2G9HD

Crystal structure of staphylococcal enterotoxin i (sei) in complex with a human mhc class ii molecule
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
213
Chain Sequence
IGVGNLRNFYTKHDYIDLKGLIDKNLPSANQLEFSTGINDLISESNNWDEISKFKGKKLDIFGIDYNGPCKSKYMYGGATLSGQYLNSARKIPINLWVNGKHKTISTDKISTNKKLVTAQEIDVKLRRYLQEEYNIYGHNSTGKGKEYGYKSKFYSGFNKGKVLFHLNDEKSFSYDLFYTGDGVPVSFLKIYEDNKIIESEKFHLDVEISYVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal structure of staphylococcal enterotoxin I (SEI) in complex with a human major histocompatibility complex class II molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 67
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2g9hD02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2g9hD01
1KTKA 2QILA 3BZDB 3BVMA 1D6EC 1PRTF 1CHPD 1RF2D 2NTTA 4RH6A 5ELDA 1HTLD 5FKAC 1BCPC 1CQVA 3DWPA 1S5CD 1PTOD 1M4VA 1S5FD 2IJ0A 1B44D 4BWGB 1HXYD 1TY0A 3URYA 1BCPF 1BCPD 1D5MC 1HA5A 1TS4A 1PZID 2R61A 4O1NA 3OWEB 1PRTB 5TSSA 1AW7A 4RGTA 1S5BD 3DWAA 1MD2D 5ELFA 1KLUD 1ET6A 1YN4A 1JQYD 2QEJC 5D3IB 1LT3D 1CT1D 1B1ZA 1DYQA 3GP7A 1LTBD 2O2LD 2XN9C 1JWUD 1V1PA 1PRTD 4TSSA 1ESFA 1UUPA 5D3DA 2G9HD 1S5ED 4Z9CB 1JWSD 1LTRD 1ET9A 1FNVA 1GOZA 1I4HA 1QILA 2XNAC 4ZYSA 1L0XB 1LT5D 3TSSA 3BYYB 3O13A 1ENFA 1EU3A 5ELBA 1EFID 1SEBD 2CHBD 1BXTA 5ELEA 1F77A 1KLGD 1PZJD 1FD7D 1PTOH 1SBBB 3W2DA 1I4GA 1SXTA 1TY2A 1V1OA 1LT6D 4RGNA 5I4DA 1AN8A 1RCVD 1SE2A 3KLSX 1I4XA 2TSSA 4K6LA 1LTGD 1JR0D 3MC0B 1LTAD 4NZLB 1V1PB 4UDUC 2XRQD 1EEID 4DXFA 3DWQA 1I4PA 1EEFD 1LTTD 1EU4A 1L0YB 1XTCD 5FK9C 3MFGA 1JCKB 3BVZA 1T5XD 1EWCA 1LO5D 4RGOS 4L6TB 1G8ZD 4DXGA 3EA6A 1FGBD 1CHQD 2ICIA 2AQ2B 1D5XC 3EFXD 1JWMD 1I4RA 3R2IA 1FNWA 3R2TA 1DJRD 1PTOC 2WV6D 4RFBA 1S5DD 3R8BA 1YN5A 3V05A 2XRSD 4L63B 1LTID 2IPKD 1LLRD 2RDHA 1SE3A 1PTOF 5ELCA 3BVGA 1PZKD 1UNSA 1PYWD 1TS5A 3SEBA 1TS3A 3CHBD 4OHJA 1SE4A 3BYTB 4C56C 1YN3A 4RHSA 1D5ZC 1I4QA 1XXGA 1LT4D 1STEA 2RDGA 2Z8LA 4RCOA 2NTSA 1CK1A 1RDPD 1PTOB 1SJED 4RHRA 1SJHD 1LTSD 1PRTC 1HQRD 2J4XA 2AQ3B 1FNUA 2SEBD 4RGMA 1BCPB 1RD9D 2AQ1B 1TS2A
chains in the Genus database with same CATH superfamily
2INCC 5CV7A 4B08A 3AMZA 1NYQA 4K5WA 1FXAA 1TYGB 5FKAC 4KKSA 1KH0A 1VZ6A 1O7LA 4FJVB 3V6CB 3FP9A 3TBIB 1E9MA 4GGQA 4P1CC 2K03A 2M17A 3SVMA 2KQSA 2FBWB 3H09A 2KO3A 5IT9L 3ENEA 1OO9B 1SYEA 5IGGA 4KSLC 2L76A 1Q5WB 4FHJA 4AYBE 4IN3A 2IBIB 4XE0A 2BA1A 3UE1A 3CCUA 3QJZA 2EYLA 3DDCB 5IAAC 3S2HH 2FCNA 4WH4A 3VR5A 4ME3A 4DAYB 4KI0A 3ZTDA 3B0AA 2K01A 1XPRA 1QLBB 3BDOA 4H02A 1YMHE 2DYMA 3I7FA 4R4TA 3T51B 1FO4A 4WRDA 3VR3A 3K0YA 3TQYA 3GTQB 2UXCQ 5E6PA 2VUMG 3DEOA 4LUZA 4BY7H 5C4XG 1WD1A 2K8CA 1PH4A 1K73C 2SNMA 4ZUIA 3HOWB 4H7BA 2C5CA 2IDYA 4TKNA 3TN2A 4DR7L 3APDA 1FRRA 3IT4B 4X3SA 3F2CA 3ULLA 5BN3A 3MJ5A 3U50C 4IFDG 2NMQA 1GUNA 3AULA 3IBEA 5IA7A 3RUZA 4OO1H 3B08A 3WDNA 5DCNA 3U4ZA 3R7QA 1E6EB 4FO2A 2CWAA 3HOXB 4GZYC 3NG0A 1I4GA 3TJPA 2EY6A 4OGQC 1L4ZB 2K5QA 3RZDB 3W5UB 1BUVT 4KIKA 3KWLA 3OMCA 5J18A 4N9TA 2N1VA 3HIZA 5H1SE 3HG9A 2MO0A 3H8HA 3QA8A 3FPUB 1CZGA 2F52A 3OTOQ 1KD1C 1OEYJ 2HE7A 4M0WB 1X6OA 1P8LA 1SNDA 4BA2I 2V9HA 2A5HA 2VXWA 3CF6E 4U673 2JYTA 3TZUA 5D7GA 1KAWA 4WWNA 4L5RC 2VQFQ 5JJKA 3X3NA 2V1YA 2WACA 2EJFC 1FNWA 4DR1Q 3NJTA 1S72A 1Z2MA 4DV3Q 1PTOC 1YD8U 5BR8Q 4TKOB 1WZ3A 1X3FA 3WCQA 1H9KA 1YNXA 2KCCA 3P20A 1LTID 3V05A 1STHA 4A3FB 1NMGA 2JWUA 2KUMA 3Q23A 3QOJA 3GTQH 2DZMA 4TQ1A 2UXDQ 1L6VA 1WFYA 3H7PB 3SEBA 2VB2X 3RCZA 5BYQA 1EY8A 2Z4IA 3OJ4B 4II3B 1I4QA 1O7YA 3B6YA 1AYFA 3DVGX 3H6MA 2MEKA 3TEXA 1JB3A 2JEBI 1EF1A 3G6EA 3PO0A 4HIOA 3PO2H 4URKA 2R2QA 1H9MA 3EJIA 3WOEA 4HXDA 3VUYA 1OXTA 1D7QA 1V8CA 3SXHA 1S3OA 1D6EC 4BBRB 2H1EA 2MP2B 5D65A 2I5MX 5IP9G 4PMCA 2IJ0A 4BWGB 2NYZD 2JUOA 1BVSA 4JC0A 1TKEA 1GJZA 4NQKE 2LASA 3J7ZC 3NWTA 1IYFA 2CQOA 4OELB 4XWWA 2F4VL 2N49A 4O1NA 2UUCQ 2R61A 5KNDA 1IL2A 1PGBA 4QIWE 2B3GA 3OHXC 1RYJA 2AL6A 1PRTB 1QNUA 4UHVA 4CJ2C 1U4AA 4EQNA 5EE3A 3TBLD 1AWDA 3H3VI 1B3QA 2ON8A 1IBMQ 4TUUA 1NBWA 3K0XA 3S9WA 1OXVA 1E8XA 4ILWA 5EAYA 1WR1A 1XLNA 4PZ8A 3VUXA 4KKTA 1IXRA 3AU5A 4YSZB 1JOKA 3ZJUA 1FGUA 1V8QA 2BDNA 5KNCA 4MDKE 1Q0WB 1BT0A 4HIKA 2MCNB 2K5WA 1SNCA 3J80E 3PHWB 1A62A 2MX2A 2KTFA 2HTME 3VTWA 1HJPA 1A0IA 3ZTCA 2SNSA 3JW0X 3A5UA 4CQNA 4A3MB 3HKZB 3IAYA 1FMAD 3M95A 1A3UA 1F9RA 4ZKCB 4DK5A 1PZJD 3UIPB 4M01A 4MACA 4BBNF 2HQEA 3QIAA 1HNZL 3R7RA 3MFYA 3I55A 3NZSA 1F2ZA 4NMZA 2BH2A 3NPPA 1WRDB 2K6DB 3A7LA 4M02A 3P4PB 2TSSA 3GD7A 4M00A 4MGZE 1YNNC 3HOVH 3ABVB 2WP8J 3G7LA 3GTGB 4BBRH 2C7MB 2DX5B 4DK6C 1WH3A 3MP9A 4NXNQ 2QF7A 3VTVA 5EPLA 3DUZA 5C0XI 3DLLA 2WXRA 3N52A 2LI5A 2K7VA 3RPFC 4LFAL 1JE5A 4DV0L 3U4VA 2MJ3A 2PYKA 5JEAH 1CHQD 2D07B 1S1QB 3LB8C 1F1HA 3CP0A 4A4IA 1AEXA 4DNRB 4CJ1B 2D5GA 1E0BA 2PE6B 1TWHH 5A35A 4X62Q 1VQ4A 1HEZE 2LS01 3I4MG 5IT9c 4V190 3DVNU 1SNOA 2IWHA 2JA5B 1PFMA 2L83A 2LUEA 1XYIA 3HEJA 4KMUC 5GAHC 2MRPA 3O65B 3HOYB 1HH2P 3QO2A 1MHHE 4XQJA 4GNXB 2FNJB 4LWCA 2NN6H 1FL0A 4DV5L 4GSWA 1UNSA 3JAMi 4KKJA 4AJWA 3I70A 2N9LA 4C56C 2OQKA 2MH7A 3JAME 3FC4A 2ZXOA 3S24A 2RGFA 1O7ZA 3SK6A 4F7ZA 2R7FA 3NP8A 5CX3A 2FCQA 3MXPA 3KLSA 1KNAA 4XXEA 2EY5A 2JEAI 4BY1G 3EFCA 1WMHA 2KCTA 2Z9HA 1XTDA 5E4XA 4DR7Q 1CSPA 3DWPA 2OF1A 4HCEA 2L8JA 1IUEA 4S17A 1QUQA 3P75A 5GROA 1WI0A 2ASBA 4XZ4A 3I5JC 3CD6A 2E2JB 1QE6A 1BCPD 3NELA 1EWIA 1YHQA 3S15B 5J22A 4RMAA 4A3IH 1B9RA 1CKOA 5TSSA 1GAQB 1STYA 1U0LA 3GTLB 3RZOB 1Z7TA 4G0NB 4IC7B 2ZCCA 4AIMA 3MA2B 1KQSA 2JYOA 1IW7C 1H4RA 2OCEA 2PI2E 2Q8TA 2IY0B 2I07B 2BYEA 2RR9A 4LF4L 2KEEA 4BA1I 4FVMA 4DUZL 5L83A 1OFFA 1IYVA 3K80C 1XT9B 1GUTA 3PHXB 3M4YA 2PPBC 3KW5B 3HKSA 4JBKA 3M4OB 3QWZB 1GVPA 2E75C 1XNQL 2QDLA 5IOCA 4YY3Q 3VYUA 5C3EB 3AEGB 3HS0C 3S1NH 4X57B 2BCOA 1AARA 1XCQL 5LHY1 4X6AH 2R93G 1QB5D 4ICUA 1U5KA 4MSQB 4DU9A 5AFWA 3CQZB 2FMMA 3MC9A 4LNIA 4A3KB 3CMEA 1KDBA 3T13A 5COYA 3IVFA 1A63A 5CTRC 1C77A 1RHPA 5G3LD 2J53A 1MG8A 4AYBG 1N34L 2I1JA 4C7ZA 1N61A 3NOBA 1F52A 3CRKC 4QIWB 1ZDVA 1E0ZA 4K6LA 5T1IA 5EPKA 3W1SC 4KLKA 2JK8A 5C4ZA 4HJ8A 1PGAA 4DXFA 1NAPA 2WFWA 1JB7A 4EKUA 4LAAA 4CHKA 1O80A 3M85A 3CCEA 2RSUA 4KN7C 2E2JH 4L5SA 2L05A 2ZW1A 5HURA 3EROA 1D5XC 1JWMD 3RZFA 1I4RA 2J0MA 4GOCA 1VQ6A 3TDQA 1DOKA 2L5TA 1KRTA 3TP6A 4A3DG 3DM1A 1EQTA 2LXKA 5C0XG 2MA9B 3HOYG 4NPNA 4AOFA 5CORA 5IN7A 1ACCA 4W9CA 4LNNA 4LJOB 4LW1A 4CDDC 3V3XA 2R92H 2F4VQ 2K32A 2QCZA 3NEMA 1T0YA 4MGYE 3IL8A 5DNFA 2RCNA 4EVOA 2E6XA 3MHSD 4WWMA 3EHVA 1CUKA 3KYCD 1N33L 2JN4A 1XXGA 2IX1A 2J7QB 4KGSA 4C1NK 5IYDH 4HKZE 2E2DC 5D2MB 4IUTA 1L0WA 5M5WH 4HCNB 5JJZA 4XX5A 4A3KH 3BS1A 1HQRD 3NZ3A 4ME5A 2W3RA 1U9RA 5EBDA 5EKKA 2R7ZB 2DZJA 2WXMA 3UI3A 4HIDA 4NAMA 3DWMA 4XC2A 1WCMB 3L16A 2HJ8A 1SYBA 3W3AA 4TRDA 4DA2A 1UGJA 4C3JB 2WX1A 2OWOA 4A3CG 5HGTA 1KHIA 4DBGA 2VRRB 3N20C 5KHOA 1HXYD 5L37A 2WXIA 4OZAA 3L9AX 1NBFC 4US9A 4OWWB 4MIUA 5IGCA 1HNZQ 4HROA 5C0XJ 3KF6A 1GM5A 4PS8A 2ZJQA 3VDZA 3KF8A 3D4RA 1CA5A 2F0EA 5FJ8H 1WE7A 4QCLA 2LEKA 2PVOD 4GDLB 1KLUD 2BF8B 4PV1C 4HJGE 1E3PA 2ZJPA 1UE1A 3PV0A 1OEYA 2O2VA 4IQZA 2Z1CA 2WDQB 1C79A 5D3IB 3HZXA 4JI6L 3GE8C 1T0RC 1CT1D 2SOBA 1TXYA 4ZCKA 5M5XB 1YIWA 2DYBA 3B1LX 4PS3A 1V1PA 1WMHB 2Q2TA 5C3EG 4CYEA 4MNOA 4DV0Q 5C5LA 5D3DA 4DAVA 1C78A 2EE1A 2OEOA 2FE8A 2KD0A 4II2B 1SNMA 3T1YQ 1ZW7A 2FIDA 3OLMD 1TWFB 2F0UA 5I6YA 2OTJA 3WALA 3O13A 4Y7NB 4GU2A 3DBHI 4WJQA 1N5WA 4K7UA 4IUQA 1YX5B 5ELBA 5IGEA 1V5OA 2KACA 3LNNA 2CHBD 1Y1VH 5I6WA 2PCFB 1VDVA 2GMIC 1Y8NB 2L32A 1OTCA 2JXTA 2ONQA 3VYRA 1PH6A 5C4HA 2WKCA 1E2WA 4DV5Q 1IGCA 1M8AA 1LTLA 2LGSA 1Q3LA 2IL8A 1Y1WH 2BTEA 1XMQL 3ZDMC 1WCMH 2KAJA 2R2OA 1VCIA 2MP1A 5IODA 1Q7YC 3DBHB 1K83B 4IUVA 3ZDTA 1N32L 2BVCA 5BYRA 3MVVA 1TWGH 1DCZA 3DWQA 1J7CA 1WTQA 2MQHA 4P71A 4HSVA 2KKCA 3BDLA 3MFGA 2K8HA 3T8MA 2G5DA 3CCVA 1XNRL 4LF9L 3PIO3 4JYAL 2QIEB 2ZXRA 1VR9A 3FKIB 2PZTA 2MWSB 2BS4B 4HPLB 1ASZA 2ICIA 4KKIA 3SFEB 2QJLA 3ZNGC 1N8RC 3TZDA 3HOUH 1Q12A 3MHBA 2B2TC 2PW7A 2BPSA 3W5OA 1MKHA 1X56A 1VQOA 3CSFA 1UELA 1D1KA 1IZ6A 3PO3G 1PDXA 2BA0A 2Z6BA 2IPKD 3BIID 5M5XH 4H13C 2A68C 5CBEE 4WQOB 3APFA 3I73A 1NI3A 4WJWA 5M9OA 2O6VD 3DPDA 3D6CA 2H88B 3I4NB 1E2VA 2E2HB 2KNBA 2IHFA 3Q24A 2XK5A 3AV8A 4GNXC 4HR7B 3PGEA 1KDAA 4IJLA 4XIGS 5IYCH 1EZ8A 1LM0A 2NWGA 3CF5A 4NDXA 4C3IG 3VVWB 5M3MH 4FADA 4CJ0B 1Q86C 4LF4Q 4RHRA 1PTOB 2R7ZG 4DUZQ 4DR5L 3VR2A 4AWJA 3K58A 1T6BX 1X65A 2KX3A 3EVQA 1EUVB 1EY9A 3PRMB 3E5SA 1WR6E 4MM3B 4B3RL 4YWLA 3DHQA 4HJKA 3VFKA 4B9KA 1V9JA 1MPEA 3C1EA 2W9NA 4U68A 1C1YB 1M4VA 3L3OC 4NJ7A 3NRZA 4BBSH 3GTKB 3ULPA 4GN5A 1PYBA 4EQ5A 4GDKB 4JOIC 1N34Q 1I50H 3WOFA 4KHVA 4KHZA 4RGTA 1A70A 4LFBL 3UINB 3DWAA 2X8XX 1I42A 1AP0A 2R3ZA 4DAYA 2I46A 4FXGC 3NVVA 1MSHA 4RM8A 1E7VA 1Z47A 2FUHB 3BDCA 4HSPA 2M1MA 2CWPA 2ZJDA 2WQYB 1CA6A 2IY1B 3I90A 3NENA 2VQFL 4HEDA 1B1ZA 2IW3A 2PPHA 2AUKA 1WE6A 4I7AA 1CKMA 5FO7B 5K36H 3ZUNA 4EZKA 1UUPA 1FXIA 3PSEB 4L8JA 2WHIA 1RFAA 2G9HD 3D8GA 1YIJA 1WWTA 2G4DB 1QILA 1Q81C 4K3CA 4HN7A 3AM9A 4XDXA 3RYTA 2KCNA 5C4JB 5EGTA 3H0GG 1WTRA 1VQ8A 3N1YC 1RRBA 3CWIA 3ZJTA 1NR2A 3S2AA 2HIVA 3KF6B 2BDOA 2IHEA 4B9WA 4AQYL 1ISNA 3HRZC 3M3YH 3PSIA 1PTOH 3PS6A 4YSYB 2IGGA 3RNAC 2O2VB 2IO2B 3KLSX 3DCGA 4WQMA 2WXFA 5C3WA 2E2IH 1N33Q 4IFDI 3Q3MC 4IKGA 4E3CA 2FCSA 4R3DA 4B6WA 4NZLB 2NBWB 1V1PB 3W5VB 4KHPL 2XRQD 2JWZA 3ETRA 2L1BA 1B3AA 1DOLA 4GN3B 4B3SL 2VUMB 2YTYA 3FKIG 4BS9A 5C4XB 2UU9L 5CV4A 1PH2A 4P16A 2REXA 4DFAA 2YLMA 2PZUA 3UGBB 3OWFA 4KV6A 2AQ2B 3PTFC 5FLXE 2OT2A 3T3OA 2KVZA 1G2SA 2XWBB 2BKRB 2UUCL 3A8JE 1YN5A 2KENA 4J3OD 4W9FA 1CKNB 1PFDA 3AEBB 3AE4B 3E6ZX 3UDGA 3U30A 4DV2L 2NVQB 2FAZA 2IO3B 2JA6H 3H9DA 4ANXA 5H92C 1WZ0A 3MC8A 1DM0B 1MFWA 3IXSA 1HZCA 1QVGA 5LL6X 3H7PA 5J2RA 4NJ6A 2QCPX 5EDSA 3H6NA 1Z9FA 1GUAB 3FDTA 2LMCA 1HFNA 1TWCB 1J8IA 3FILA 2NVXH 2N9XA 2CH4A 4A3EG 4HCSA 2LGXA 2RMMA 1LT4D 4BKGA 4R4CA 5E6NA 3I91A 1RL2A 3GTOB 5LXIB 2PQAA 4JI6Q 2FMCA 4YL8A 1YEZA 1X9NA 4E71A 2JA7H 1VRAB 4DXAB 1D4BA 2K5NA 4C1NI 2C9WB 3AE9B 1H9SB 3T56B 2L52A 2CW0C 3ND9A 4BKSD 2AKWB 2JQRB 4W9JA 2MP2A 3WAPA 2DYOA 4DDGD 2NBVB 5C2TB 5CC4A 1XWEA 2M00A 4H0LC 1S5CD 2WKDA 2I5HA 4JI3L 4IWPA 1GB1A 4O0AA 3HOZH 3NTKA 2WXGA 2PE9A 5GAEC 1ENCA 4JK1C 3S1QH 4QL5A 4A3BG 4GMVA 4JI2Q 2RD0A 4HKQA 2XK5B 1WXAA 1EIGA 2VW9A 3CC2A 2PO4A 1XD3B 2A6EC 2K6QA 2DGYA 2INPE 1CSQA 4RWSC 1BNZA 3QR8A 1XMQQ 3NS1A 4HPPA 4OONA 1T9HA 4R9WA 3STBC 3K6OA 5KIXA 4PT5A 1W2BA 1PGXA 3NVYA 2KHIA 1N32Q 2H4OA 5M3FH 1XCTL 4NB3A 4P6VF 4YXDB 3TL5A 4F8CB 2XTIA 4HMIA 3C2PA 4DHZE 4PYZA 1LTBD 4DHJD 3A8KE 2YEPF 4LDTB 1XNRQ 4F87A 4JYAQ 2BE5C 3CXCA 4LF9Q 2CR5A 4NY0A 4KY5A 2GRIA 4X62L 3LJ3A 2F3IA 1SLJA 2JA8G 1VDZA 4UP8A 3LDZE 3A0JA 4JG2A 2KBNA 4BBNC 3RNEC 1R9TH 4LCDE 3AFPA 3P2BA 1SEBD 1BXTA 4QY7A 1WGRA 5ELEA 4OZCA 3PLUA 4KSKC 3T3NA 1VF7A 1SE9A 5EE0A 4CO7A 3NTHA 3GQBA 2PZWA 5M5YB 1YJWA 2KFKB 3CCJA 1RCVD 1SE2A 2GBKA 3A1QA 3EUB2 2PNRC 4CKEA 4HJAA 3Q8BA 5AUKA 4A55A 2Y5BB 1KOTA 1V86A 2WGSA 3AU4A 2UU7A 4CDFC 1NCVA 1DXMA 5C44B 3Q22A 3IG3A 1EEID 4P1BC 2NS5A 2PMVA 4DR5Q 3SU8X 4A3JH 4NKLA 3GTJH 4LNKA 1DOMA 1SYCA 2YV5A 4RF1A 4TVAB 1ICWA 2B2TA 2VY3A 4KGTA 3K59A 4MGKE 4L6TB 4B3RQ 4DXGA 5T8IA 1E7PB 3A54A 1N60A 3L4PA 4HWIB 1W6KA 2YVCA 4M8NA 1VZ8A 1E7ZA 1X1MA 4W9IA 2HHHQ 1WYGA 4EGVA 1BF4A 1BBUA 3S14H 1C8CA 1AZQA 4LMQD 3R8BA 4J6HA 4KD4A 3W1GA 2MHVA 2PQEA 1TIFA 1MIUA 1SE3A 4GNXA 1FD6A 2NBUA 5AUIA 2WAQE 1Q8IA 2NVUI 3Q8FA 2MJEA 4LFBQ 4HK2A 4DNTB 3PT2B 2WINB 5I9PA 1K8OA 4OHJA 2F0QA 3PV1A 2LRUA 2WDTB 1VQJA 2A69D 4LUOA 1WXMA 5IP9H 4WWPA 2K05A 3GOEA 1ILPA 3IAM1 4EEWA 1PH5A 1TR5A 1FEHA 1CK1A 4XYQA 5CHWA 4E74A 4IDIA 1LABA 1N36L 2MBQA 2I5LX 4YY3L 5DAUA 1EY5A 2F0HA 5IT9E 2J4XA 3Q6SA 1FNUA 3S17B 2EYHA 2LWPA 3ULJA 3WAMA 5D94A 2B63B 2LXCA 1SMYD 1IBKL 2WNMA 2WU5B 3V62A 3I2ZA 2ZTCA 1P9DU 2MSED 4RH6A 4DV1L 2WXPA 3EGRA 3ZXRA 3I4MB 4JOIA 4IFDJ 4R8NA 1WRIA 4FJYA 4FULA 3RULA 4N9PA 1VQBA 2VZAA 3QB3A 2KWUB 2XIWA 4AQYQ 3URYA 1QQRA 2LSSA 4XQNA 2LMCB 1TT5B 1D5MC 1D2BA 4DNIA 4C00A 3NE5B 3HOWH 3FILB 5LMUL 2DZKA 3KLRA 3SK8A 2PQAB 2WP9B 4BY7G 4FBJB 3N9YC 4JI0Q 4IM3A 3KH0A 3QC8B 3J80L 4R1JA 2L4NA 3C46A 4KHPQ 1C9FA 3HOXH 1FCLA 2PKOA 1Q10A 2IO1B 1RWSA 4B3SQ 1T0SC 2EYMA 1K8RB 3RZDH 1ESFA 2UU9Q 4ANUA 4DV7L 1B50A 4BY1B 1LXDA 2JVCA 4YWGG 4DUYQ 4XTCS 4OO1G 3C3LA 1PVOA 4QAYA 3S16B 2XNAC 3OW7A 2OEDA 3J81E 2K75A 3KDFB 4OWXB 2Y0SE 2CHWA 4DAMA 3Q0AA 3MHZA 1EFID 4GOPC 4EOYA 2ENBA 2OTLA 4C4VB 1PXUA 4X66L 5FLMH 2WB1E 1E90A 1KLGD 3I3TB 2X69A 4DV2Q 2DWQA 1P7EA 4NPSA 1FD7D 5KEEA 3APCA 3W1BA 2BB6A 2X38A 2CVRA 4TMAB 2N7DA 3F2BA 1WGHA 1GO3E 1UEAB 1ZXTA 1EWHA 2B8FA 2EJMA 3VR6A 5C44G 2PW9A 2EYFA 2ZVOA 4HRSA 1OXXK 1Q1OA 1LTGD 3J7YW 4DGZA 3OOCA 3J80i 1V49A 1UAPA 1HE8A 2B2WC 4A3FH 5C23A 4UPAA 3K5NA 3EECA 3I4MH 1LQBA 3ZRCA 1YI2A 3A4RA 3TEZA 2EY2A 3PMFA 1EU4A 5IOIA 4ZDVA 3MEHA 4HMJA 3CPWA 3M9BA 2FFKB 1Y8OB 3BVZA 1SGHA 5EKLA 4DHZB 4A3GB 2F0MA 4JPSA 3L08A 2KLGA 1Q46A 2R93B 2JZPA 3VDYA 4LNFA 2KDFB 1YNJD 4C2MB 3K81C 3F2DA 2CJNA 4JWUC 2RSNA 4JI3Q 2JF5A 2D5DA 4XGAB 1KAAA 3JAML 2K04A 3PZ8A 4ARIA 3AEAB 1JJGA 1J8CA 2JXXA 4AYBB 1LLRD 3A1QB 3ONAB 3M7NA 4JLCA 1L1OC 2A19A 2JSOA 4LFCL 4CHTB 1KC8C 4OW0A 1PYWD 3VYTA 3PIPA 1SNQA 3RI7C 3K8AA 3PO2G 3BYTB 1EYCA 2C60A 5EE1A 1D5ZC 4WWOA 2LY7A 3Q3NC 1YQ3B 1FCCC 2KC1A 4A76A 2V3PA 2GBRA 4W9HA 2D11A 1H95A 3T1YL 2V3NA 4ASWC 1G51A 2B63G 3GTPB 3PUWA 5JPMC 1T3QA 4X3UA 1BR9A 3A74A 2KHJA 1OQYA 2K50A 4IZ8A 4CKCA 1VQIA 1JT8A 1GB4A 1H9JA 5JHAA 4ZOHC 4A3DB 1VQFA 3RUIB 2GBJA 1U4RA 2FIFA 4M1UB 3CRLC 4WJPA 3PRPB 2L0FA 1WTVA 1WJ4A 2L0TA 3MEFA 3CSTA 1WTPA 4QMGA 5CV6A 2K8BA 4K3BA 3NUCA 3GO5A 4JWSC 3VXWA 1VZ7A 3MTSA 3I4LA 3H3VH 1I7HA 2J0TD 2BB5A 2QDFA 3R3OA 2UWQA 2DZIA 2WXHA 2YEPB 1ZYRD 3RZWC 2B3AA 4G7OC 2BWFA 1MD2D 5ELFA 2GVBA 2WAQB 2EKEC 1ONLA 1P0RA 1WTHA 4GDLA 1X32A 2MFIA 4HDQA 3GTMB 2Z0SA 1TU2B 4A3MH 2IT1A 1PUTA 5CR3A 1KDCA 3W9CB 4YCUA 1XPUA 3LXFA 2GBMA 4R8IA 1WM2A 2VZKB 2QSDA 3DQVA 2J7ZA 2W55A 4ICVA 3SD5A 2O2LD 1PRTD 3K57A 2L11A 2HJ1A 1NUCA 4E6IA 4EQPA 4BAXA 1KFYB 5IGFA 1GC6A 3GTGH 3TSSA 1LT5D 3K7AB 3KBGA 4ALPA 1NR4A 1YVCA 1M94A 2KX0A 3ITPA 3P4RB 3TUOA 1TZ1A 1VF5C 1NENB 2LUMA 4FP5D 1HTOA 3W1YA 4FXKC 2I38A 1JROA 3HOVG 3D4WA 4GKJQ 3OG5A 3CU7A 1STGA 4IOIE 1V1OA 1LT6D 4NNJB 1R4QB 4DF7A 2WX0A 1G291 1ZUD2 4ZAIA 4A3LG 2F0PA 4HEA1 1GKHA 4JI4L 3IRBA 1LTAD 5JEAG 1QVCA 2EQSA 2JA5H 4A3DH 5HY6A 5K5PA 4ANWA 4N58A 5C0XH 5I2XA 2PI2A 4JW0A 3HOYH 2DJFC 1BOSA 5EQ0A 2E8GA 2FJ2A 1N36Q 5AZGA 4A3GG 1UGMA 1YITA 3ND8A 1RIPA 3CCLA 4JBMA 1SSNA 3S2DB 2YU9B 2Z4HA 5KHQA 3DMUA 3U8ZA 1LO5D 1NYRA 1VQDA 4C80A 1EQRA 1G8ZD 1R4PB 2MPMA 2RF4A 1IBKQ 2Q2UA 1GUGA 4DR4L 3D32A 3M63B 3QQ8B 4Q2JA 5HHDG 5JAVA 4DV1Q 2NN6G 2K0PA 2ALYB 1OTRB 1K50A 3Q8DA 1L4DB 3Q8EA 4S3SA 2K25A 2RHSB 4L63B 1XJVA 4K8IA 1K53A 1MJDA 2KVMA 4ARCA 2ZJRA 2Z0DB 2RDFA 1TKWB 2IYDB 4DV4L 3AE2B 1TS3A 4G57A 5LMUQ 1VQ7A 2VH2A 3CAMA 4K7WA 1I3QB 2L9HA 3L0OA 3J80c 4X3TA 3PUXA 4DV6Q 1K28A 4HAEA 2F0JA 4A3CH 4EX5A 1VCBA 3HVDA 1JQ4A 3NBHB 1VS0A 1DONA 5G2NA 3S15H 2A8VA 2KDBA 1F9QA 1LTSD 1YOVB 3U2SC 4IG7B 5E1FA 1C4CA 3GTLH 3RZOH 3GDEA 4DV7Q 2WXLA 4MM3A 3L7ZC 3VR9B 1TT2A 3SE0A 2A6HD 1SB3C 3N30A 1K8AC 4ZUJA 2E5LQ 3P63A 4Q5VA 2NVYB 2K28A 2KT7A 1RF2D 2RHQB 1I94L 1VLBA 2LJ5A 4KVGB 5JH5C 2OXPA 2K5HA 2ATWA 3PO3B 1RTOA 3CMAA 3S1RB 4BOZB 3B2FA 4X66Q 2F0LA 3G6JB 3L10B 5KYLA 3M4OH 2ICEC 3KOJA 4A93B 5KNBA 1TS4A 1PQSA 1ZP0B 4GDKA 3ZIMA 3M7GA 5C3EH 2WAQG 4QJFA 4DQOC 3OWEB 3MZ5A 5DLQE 1HA6A 3FKYA 3S2DH 1ZE3D 2KYWA 2F3VA 4QF4A 4TV3A 4ZRPA 3CQZH 5LLIA 2NVTB 1LUZA 2CU3A 1FVIA 4C3IB 1KNEA 2BS3B 3QHTA 2PMZE 4NAWA 4K14A 4MT5A 2QEJC 2DY7A 1CQFA 1LT3D 4DK0A 1E8YA 1JALA 3ONSA 3PF5A 1NE3A 1UWVA 4B9XA 4P2CB 4FLHA 5A2QE 2EOTA 1MG4A 1QT9A 3RNFC 3K7UC 2OQ0A 4Z9CB 4GOPA 1C0AA 2Y5CA 2IX3A 1EY0A 4ZYSA 4IALA 1V2YA 4OVUA 3BYYB 2L00B 5JJLA 1ENFA 3NVZA 2PNHA 3OSOA 3JAMc 4EE2A 1DOXA 4ZRZA 1QOAA 1MVKA 3SK5A 2G9DA 2RBMA 3GZNI 3CW2C 3RNUA 1IBLL 2LHDA 3R66C 3WANA 2EIFA 2N78A 3I56A 1EF5A 1SBBB 2O4XA 1UBQA 4UP9A 3S1MB 5I2YA 1WXSA 4LFCQ 3DHIC 3F8TA 3SGIA 5BN5A 5KYIA 2B2WA 1HPCA 3KYHC 2KC2A 3BZKA 1BBXC 2KWCA 4ACFA 4LF8Q 1UE6A 3SDLC 2KQ4X 2F1MA 4ZRIA 3VUWA 3SR6A 1JR0D 2NVYH 1RTNA 1ZKOA 2JT4B 3AEFB 3RLNA 4UDUC 2MHJA 1X3PA 1DD2A 4GLSC 5IGDA 1EOVA 3TP7A 1BQQT 1GC7A 4MZ9A 3GZNB 4XT3B 2F0DA 1LTTD 3RN2A 2Z6KC 2Q5WD 5E6OA 2LXJA 1QOGA 1BBWA 1V5TA 3SHLA 2QW7A 4ANVA 3CC4A 1CI3M 2F0NA 1S3SG 2XEWA 1MI2A 5D14A 3K5OA 2R92G 3SK4A 3H0GB 5JPNC 1ILQA 1AE3A 2CHXA 4XDCA 2NPTB 4PG3A 4JI2L 2Y0SG 3J7AF 2WV6D 2EELA 4RCNA 1CKNA 1L1OA 5AZHA 1UZXB 1FFUA 1SFOB 4C3IH 4LLGM 2KZRA 5LNK1 4HJ7A 4I65A 2P5ZX 2WB1G 2R7ZH 1TZOA 5FR3A 3SFDB 1NNXA 4K7SA 3VRBB 3ERQA 5IYDG 1UD7A 3C0RB 2HDLA 4AH6A 1FYCA 2GA4B 2UYZB 2WXOA 3PUYA 2KOXA 4KDIC 4C3JH 3A7AB 3AU7A 4L5TA 1L5PA 3ZJVA 2JJQA 1R4NI 3LWEA 1HZBA 4EZJA 1CZPA 4OIJA 4RHSA 1J19A 2Q8RE 3IAS1 1STEA 2MBEA 3L2PA 3LWUA 5T1GA 1MJCA 5CBAE 3NTIA 2EZVA 2OJRA 4IJHA 5KGUA 3BZCA 3FMCA 1SF0A 1B7YB 5GADC 3AE3B 1RJTA 1H9SA 3V6EB 2HCCA 2C7NB 1SYGA 2B29A 2BT6A 2CU1A 3Q3JA 4WAAA 4BXXG 2EYPA 4MHEA 3BVMA 2DNEA 1CHPD 1R4NB 2D2CC 3SHQA 1K9MC 1QZGA 4GKKL 4DN4M 1J7BA 2CW0D 5FJ8G 3ZO5B 4AP4C 2MO1A 4A93G 2EYOA 2G3QB 3K5LA 1WX7A 5JZEB 2CJOA 1F9SA 3LX0A 1HR0Q 1JW9D 4FF2A 5LMNQ 1TWAB 2BOSA 1JICA 1B9NA 1TWFH 2RVLA 3ML9A 4NP5A 4LK0M 1WOCA 1U4LA 2ZXPA 3Q8CA 1ZEQX 2RQXA 5E4WC 4JI1L 4Y7NH 4A3EB 4IURA 2A5UA 4WFN3 1QZHA 2BQQA 4JI4Q 4PYUA 1HUMA 1YQ4B 2A73B 3OPOA 4G4KA 2F0KA 1OQQA 1K8MA 2LKVA 1PFNA 2KA7A 2NBFA 4DR3L 2IGHA 1ESRA 3NHEB 1JWUD 2CH4W 1D3ZA 5IWAL 1F9PA 3ERSX 1JJCB 2HHHL 1EY4A 1Y1VG 2L3ZA 1KIXA 2KQ7A 3AE5B 4DR4Q 1I4HA 1L2FA 5KRUA 4FXCA 1K83H 1L0XB 1VQLA 2CKHB 2K5DA 3QOLA 5IIFA 1EUJA 4FN2A 3R3MA 5ELOA 4KN4C 5F2DA 1HNXQ 2J0JA 3DEPA 2HIXA 1Y1WG 1NMFA 1SRUA 1STBA 1JMCA 4A3BB 4O2DA 4HJ5A 4MH8A 3FKIH 5HFYA 3I3CA 4R4OA 4I7ZC 4HIMA 2N7EA 4N9F4 1TY2A 2KFKA 4C3HB 4DV4Q 2N7JA 4NAWB 2WU2B 3QCAA 5DPWA 1NY4A 3NS8A 3F2UA 5AEKB 1I6HB 3MC0B 2M56B 5FLXL 3CCQA 2YTXA 3HOUG 2PMZB 1V1QA 4GOPB 1YQBA 1SR3A 2K33A 1GG3A 1L0YB 2H89B 2OOBB 1PH8A 3TMEA 3I4NH 1E5WA 2GLSA 4WORA 2E2HH 2JA8B 2CQAA 1TWAH 1FGBD 3EA6A 4ODGA 1UF0A 4YWKA 1I94Q 1V81A 5BYSA 1XMOL 4MELA 5JXVA 2DNCA 1D8LA 5IYBH 4ZHPA 3AQQA 2CCZA 3FHWA 1LACA 4YCVA 3TP8A 1GUSA 2RPVA 1YHAA 3AB5A 4YT0B 4IPDA 3DHHC 5M3MG 5ELCA 4JI0L 2BGFA 4FF3A 1ENAA 5IP7G 3X23A 1FPYA 1VQKA 1CTMA 1SE4A 2DENB 3CMMB 4RG1A 2K4KA 2PTLA 4P74A 3Q69A 5JVG3 1TKGA 2ZTEA 5EPJA 4IWOA 3GTKH 4K8JA 4RCOA 4DUYL 4PMBA 1RDPD 1STAA 3ER0A 3MTNB 1Y8PB 4BKTA 4A3BH 2K5VA 3TS0A 1CFMA 4ITKA 4GLVB 4YHHL 1C4PA 4BBSG 4MTNA 2JSVX 1GJXA 1TS2A 1KTKA 1JMLA 1MHXA 5H8YE 3KBXA 1L1OB 1HCZA 1Q90A 2B2UC 1PRTF 2QILA 2D3AA 2LHEA 2Y3AA 5ELDA 5CYUA 3TMPB 3J9CA 2IO0B 1PTOD 3Q6BA 1JC7A 4IWQA 1TY0A 1IBLQ 3RFZB 2N8NA 1WTWA 3DBRI 5JVH3 3Q3OC 2JZ3B 3LYYA 3U7DA 3HHMA 1BCPF 2ZT9C 3PUVA 1P3QU 4W9LA 2DNFA 3NK9A 3NHHA 1S5BD 4G7ZC 5C4JH 3ZVVA 2KXJA 2F0TA 5K36G 4JGHB 2V4IB 1D1IA 2B2VC 4H44C 3A55A 5J39A 4KV2A 1RAXA 2LGYA 3WIMA 4PNYA 1E1OA 1J5EL 3OYYA 4JI5L 2BYFA 3A9KB 1G2TA 4IM2A 4TSSA 2VQEQ 4JL9A 3AN1A 4ZRKA 1V97A 4RAUC 1C76A 1ML0D 2WIIB 2KJRA 2FXQA 4ZRQA 1JWSD 1N5XA 1LFDA 1WTXA 1FNVA 1J7AA 2ZPNA 1IPGA 4EZLA 3EIVA 3KDFA 1Q1BA 1PH9A 1T0QC 3S2HB 3BWUD 1X3QA 4C4VA 2VUMH 3T16A 4PMWA 2JZZA 5C4XH 4HVBA 3C19A 1DGSA 4C3HG 1QVFA 5CMDA 3RNGC 5G3LF 3W2DA 4OO1I 3L17A 1XLPA 1YZ6A 5BMGA 2EYJA 2ID0A 1V80A 2CFMA 5IE8A 2MLBA 4G7HC 4CGYB 4IFDH 4BY7B 1O7IA 5HGQA 3AE6B 4L1BA 3VYSA 2K14A 4RMFA 2Z6KA 1AE2A 1BKBA 4XT1B 2ES2A 1EO6A 2N9PC 4A90A 4B0MA 4C7YA 4P7IA 1SYDA 3P1MA 2D0PA 1X3GA 2NVQH 1S40A 2JYEA 1I35A 2N88A 1AZPA 4P73A 2N3SA 1A2UA 4YTPB 3GS2A 5EE9A 3NVWA 3IFDA 4G11A 4NW2A 2JY6A 5ELNA 1TWCH 2VS1A 4YIJA 3V96A 3IT6B 2KWDA 5G5GA 2JA6G 1SIJA 1YJIA 3GTOH 2QGQA 4FF4A 4GKKQ 2PW5A 2Z0EB 4N8X1 2XGTA 3SR1A 1E1TA 1EYDA 4K0KL 1WGGA 3TCAA 3CPFA 3P7JA 3OIPA 3HKZE 4IUUA 2EXDA 4RF0A 4ZHOA 2Q2HA 2W82A 1XQQA 3CKIB 1QF6A 4X3KA 2HTHA 1NVID 3BVGA 2INNE 1PH1A 1YHBA 4BOSC 3VR8B 1F0ZA 4XDDA 4JI1Q 4DR2Q 1F2RC 1NDDA 2JA7G 2Q8IB 3HVZA 2E3TA 3M4QA 3ZQ4A 2LJIA 1YNND 2G4SA 1E8ZA 2F0WA 1SAPA 1VQ9A 2YTVA 4BFRA 3FEWX 1K3BC 5IGBA 3NUHB 3H94A 3RR5A 4ZQ3A 4YCWA 1VQ5A 2J52A 3OAWA 1C4QA 4DR3Q 3PQIA 5CGKA 2F0FA 4F7XA 1FM0D 2IX0A 5I9OA 4YWMA 5IWAQ 2G1EA 2C7HA 2LD9A 2D62A 3U9OA 3KJPA 3HOZG 1WIAA 2AYOB 2KOLA 4MN3A 2KMAA 2SAKA 3IHPC 1RD9D 2KN4A 4PS7A 2F0SA 4OX9Q 1KF6B 3VH4B 1VQGA 2VB3X 1TBEA 1VQHA 4GKJL 1HFGA 4HJ9A 1GUWA 3RD2A 4K5VA 4PK1A 1PH7A 5NUCA 2Y5PA 4LUVA 3MWYW 4FHKA 1STNA 4J1MA 4ULLA 4F1SA 4IOAA 5CV8A 2QA4A 3U58A 3UDFA 5M3FG 1F2YA 2EKIA 2KJXA 2KDMA 1BMLC 3RD4A 1AW7A 1S4ZA 4REZA 3PO2B 1QKZA 1JWAD 4MH0E 3E9IA 3NBIA 3QAQA 5FO9B 2IGDA 3R93A 4A8XC 3NQTA 1WI5A 4ZLTF 4LF6L 2JU6X 1ET6A 1IGDA 1C3TA 5FLXc 1VQAA 2OJWA 2UXBL 4W9EA 2YYZA 3UF8A 1JQYD 5L95C 1B9MA 3J81L 1E2ZA 5M5YH 2LVOA 5GXGB 1A8VA 1SIFA 2J42A 2XWJB 1F2MA 3E0EA 4CBVA 4QB4A 3KK7A 3PIP3 2O5JC 1MI0A 2D3GA 2HDEA 2SDFA 1IHZA 4IUPA 3E3XA 2ZW0A 4X64L 1G6PA 4N8FA 5C44H 4KTAA 1KLVA 1HRJA 4US8A 1DOYA 3K9OB 1XMOQ 1ZGUB 1MGSA 1DGJA 2QEXA 2RKSA 4KJNA 3J81j 1VQMA 4OZBA 3HUIA 1VQNA 4DDID 1V9PA 2EY1A 4X65L 3QX1A 2RSOA 4L5QA 1OXSC 3ICEA 2DBYA 4LDTD 3EFUA 2L55A 4DV6L 4KDLB 5GQOA 5J1ZA 1TTNA 4A3JG 4W9KA 4JI8Q 3C8YA 1I4XA 1C48A 1UWXA 3EN2A 1H8CA 3AEEB 2A4ZA 1X3EA 1IW7D 1JRPA 3U7ZA 4RKBA 3TEHB 1J0GA 1ROEA 3J7AV 1WVLA 5CHFA 2JRHA 3J81i 1CM9A 1EEFD 3LGJA 4OL7A 4CKBA 3MXNA 1Q82C 2E5LL 3E9HA 1ZXHA 1XTCD 5FK9C 1TJEA 2EDGA 4YHHQ 2E76C 2R6GA 3ZNZB 1EIFA 2FCMA 1WSPA 1QOBA 2WXKA 4TQUS 2N1WA 2FHTA 3EFXD 4GS3A 3U52E 4AQ7A 3R2IA 1SNPA 3T4AC 2A74C 3R2TA 3VQIA 1WYWB 5AZFA 3ECIA 2CKZB 3HOVB 2N9EB 1YNTE 3I9V1 3QARA 2KLCA 3S17H 4WJ4A 1RFKA 5C5MA 3WAOA 2RDHA 4A3PA 3I4OA 2B63H 1L6UA 1PYSB 2KDIA 3AE1B 1PDQA 1OQRA 4HPMB 4R4QA 1X54A 3E9SA 1SYFA 1NEKB 2NN6I 1SSOA 4AJYB 2O5IC 1XO3A 2VNUD 5D6JB 4WJOA 2BYTA 3TEWA 1EQVA 4QGUA 2W54A 4B95A 2RDGA 4GLAC 3NBHA 5LL6S 2NUCA 4IM0A 1J5EQ 4JI5Q 1SJED 1TWHB 4OIKA 4CDCC 3RMHA 4A75A 2UUAL 2R7DA 4LF5L 2B2UA 4LF7L 1HHVA 2NCNA 4IUMB 4MJSA 1B70B 1K8GA 5IO9A 3CIRB 1PA6A 1BCPB 2C35B 2AQ1B 2FINB 3IFTA 3I8ZA 2N4FA 2WXQA 5CHVC 3HGBA 1LM8B 3D0FA 3HOWG 4G50A 2M2LA 5G5HA 2LRWA 2B39A 5JJIA 2KN5A 2D2QA 4BY1H 2ZNVC 2DJGC 4GB9A 4LF8L 2B2VA 4DKAC 1PZID 1IKLA 1KRHA 3HOXG 1KXLA 3S16H 2E74C 2KMMA 1A3TA 3RT3B 1E8WA 1C7YA 2PEAA 2N55A 2Z59B 3KVFB 4DWFA 4B0EA 5BN4A 1YN4A 1YJ1A 4K1RB 4LNOA 4HTHA 3WA0A 3M62B 5ISRA 4N59A 2D9UA 3KYDD 1RM6C 3KUCB 3UQAA 1VQPA 3FAHA 1TVXA 1I6VC 2K6AA 3I57A 2K1BA 3TIXA 1HTPA 2F0OA 3V60A 4OWTB 1K0RA 4PZ7A 4POGA 1GUOA 1KJTA 2KCMA 2GB1A 3P4QB 3VRAB 3MXUA 2VL6A 5FLMG 3U4EG 1JRUA 1SDFA 1LTRD 1ET9A 3DM3A 4DR6L 1GOZA 1HR0W 4A3IB 1EL0A 2JQOA 5LMNW 4KY6A 1EM7A 3PLVA 5IY0A 4A3LH 1BO0A 4EQOA 1WGDA 4KZ0A 4UP7A 1EU3A 1WTOA 2UUBQ 1Y8RC 3OW2A 4XYOA 1I5FA 4K0KQ 2O6VA 2PJHA 2WS3B 4ID6A 1F77A 3GV3A 2KTRA 1B53A 2V4DA 3ZW3A 3A4SC 3KUPA 4JX1C 5AJ3L 4A3GH 4UAIA 1N62A 2CS4A 3AI5A 3L0WB 3ZNHB 4A3FG 3H7SA 2R93H 1BUIC 3DXJC 1C9OA 4A3OA 4XQQA 4C2MH 1RKNA 2KECA 1VJKA 2G45B 2K1FA 4KIKB 1ZOYB 4RM9A 3MJWA 1UE7A 3QIJA 4XWTA 2A69C 3PREA 2EPBA 3PPAA 2HD5B 3S1NB 4APVA 3OMGA 1EY6A 2W3SA 4AUQC 1W3SA 3WWVA 1I4PA 3A8IE 3T1HL 1UH6A 4FJZA 3NSWA 2VH1A 2AWOA 4JV5L 2BBCA 1WD0A 2MBBB 1IL8A 2MQJA 2RCFA 3NQIA 1SMYC 2JA9A 4B3TL 2V1CC 3EC8A 2K52A 3M3JA 1YX6B 2NPTA 2WDRB 3GV6A 2WXJA 4F8MA 4BBRG 3Q14C 1E24A 1HR0L 2D3CA 4GIVA 5LMNL 1U4PA 1LGRA 5BO4B 2JP1A 4LJZC 3RLOA 1K3RA 5GAGC 3CCSA 3GTPH 1E10A 4MSMB 4ZKBB 4NXML 2F4IA 4WJNA 4YTMB 5DM73 1PTOF 3UIOB 1E22A 4IUNA 2V4LA 1GD7A 1EFWA 4IW0A 4WIPA 3BG3A 1PV4A 1L7YA 2L7RA 3CHBD 2ACZB 5HI1A 5G55A 1RLFA 4LF6Q 2IZVB 1P16A 1H9RA 1FRDA 2EJGC 3MXNB 2UXBQ 5DPSA 1QJOA 1FFVA 3AE7B 5JHBA 3J81c 2NB0A 2NTSA 1U4MA 3QJYA 3AEVA 4FXDA 2QMTA 2B8GA 2I0QA 2QKIC 3G48A 4HDOA 3KLWA 3G4SA 1ZDXA 3ZYYX 3KUDB 2R92B 4QQBX 3GTMH 1HNXL 3HRDD 3N1XC 3DWGC 4MEMA 4YTNB 5BMIA 2IY5B 3RN9C 4X64Q 2TMPA 4OEMB 4PZ6A 1KABA 1RODA 2Y0SB 4XYCA 1CJEA 4H2AA 4BZAA 4EUTA 4GXBA 1CQVA 3N32A 3AEDB 2WB1B 1A3VA 3ZNID 3HP3A 5E7NA 2DN8A 2V0GA 2CHZA 4A3MG 3HKZG 4X65Q 2Q2IA 2OHFA 5M5WB 4B3ML 1EIHA 2JRIB 4CDEC 1WF9A 1QCBD 2A68D 4J6IA 3PCOB 3D6WA 3H91A 3PZ7A 4KZCA 3K7AH 2M0XA 5A2QL 3CCRA 5J3BA 4MGIE 4JE3B 1PMRA 4K5XA 1M1KC 3KFUA 5DPTA 4FA6A 5JEAJ 3MAQA 4MJSB 3DHGC 5LXHA 1JWBD 2DLBA 3EQLC 1WM3A 1PFBA 1SMXA 2KHSA 3HM6X 3ML8A 2XN9C 2AHOB 3NZUA 4M8AA 4A3IG 1F2LA 2AL3A 2HCIA 4KD3A 3L13A 2N9KA 4A20A 2BWES 1IYJB 3AE8B 1A5RA 1MHWC 1YNJC 1M90C 1NI2A 4D2KA 4QUFA 3UDXA 1CMXB 1CZWA 2VZKD 1IBXA 4KX6B 2RPQA 1B4OA 3FVQA 3AMUA 1XLQA 2YU9H 3VHTC 2GN5A 2ZCBA 1SN8A 1PLFA 1VMPA 5DM63 2PLPA 4P72A 3TS2A 2JA5G 1O78A 1E7UA 1XLOA 4K2KA 2LZ6A 3OIQA 2N0SB 3JYUA 1HTQA 2C9OA 3PRZA 5I4DA 2XSCA 3P4SB 1HZ5A 3UI2A 1K52A 3UQBA 4POFA 4TQ0A 1WYDA 2EXZA 4BKSA 1YJJA 4ABNA 2ZEQA 1GXDC 2GI9A 2KVRA 4LF7Q 3AB9A 3SDZA 2UUAQ 1Y14B 4LF5Q 3KWVA 3ALBA 3TREA 3DVNV 1Y1VB 1XEEA 2K22A 1JCKB 3GE3C 1L0VB 1T5XD 3A56A 4RGOS 5EBCA 1I3QH 1UBIA 3KUZA 5HG2A 2HD3A 2GVAA 4JVZA 2O6VB 1AFPA 2KTRB 3H15A 3ZLZA 1BDOA 1Y1WB 2D10A 2JX5A 4OVVA 2AWNA 4RFBA 3RNBC 4A6QA 5FO8B 1TIID 2F0VA 1XX8A 3IKJA 4JPBW 3QK0A 3A9JA 4FF1A 2WDVB 4JQWC 1TWGB 4IPGA 3X3MA 2HQLA 1Y56A 1KRSA 1ZYRC 4IPHA 1GPXA 1TS5A 1V43A 2DAJA 1NSNS 4WAFA 4FYDA 4BXXH 3PO3H 1WXVA 3EBEA 3S1RH 3AXCA 1F2RI 2B2YC 2VQEL 5J17A 4USAA 5DEHA 5MPOA 3AH7A 3HOUB 1FXTB 4ZRJA 1MSGA 1QNKA 1GHJA 4A93H 4A9AA 4NJCA 4O42A 3N6RA 2ZM6L 1WFQA 1PRTC 1HNWL 1HZ9A 1B8AA 3NWSA 1WJUA 2AQ3B 2F3WA 2MJ8A 2Z8LA 2LFIA 4LNQA 2NVTH 4DR6Q 1AH9A 1WGKA 4AS1A 3HFZB 5FOBB 1JJ2A 2AX5A 2NTTA 2NZ1D 4LFAQ 1HTLD 4GN4B 1XPOA 1BCPC 2FUG1 1UEBA 2KJHB 3P42A 3PZDA 4S0RA 2EVBA 2F0IA 1N6ZA 2K3UA 1S5FD 4KGRA 4N6EB 3FPPA 1WJNA 1QOFA 3JSVA 2F0GA 4DAPA 1XF5L 1QUQB 4A3KG 2X6LA 4EFOA 3U9SA 5M3MB 5AJ3Q 2MBHA 4NQLB 1HA5A 5C3XA 3QG1A 3H3VC 3HK0A 1R4MI 2I1KA 3AYHB 3JVZX 2KANA 3BJUA 4I6PA 2C5LC 1C4AA 3H1UA 5IP4D 4JBJA 1Q1EA 3I72A 3T9LA 3B9JA 1V6EA 1FIQA 5C6AA 2DHZA 1FJGL 2AWTA 2AMCB 2LVPA 3BK1A 3N3KB 3NY5A 4P75A 3A9KA 3S1MH 3T1HQ 1WXQA 1DYQA 3GP7A 2WLBA 3ZKJC 3VA7A 2JE6I 3UE0A 1YJ9A 4JV5Q 4BBSB 2WYQA 4JI7L 4GN1A 1WY8A 1S5ED 1R4MB 2PIAA 1EYAA 3G71A 4B3TQ 1I50B 3ZJYC 2AUJD 4ZK9B 2MUYA 2L0CA 3DOWA 2BW2A 4GLXA 1PFSA 1WJ6A 4IO9A 4NXMQ 3C1FA 3VA5A 1WX9A 3B2GA 4DR2L 1T5EA 2M8SA 1KM7A 1F9JA 5HKHA 1EY7A 3Q2AC 2LVQA 1SXTA 2JXMB 3H0GH 1QG7A 1AN8A 2A1AA 2A6ED 4K2LA 2L1AA 1G6ZA 1W6JA 1SFOH 3I63C 3NXWA 1QOHA 3STBD 2WXNA 3IFWB 1ZKHA 1FR3A 2K9XA 5FR6A 1PHJA 1JOQA 3DBSA 3E0JA 4OX9L 3PF4A 1PH3A 1DZ1A 5JOBA 1EZ6A 2INDC 2UXCL 2M19A 1A6XA 1EWCA 2BE5D 2GBNA 2A6HC 5C1ZA 3M3YB 1K51A 2M0AA 3TP5A 3VR4A 5IP7H 2AEHA 1IBXB 4LK1C 1WCMG 2RDBC 1WJJA 1NJIC 2XBBC 4C3JG 1A15A 2E2IB 3FRPB 1Y69U 1XNQQ 4QUCA 1IP9A 1ICFB 4L23A 1LYLA 1SROA 4FDBA 5TR5A 2EMSA 3RMKC 4MTKA 4B3MQ 1HZAA 4JBWA 1PZKD 4K6DA 4LTUA 2XVSA 5DPRA 2KQ3A 4WJ3M 4UY8C 1G6JA 1YN3A 1NTGA 2ZVNA 4I6LB 2H5XA 1EYGA 1IYUA 3OTOL 3CCMA 3JC66 1QZEA 3OJ3A 2MGSA 2LFNA 1VQCA 1SJHD 1KL9A 2NR2A 2MW5A 4W9DA 3V2TA 4A3EH 2M9VA 2JA6B 2BS2B 3BY4B 4RNAA 3Q8AA 3Q3FA 3D4DA 1JOOA 3F1ZA 3BZDB 2V3SA 4KJOA 2L15A 2LXAA 4G3XB 1L2NA 4OXPA 4DR1L 5IYCG 2NZOA 4IPCA 4DV3L 1J9OA 3A9JB 5BR8L 2GOWA 1TKYA 2NVXB 3KQ4A 1B44D 2QC8A 5CV9A 1ASYA 4JI8L 1J6QA 4K81A 1EIYB 3V61A 2NZHA 3BU2A 4DHJB 1SE8A 4LJPB 3PIOA 1EQQA 1LV9A 1MJEA 2UXDL 3RN5A 2JA7B 1WGYA 3KF8B 3PVLA 2KMCA 2QHOA 3UDIA 2M4NA 3W1SA 2ZPYA 4RKLA 1JE4A 4FNFA 1EWYC 3VAWA 2MBOA 3DVGY 4Q0FA 1HZ6A 1QWYA 3TEYA 3D3RA 5EKIA 4C3HH 3HOZB 2KJ6A 3VTUA 4ZYNA 4M0WA 4WURA 3S1QB 2ZNVB 3ZRFA 2BKFA 2KWVB 2LGDA 1I6HH 2ZZPB 3L54A 1P7FA 3J7A5 2BYVE 1R7SA 1TGZB 3RLFA 1VMCA 3E56A 3JSVB 1Q8KA 3MXGA 3ZXVA 2LGIA 3ZGZA 3X0WA 3DBLI 1A2TA 1VD2A 1GHKA 3RNCC 2EMTA 1P98A 4PQXA 2JPHA 5BMHA 4HCPB 3K5MA 4KY7A 1II3A 2JA8H 5M3FB 1HUNA 2KEDA 2HT1A 4KKUA 4R4IA 4DK1A 4RGNA 2KDEB 2DUDA 1IBML 2I2YA 1OXUA 2L12A 1P1AA 2DAFA 1DOIA 3K9PB 3P1HA 3I4NG 4DK3C 1YJNA 3DBRB 2ZTDA 1Z6HA 2KK8A 3DBLB 3VH3B 2KHWB 4BVUC 3AECB 2K39A 4Y52H 4J8QA 4F88A 1N9WA 2D0OA 1ZPSA 4OVZA 4YSXB 1R9TB 4IOCA 1N63A 5EJWA 2ZM6Q 3QWNA 2B76B 1HNWQ 1OGWA 5IYBG 3A33B 1TQOA 4RA8A 2KFJA 5CV5A 5GMVA 3D31A 3KJOA 1WX8A 2WWZA 2J0KA 2D3BA 2BH8A 4HLEA 3CC7A 1HQMC 4L2YA 2PVGC 3A5ZB 5IKCM 1VQEA 4KK7A 1DJRD 2F03A 1S5DD 2DY8A 1K0SA 4J15A 4M8MA 3PUZA 2XRSD 4JCVE 1ZXIA 1YBYA 4DPGA 2ASQA 3N1ZC 1JORA 2RA4A 2B2YA 3HM3A 4A3JB 1GNUA 3GTJB 3AFQA 3BK2A 2X6GA 1IKMA 3T53B 1G91A 3PGZA 1MBYA 4I6NB 2MJDA 1FJGQ 1Z5SB 1UE5A 3TRZA 4NXNL 4V0BA 1X55A 2HDMA 3S14B 2QDBA 3GB1A 5E6JA 1UWMA 3M4PA 3BINA 5C3JB 2HUGA 5E3FA 1B2TA 4RGMA 2SEBD 4JI7Q 4JIOU 2UUBL 1EOTA 2K5PA 4W9GA 2MNAA
chains in the Genus database with same CATH topology
3AMZA 5CV7A 4B08A 1NYQA 4K5WA 1FXAA 1TYGB 5FKAC 4KKSA 1KH0A 1VZ6A 1O7LA 3TBIB 1E9MA 2K03A 3SVMA 2FBWB 3H09A 5IT9L 1OO9B 1SYEA 5IGGA 4IN3A 4XE0A 2BA1A 2EYLA 4WH4A 3VR5A 4KI0A 2K01A 1QLBB 3BDOA 1YMHE 2DYMA 3T51B 1FO4A 4WRDA 3VR3A 3K0YA 3GTQB 3DEOA 1WD1A 2SNMA 4ZUIA 3HOWB 4H7BA 2C5CA 2IDYA 3TN2A 1FRRA 3IT4B 4X3SA 5BN3A 3MJ5A 4IFDG 2NMQA 1GUNA 3RUZA 4OO1H 3WDNA 1E6EB 4FO2A 3HOXB 4GZYC 1I4GA 2EY6A 4OGQC 1L4ZB 2K5QA 3RZDB 3W5UB 1BUVT 3KWLA 3OMCA 4N9TA 3HG9A 3H8HA 3FPUB 1CZGA 1SNDA 4BA2I 2A5HA 2VXWA 4U673 2JYTA 3TZUA 5D7GA 3X3NA 2WACA 2EJFC 1FNWA 1PTOC 4TKOB 3WCQA 1H9KA 2KCCA 3V05A 3P20A 1LTID 1STHA 4A3FB 2JWUA 2KUMA 3Q23A 3QOJA 4TQ1A 1L6VA 3SEBA 2VB2X 5BYQA 1EY8A 2Z4IA 1I4QA 1O7YA 1AYFA 3H6MA 2MEKA 3TEXA 1JB3A 2JEBI 3PO0A 1H9MA 3EJIA 3WOEA 1OXTA 1V8CA 3SXHA 4BBRB 1D6EC 2H1EA 5D65A 4PMCA 2IJ0A 4BWGB 2NYZD 1TKEA 3NWTA 4XWWA 4O1NA 1PGBA 2R61A 5KNDA 1RYJA 3OHXC 1PRTB 1QNUA 4CJ2C 5EE3A 4EQNA 1AWDA 2ON8A 3S9WA 1OXVA 4ILWA 1XLNA 4KKTA 4YSZB 1JOKA 3ZJUA 2BDNA 1V8QA 5KNCA 2K5WA 1SNCA 3J80E 2HTME 2SNSA 4CQNA 4A3MB 3HKZB 3IAYA 1FMAD 1A3UA 1F9RA 4ZKCB 1PZJD 4MACA 2HQEA 3QIAA 3MFYA 1F2ZA 4NMZA 3NPPA 3A7LA 3P4PB 2TSSA 3GD7A 1YNNC 3ABVB 2WP8J 3G7LA 3GTGB 3MP9A 2QF7A 5EPLA 3DUZA 5C0XI 2WXRA 3N52A 2K7VA 3RPFC 2MJ3A 2PYKA 5JEAH 1CHQD 3LB8C 4DNRB 1AEXA 4CJ1B 2D5GA 1E0BA 5A35A 1HEZE 2LS01 4V190 1SNOA 2IWHA 2JA5B 1PFMA 2L83A 1XYIA 3HEJA 4KMUC 3HOYB 3QO2A 1MHHE 4XQJA 2NN6H 4KKJA 1UNSA 3I70A 2N9LA 4C56C 2MH7A 3JAME 3FC4A 2ZXOA 1O7ZA 3SK6A 3NP8A 3MXPA 3KLSA 1KNAA 4XXEA 2EY5A 2JEAI 5E4XA 3DWPA 2OF1A 4HCEA 1IUEA 3P75A 2E2JB 1QE6A 1BCPD 3S15B 5J22A 1B9RA 5TSSA 1GAQB 1STYA 3GTLB 3RZOB 1Z7TA 3MA2B 2JYOA 1IW7C 2Q8TA 2I07B 2KEEA 4BA1I 4FVMA 1OFFA 1IYVA 1GUTA 3M4YA 2PPBC 3M4OB 2E75C 5C3EB 5IOCA 3VYUA 3AEGB 3HS0C 2BCOA 1XCQL 5LHY1 1QB5D 4DU9A 5AFWA 3CQZB 2FMMA 4A3KB 1KDBA 3T13A 5COYA 1C77A 1RHPA 5G3LD 2J53A 4C7ZA 1N61A 3CRKC 4QIWB 1ZDVA 1E0ZA 4K6LA 5T1IA 5EPKA 5C4ZA 1PGAA 4DXFA 1NAPA 4LAAA 1O80A 3M85A 4KN7C 2ZW1A 5HURA 3EROA 1D5XC 1JWMD 1I4RA 3TDQA 1DOKA 2L5TA 3TP6A 1EQTA 3DM1A 5C0XG 5CORA 1ACCA 3V3XA 2K32A 3IL8A 5DNFA 4EVOA 2E6XA 4WWMA 1XXGA 2IX1A 4KGSA 4C1NK 4HKZE 2E2DC 4IUTA 5JJZA 3BS1A 1HQRD 3NZ3A 4ME5A 2W3RA 1U9RA 5EBDA 5EKKA 2R7ZB 2WXMA 3UI3A 4NAMA 3DWMA 1WCMB 1SYBA 3W3AA 4TRDA 4DA2A 1UGJA 4C3JB 5HGTA 1HXYD 2WXIA 4OZAA 3L9AX 4US9A 4MIUA 5IGCA 4HROA 5C0XJ 3KF8A 3D4RA 1CA5A 2F0EA 2LEKA 2PVOD 4QCLA 4GDLB 1KLUD 4HJGE 4PV1C 3PV0A 4IQZA 2Z1CA 2WDQB 1C79A 5D3IB 3HZXA 1CT1D 2SOBA 5M5XB 1V1PA 1C78A 5C5LA 5D3DA 4DAVA 2FE8A 2EE1A 2OEOA 1SNMA 1TWFB 2F0UA 5I6YA 3O13A 4Y7NB 1N5WA 4IUQA 5ELBA 5IGEA 2KACA 3LNNA 2CHBD 5I6WA 2PCFB 1VDVA 1Y8NB 2L32A 2JXTA 2ONQA 3VYRA 5C4HA 2WKCA 1E2WA 1IGCA 1M8AA 1Q3LA 2IL8A 2BTEA 2KAJA 1VCIA 2MP1A 5IODA 1K83B 4IUVA 5BYRA 3MVVA 1DCZA 3DWQA 1J7CA 1WTQA 4HSVA 3BDLA 3MFGA 3PIO3 2QIEB 2ZXRA 1VR9A 3FKIB 2PZTA 2BS4B 2ICIA 4KKIA 3SFEB 2QJLA 3TZDA 1Q12A 3MHBA 2B2TC 2PW7A 1D1KA 1PDXA 2BA0A 2IPKD 3BIID 4H13C 2A68C 5CBEE 3I73A 1NI3A 4WJWA 5M9OA 3D6CA 2H88B 3I4NB 1E2VA 2E2HB 3Q24A 3AV8A 4HR7B 1KDAA 4XIGS 1EZ8A 2NWGA 4NDXA 4C3IG 4CJ0B 4RHRA 1PTOB 3VR2A 3K58A 1T6BX 3EVQA 1EY9A 3E5SA 4MM3B 3DHQA 1MPEA 3C1EA 4U68A 1M4VA 3L3OC 3NRZA 3GTKB 4GDKB 3WOFA 4KHVA 4KHZA 4RGTA 1A70A 3DWAA 1AP0A 2R3ZA 4DAYA 2I46A 4FXGC 3NVVA 1MSHA 1Z47A 3BDCA 4HSPA 2WQYB 1CA6A 3I90A 4HEDA 1B1ZA 2IW3A 2AUKA 5FO7B 5K36H 1UUPA 1FXIA 4L8JA 2G9HD 3D8GA 1WWTA 1QILA 4HN7A 3AM9A 4XDXA 2KCNA 5C4JB 5EGTA 1WTRA 3CWIA 3ZJTA 1NR2A 4B9WA 2BDOA 3HRZC 1PTOH 4YSYB 2IGGA 3KLSX 4WQMA 2WXFA 5C3WA 4IFDI 4IKGA 4R3DA 4NZLB 1V1PB 3W5VB 2XRQD 3ETRA 2L1BA 1B3AA 1DOLA 2VUMB 4BS9A 5C4XB 5CV4A 4P16A 4DFAA 2PZUA 3OWFA 4KV6A 2AQ2B 5FLXE 2OT2A 3T3OA 1G2SA 2XWBB 3A8JE 1YN5A 4J3OD 1PFDA 3AEBB 3AE4B 3E6ZX 2NVQB 5H92C 1DM0B 3IXSA 5LL6X 2QCPX 3FDTA 2LMCA 1HFNA 1TWCB 1J8IA 3FILA 2RMMA 4HCSA 1LT4D 3I91A 3GTOB 2FMCA 1VRAB 1D4BA 4C1NI 3AE9B 1H9SB 3T56B 2L52A 2CW0C 3ND9A 2JQRB 2DYOA 5C2TB 5CC4A 1XWEA 2M00A 4H0LC 1S5CD 2WKDA 1GB1A 3NTKA 2WXGA 1ENCA 4JK1C 4HKQA 1EIGA 2PO4A 2A6EC 2INPE 4RWSC 1BNZA 3NS1A 4R9WA 3K6OA 5KIXA 4PT5A 1PGXA 4P6VF 3NVYA 1XCTL 2H4OA 4YXDB 4HMIA 3C2PA 1LTBD 3A8KE 2YEPF 4F87A 2BE5C 4KY5A 2GRIA 1VDZA 1SEBD 1BXTA 4OZCA 5ELEA 3T3NA 1VF7A 5EE0A 3NTHA 3GQBA 2PZWA 5M5YB 1RCVD 1SE2A 3EUB2 2PNRC 4CKEA 3Q8BA 5AUKA 4A55A 1NCVA 1DXMA 5C44B 3Q22A 1EEID 2PMVA 4NKLA 4RF1A 1DOMA 1SYCA 1ICWA 2B2TA 4KGTA 3K59A 4L6TB 4DXGA 5T8IA 1E7PB 3A54A 1N60A 3L4PA 1W6KA 1VZ8A 1WYGA 4EGVA 1BF4A 1C8CA 1AZQA 4LMQD 3R8BA 4J6HA 4KD4A 2MHVA 2PQEA 1SE3A 1FD6A 5AUIA 1Q8IA 3Q8FA 2MJEA 4DNTB 2WINB 5I9PA 1K8OA 4OHJA 2F0QA 2A69D 2K05A 3IAM1 1ILPA 1FEHA 1TR5A 1CK1A 4XYQA 4IDIA 1LABA 5DAUA 1EY5A 2F0HA 5IT9E 2J4XA 3Q6SA 1FNUA 3S17B 2EYHA 2B63B 1SMYD 2WU5B 2WNMA 4RH6A 2WXPA 3EGRA 3I4MB 4IFDJ 4R8NA 1WRIA 4N9PA 3QB3A 2XIWA 3URYA 1QQRA 4XQNA 2LMCB 1D5MC 1D2BA 3NE5B 3FILB 3KLRA 3SK8A 2WP9B 3N9YC 3J80L 2L4NA 3C46A 1C9FA 1FCLA 2PKOA 1Q10A 1RWSA 2EYMA 1ESFA 1B50A 4BY1B 4YWGG 4XTCS 4OO1G 3C3LA 3S16B 2XNAC 3OW7A 2OEDA 3J81E 3Q0AA 3MHZA 1EFID 2ENBA 1PXUA 1KLGD 2X69A 2DWQA 1P7EA 5KEEA 1FD7D 2BB6A 2X38A 2CVRA 4TMAB 1UEAB 1ZXTA 1EWHA 2B8FA 2EJMA 3VR6A 2PW9A 4HRSA 2EYFA 1OXXK 1LTGD 3J7YW 4DGZA 3OOCA 1UAPA 2B2WC 3K5NA 3TEZA 2EY2A 3PMFA 1EU4A 3MEHA 4HMJA 2FFKB 1Y8OB 3BVZA 5EKLA 4A3GB 2F0MA 4JPSA 2R93B 2JZPA 1YNJD 4C2MB 4JWUC 2CJNA 2RSNA 2D5DA 1KAAA 3JAML 2K04A 3PZ8A 4ARIA 3AEAB 4AYBB 1LLRD 3ONAB 3M7NA 2JSOA 4CHTB 4OW0A 1PYWD 3VYTA 1SNQA 3BYTB 1EYCA 5EE1A 1D5ZC 2LY7A 1YQ3B 1FCCC 2V3PA 2V3NA 1T3QA 3GTPB 3PUWA 5JPMC 4X3UA 1BR9A 4IZ8A 4CKCA 1GB4A 1H9JA 4ZOHC 4A3DB 1U4RA 4M1UB 3CRLC 1WTVA 1WTPA 4QMGA 5CV6A 3NUCA 3GO5A 4JWSC 1VZ7A 3MTSA 3I4LA 1I7HA 2J0TD 2BB5A 3R3OA 2WXHA 2YEPB 1ZYRD 4G7OC 1MD2D 5ELFA 2WAQB 1ONLA 1X32A 3GTMB 1TU2B 2IT1A 1PUTA 5CR3A 1KDCA 3W9CB 3LXFA 4R8IA 2VZKB 2QSDA 2J7ZA 2W55A 2O2LD 1PRTD 3K57A 2L11A 1NUCA 4E6IA 4EQPA 1KFYB 5IGFA 3TSSA 1LT5D 3K7AB 3KBGA 3P4RB 1NR4A 3ITPA 3TUOA 1VF5C 1NENB 2LUMA 4FP5D 4FXKC 2I38A 1JROA 3D4WA 3CU7A 1STGA 4IOIE 1V1OA 1LT6D 1R4QB 4DF7A 1G291 1ZUD2 4ZAIA 2F0PA 4HEA1 1LTAD 5JEAG 5K5PA 4N58A 5C0XH 5I2XA 1BOSA 5EQ0A 2FJ2A 3ND8A 1SSNA 3S2DB 2YU9B 2Z4HA 3DMUA 1LO5D 1NYRA 4C80A 1G8ZD 2MPMA 1R4PB 4Q2JA 1GUGA 5HHDG 5JAVA 2NN6G 2K0PA 1K50A 1L4DB 3Q8EA 4S3SA 4L63B 4K8IA 1K53A 2KVMA 4ARCA 2RDFA 1TKWB 3AE2B 1TS3A 4G57A 1I3QB 2L9HA 4X3TA 3PUXA 4HAEA 2F0JA 3HVDA 1JQ4A 1DONA 1F9QA 1LTSD 3U2SC 5E1FA 1C4CA 2WXLA 3L7ZC 3VR9B 1TT2A 3SE0A 2A6HD 1SB3C 4ZUJA 4Q5VA 2NVYB 2K28A 1RF2D 1VLBA 2OXPA 3PO3B 1RTOA 3S1RB 3B2FA 2F0LA 3G6JB 5KYLA 1QF6A 2ICEC 4A93B 5KNBA 1TS4A 1ZP0B 3M7GA 4DQOC 3OWEB 3MZ5A 1HA6A 1ZE3D 2F3VA 4QF4A 4ZRPA 2NVTB 2CU3A 4C3IB 1KNEA 2BS3B 4K14A 4MT5A 2QEJC 2DY7A 1CQFA 1LT3D 4DK0A 1JALA 4B9XA 4P2CB 5A2QE 2EOTA 1QT9A 4Z9CB 2Y5CA 2IX3A 1EY0A 4ZYSA 4IALA 3BYYB 3NVZA 1ENFA 3OSOA 4EE2A 1DOXA 4ZRZA 1QOAA 1MVKA 3SK5A 2G9DA 2RBMA 2LHDA 1SBBB 2O4XA 3S1MB 5I2YA 5BN5A 5KYIA 2B2WA 1HPCA 1BBXC 2KQ4X 2F1MA 3SR6A 1JR0D 1RTNA 1ZKOA 3AEFB 4UDUC 4GLSC 1X3PA 1DD2A 5IGDA 3TP7A 1BQQT 4XT3B 2F0DA 1LTTD 2Q5WD 1QOGA 3SHLA 1CI3M 2F0NA 1MI2A 5D14A 3K5OA 3SK4A 3H0GB 5JPNC 1ILQA 4XDCA 3J7AF 2WV6D 2EELA 4RCNA 1FFUA 1SFOB 4LLGM 5LNK1 4I65A 1TZOA 5FR3A 3SFDB 3VRBB 3ERQA 2HDLA 1FYCA 2GA4B 2WXOA 3PUYA 3A7AB 3AU7A 1L5PA 3ZJVA 3LWEA 1CZPA 4OIJA 4RHSA 2Q8RE 3IAS1 1STEA 3LWUA 5T1GA 5CBAE 3NTIA 2EZVA 5KGUA 3FMCA 1SF0A 3AE3B 1RJTA 1H9SA 2HCCA 1SYGA 2BT6A 2EYPA 4MHEA 3BVMA 2DNEA 1CHPD 2D2CC 4DN4M 1J7BA 2CW0D 2EYOA 3K5LA 2CJOA 1F9SA 3LX0A 1JW9D 4FF2A 1TWAB 2BOSA 1JICA 1B9NA 2RVLA 4NP5A 4LK0M 1U4LA 2ZXPA 3Q8CA 1ZEQX 2RQXA 5E4WC 4A3EB 4IURA 4WFN3 1HUMA 1YQ4B 2A73B 3OPOA 4G4KA 2F0KA 1OQQA 1K8MA 2LKVA 1PFNA 2KA7A 2NBFA 2IGHA 1ESRA 1JWUD 1F9PA 1EY4A 3AE5B 1I4HA 5KRUA 4FXCA 1L0XB 2K5DA 3QOLA 5IIFA 4KN4C 5F2DA 3DEPA 4A3BB 1STBA 4MH8A 5HFYA 3I3CA 4I7ZC 1TY2A 4C3HB 2N7JA 4NAWB 2WU2B 3F2UA 1I6HB 3MC0B 2M56B 5FLXL 2PMZB 2K33A 1L0YB 2H89B 3TMEA 4WORA 2JA8B 2CQAA 3EA6A 1FGBD 4ODGA 5BYSA 5JXVA 2DNCA 4ZHPA 1LACA 3TP8A 1GUSA 2RPVA 3AB5A 4YT0B 5ELCA 4FF3A 1ENAA 1CTMA 1SE4A 2PTLA 3Q69A 5JVG3 1TKGA 5EPJA 4K8JA 4RCOA 4PMBA 1RDPD 1STAA 1Y8PB 1CFMA 4ITKA 1C4PA 2JSVX 1GJXA 1TS2A 1KTKA 1JMLA 1MHXA 5H8YE 3KBXA 1HCZA 1Q90A 2QILA 2B2UC 1PRTF 2LHEA 2Y3AA 5ELDA 5CYUA 3J9CA 1PTOD 1JC7A 1TY0A 3RFZB 1WTWA 5JVH3 3LYYA 1BCPF 2ZT9C 3PUVA 3NK9A 3NHHA 1S5BD 4G7ZC 2F0TA 5K36G 2V4IB 1D1IA 2B2VC 4H44C 3A55A 5J39A 4PNYA 1G2TA 4TSSA 3AN1A 1V97A 4RAUC 1C76A 1ML0D 2WIIB 4ZRQA 1JWSD 1N5XA 1WTXA 1FNVA 1J7AA 1Q1BA 3S2HB 3BWUD 1X3QA 3T16A 4PMWA 4C3HG 5CMDA 5G3LF 3W2DA 4OO1I 1XLPA 5BMGA 2EYJA 2ID0A 4G7HC 4CGYB 4IFDH 4BY7B 3AE6B 4L1BA 3VYSA 4C7YA 4XT1B 4A90A 4B0MA 1SYDA 3P1MA 2JYEA 2N88A 1AZPA 4YTPB 1A2UA 3GS2A 5EE9A 3NVWA 3IFDA 4NW2A 3IT6B 4YIJA 3V96A 2KWDA 5G5GA 1YJIA 1SIJA 4FF4A 2PW5A 3SR1A 1EYDA 3P7JA 3OIPA 4IUUA 4RF0A 4ZHOA 2W82A 3CKIB 4X3KA 1NVID 3BVGA 2INNE 3VR8B 1F0ZA 4XDDA 1F2RC 3HVZA 2Q8IB 2E3TA 3ZQ4A 2LJIA 1YNND 2F0WA 1SAPA 3FEWX 5IGBA 3NUHB 3H94A 4ZQ3A 2J52A 1C4QA 5CGKA 2F0FA 4F7XA 1FM0D 2IX0A 5I9OA 2G1EA 2D62A 3U9OA 2SAKA 2KOLA 4MN3A 1RD9D 2KN4A 2F0SA 1KF6B 2VB3X 1HFGA 1GUWA 4K5VA 5NUCA 2Y5PA 3MWYW 1STNA 4J1MA 4ULLA 2KDMA 5CV8A 2EKIA 1F2YA 2KJXA 1BMLC 3RD4A 1AW7A 1S4ZA 4REZA 3PO2B 1QKZA 1JWAD 3NBIA 5FO9B 2IGDA 3R93A 4A8XC 3NQTA 4ZLTF 2JU6X 1ET6A 1IGDA 2YYZA 1JQYD 1B9MA 3J81L 1E2ZA 5GXGB 2J42A 2XWJB 1F2MA 4CBVA 4QB4A 3KK7A 3PIP3 2O5JC 1MI0A 2HDEA 2SDFA 1IHZA 4IUPA 2ZW0A 4KTAA 1HRJA 4US8A 1DOYA 1MGSA 1DGJA 2RKSA 4KJNA 4OZBA 3HUIA 2EY1A 2RSOA 1OXSC 2DBYA 2L55A 5J1ZA 3C8YA 1I4XA 1C48A 1UWXA 3AEEB 1IW7D 1JRPA 3U7ZA 4RKBA 1ROEA 3J7AV 1WVLA 4LTUA 1CM9A 1EEFD 4CKBA 4OL7A 1ZXHA 3MXNA 1XTCD 5FK9C 1TJEA 2EDGA 2E76C 2R6GA 1WSPA 1QOBA 2WXKA 4TQUS 2FHTA 3EFXD 3U52E 4AQ7A 3R2IA 1SNPA 3T4AC 2A74C 3R2TA 3VQIA 3HOVB 1YNTE 3I9V1 1RFKA 5C5MA 2RDHA 1L6UA 3AE1B 1PDQA 1OQRA 3E9SA 1SYFA 1NEKB 2NN6I 1SSOA 2O5IC 1XO3A 2VNUD 2BYTA 3TEWA 1EQVA 2W54A 2RDGA 5LL6S 3NBHA 2NUCA 1SJED 1TWHB 4OIKA 3RMHA 2B2UA 1HHVA 3CIRB 1BCPB 2AQ1B 2FINB 3IFTA 3I8ZA 2WXQA 3HGBA 2M2LA 5G5HA 2B39A 2B2VA 1PZID 1IKLA 1KRHA 2E74C 2KMMA 1A3TA 2N55A 4B0EA 5BN4A 1YN4A 4HTHA 5ISRA 4N59A 2D9UA 1RM6C 3FAHA 1TVXA 1I6VC 2K6AA 3I57A 2K1BA 1HTPA 2F0OA 1GUOA 2GB1A 3P4QB 3VRAB 3MXUA 3U4EG 1SDFA 1LTRD 1ET9A 1GOZA 1EM7A 4A3IB 1EL0A 4KY6A 1BO0A 4EQOA 1EU3A 1WTOA 4XYOA 2WS3B 4ID6A 1F77A 3GV3A 1B53A 2V4DA 3KUPA 4JX1C 4UAIA 1N62A 1BUIC 3DXJC 4XQQA 1RKNA 2KECA 1VJKA 4XWTA 1ZOYB 2A69C 2EPBA 3S1NB 3OMGA 1EY6A 2W3SA 1I4PA 3A8IE 3NSWA 2AWOA 2BBCA 1WD0A 1IL8A 3NQIA 1SMYC 2WDRB 3GV6A 2WXJA 4F8MA 1U4PA 2JP1A 4LJZC 1E10A 4ZKBB 4YTMB 2F4IA 5DM73 1PTOF 4IUNA 4WIPA 3BG3A 3CHBD 2ACZB 5HI1A 1FRDA 1H9RA 2EJGC 1QJOA 1FFVA 3AE7B 2NB0A 2NTSA 1U4MA 3QJYA 4FXDA 2QMTA 2B8GA 2QKIC 1ZDXA 3ZYYX 2R92B 3HRDD 3DWGC 4YTNB 5BMIA 2TMPA 1KABA 1RODA 2Y0SB 1CJEA 4H2AA 1CQVA 3AEDB 2WB1B 1A3VA 2V0GA 3HP3A 2DN8A 2OHFA 5M5WB 1EIHA 1QCBD 2A68D 3D6WA 3H91A 3PZ7A 5A2QL 4JE3B 1PMRA 4K5XA 5JEAJ 3MAQA 1JWBD 2DLBA 3EQLC 1PFBA 2KHSA 2XN9C 4M8AA 1F2LA 2HCIA 4KD3A 2N9KA 3AE8B 1YNJC 4D2KA 4QUFA 2VZKD 1CZWA 1IBXA 4KX6B 1B4OA 3FVQA 3AMUA 1XLQA 1PLFA 1VMPA 5DM63 2PLPA 2N0SB 1O78A 1XLOA 4K2KA 3OIQA 2C9OA 5I4DA 2XSCA 3P4SB 1HZ5A 3UI2A 1K52A 4TQ0A 2EXZA 1YJJA 4ABNA 1GXDC 2GI9A 3AB9A 3SDZA 3KWVA 1Y1VB 1XEEA 2K22A 1JCKB 1L0VB 1T5XD 3A56A 4RGOS 5EBCA 5HG2A 1AFPA 1BDOA 1Y1WB 2JX5A 2AWNA 4RFBA 4A6QA 5FO8B 1TIID 2F0VA 1XX8A 3IKJA 4FF1A 2WDVB 1TWGB 3X3MA 1Y56A 1ZYRC 1GPXA 1TS5A 1V43A 1NSNS 4WAFA 4FYDA 1F2RI 2B2YC 4USAA 5DEHA 5MPOA 3AH7A 3HOUB 1MSGA 1QNKA 1GHJA 4A9AA 4NJCA 4O42A 3N6RA 1PRTC 3NWSA 2AQ3B 2F3WA 2MJ8A 2Z8LA 2LFIA 1WGKA 4AS1A 5FOBB 2AX5A 2NTTA 2NZ1D 1HTLD 2FUG1 1BCPC 3P42A 2EVBA 2F0IA 4N6EB 2K3UA 1S5FD 4KGRA 3FPPA 1QOFA 2F0GA 4DAPA 1XF5L 2X6LA 3U9SA 5M3MB 1HA5A 5C3XA 3QG1A 3H3VC 1C4AA 1Q1EA 3I72A 3B9JA 3P63A 1FIQA 5C6AA 3BK1A 1WXQA 1DYQA 3GP7A 2WLBA 3VA7A 2JE6I 4BBSB 1S5ED 2PIAA 1EYAA 1I50B 2AUJD 4ZK9B 2MUYA 2L0CA 2BW2A 3C1FA 3VA5A 3B2GA 1T5EA 1EY7A 1SXTA 2JXMB 1QG7A 1AN8A 2A6ED 4K2LA 2L1AA 1G6ZA 1W6JA 3NXWA 1QOHA 2WXNA 2K9XA 1FR3A 1JOQA 3E0JA 1DZ1A 5JOBA 1EZ6A 2M19A 1A6XA 1EWCA 2BE5D 2A6HC 3M3YB 1K51A 2M0AA 3TP5A 3VR4A 1IBXB 4LK1C 4C3JG 1A15A 2E2IB 3FRPB 1Y69U 4QUCA 4L23A 4JBWA 1PZKD 4K6DA 2XVSA 2KQ3A 1YN3A 1IYUA 2MGSA 2LFNA 1SJHD 3V2TA 2M9VA 2JA6B 2BS2B 4RNAA 3Q8AA 3D4DA 1JOOA 3BZDB 4KJOA 1J9OA 3KQ4A 1TKYA 2NVXB 1B44D 5CV9A 1LV9A 2JA7B 3W1SA 4RKLA 1JE4A 4FNFA 1EWYC 4Q0FA 1HZ6A 1QWYA 3TEYA 3D3RA 5EKIA 3HOZB 4M0WA 4WURA 3S1QB 1P7FA 1R7SA 3RLFA 1VMCA 3E56A 3MXGA 3ZGZA 2LGIA 1A2TA 1GHKA 4PQXA 5BMHA