GA 3H3VI 1L0WA 2NCNA 1A2UA 4K1RB 1F2LA 1EYAA 4NNJB 4C4VB 2LSSA 4DAVA 1ASZA 1ESFA 4UP8A 1JROA 2WAQB 3I56A 2F0EA 1VQDA 4R4CA 1VQNA 4A93H 2PQEA 1X54A 2KA7A 4NXMQ 2VNUD 4O1NA 4NDXA 1YI2A 2IX1A 2M0XA 2XK5B 4R8NA 4B3MQ 2L52A 4CJ2C 4JI4L 1WTPA 1C76A 1YNNC 3DWGC 4NQKE 2UXDQ 5E6JA 1VMCA 3KF8B 3OMGA 4DV5Q 3MEFA 2LUEA 1A3TA 1E90A 2R92G 1GUTA 4B3SQ 2KX0A 1E0BA 3E9IA 4K2KA 5NUCA 1WFQA 2K04A 1K52A 2R3ZA 2B2WA 2MFIA 1S72A 5H1SE 1PRTC 3HOUG 3D32A 4XE0A 4HJ9A 1HEZE 3M4YA 4LFCL 4DV3L 3A33B 3HIZA 1P7FA 2F0UA 2VS1A 2QDBA 4BBRH 2ZVNA 2QJLA 3NRZA 1V8CA 2PLPA 2V1YA 5CORA 2Z0SA 3T3NA 2H1EA 3G4SA 4PS8A 3VR2A 3K5LA 1N36Q 3P42A 2YLMA 4YWKA 2WDTB 2Y5BB 3BINA 3RNEC 4LFAL 1PZJD 4RWSC 4POFA 1E24A 5LL6S 3V2TA 1XMQQ 2JA8H 2BB6A 4ICVA 4MH8A 1MPEA 3FVQA 2KWCA 2EY6A 3GO5A 4EQNA 4NXML 3NELA 1VCIA 1TWHH 2R92H 4K8IA 2E76C 3MXNA 2HTME 1XLOA 1WGHA 4PZ7A 2QF7A 4IQZA 1A3UA 4EQ5A 4LTUA 1LO5D 3ZUNA 2JA8B 4C56C 4DV4Q 2KTFA 1I4RA 1KDCA 1D6EC 1T0RC 5GROA 3I55A 4DV1Q 2IY0B 3UQBA 1O7IA 1TWHB 4DV5L 3ND8A 3STBD 3NS8A 5M3MG 2PZTA 1TY2A 4B3SL 5AUKA 2YYZA 1GUOA 4KLKA 4DR7Q 3DM1A 2F3WA 4RKLA 5HGTA 4QAYA 4NJCA 2ZW1A 2KWUB 1I5FA 3HOWG 1EY9A 2NVXH 5IYCG 3PZ8A 3TEXA 4IZ8A 1YNTE 2OTLA 5G3LD 2F0KA 3BK2A 4ZYNA 1R4MB 2MGSA 4L63B 1RM6C 5M3FG 5HG2A 2GVBA 4H13C 2SAKA 4YWGG 2K8BA 1N36L 3BVMA 3NBIA 3ZIMA 1VQ4A 2BDOA 1I6VC 1RTOA 3Q8EA 4KI0A 3VA7A 3NTHA 1J8CA 1QLBB 2G1EA 3LJ3A 1E2VA 1F2RC 2L4NA 2EJGC 4DN4M 4BKSA 1BR9A 1XMQL 2PJHA 1H9KA 3K8AA 4BY1G 3KLSA 4CJ1B 1PZKD 1SYGA 5T1GA 2D3BA 4ANXA 1Q0WB 3NQIA 1ZE3D 3ECIA 4II2B 1PTOF 2V4IB 2GBMA 2PVGC 1H9SA 4GN3B 4P71A 2F0NA 2EKIA 1B9MA 1D1IA 2QEJC 1S5DD 4A3EH 2KFKB 3DBLI 1XTCD 1EF5A 3FPPA 5BYSA 4DV4L 3E5SA 3AE4B 4FF1A 5L95C 4DV1L 3RULA 1YEZA 1V9JA 5AUIA 4A3DH 1TBEA 1O80A 3ZNZB 4XZ4A 2K05A 2BH2A 4KZ0A 2K52A 4DR7L 5EDSA 5D7GA 2E2DC 3G6JB 1U4MA 4K5XA 4YHHL 5BYQA 2M9VA 4ZLTF 1N9WA 1BBXC 4JBMA 1WCMH 4IM3A 3K9OB 4KZCA 4BY1H 1MSGA 2E75C 1RODA 3KW5B 5CR3A 4GN1A 2GMIC 4IOAA 3G71A 1RKNA 2EJFC 1EF1A 1VQ7A 1KTKA 1OEYJ 2CH4W 2L76A 4YL8A 3SD5A 1NAPA 2BF8B 1UWVA 1OGWA 4IALA 5D14A 2WHIA 2Z6BA 4QCLA 4S0RA 2NBWB 3ZO5B 3SDLC 2KZRA 3J81j 1NBWA 2HT1A 3CQZB 2LRUA 5ELOA 4FULA 2NVTH 1BMLC 4JLCA 5IP7H 4C3IH 1E7PB 4KKIA 2B8GA 5FLMH 2F0GA 4GU2A 1A8VA 5LXIB 2XN9C 1FXTB 1XCQL 4P73A 4PNYA 1UE6A 1WGKA 2DZIA 4KV2A 4B08A 3GTQH 2NVTB 3STBC 3B2GA 4YSXB 1SN8A 5EPKA 3HOXH 4IPHA 1HE8A 2HDEA 2EZVA 4ZHPA 2E2JH 4RG1A 1STNA 2B2VC 1DOIA 2O4XA 1LTRD 3I72A 3RYTA 3D6WA 4C4VA 1NY4A 4C3HG 3GTQB 4YTMB 2WFWA 3HOZB 1W2BA 4YTPB 2X8XX 3J81i 4GXBA 3KJPA 2EYJA 3VUXA 2E2JB 4KN4C 2NTSA 1YQBA 5EE1A 2ZTCA 3BZCA 1IBMQ 2C7NB 1WJNA 3RZDH 2EIFA 1NTGA 3RD2A 2OQKA 1KHIA 3NXWA 4OVUA 3MAQA 2QCZA 4A6QA 4E3CA 4ZK9B 2K75A 4AIMA 3NWTA 3AEBB 5CMDA 2XK5A 1AFPA 2NBUA 3OW2A 1HJPA 3ZNGC 4JBJA 1XQQA 1K8AC 3P63A 3S1NB 1WXVA 3PIP3 4PS3A 1SE8A 3KF8A 3KJOA 2NZOA 2L55A 3MTNB 1UBQA 2JX5A 3U4EG 2KK8A 1UE5A 3ZQ4A 4DV6Q 3TRZA 1P98A 2K32A 4XIGS 1M90C 3DBRB 3PF4A 4RGOS 1SIJA 2B2VA 1C9OA 4ABNA 3NSWA 4I7ZC 1I7HA 1WX8A 2IX3A 1QOGA 2C7MB 3KUDB 2F0TA 2HQEA 4A3IB 1JJ2A 1E5WA 2BH8A 5LXHA 5L37A 3GTJB 2K1FA 2LXCA 3ERSX 4HK2A 4OGQC 2BYEA 2C35B 2RGFA 2K6AA 1PH6A 1VDVA 4X62Q 4S3SA 3M7GA 5JZEB 4N8X1 1E7UA 1NR4A 3F2UA 3L17A 3VYTA 1EFWA 3S14B 4OO1H 2IBIB 1J6QA 5DM63 2RDBC 1XF5L 2R7ZG 4KN7C 3EGRA 1DXMA 1TWCH 1HR0W 5CV8A 2YU9H 2LXAA 4KY6A 1AN8A 4A3JH 3HOVG 3W2DA 2UU7A 1S5BD 3H0GG 3UIPB 2EJMA 4DK0A 4IO9A 1KAWA 4R9WA 1P1AA 1VRAB 1K83H 1TR5A 1OQRA 2KYWA 3FP9A 1EIGA 2KENA 2E5LQ 1SYBA 4DV6L 2JQOA 1AE2A 2B63G 2JA5H 3C1EA 4LUVA 2MQJA 1RAXA 1VQEA 1L1OA 2P5ZX 1IBLQ 1VR9A 2F0JA 5FJ8G 3RNCC 3V6EB 1K73C 4MH0E 1E8ZA 3M95A 4RGMA 2NR2A 4KKJA 2A19A 2EYHA 1Z6HA 2JSOA 4GN4B 2CCZA 1SF0A 1M1KC 2NZ1D 4W9KA 2QA4A 1EQRA 1G2TA 2OOBB 4MGIE 2BKFA 4X62L 1QUQB 2NN6G 3DVGX 2DAFA 3I70A 3Q6SA 3SE0A 3GTOH 1FYCA 3X0WA 2ZNVB 2NB0A 1UUPA 2LGSA 3APFA 4TQ1A 1CK1A 2WXPA 3QJYA 2WINB 3HEJA 3KLWA 1OQQA 4XC2A 3TZDA 3CF6E 1RYJA 5C4XH 2PW5A 4K7UA 1L2FA 1XJVA 1WWTA 4W9CA 2IGGA 3ETRA 2KFKA 2ZJRA 2WXIA 2KTRB 5KEEA 4I6PA 3CMMB 3PS6A 3T13A 3WIMA 3AQQA 1R4NB 3RFZB 3D31A 2EYFA 2E5LL 1ZP0B 2DGYA 2G4SA 1I4PA 2EVBA 1SE9A 3LGJA 3DHHC 4DK3C 3UINB 3QHTA 1N8RC 4BOSC 4RFBA 3PUYA 2PQAB 1Q12A 1D2BA 1WMHB 3ZNID 3S1QH 2MA9B 3IRBA 4KY5A 3NJTA 3E9SA 1IYJB 4L8JA 2Z0EB 4CKBA 4X64L 2BGFA 3Q3NC 1WR1A 4O2DA 2KDFB 3NENA 3DHIC 2J0JA 2V4LA 2LVOA 3EFCA 4FN2A 4IOIE 3D4RA 5D3IB 1Y1WH 1E9MA 2ZVOA 3RCZA 4FP5D 2Q8RE 2WV6D 3OJ4B 1EQTA 2DJGC 2WDQB 5K36G 2C7HA 3K7UC 4TQ0A 3ZW3A 1PDXA 3HK0A 1QOAA 3RN9C 3VH4B 2FINB 5I2XA 3GTPH 4DF7A 3TN2A 1Y1WB 3MHZA 3NS1A 4OIJA 4DUYL 4IKGA 4MGKE 3IAYA 2N4FA 5J22A 4W9FA 5A2QL 1SNCA 4R8IA 5KNDA 2M19A 2LWPA 2KWVB 1UNSA 3VDZA 1TS4A 1KC8C 3GTPB 2PKOA 4LJOB 3WA0A 4ZRJA 1R4MI 3DUZA 2J0KA 2WXJA 2UWQA 3PSEB 4C3JH 1F9SA 1ZW7A 3PUZA 3JAMc 4B9KA 4RKBA 5E7NA 4M8AA 1FNUA 2MRPA 2MNAA 4ITKA 4GIVA 4OVVA 3A5UA 3AE5B 4FF3A 3SHLA 2DX5B 4L23A 5DPRA 5IGEA 2O6VB 1MG4A 4C3JB 5IN7A 3FEWX 3I4NB 4JIOU 2WU5B 1K0RA 1YHBA 5DEHA 2MBOA 2B29A 2J4XA 3GE3C 2CWAA 3L08A 2RDHA 4DNIA 2WXLA 1E3PA 2QIEB 3BDOA 4P72A 4OW0A 2DYMA 2EY2A 1A62A 3DHQA 1G6ZA 5J18A 2DNEA 4ZOHC 3U30A 3MC0B 5D94A 3ZRCA 1YN5A 4RA8A 1E8XA 1FRRA 3LDZE 4LF4Q 1MGSA 2JWUA 4LNKA 3OIQA 2PE9A 1CM9A 4M02A 2MWSB 1XMOQ 3T51B 1IKMA 2JJQA 1R4PB 2WB1E 4LNIA 2EXDA 5COYA 2K1BA 1ESRA 2N9EB 2JA6H 1YJNA 3ULJA 3UE0A 2K8CA 4GLVB 1B2TA 2NMQA 1EUVB 3Q3MC 4KGSA 2ZTEA 2N1VA 1PA6A 1FGBD 5C4JH 2KNBA 2FJ2A 4HR7B 2CQAA 3NY5A 2O6VD 4MJSB 1LFDA 2KLCA 2IZVB 3SK8A 3PF5A 2BQQA 4B9XA 3U4VA 2F0DA 3I4MH 4GN5A 3EC8A 3ZDMC 3TL5A 1IP9A 4PT5A 1IZ6A 3MHBA 1V1PB 2E6XA 1X3PA 4GMVA 4LK1C 1Y56A 3G48A 2K5HA 1MI2A 3U7ZA 3M4OB 1FFUA 1TZOA 1SB3C 1NE3A 1STBA 4UP7A 4BXXG 2AEHA 2ZNVC 1KDAA 4N8FA 2QHOA 1L4ZB 3SHQA 2MBQA 4KKUA 3TIXA 3C3LA 3L0WB 4AUQC 5JPMC 4RF1A 4B0EA 4C7ZA 1DOKA 4QB4A 2JZZA 3DCGA 4DV7Q 1Q81C 1C4CA 2UYZB 1BCPF 3GQBA 4KD4A 1XMOL 3HVDA 4C1NK 3AE3B 2F0OA 3M3YH 2RQXA 3ENEA 2QMTA 1HNWQ 4NPNA 4PZ8A 1CKNB 1LTTD 2E8GA 1MHWC 2B2UC 1HQMC 5KRUA 3QR8A 3APCA 3QAQA 1L2NA 1TGZB 4HDQA 2B2YC 1MHXA 1V81A 4FJZA 3FKIG 1C79A 1D4BA 1HA6A 4IFDH 2BYVE 3E0JA 2N78A 2H5XA 2EQSA 1BUIC 1YX6B 2DNCA 3FILB 3UF8A 3V60A 2Z4HA 3HUIA 4LW1A 3HG9A 3RNAC 1X3QA 4GOPB 1QUQA 2F0WA 4UDUC 2A6HD 5IY0A 2AL3A 2UUCQ 2L05A 3MC9A 1KOTA 3HKZG 2WB1B 4FNFA 4DNTB 4HJGE 2JK8A 1K3RA 3BWUD 1ZKHA 4ZHOA 4GZYC 4QGUA 3AI5A 2QKIC 4A3MH 2UUAL 2F1MA 4WJOA 2DHZA 3V62A 1YZ6A 1SE2A 3OW7A 1VJKA 3DBRI 4IW0A 4FVMA 2QC8A 2EDGA 2H89B 3DQVA 5F2DA 1DGJA 1QVFA 4LNFA 5J17A 2KTRA 1GKHA 3BK1A 2JZPA 4NKLA 4IFDJ 1E7VA 3M63B 4DV7L 2MBHA 4FADA 1SNDA 1YHQA 5BMGA 5J2RA 1ZYRD 5IT9L 2WXOA 2B2YA 3WOEA 2X69A 1PYWD 1LTID 1ILPA 1S3SG 2VZKD 3Q8AA 3AXCA 5TSSA 3T9LA 3DWAA 3X23A 1PH9A 2JF5A 3AU4A 2N9LA 2EYOA 2VUMG 3KF6B 3TSSA 1WMHA 1PH4A 3ZYYX 3URYA 5IGFA 2BS3B 5E6NA 3DBLB 4HSVA 4IUQA 1M8AA 3GS2A 2KAJA 2BVCA 1RRBA 2XWJB 4MELA 1JW9D 1CHQD 1OXVA 2ID0A 1Z47A 4LJPB 1F0ZA 4BA2I 1RLFA 2KOLA 4FA6A 2WDVB 1EYGA 4K3CA 4J6IA 4LLGM 4K2LA 5GAEC 2JA7B 1T0QC 4OO1I 2V4DA 1ONLA 4Y7NH 4FHKA 4JWUC 1PH3A 1QZHA 3VAWA 1VS0A 3TP8A 5IIFA 4XQJA 2V3NA 4GDKA 3TBIB 3Q8BA 2R2QA 3RT3B 4YT0B 3KVFB 4BY7G 3I90A 1Z9FA 1Y8PB 4F87A 4RMFA 5BMHA 1W6JA 3KUPA 2NTTA 3CCQA 1SYEA 1NI2A 2OJRA 2VUMH 1Q5WB 3C46A 4XXEA 3QIAA 1JB7A 3CC4A 2DAJA 2CHBD 4A3GH 1LQBA 2R93H 2A5UA 2IO1B 4JGHB 4DR4Q 2F0SA 1PRTF 4N9PA 1LUZA 2ZXOA 4UP9A 2HCIA 3GTGB 4RM8A 1JMLA 3TS0A 3QC8B 2FMCA 1PQSA 3CD6A 4PZ6A 2F0PA 3IAS1 3S9WA 4WWMA 3IKJA 1WFYA 2GBRA 5D65A 2E2HH 4C2MH 3VH3B 4C80A 2MP1A 1EIYB 3R7RA 3WALA 3VR4A 2HIVA 1QKZA 1HA5A 1UE7A 1NYRA 4WJPA 5AZFA 1N32Q 2ZEQA 2SEBD 2INNE 3N52A 3CMAA 2E2HB 3DEOA 4C2MB 4E74A 1LTBD 2A6HC 1JRPA 1OQYA 1C3TA 5FLXE 5T1IA 1K53A 4Q2JA 3TDQA 1Q3LA 3FRPB 1UWMA 3QX1A 2I5MX 3B0AA 1N60A 1G6JA 2MEKA 2D3GA 2J53A 1CSQA 2NVYB 4DQOC 4ZCKA 5C3EH 2BW2A 3L4PA 2OEOA 2K25A 1L4DB 1T3QA 2A68D 1VF5C 1WTXA 1PH8A 3ZVVA 4K81A 4ARIA 2J52A 4RHSA 4CYEA 3O13A 1SSNA 2DZMA 1VQHA 2X6GA 3JYUA 1GB1A 3HM3A 2I5LX 4DUZL 1STGA 2QILA 4AYBE 4DR4L 4HXDA 4BBNF 3T3OA 4GLXA 1H9MA 1TY0A 4DV2Q 4AP4C 5IE8A 2JYEA 4JPSA 5KGUA 1ZGUB 2KOXA 2HD5B 2BS4B 5C3WA 4JWSC 1X9NA 4A4IA 3RZWC 4DR2Q 4A3BB 4MJSA 2CH4A 2PMZB 4EQOA 1KF6B 4LNOA 4S17A 5HI1A 1CHPD 2YTVA 1ET6A 3WDNA 5IAAC 1EY5A 1WXAA 3A0JA 4B6WA 2ATWA 3CIRB 1J0GA 2N9PC 3DWMA 5EGTA 2L1BA 2N7DA 1T0SC 1IKLA 2C9OA 3EUB2 4ZUIA 1N32L 4GOPC 2O2LD 2ZW0A 1TWGB 4BKGA 5CV5A 2Z1CA 1WTHA 3PO2H 2IY5B 2R2OA 3I91A 3I63C 1C1YB 3HOYH 3S1MH 4A3KB 4HDOA 3T16A 3FHWA 3H1UA 1GD7A 4JI4Q 1EIHA 4IURA 5IGGA 4TSSA 1XPUA 3E56A 1ENAA 2JP1A 1VQGA 5JVG3 4LF9L 1UWXA 2GI9A 3RI7C 4A9AA 2L32A 2KEDA 2WACA 2X38A 1H9JA 5J39A 3S2DH 1TT2A 2F52A 1J5EQ 4JI5L 3PZ7A 2K5QA 1WXQA 1WY8A 2WAQG 4L2YA 4JK1C 4A55A 2FCQA 1JQ4A 4NZLB 4L5TA 5DAUA 3PUVA 2AHOB 1JWSD 4DV2L 3N1XC 5CTRC 5C44H 4LDTB 3KBXA 2ZM6L 1JT8A 1B70B 2ENBA 3FILA 4EKUA 2Q8IB 1NUCA 5DPWA 4B0MA 1GG3A 4DR2L 3J81L 2XSCA 4GOPA 2HCCA 2LGYA 3F2CA 2FHTA 1E6EB 1VQAA 1QVGA 3IHPC 4LFAQ 1HZBA 1EYDA 1HXYD 4PQXA 4RGNA 5KNBA 2G5DA 4HKZE 2ZZPB 4AYBB 1H9RA 4ULLA 4BBSG 1H95A 4FXDA 3Q3JA 4YCWA 3MFGA 1BO0A 2JA9A 5IO9A 2K5DA 1PGBA 4GS3A 2LGIA 1RL2A 5I9OA 4DHJD 4A93B 1KM7A 2NUCA 3L7ZC 3NUCA 2A68C 2W82A 1E10A 1C4AA 3OAWA 2KJHB 2EYMA 3MWYW 3GD7A 1Z5SB 5FOBB 1J5EL 2VB2X 2L11A 3NWSA 4A3LH 2KMMA 3KF6A 1X55A 3RZFA 3VVWB 1N34Q 5A35A 1V5OA 2D9UA 2Y3AA 5C3JB 1RFKA 1IYVA 3NG0A 4LDTD 5C5MA 1QB5D 1EY0A 4PYZA 1WJ4A 2FCSA 2RSNA 1WI0A 4WJQA 2K6DB 1SMYD 3A56A 1B9RA 3WAMA 4WAAA 4WJNA 2K50A 5CBAE 4BBRB 5I2YA 2WP8J 2Z8LA 3S24A 1R4QB 2ON8A 2Q2TA 4X57B 4ZUJA 3H15A 1SNOA 4ANWA 3OMCA 5GAGC 4QJFA 2M1MA 5EJWA 2BE5D 2D5DA 5EPLA 1VQFA 3MC8A 3VFKA 1YN4A 5C1ZA 4AH6A 5JPNC 4IM2A 2LGXA 3M4PA 4PYUA 4FYDA 4OXPA 3PCOB 3HOUH 4FXCA 1VQPA 4OHJA 2VY3A 3TQYA 2KN5A 2R92B 1PH5A 4P1CC 3RNBC 3DVGY 2INPE 2K4KA 2MBBB 2V0GA 2HQLA 3VHTC 2CW0D 4G7OC 2JU6X 2GOWA 2IO2B 1N34L 1WE6A 1JB3A 4YHHQ 1EEFD 4IFDI 4G3XB 1VQ8A 3U58A 2MO0A 4ALPA 4NXNQ 1ZXHA 3EBEA 5FKAC 2MJ8A 4W9HA 4DXGA 1SXTA 4DA2A 3SVMA 1N5XA 1JE5A 2MP2A 1HQRD 2OXPA 1LTSD 1OXXK 2BYTA 3ZJUA 2F3VA 2NVXB 1JOKA 3P1MA 2FUHB 4NAWB 2KMAA 1ENFA 1UF0A 1S40A 2IHEA 4X3TA 1BOSA 3IT4B 1LT5D 2EXZA 4QQBX 1TWAH 2WXKA 2ZT9C 5M3MH 4W9LA 3E0EA 3PGZA 2BA0A 2A69D 5JXVA 1F9PA 3KWLA 4YCUA 5C2TB 4N9F4 3HOWH 1EY7A 5IYCH 1A63A 2K39A 1PFMA 3CRLC 4JI8Q 5IYBG 4JI6Q 1CT1D 4A3EB 2KXJA 3D4WA 4OWTB 1PTOH 5E4WC 3S2AA 4R4OA 5M3FH 1NI3A 1MFWA 3K81C 3K0XA 3A8JE 4DKAC 1PUTA 1CQFA 3RUZA 2O5JC 1GUAB 1X56A 2RSUA 2A74C 3BG3A 4NXNL 3K58A 4A3DB 1HUNA 2D11A 4PG3A 2HJ1A 5M3FB 3ZJVA 1DJRD 4HJKA 1ROEA 5CBEE 4DR3Q 4MEMA 5G5GA 1LV9A 2BYFA 2AWOA 3AH7A 5LLIA 2BB5A 1A15A 2NZHA 1YJ9A 1SSOA 2BT6A 2JXXA 2KJRA 2PPHA 4EZLA 1DOYA 3I4OA 1WCMB 3I7FA 4NP5A 1A70A 1IHZA 2PE6B 4BY1B 3PLVA 5BO4B 3Q8FA 4HIKA 1P0RA 2SOBA 4GSWA 3PIPA 1YNXA 1MKHA 3CKIB 3A8KE 5C0XG 2BWFA 4KHZA 1WI5A 4G7HC 3CHBD 1KLVA 4JV5Q 1XLNA 3RN2A 3CCRA 3AFQA 4DR1L 2L00B 4POGA 2EY5A 3HOZG 2WXMA 2MQHA 4CDFC 1I6HH 3L3OC 4DDID 1QILA 2YTXA 4LWCA 3CCUA 2DYOA 1MJCA 3LXFA 4WURA 3RN5A 3TS2A 4JI6L 1WGRA 1V9PA 4JI8L 3CC7A 1UBIA 1HZ6A 3ND9A 1CKOA 3DXJC 1I94Q 4C3IB 4KHPQ 3VUWA 3ZRFA 3NPPA 1U4RA 2ALYB 1LLRD 4RHRA 3ULLA 1KD1C 2LFIA 1XEEA 5LMNW 1QVCA 4TV3A 2WX0A 1PTOD 1KRTA 1TZ1A 1Z2MA 2KD0A 5BR8Q 1ET9A 4KVGB 3OSOA 3HOXB 2KHSA 3DBSA 3A9KB 1EY6A 2AUJD 2G9HD 2RVLA 4DR3L 3MHSD 3QO2A 3MXUA 5C0XH 3I3CA 2EY1A 3KDFB 2Y0SG 5EKLA 1ISNA 1YIWA 2BKRB 1I35A 2IPKD 2WS3B 1HZCA 3EVQA 1EZ6A 3IFTA 4A3IG 3DDCB 3J7AV 3NVZA 3ZJTA 3RZDB 4UPAA 2I2YA 3UIOB 5C4HA 5J1ZA 4HROA 5E6OA 1GUGA 3MXGA 2WXHA 1OXSC 1H4RA 4JV5L 2A69C 2D2QA 2PNHA 2KQSA 4C3HH 1P3QU 2MH7A 4H44C 4ZQ3A 4FXGC 1KRSA 2IT1A 1I94L 4KHPL 5ELFA 2PVOD 2D10A 3CPWA 1E8WA 1C0AA 2WP9B 5LMUQ 3RR5A 2MO1A 1OO9B 3CRKC 2K14A 2EPBA 5MPOA 1VQIA 5JEAG 3MVVA 5BR8L 2W55A 3AEVA 3ABVB 2JVCA 3CCEA 1B7YB 2QW7A 4RGTA 2A8VA 3TJPA 4XWWA 1QF6A 4XYOA 3QG1A 3T1YQ 4UY8C 5JJKA 4WJ3M 3AU5A 1U0LA 4DNRB 2EMTA 3OOCA 5C5LA 4G57A 4WORA 5TR5A 1QT9A 1WTOA 2AYOB 2HJ8A 5ISRA 5M9OA 2K5NA 1FMAD 3X3MA 3A9JB 1YX5B 2L5TA 3T53B 2LVQA 1TWFH 3WOFA 1FO4A 4MN3A 1Q86C 1TWCB 4KSKC 2YU9B 2H4OA 4A3JB 2RPQA 1EOVA 3FDTA 1WRIA 1NENB 2ZXRA 1AW7A 5IWAQ 3UQAA 3Q3OC 4HKQA 2O2VB 2C5LC 1H8CA 1LTLA 1SYFA 1K83B 3KFUA 4NJ6A 3DMUA 1JR0D 1K3BC 3S17H 1O7YA 2E2IH 3TEZA 1JC7A 2KDMA 2UUBQ 1T9HA 1YIJA 1KNAA 1SAPA 3JC66 5LMUL 2JA5B 3J80c 2JQRB 4X64Q 4MM3B 1PH7A 4WAFA 2R7ZH 3VR9B 4JI3Q 4E71A 5JJLA 1MJEA 2Y5PA 4A3FG 2N9XA 5FO7B 1PTOC 3JVZX 3CP0A 3QOLA 4C1NI 3DLLA 3HOVH 4NAWA 3H0GH 3TEWA 2CQOA 5M5XH 1VQ9A 3PO0A 4DK6C 5IOCA 1VQCA 3IBEA 4ARCA 2IO0B 3T1YL 1WX9A 4AJWA 3PIOA 2K5VA 3VTUA 1HHVA 4KD3A 4DUYQ 3TMEA 3GTOB 4X66Q 1STHA 4OIKA 4WRDA 5EPJA 2B63H 3N3KB 3LYYA 1PGXA 4G0NB 5EBDA 1JJGA 5FJ8H 3NEMA 5C4XB 5DPTA 2PEAA 4DK5A 2MUYA 1E2WA 3AMUA 2J0MA 2B63B 4TKNA 3IL8A 3P20A 1OEYA 5IWAL 1N62A 4CO7A 3B6YA 3KLSX 4LMQD 3VA5A 2AWNA 2NN6H 2KO3A 4DPGA 3A4RA 2PW9A 3ZNHB 3CC2A 2NWGA 1VZ6A 1U4LA 2UUBL 4HIMA 1AH9A 3Q3FA 4XQQA 4DXFA 4GGQA 1TIID 4URKA 4C7YA 1B8AA 3S1QB 4JI3L 1T0YA 4LCDE 1VLBA 5CX3A 4F1SA 3E9HA 4N9TA 1Q8IA 1WE7A 1PH1A 4JC0A 4DAYB 3ULPA 1EYCA 5IT9c 1CI3M
chains in the Genus database with same CATH topology
4P6VF 4KHVA 1TS5A 1KLUD 1C4PA 1C78A 4XDCA 3AE2B 2NYZD 3PIO3 3I9V1 2MHVA 3VYUA 2LHDA 1JCKB 1STEA 3EROA 1UEAB 1ENCA 1L6VA 2BOSA 1RHPA 2WKDA 3BS1A 1Y8OB 4E6IA 1M4VA 1L0VB 1FRDA 5EE9A 1WTWA 5K36H 1EWCA 3VR6A 4XT3B 1C77A 3P4SB 5EE0A 1AP0A 4KV6A 2I38A 2K01A 3T56B 1LT3D 1RCVD 3X3NA 1NEKB 1STAA 1YQ4B 1FR3A 1PXUA 3FAHA 4PMWA 2CJNA 4QF4A 1WSPA 1ML0D 3J80E 4A8XC 2M2LA 2XRSD 1DOXA 4B9WA 2D5GA 4WQMA 3AEGB 4CKEA 3MZ5A 3DEPA 2JA6B 1RF2D 4DFAA 2L83A 1IYUA 2B8FA 2IL8A 3FMCA 3H8HA 4JX1C 1EOTA 5C4JB 3MA2B 2G9DA 3A7LA 5T8IA 2DLBA 3SR1A 1CFMA 3I4MB 2RSOA 4WJWA 3KK7A 4X3KA 3NHHA 1Q1EA 1L6UA 4G4KA 1FD6A 3SFDB 1RWSA 3AB5A 1LABA 1N63A 1CZWA 1KLGD 3P75A 2A6ED 2VZKB 1U4PA 4HCSA 2DY8A 2J7ZA 1K8OA 1U9RA 1TKEA 5I4DA 3Q23A 1CZGA 1SFOB 1WD0A 1KDBA 3M3YB 2OHFA 1FM0D 2IJ0A 1B1ZA 4G7ZC 3OIPA 1SYCA 1JICA 2RA4A 1ZDVA 2WU2B 3AU7A 5FO8B 2WXGA 1LACA 3AE8B 1NSNS 2MJ3A 1TS2A 1NVID 4KGTA 1HFNA 1WTRA 1RTNA 2IDYA 3MEHA 1KAAA 3D3RA 2N7JA 3JAME 4REZA 4WIPA 4A3MB 1NR2A 4MACA 2B2UA 4P2CB 2F0HA 3LWUA 1XWEA 3AECB 5FK9C 5CGKA 1SE4A 3D4DA 1Z7TA 3P4QB 2PPBC 1QE6A 4KGRA 4O42A 3I8ZA 3NVVA 2PMVA 4K8JA 3GP7A 1UGJA 3BYTB 1II3A 1O7ZA 1FCLA 2K5PA 1KH0A 2L12A 3D8GA 4HCEA 2WKCA 5DM73 5IODA 1YN3A 5H8YE 1QOFA 5ELBA 2ICIA 1BCPD 4DAYA 3FPUB 3K6OA 4ID6A 4H7BA 3AE1B 4J1MA 3SEBA 3K5NA 1F9RA 2FUG1 4Y7NB 2LS01 1FIQA 1TYGB 2YEPB 4YXDB 1VMPA 3NTIA 2Y5CA 1TKWB 1Y8NB 1FXAA 3VRAB 3ERQA 2VUMB 2A6EC 3I4LA 3MJ5A 4A3GB 2R93B 5IGDA 1KABA 4EVOA 1W6KA 3SR6A 4KK7A 5G5HA 2RMMA 2W54A 3QB3A 1J8IA 3V05A 3Q69A 5E3FA 5FO9B 1IGDA 3H94A 2EELA 4DU9A 2A73B 1YQ3B 1E0ZA 1RDPD 2LY7A 4OZBA 5C3EB 4YSZB 2DN8A 2KQ4X 4H2AA 2JSVX 3VYRA 1JALA 4XYQA 4OVZA 1ZYRC 2JEBI 3PUWA 1MBYA 2NN6I 3AEDB 2RDGA 5BYRA 1S5CD 1SJED 2WXRA 3G7LA 3C8YA 1G8ZD 3NQTA 3Q0AA 2Q5WD 3P4PB 4N6EB 3W1SA 1IUEA 1J7BA 2N0SB 3AE9B 1VZ7A 1V1PA 1GXDC 3H09A 1CZPA 2ACZB 4N59A 4ME5A 3GV6A 2I46A 1BCPC 3S1RB 4USAA 1YJIA 2XWBB 5FLXL 1F2ZA 1XO3A 3HRDD 2HDMA 4TRDA 3PO2B 3CWIA 3WCQA 1EEID 5K5PA 5CV4A 2AX5A 2HDLA 3HOYB 3S1MB 2ICEC 1QNKA 2Q8TA 3TEYA 4ZRQA 1BDOA 2PYKA 4J6HA 1SNPA 3S2DB 4QMGA 3AEAB 2Z4IA 3NP8A 5KIXA 2RPVA 4XDXA 3KWVA 2BTEA 5I6YA 3K59A 1XLPA 2K22A 1HUMA 4FF2A 3NTKA 1S5ED 4Q5VA 5C44B 2OT2A 2KCCA 2M00A 1GHJA 3W3AA 1JWUD 2C5CA 4EE2A 3IT6B 4HMIA 3OWFA 1HZ5A 1PMRA 3SDZA 1D5XC 4BA1I 5ELDA 2B2WC 3BVZA 1QJOA 4NMZA 3QWNA 3L9AX 1AYFA 4YTNB 1CJEA 2AUKA 3Q22A 3ITPA 1B44D 3RMHA 4HEDA 2CU3A 1B53A 1ZXTA 5G3LF 3A55A 1TS3A 2X6LA 4MIUA 1JWBD 5EKKA 2SDFA 2B76B 3NBHA 4RF0A 1OFFA 3Q24A 1ZDXA 1ZEQX 2AQ3B 3P7JA 4YIJA 4HEA1 2KQ3A 4BBSB 1AWDA 3OHXC 2W3SA 3NK9A 1EWHA 1F77A 4IUPA 3MFYA 3C2PA 4XTCS 3AMZA 3FC4A 1LTAD 2O5IC 5BN3A 2FE8A 3BYYB 2PZWA 5EKIA 4Z9CB 1PDQA 1EU4A 1T5EA 2GRIA 4J8QA 3NZ3A 4KTAA 1AEXA 3EA6A 3HOUB 1L0XB 2K28A 3K0YA 2WXFA 2EYPA 4KKTA 1PLFA 5JOBA 1CTMA 4EGVA 2MJEA 1GUSA 4OZAA 1JOOA 3RZOB 2DWQA 1MVKA 3W5UB 1DZ1A 1L5PA 3AE7B 3HGBA 4IUVA 2HUGA 2PTLA 1CA6A 1WD1A 1V8QA 2J42A 4X3SA 4D2KA 2F0QA 4U68A 3D6CA 1WYGA 5CV7A 1S5FD 1TWAB 4L1BA 2SNSA 4BWGB 4ILWA 5M3MB 2KUMA 1IBXB 1DONA 3V3XA 2K0PA 1X32A 4LK0M 4U673 1I4GA 1BUVT 3HOWB 4J3OD 2MPMA 1FFVA 1PTOB 3MP9A 1F2MA 4ZRZA 1EQVA 1FXIA 5E4XA 4UAIA 1SMYC 3SK6A 1XYIA 4C3IG 1E2ZA 4KY7A 4X3UA 2WXQA 2PO4A 3MXPA 2JEAI 5BMIA 2JYOA 2BE5C 1AZQA 2WXNA 1B9NA 1PZID 2WLBA 3IAM1 1J9OA 1QOBA 4PMBA 2IGHA 3J7YW 4US9A 4ZRPA 3HP3A 2PNRC 2EE1A 5ELEA 3SK5A 5CV9A 3TP7A 2BCOA 2CW0C 1I6HB 1PFBA 5D3DA 1NYQA 2IGDA 4R3DA 1WVLA 1EL0A 5EE3A 2I07B 3T4AC 4ZKCB 5ELCA 3RPFC 1D5ZC 4NAMA 2PW7A 1JWAD 3K5MA 1A3VA 1D1KA 1G2SA 5KYLA 1CA5A 2IX0A 5HHDG 2IWHA 2OEDA 4CKCA 2LFNA 2BS2B 1J7CA 4HMJA 2JXMB 5I6WA 3NE5B 5EQ0A 1DD2A 1R9TB 2KWDA 3KBGA 1BF4A 4BS9A 1MHHE 1LTGD 1BXTA 4RAUC 5C0XJ 2BA1A 2E74C 1OXTA 1IL8A 3TUOA 4OO1G 4C3HB 1ZPSA 1D5MC 3VRBB 1QQRA 1TVXA 5M5WB 1A6XA 2PZUA 4MHEA 4I65A 1SE3A 2D2CC 1SJHD 1EM7A 2Y0SB 4FXKC 1Q10A 3AE6B 1STYA 2ZXPA 2PIAA 1F2RI 2E3TA 1FEHA 4DGZA 1I3QB 4V0BA 1DOLA 4KMUC 1DOMA 1PFNA 1FD7D 3N9YC 4A90A 4DAPA 1TWFB 4PMCA 3CU7A 5JEAH 4PV1C 2B2TC 2F0MA 3OWEB 4F7XA 3LB8C 1SEBD 2B39A 3M85A 4AQ7A 4Q0FA 3RD4A 2FMMA 5HFYA 3BZDB 4CBVA 5IGBA 3S17B 2E2IB 3J9CA 1EFID 2AQ2B 5BN5A 2R7ZB 4K14A 3HOVB 3A7AB 1ZOYB 3H0GB 1HTLD 1QG7A 3BDLA 5JEAJ 3AB9A 5M5XB 4GDLB 2LJIA 2LEKA 1XXGA 2FFKB 2GB1A 3NVYA 1IBXA 2M56B 4HRSA 1J7AA 1IW7D 2B2TA 4ZYSA 2XVSA 2JXTA 5KNCA 5A2QE 1WTQA 1AZPA 3AEEB 1Q1BA 1MD2D 1N5WA 1C9FA 1GPXA 1DCZA 3EJIA 1L0YB 2ONQA 4OZCA 3V96A 4A3FB 3R8BA 4KX6B 2VXWA 5JJZA 4FF4A 5IGCA 2K5WA 2PCFB 1I50B 1T6BX 3VR3A 1YMHE 1K8MA 4C3JG 1YJJA 3IXSA 1BNZA 1V97A 2GA4B 3PMFA 4WFN3 1B3AA 4HTHA 5C6AA 3VQIA 3H6MA 3A54A 1HTPA 4KKSA 4GDKB 2K9XA 2LMCB 5C3XA 3P1HA 3R3OA 1JE4A 1GJXA 1GUWA 3BVGA 1QNUA 1DYQA 1P7EA 3M7NA 1PGAA 3AN1A 4QUFA 5CV6A 3R93A 2L1AA 1VDZA 3TP5A 4JBWA 2N9KA 3HS0C 1ILQA 3U2SC 1JORA 4H0LC 5E1FA 1KRHA 4XT1B 3ONAB 1HFGA 3U9OA 1ZXIA 4WH4A 1GHKA 4FO2A 1IGCA 3N6RA 1ICWA 2H88B 2KEEA 4HSPA 3GV3A 3HRZC 5AFWA 1IW7C 1MI0A 2WQYB 2K7VA 1VF7A 2RBMA 1SBBB 3R2TA 2RKSA 3UI3A 3PV0A 1ZKOA 4HAEA 1ACCA 2JE6I 3NVWA 4IUNA 3DWQA 2F0LA 5BN4A 2QSDA 1QWYA 4CQNA 5LHY1 3GB1A 1TU2B 5DNFA 2FBWB 3UI2A 5LL6X 4CHTB 3IFDA 1QOHA 1N61A 2IW3A 1KFYB 3P4RB 3EFXD 5CYUA 3OPOA 3KQ4A 3KLRA 5C4ZA 4IFDG 4EQPA 4JE3B 1GOZA 5M5YB 3HZXA 1JOQA 4XWTA 3J80L 1HRJA 5GXGB 4XDDA 3I73A 5IT9E 3K57A 2F03A 3LWEA 1ZUD2 4IUTA 4RH6A 2KACA 3S15B 5C0XI 1BCPB 2J0TD 4RNAA 1TJEA 3AV8A 3U9SA 1A2TA 4US8A 4CGYB 1EY4A 1K50A 3MTSA 4V190 1SNMA 4P16A 3AEFB 4GLSC 2L9HA 3BIID 5JVH3 2M0AA 4LJZC 1PFDA 3W5VB 1G291 2WDRB 2N55A 1YNJD 3HVZA 1RJTA 2A5HA 4RCOA 3FKIB 2D62A 4MT5A 2KCNA 3VYSA 3B9JA 3LNNA 4K6DA 4K6LA 1EZ8A 1OXUA 3U52E 3K5OA 3HKZB 5FR3A 4TQUS 3S2HB 3W9CB 5H92C 1EY8A 1XX8A 4KJOA 4F8MA 2NBFA 2YEPF 1CQVA 3BDCA 3VR5A 3K7AB 4IDIA 5JAVA 1O78A 1C8CA 1C48A 4RCNA 2W3RA 2CVRA 4K5WA 5CC4A 4QUCA 5EBCA 3PUXA 1C4QA 1FNWA 4IUUA 4KJNA 3JAML 1TKGA 2LHEA 1I4XA 1JWMD 2TSSA 2F0VA 3EQLC 3QOJA 2LUMA 2KJXA 3GTKB 1F9QA 4ODGA 1EU3A 2K3UA 2LMCA 1RD9D 1GAQB 2N88A 2DY7A 3ZGZA 3H3VC 4YSYB 1V1OA 3H91A 1I4QA 3TP6A 1FCCC 2R61A 2R6GA 1NCVA 2QCPX 5LNK1 4XQNA 2OF1A 3S16B 1XCTL 4M1UB 1PRTB 4BY7B 3NUHB 2AQ1B 3RLFA 1SDFA 4LAAA 3GTMB 4K5VA 2JYTA 1GUNA 4DK1A 1XLQA 5HURA 1Y1VB 1I4HA 1O7LA 2CJOA 1YNJC 2XNAC 3TZUA 2NVQB 3SXHA 4N58A 3C1FA 3SK4A 4ZKBB 1YNND 1EWYC 1LT4D 1SYDA 1H9SB 2SNMA 1TKYA 1FNVA 2VB3X 1JQYD 3SFEB 4QIWB 3DWPA 1SNQA 4F88A 1B50A 2KN4A 1PRTD 3VR8B 1BQQT 3AM9A 3J81E 2K03A 1DM0B 3Q8CA 2F0FA 3PO3B 4HN7A 4NW2A 2XIWA 1K51A 1TQOA 2DBYA 1V43A 2EOTA 2V3PA 1HPCA 5I9PA 1GB4A 3E6ZX 4ZAIA 2WNMA 2LKVA 2XRQD 1MSHA 4OL7A 4IN3A 2BBCA 3R2IA 4AS1A 3A8IE 1F2YA 1LT6D 1UAPA 2TMPA 1R7SA 2RDFA 1G91A 2BDNA 1T5XD 1S4ZA 4TMAB 2L0CA 5KYIA 1HCZA 3B2FA 1VZ8A 2F0IA 2F4IA 2MJDA 2WIIB 1Q90A 1QCBD 4TKOB 1KNEA 2KECA 2KVMA 4L6TB 2EYLA 3GTLB 1WTVA 4CJ0B 3J7AF 2K33A 3I57A 1B4OA 3LX0A 1Y69U 1A2UA 1F2LA 1EYAA 4DAVA 1ESFA 1JROA 2WAQB 2F0EA 2PQEA 2KA7A 2VNUD 4O1NA 4NDXA 2IX1A 4R8NA 2L52A 4CJ2C 1C76A 1WTPA 1YNNC 3DWGC 5E6JA 1VMCA 3OMGA 1A3TA 1GUTA 1E0BA 4K2KA 5NUCA 2K04A 1K52A 2R3ZA 2B2WA 1PRTC 4XE0A 1HEZE 3M4YA 1P7FA 2F0UA 2QDBA 2QJLA 3NRZA 1V8CA 2PLPA 5CORA 3T3NA 2H1EA 3VR2A 3K5LA 3P42A 1PZJD 4RWSC 3V2TA 5LL6S 2BB6A 4MH8A 1MPEA 3FVQA 2EY6A 3GO5A 4EQNA 1VCIA 4K8IA 2E76C 3MXNA 2HTME 1XLOA 2QF7A 4IQZA 1A3UA 4LTUA 1LO5D 2JA8B 4C56C 4M0WA 1I4RA 1KDCA 1D6EC 1TWHB 3ND8A 2PZTA 1TY2A 5AUKA 2YYZA 1GUOA 3DM1A 2F3WA 4RKLA 5HGTA 4NJCA 2ZW1A 1EY9A 3TEXA 3PZ8A 4IZ8A 1YNTE 5G3LD 2F0KA 3BK2A 2MGSA 4L63B 1RM6C 5HG2A 4H13C 2SAKA 4YWGG 3BVMA 3NBIA 2BDOA 1I6VC 1RTOA 3Q8EA 4KI0A 3VA7A 3NTHA 1QLBB 2G1EA 1E2VA 1F2RC 2L4NA 2EJGC 4DN4M 1BR9A 1H9KA 4CJ1B 3KLSA 1PZKD 1SYGA 5T1GA 1ZE3D 3NQIA 1PTOF 2V4IB 2PVGC 1H9SA 2F0NA 2EKIA 1B9MA 1D1IA 2QEJC 1S5DD 1XTCD 3FPPA 5BYSA 3E5SA 3AE4B 4FF1A 5AUIA 1O80A 2K05A 5D7GA 2E2DC 3G6JB 1U4MA 4K5XA 5BYQA 2M9VA 4ZLTF 1BBXC 1MSGA 2E75C 1RODA 5CR3A 1RKNA 2EJFC 1KTKA 1NAPA 4IALA 5D14A 4QCLA 3CQZB 1BMLC 1E7PB 4KKIA 2B8GA 2F0GA 2XN9C 1XCQL 4PNYA 1WGKA 4B08A 2NVTB 3B2GA 4YSXB 5EPKA 2HDEA 2EZVA 4ZHPA 1STNA 2B2VC 1DOIA 2O4XA 1LTRD 3I72A 3D6WA 4C3HG 3GTQB 4YTMB 3HOZB 4YTPB 2EYJA 2E2JB 4KN4C 2NTSA 5EE1A 3NXWA 3MAQA 4A6QA 4ZK9B 3NWTA 3AEBB 5CMDA 1AFPA 3P63A 3S1NB 3PIP3 3KF8A 2L55A 3U4EG 2JX5A 3ZQ4A 2K32A 4XIGS 4RGOS 1SIJA 2B2VA 4ABNA 3NSWA 4I7ZC 1I7HA 2IX3A 1QOGA 2F0TA 2HQEA 4A3IB 3GTJB 4OGQC 2K6AA 1VDVA 4S3SA 3M7GA 1NR4A 3F2UA 3VYTA 3S14B 4OO1H 5DM63 1XF5L 4KN7C 3EGRA 1DXMA 5CV8A 4KY6A 1AN8A 3W2DA 1S5BD 2EJMA 4DK0A 4R9WA 1VRAB 1TR5A 1OQRA 1EIGA 1SYBA 3C1EA 1VR9A 2F0JA 4RGMA 4KKJA 2EYHA 1Z6HA 2JSOA 1SF0A 2NZ1D 1G2TA 2NN6G 3I70A 3Q6SA 3SE0A 1FYCA 2NB0A 1UUPA 4TQ1A 1CK1A 2WXPA 2WINB 3HEJA 3QJYA 1OQQA 3TZDA 1RYJA 2PW5A 1WWTA 2IGGA 3ETRA 2WXIA 5KEEA 3T13A 3RFZB 3D31A 2EYFA 1ZP0B 1I4PA 2EVBA 4RFBA 3PUYA 1D2BA 1Q12A 4KY5A 3E9SA 4L8JA 4CKBA 4IOIE 3D4RA 5D3IB 1E9MA 4FP5D 2Q8RE 2WV6D 1EQTA 2WDQB 5K36G 4TQ0A 1PDXA 1QOAA 2FINB 5I2XA 4DF7A 3TN2A 1Y1WB 3MHZA 3NS1A 4OIJA 4IKGA 3IAYA 5J22A 5A2QL 1SNCA 4R8IA 5KNDA 2M19A 1UNSA 1TS4A 3GTPB 2PKOA 3DUZA 2WXJA 1F9SA 3PUZA 4RKBA 4M8AA 1FNUA 4ITKA 3AE5B 4FF3A 3SHLA 4L23A 5IGEA 4C3JB 3FEWX 3I4NB 2WU5B 5DEHA 2J4XA 2RDHA 2WXLA 2QIEB 3BDOA 4OW0A 2DYMA 2EY2A 3DHQA 1G6ZA 2DNEA 4ZOHC 3MC0B 1YN5A 4RA8A 1FRRA 1MGSA 2JWUA 3OIQA 1CM9A 3T51B 1IKMA 1R4PB 5COYA 2K1BA 1ESRA 1B2TA 2NMQA 4KGSA 1FGBD 2FJ2A 4HR7B 2CQAA 3SK8A 4B9XA 2F0DA 4PT5A 3MHBA 1V1PB 2E6XA 1X3PA 4LK1C 1Y56A 1MI2A 3U7ZA 3M4OB 1FFUA 1TZOA 1SB3C 1STBA 1KDAA 1L4ZB 4KKUA 3C3LA 5JPMC 4RF1A 4B0EA 4C7ZA 1DOKA 4QB4A 1C4CA 1BCPF 3GQBA 4KD4A 3HVDA 4C1NK 3AE3B 2F0OA 2RQXA 2QMTA 1LTTD 5KRUA 2B2UC 1HQMC 2B2YC 1MHXA 1C79A 1D4BA 1HA6A 4IFDH 3E0JA 1BUIC 3FILB 2DNCA 2Z4HA 3HUIA 3HG9A 1X3QA 2F0WA 4UDUC 2A6HD 4FNFA 2WB1B 4HJGE 4DNTB 3BWUD 4ZHOA 4GZYC 2QKIC 2F1MA 1VJKA 1SE2A 3OW7A 4FVMA 2EDGA 2H89B 5F2DA 1DGJA 3BK1A 2JZPA 4NKLA 4IFDJ 1SNDA 5BMGA 1ZYRD 5IT9L 2WXOA 2B2YA 3WOEA 2X69A 1PYWD 1LTID 1ILPA 2VZKD 3Q8AA 5TSSA 3DWAA 2N9LA 2EYOA 3TSSA 3ZYYX 3URYA 5IGFA 2BS3B 4HSVA 4IUQA 1M8AA 3GS2A 2KAJA 1F0ZA 2XWJB 1JW9D 1CHQD 1OXVA 2ID0A 1Z47A 4BA2I 2KOLA 2WDVB 4LLGM 4K2LA 2JA7B 4OO1I 2V4DA 1ONLA 4JWUC 3TP8A 5IIFA 4XQJA 2V3NA 3TBIB 3Q8BA 4YT0B 3I90A 1Y8PB 4F87A 5BMHA 1W6JA 3KUPA 2NTTA 1SYEA 3C46A 4XXEA 3QIAA 2CHBD 2F0SA 1PRTF 4N9PA 2ZXOA 2HCIA 3GTGB 1JMLA 2FMCA 2F0PA 3IAS1 3S9WA 4WWMA 3IKJA 5D65A 4C80A 2MP1A 3VR4A 1QKZA 1HA5A 1NYRA 2SEBD 2INNE 3N52A 2E2HB 3DEOA 4C2MB 1LTBD 2A6HC 1JRPA 5FLXE 5T1IA 1K53A 4Q2JA 3TDQA 1Q3LA 3FRPB 1UWMA 1N60A 2MEKA 2J53A 2NVYB 4DQOC 2BW2A 3L4PA 2OEOA 1L4DB 1T3QA 2A68D 1VF5C 1WTXA 4ARIA 2J52A 4RHSA 3O13A 1SSNA 2X6GA 1GB1A 1STGA 2QILA 3T3OA 1H9MA 1TY0A 2JYEA 4JPSA 5KGUA 2BS4B 5C3WA 4JWSC 4A3BB 5HI1A 4EQOA 2PMZB 1KF6B 1CHPD 1ET6A 3WDNA 1EY5A 3CIRB 3DWMA 5EGTA 2L1BA 1IKLA 2C9OA 3EUB2 4ZUIA 2O2LD 2ZW0A 1TWGB 5CV5A 2Z1CA 3I91A 4A3KB 3T16A 1EIHA 4IURA 5IGGA 4TSSA 3E56A 1ENAA 2JP1A 5JVG3 2GI9A 1UWXA 4A9AA 2L32A 2KEDA 2WACA 2X38A 1H9JA 5J39A 1TT2A 3PZ7A 2K5QA 1WXQA 4L2YA 4JK1C 4A55A 1JQ4A 4NZLB 5DAUA 3PUVA 1JWSD 3KBXA 2ENBA 3FILA 2Q8IB 1NUCA 4B0MA 3J81L 2XSCA 2HCCA 1E6EB 2FHTA 4HKZE 1EYDA 1HXYD 4PQXA 4RGNA 5KNBA 4AYBB 1H9RA 4ULLA 4FXDA 3MFGA 1BO0A 2K5DA 1PGBA 2LGIA 5I9OA 4A93B 2NUCA 3L7ZC 3NUCA 2A68C 2W82A 1E10A 1C4AA 2EYMA 3MWYW 3GD7A 5FOBB 2VB2X 2L11A 3NWSA 2KMMA 5A35A 2Y3AA 2D9UA 5C3JB 1RFKA 1IYVA 5C5MA 1QB5D 1EY0A 2RSNA 1SMYD 3A56A 1B9RA 5CBAE 4BBRB 5I2YA 2WP8J 2Z8LA 1R4QB 2ON8A 4ZUJA 1SNOA 3OMCA 5EJWA 2BE5D 2D5DA 5EPLA 1YN4A 5JPNC 4FYDA 4FXCA 4OHJA 2R92B 2INPE 2V0GA 2CW0D 4G7OC 2JU6X 1JB3A 4IFDI 1EEFD 1ZXHA 5FKAC 2MJ8A 4DXGA 1SXTA 4DA2A 3SVMA 1N5XA 1HQRD 2OXPA 1LTSD 1OXXK 2BYTA 3ZJUA 2F3VA 2NVXB 1JOKA 3P1MA 4NAWB 1ENFA 4X3TA 1BOSA 3IT4B 1LT5D 2EXZA 2WXKA 2ZT9C 2BA0A 2A69D 5JXVA 1F9PA 3KWLA 5C2TB 1EY7A 1PFMA 3CRLC 1CT1D 4A3EB 3D4WA 1PTOH 5E4WC 1NI3A 3A8JE 1PUTA 1CQFA 3RUZA 2O5JC 2A74C 3BG3A 3K58A 4A3DB 1HUNA 5M3FB 3ZJVA 1DJRD 1ROEA 5CBEE 5G5GA 1LV9A 2AWOA 3AH7A 2BB5A 1A15A 1SSOA 2BT6A 1DOYA 1A70A 1WCMB 4NP5A 1IHZA 4BY1B 3Q8FA 2SOBA 3CKIB 5C0XG 3A8KE 4KHZA 4G7HC 3CHBD 1XLNA 2EY5A 2WXMA 3L3OC 1QILA 2DYOA 4WURA 3LXFA 1HZ6A 3ND9A 3DXJC 4C3IB 3NPPA 1U4RA 1LLRD 4RHRA 2LFIA 1XEEA 1PTOD 1ET9A 3OSOA 3HOXB 2KHSA 1EY6A 2AUJD 2G9HD 2RVLA 3QO2A 3MXUA 5C0XH 3I3CA 2EY1A 5EKLA 2IPKD 2WS3B 3IFTA 3EVQA 1EZ6A 3NVZA 3J7AV 3ZJTA 3RZDB 2I2YA 5C4HA 5J1ZA 4HROA 1GUGA 3MXGA 2WXHA 1OXSC 2A69C 2MH7A 4H44C 4ZQ3A 4FXGC 2IT1A 2PVOD 5ELFA 2WP9B 1OO9B 3CRKC 2EPBA 5MPOA 5JEAG 3MVVA 2W55A 3ABVB 1QF6A 4RGTA 4XWWA 4XYOA 3QG1A 4DNRB 3OOCA 5C5LA 4G57A 4WORA 1QT9A 1WTOA 5ISRA 5M9OA 1FMAD 3X3MA 2L5TA 3T53B 3WOFA 1FO4A 4MN3A 1TWCB 2YU9B 2H4OA 4A3JB