2G9HD

Crystal structure of staphylococcal enterotoxin i (sei) in complex with a human mhc class ii molecule
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
213
Chain Sequence
IGVGNLRNFYTKHDYIDLKGLIDKNLPSANQLEFSTGINDLISESNNWDEISKFKGKKLDIFGIDYNGPCKSKYMYGGATLSGQYLNSARKIPINLWVNGKHKTISTDKISTNKKLVTAQEIDVKLRRYLQEEYNIYGHNSTGKGKEYGYKSKFYSGFNKGKVLFHLNDEKSFSYDLFYTGDGVPVSFLKIYEDNKIIESEKFHLDVEISYVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of staphylococcal enterotoxin I (SEI) in complex with a human major histocompatibility complex class II molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 67
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2g9hD02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2g9hD01
1FGBD 5ELEA 3MC0B 1I4PA 1FD7D 4RHSA 1LT6D 1JWSD 1D5ZC 1LTRD 1CHQD 1LT4D 1TS5A 1PTOD 2R61A 1D5XC 2XNAC 1YN3A 1BCPC 1EEFD 1FNUA 3CHBD 4TSSA 1AW7A 1BCPF 4RGOS 1PRTD 2RDHA 1TS3A 1D6EC 1KLGD 1TS4A 5ELDA 3DWPA 1RDPD 3OWEB 1I4QA 3EA6A 1MD2D 1SXTA 3GP7A 2QILA 3V05A 1ENFA 3BVZA 1SE3A 1EEID 1I4HA 1SEBD 1GOZA 1LTAD 1HXYD 1DJRD 1EWCA 1V1PB 1XXGA 2SEBD 3URYA 1PZID 5TSSA 1I4GA 1EFID 1ET9A 1HQRD 3R2IA 1QILA 1UNSA 5D3DA 3EFXD 4BWGB 1LTSD 1FNVA 2RDGA 1RF2D 2NTSA 4RGMA 1PZKD 1B1ZA 1L0XB 1V1PA 1ESFA 1JCKB 4ZYSA 1TY0A 4OHJA 1EU3A 4RHRA 1B44D 4RGNA 3BZDB 1BCPB 1CQVA 2J4XA 5FKAC 1BCPD 5ELCA 1F77A 1FNWA 2CHBD 4C56C 1BXTA 2XRQD 3BVMA 3R2TA 3KLSX 1JQYD 1PTOF 4L6TB 3W2DA 3BVGA 2IPKD 4RFBA 1S5BD 5ELBA 3O13A 2NTTA 1HA5A 5FK9C 1LTBD 1LTTD 1JWUD 1T5XD 1UUPA 2TSSA 1S5CD 1LO5D 1PRTC 1SJED 1TY2A 1G8ZD 3DWAA 1LTGD 2AQ3B 4O1NA 1ET6A 4NZLB 5ELFA 1L0YB 1PRTF 4UDUC 4DXGA 1KLUD 1PTOH 1S5ED 1SE2A 1SE4A 2G9HD 1LT3D 1M4VA 3DWQA 1LT5D 1HTLD 4DXFA 1STEA 3MFGA 1AN8A 1SBBB 1RD9D 1XTCD 1PZJD 2ICIA 3BYYB 3TSSA 1S5DD 2AQ2B 1LTID 4RGTA 1RCVD 1D5MC 3SEBA 4K6LA 4RH6A 1YN5A 1DYQA 1PYWD 4L63B 1I4RA 1PTOB 4RCOA 2AQ1B 2IJ0A 1PRTB 1CHPD 1EU4A 1CT1D 2QEJC 3R8BA 1PTOC 1CK1A 3BYTB 1LLRD 2O2LD 5I4DA 1V1OA 2XN9C 4Z9CB 1YN4A 1JWMD 1SJHD 5D3IB 2Z8LA 1KTKA 2WV6D 2XRSD 1I4XA 1S5FD 1TS2A 1JR0D
chains in the Genus database with same CATH superfamily
1TVXA 1CSPA 1XMOL 2MSED 1I4PA 2D0PA 1FD7D 2WFWA 1WE6A 1W6JA 1TWCB 1D5ZC 1YJWA 2I1KA 4GLAC 2Z6BA 2XGTA 1V43A 3FAHA 1YHAA 1QVCA 1BQQT 2O6VD 1RKNA 4N8FA 1XNRL 4DR6Q 2A6EC 1BF4A 1O78A 2L00B 3AH7A 2N9EB 1J19A 1XD3B 3U4ZA 3CKIB 5BO4B 3M3YB 4JOIA 1ZDXA 4TQUS 2N0SB 1I4QA 4JI6L 2PPHA 5H8YE 5BR8Q 3AMUA 2PO4A 3D3RA 4LWCA 1I94L 1IKMA 3PGZA 1LGRA 3N32A 3L2PA 3M4OH 2PQAB 4ITKA 4HKQA 1GUWA 3S2HB 1ZYRC 2KMCA 1E22A 2R92B 4N59A 4URKA 3S15B 1U4LA 1JJGA 2E2HH 2ZNVC 4XC2A 2HTME 1FXTB 1PYSB 4Q2JA 5JXVA 1RTOA 1N32Q 3PV1A 2FBWB 2RCFA 3MVVA 3G4SA 4A3IH 2F0KA 3IFTA 2AYOB 3QR8A 5HGQA 1A5RA 1UNSA 2HDLA 5D3DA 3SGIA 3EFXD 4ANWA 3CIRB 2YLMA 1PH6A 3VDZA 2B2YA 2MUYA 5L83A 1TZOA 4HK2A 5DM63 3A8KE 1QOBA 2QF7A 5C4JB 4GOCA 4DK6C 4DR5Q 2F0MA 5JEAJ 4EGVA 4ICVA 5CTRC 1L2NA 1E1OA 3GDEA 1T5EA 2MGSA 4ID6A 2O5IC 1N34L 3HUIA 4IWQA 1EZ8A 1ACCA 4AWJA 4BFRA 5IT9c 4P1CC 1Y1WG 3RI7C 1GVPA 3KLSA 3QQ8B 5JVH3 1X32A 4MM3B 3BVMA 4QGUA 2JN4A 4WRDA 1CMXB 4AOFA 2X6LA 2N7EA 2EY6A 4FULA 2LGXA 4DR7Q 4WJ4A 2KMAA 3MHBA 1HNWQ 4JI4Q 4ASWC 4I65A 5DPSA 4DV5Q 4FBJB 3MWYW 4K5WA 1Q46A 1GJXA 2OOBB 2L76A 1H9SB 1LTTD 2K14A 3KF8A 2KMMA 2EYFA 3B1LX 1ZKOA 3IAS1 3T3NA 5JJLA 2JYOA 4WWMA 3UINB 2ZW1A 1PV4A 1E6EB 4KN7C 2NPTA 1SN8A 1G6PA 3BINA 3SR6A 1H8CA 1EIFA 1SE2A 2F52A 4CDEC 1WTHA 2R7ZH 1WM3A 2RQXA 1U5KA 4N8X1 2JZPA 4A4IA 1TGZB 5DPWA 1NDDA 1TWHB 2D0OA 1DD2A 1DYQA 1G2TA 2QIEB 1L4DB 1WXAA 4PMBA 1SNQA 1F2RI 1MVKA 3M7NA 3VR9B 5E4XA 3O65B 2K50A 1NCVA 3QIJA 4P7IA 3QG1A 1YJ1A 1Y1VG 1AYFA 2AUJD 4DAMA 1YN4A 2KUMA 2Y3AA 1E1TA 5D3IB 2DNEA 3N9YC 1GUAB 1VLBA 1X3GA 4A3FH 2NVUI 2M4NA 3ER0A 3TP8A 3S24A 2JUOA 3V60A 1X3QA 1A6XA 4ZRQA 2VH1A 5IGFA 1V1QA 3C19A 3A4SC 5C5LA 3W1SC 4K0KQ 3HKZG 4C2MB 1BCPC 5E1FA 3JYUA 1QG7A 3MC8A 2PQEA 1YIJA 2W54A 3A1QA 4DHJD 5C1ZA 1BCPF 1S4ZA 1HNXL 3SHLA 5IYBG 3Q8FA 3IT6B 2A69C 2VB2X 4A3GG 3TUOA 3ZRFA 3P63A 3PRPB 1C3TA 4OELB 3D6WA 2X6GA 4DHJB 4LF5Q 3BK1A 4B3SL 4DK3C 4ZRZA 2ZW0A 1MD2D 2B2UA 3VR3A 1WXSA 3S2DH 5C4ZA 4B9XA 1JE4A 3UDGA 3UE1A 5C4JH 5AUIA 1EEID 1VF7A 3KUPA 3DWMA 4HJGE 4W9HA 5D65A 3SVMA 2ZCBA 1E9MA 3Q3NC 1RTNA 4JPBW 1EYGA 1MKHA 5EDSA 3T1HL 4HJKA 1EWCA 2KEDA 3CSFA 1XXGA 2HD5B 3OYYA 4LF5L 2HT1A 5C0XH 2L05A 1C4CA 2OEDA 4FHJA 1I4GA 1IW7D 1WXMA 5IOCA 2Y0SB 4ZUJA 1V80A 1WI0A 3NRZA 1CTMA 3GTLH 2F0VA 2PW7A 1VQAA 2JEAI 4BOSC 2FAZA 3M7GA 3VR8B 4GNXC 2KWCA 4K3BA 1J8CA 3T1YL 3NSWA 3LYYA 4IPGA 1OEYJ 1L0XB 1ZDVA 2INNE 3QAQA 1WJNA 2F0UA 5C3JB 1WX7A 1HRJA 4K2KA 4RHRA 1CZGA 2V3PA 3AE7B 2F0NA 1CQVA 3WAOA 4Y7NB 3CC7A 2UXDL 2WXHA 3AFPA 3RZOB 3P4QB 3AYHB 3VXWA 3A7AB 2KJXA 2OJWA 1FXIA 1O80A 4ARCA 4LJPB 3G48A 2AWNA 3AEFB 4DV4L 3ZNID 3OIPA 2REXA 1QZEA 1K28A 2G1EA 3NG0A 1KL9A 4GMVA 5ELBA 2NTTA 2CFMA 5IE8A 2KN5A 3TRZA 3AEBB 2W3SA 3TL5A 1IKLA 2IO0B 3A9KB 1EY9A 1JWUD 5F2DA 1K73C 2KQ4X 4LJZC 5I2XA 4F1SA 1E24A 1WXVA 2WXPA 2KA7A 4DR2L 2FCMA 2LI5A 5ELFA 5BMHA 3GTPH 2D2CC 2I0QA 3ERSX 3HOVG 3X23A 1IW7C 2G9HD 2KDIA 1STNA 1SYBA 4YCUA 4JI3L 3S1QH 1ZGUB 3RT3B 4NKLA 2IL8A 1Y8RC 3DWGC 3WOEA 4A55A 1C48A 4IUVA 3TSSA 1YVCA 2AWTA 2HIVA 2CQAA 4APVA 2A19A 2XWBB 3I4MB 2CKHB 1CA5A 1FR3A 4A3JG 4DR2Q 2J53A 4IW0A 3K58A 3UI2A 4MSMB 4R4QA 1JQ4A 2WIIB 2BYFA 4FLHA 2LY7A 4B3RL 4BBRB 4DF7A 2GI9A 3QIAA 3HKSA 4JI5Q 1VQ9A 1I5FA 1BUIC 3WWVA 3VDYA 2KJRA 2LFNA 3OHXC 4O0AA 3DHQA 3ZJYC 3ZUNA 3U9OA 1R4QB 5C4HA 2NR2A 3ZKJC 2B2VC 4KJOA 1EIYB 4W9GA 5IGCA 1JRPA 4HJ7A 3RNGC 3NWTA 1B9NA 1RWSA 3WOFA 3OPOA 1QJOA 3DBHB 4YSXB 5HURA 1F9SA 1WZ3A 2EMTA 2GA4B 4IOIE 1SR3A 1QB5D 4JW0A 1MI2A 2RSOA 2ICEC 1SNOA 4DAVA 3HOZH 3RNCC 4JCVE 4GS3A 2BS4B 2DAJA 3D0FA 3DVGY 2LGIA 3EFCA 4H02A 1J7BA 2NCNA 3ULLA 3UGBB 3FILB 3MHZA 1WD0A 3S1NB 2B2WC 3CCUA 2I5LX 2FMCA 5FLMG 5CR3A 2VQEL 2CH4A 2RCNA 2IY0B 1NBFC 2UUBQ 1OXTA 1E8XA 1YJ9A 2SAKA 1SEBD 3QC8B 2HE7A 5ELOA 2BT6A 3IKJA 4S17A 5JEAG 4OW0A 4BZAA 2UU9Q 3FC4A 2NBUA 1TWAH 3HS0C 1AFPA 2L1AA 4A3PA 4BXXH 2LMCB 2WS3B 1N5XA 2PCFB 2JQRB 1OXUA 3NBIA 3KVFB 5MPOA 3I4MG 3L16A 1VQLA 1SFOH 1VRAB 4BA1I 2DAFA 1XLQA 3RUIB 1EY7A 1SF0A 2KEEA 2K25A 3DQVA 1Q7YC 2L5TA 1WTVA 1HPCA 4BBSH 4IFDG 2D3BA 4YWMA 4M02A 3PZ7A 5LMNW 5E6JA 3ND8A 1CI3M 4CKCA 1E2VA 4BY1H 4MN3A 3BDOA 4IUMB 1ESFA 5BR8L 3PF4A 3HOVB 3TZUA 1TIID 5C0XJ 1WGRA 3K8AA 4OHJA 2UXBL 2PKOA 3I3TB 3ZIMA 3RLOA 4W9KA 3CC4A 3UQBA 3PRMB 2JA5H 4JG2A 5I6WA 4EE2A 5GADC 5CV4A 3J81c 5IGEA 4BBSG 4IFDH 5K36G 1E8WA 2D10A 4YY3L 4NAMA 1OFFA 2E3TA 2INCC 1MHWC 1RRBA 1HCZA 4F8MA 4IUQA 2NPTB 3HG9A 4OIJA 5FK9C 4JWSC 1Q86C 1SMXA 1STHA 3A8IE 4QUFA 3H1UA 2R7ZG 3ML9A 2INPE 2O5JC 3A56A 1G6JA 2NVYH 1JC7A 1R9TH 4JI5L 4C3IG 5JJZA 2AQ3B 4O1NA 5K36H 4KZ0A 1Q8KA 4W9EA 4YL8A 5LXHA 1SSOA 4L5RC 2PW9A 4L5TA 1HFNA 1L6VA 3L54A 4PMCA 3H7PB 2BH2A 2O2VA 4LFBL 4L23A 3KF8B 4IFDI 2CKZB 2Y5CA 2D62A 5CV8A 1HE8A 1WMHA 1F2YA 1NMFA 4RG1A 3SEBA 2FCNA 4K6LA 3HVDA 4JOIC 3NZSA 2HJ1A 2EQSA 1WTPA 3H91A 4AYBG 1D7QA 2CW0C 4HRSA 4MH0E 4O2DA 1GXDC 1EU4A 1AWDA 2MX2A 1PHJA 2WU5B 3EQLC 5CV9A 3B9JA 2J52A 3S2AA 1SE8A 2XN9C 2F0WA 2JA6H 2GBMA 4BY1B 1JWMD 5CHWA 1PH3A 3AULA 1FXAA 2WAQG 4GKKQ 1VQIA 3GV6A 4V190 2BYEA 1MFWA 2XTIA 4NW2A 2BBCA 3F2UA 2CHZA 2RDFA 4HTHA 2J0MA 1Q8IA 2EKEC 4C00A 1I6VC 3MZ5A 1T0RC 1PMRA 2B2TC 2PMZE 2E76C 2VZAA 4IPDA 2OWOA 4B9WA 4A3GB 4NB3A 1PUTA 4CGYB 2BB6A 4WJPA 2IX3A 3OTOL 4USAA 3K81C 1VMCA 3FKYA 4X64L 1A70A 2D3CA 2KCCA 4HJ5A 1QOAA 1Z6HA 4LNKA 2JSOA 1LUZA 1PH1A 4C7ZA 4XYOA 3RN9C 2PPBC 3NVZA 1N9WA 1VQ7A 1YIWA 3L4PA 1IL2A 3QWZB 5AZFA 2F0PA 4CHKA 2HIXA 2GN5A 2BCOA 3PO2H 2FNJB 1JWAD 2M56B 3RN5A 4AH6A 3OJ4B 4IZ8A 1EQTA 4AJWA 1XX8A 2CS4A 2KFJA 4YWKA 3VA5A 4KDLB 4UPAA 1WIAA 5FO9B 4DV2L 4WJWA 2OCEA 3KQ4A 2LJIA 1V1PB 2N7DA 3QA8A 3W1GA 5JAVA 1CQFA 2KX3A 2FINB 4PNYA 4LF4Q 4RNAA 3QCAA 1ZKHA 3WAPA 1A3UA 1EFID 2NUCA 1S40A 2VUMH 1DOLA 1F2MA 4A3KH 4MNOA 3TP7A 1I35A 2KCNA 4RAUC 2RMMA 5EQ0A 2YTYA 2B2VA 4E74A 1J5EQ 5JVG3 4GN1A 4RGMA 1QF6A 1IGDA 3CCVA 2KC1A 1V1PA 4DR7L 2DY7A 2BQQA 1QQRA 2BW2A 4BBNF 2DZMA 5DPRA 4GSWA 1JORA 2B63G 2UUCL 3D4RA 4K7UA 3S1RB 5FLXE 4EX5A 3I57A 1QT9A 3Q8EA 1UGMA 2J4XA 3CP0A 2BS2B 3ZDMC 1IBML 3HFZB 1A15A 2DNCA 2K1BA 1PQSA 5IO9A 2AUKA 1JOQA 4DXAB 4ZHOA 3J81E 4JI2Q 3HOUB 4ARIA 1K83B 2B2TA 4YCWA 2UUAL 1V6EA 2I46A 2WDQB 2NVXB 5IY0A 2J7ZA 2OXPA 3OSOA 2M0AA 2B8GA 4FXDA 3SR1A 3CSTA 5C23A 3WANA 1Q10A 4FN2A 1Q1BA 3AN1A 1WVLA 1PH7A 2QC8A 1S5CD 5T8IA 4GKKL 1PRTC 3HZXA 2ZM6L 5H1SE 2KECA 4DV3L 4DUZQ 1CZWA 3MXNA 2OHFA 1SNMA 4ZRJA 1W3SA 2LEKA 4LNFA 4YTMB 1D2BA 1HTLD 4NP5A 3RZWC 1UEAB 4Y7NH 5M9OA 4B3TL 2D5GA 2W55A 2MEKA 5E6PA 1IXRA 1W2BA 2KHJA 4QMGA 2F0HA 5C6AA 1IBXA 3OTOQ 4A3JB 3DBLB 2B8FA 4RCOA 5IGBA 2NVQB 3T53B 5IGGA 2IZVB 2WKCA 1QLBB 4II3B 3DHIC 1C7YA 1N36Q 4Z9CB 5JEAH 1HZAA 2IHFA 3HOYB 4KY5A 1KTKA 3U58A 1YX6B 3ZJTA 4FDBA 4GDKB 2L55A 4GOPB 5C5MA 3M4QA 4X3KA 2I1JA 2EXDA 2E2IB 3PO2B 2KYWA 4TUUA 1EQVA 5JPNC 4Y52H 3RFZB 4GOPC 4XE0A 2EMSA 4P2CB 4ULLA 1CM9A 5A2QE 3SK6A 4JC0A 5JPMC 1VZ8A 3VUXA 4IOCA 1AW7A 1I3QB 3ALBA 4EZLA 1STBA 2MW5A 3A9KA 5M5XH 1L6UA 1D6EC 3J80E 3A5ZB 4MZ9A 3KBGA 5DAUA 4DV0L 3C0RB 2I38A 3DBHI 2E2JB 5HI1A 3GTGB 1FCCC 4ZDVA 3P42A 3E6ZX 1IHZA 2MBBB 4IUUA 5IT9E 1WSPA 2DX5B 5G5HA 4IPHA 3KUCB 5I2YA 3K5LA 3EC8A 4GDKA 1F1HA 3QARA 2F0LA 2CJOA 1C1YB 5C3EH 3J7YW 1YJJA 1GUNA 4JIOU 2Y5PA 3CCMA 4PS3A 3TEWA 4I7ZC 4JI2L 3KOJA 3GTPB 5IGDA 1ENAA 1KOTA 4C4VA 4DR5L 5CYUA 4I6PA 1P98A 1QILA 4NXNQ 2DENB 2JWUA 2Y0SE 4BWGB 1R4NI 2BKFA 4LNNA 4DBGA 2YTXA 2NB0A 2RF4A 2Q2UA 5CGKA 2YEPB 2MFIA 2ZXPA 1EQRA 1XNQQ 1P9DU 2DN8A 1PZKD 2A74C 4TVAB 5IA7A 4WJNA 1O7ZA 1RL2A 3APCA 4M8AA 4E6IA 2SNSA 4DUYL 1UE1A 2MHVA 2ZM6Q 2MH7A 3EROA 4DHZE 1JROA 4TQ1A 2N9PC 1T9HA 4BBRH 5FR3A 4ZK9B 4WH4A 1CKOA 2L4NA 2XRQD 2ZTCA 1NR4A 3NK9A 2ACZB 4HEA1 1EWIA 1VQNA 3NQIA 1FEHA 2F4VQ 2K3UA 4IURA 4L6TB 3K9PB 2K0PA 3NHEB 3UDFA 3IFWB 3BZKA 1CSQA 1UE5A 3BDLA 1RJTA 5FLXc 5M3MG 2LWPA 4GLSC 4DKAC 3OMCA 4JBJA 5A2QL 1ZP0B 1ONLA 1F9RA 1HFGA 3TP6A 2JZZA 1DOMA 1HHVA 3VRBB 3P75A 3BDCA 1LTGD 3WCQA 4TKOB 2WB1E 2LXJA 4LNIA 3KYHC 2NWGA 1WGDA 3F8TA 1B2TA 3CPWA 2NN6G 3S2DB 2MRPA 4AIMA 2VH2A 1AN8A 1SBBB 2WP8J 1K0RA 3ZQ4A 4FADA 3K59A 2QCZA 3ZJVA 1LTID 1F0ZA 2ZTDA 1YBYA 4RH6A 2JRHA 1QNKA 4L63B 2KLGA 1I50H 3SK8A 1VD2A 5EKKA 2V4IB 2IJ0A 4MACA 4OVVA 1CHPD 2OEOA 1TR5A 4KLKA 2K7VA 3R8BA 1SROA 1IZ6A 3RZDB 5C44G 1TWAB 1K9MC 1C4AA 3U7ZA 2DZKA 2VNUD 2ZNVB 3QJZA 4GU2A 2OJRA 1YNTE 4ZKBB 2LVPA 3W1BA 4FVMA 4ZQ3A 1ICFB 3HOXB 3OJ3A 1JR0D 1X3PA 2JA9A 3FKIG 4XZ4A 1JW9D 5ELEA 1X55A 2JA7G 5E6NA 2CWAA 1CFMA 2NBFA 4LUOA 1JWSD 3ZYYX 3Q0AA 4E3CA 1ZXHA 2KTRB 2VQFQ 5J17A 4HR7B 3S14H 3PGEA 2VQEQ 5CMDA 3K0XA 5FO8B 2XNAC 1UWXA 1T0SC 2JXTA 1VQPA 3QB3A 2IW3A 1JT8A 1WTRA 4KMUC 1E7UA 4DWFA 4ABNA 2DNFA 4RGOS 1QVGA 3QHTA 1EY6A 2RDHA 1C0AA 2MCNB 2F0DA 2MJ3A 2A68D 1TWGB 1P7FA 2CHXA 1F9PA 4HIMA 1EIHA 1Y8PB 3L9AX 1S1QB 2QGQA 2V0GA 4HKZE 2I5MX 1SYEA 3P7JA 4QJFA 4JVZA 1R7SA 2A4ZA 2WDVB 2QA4A 1OQYA 2A6HD 1TBEA 4OZCA 5J1ZA 4AQYL 3T9LA 1CZPA 2YEPF 3PS6A 4YT0B 3EGRA 3Q14C 4OO1G 3VUWA 4KSLC 2JA7B 2NN6I 5E4WC 4C3IH 2R93G 1FIQA 1IPGA 4KKJA 4MTKA 5C3EB 2LVQA 3AI5A 3FKIB 3M95A 3PO3H 1K51A 4PK1A 1HQRD 5EKIA 5J22A 3OW2A 1X6OA 3L0WB 3JW0X 1SIFA 3CXCA 2F3WA 3MXNB 2EYHA 1DXMA 4ZYSA 1R4NB 2BDOA 2MBOA 5EBCA 4FF1A 3HOWB 1N60A 4W9FA 2K5WA 1KDAA 1EY5A 3V6CB 1ESRA 5FKAC 3CCQA 1QKZA 4LF6Q 2CHBD 4KY7A 4X64Q 5GQOA 4F88A 1LFDA 2KTRA 1LACA 2N1VA 1DGSA 3AFQA 1PTOF 5FO7B 1NNXA 3GTKB 1H4RA 2IO2B 3V6EB 3WIMA 1J9OA 5C0XI 4IC7B 1KH0A 2JF5A 4ICUA 4AS1A 5K5PA 1BR9A 3GB1A 5E6OA 3S15H 5AZGA 2R93B 5M3FG 1P7EA 3HRZC 2C7NB 1WM2A 3HRDD 2TSSA 4EZKA 2B3AA 3VQIA 2RDBC 3U2SC 5IYCG 2Q8TA 4BY7H 4LF8L 1PVOA 2M0XA 2F3IA 4POFA 1L0YB 4H0LC 1K0SA 1I42A 1UWVA 5J39A 2GVBA 3H6MA 2DHZA 5HHDG 2AWOA 3U52E 3QO2A 2WXNA 1EOTA 2B76B 1VJKA 1STEA 2AX5A 2EYMA 4K5VA 3CWIA 4QIWB 3TBIB 2B63H 1SLJA 4KV2A 1L0VB 5BYQA 1J5EL 4EZJA 5IP9H 2PW5A 1Y69U 4DNRB 2K8CA 2YU9B 1WCMB 4N6EB 3QOJA 2K5DA 3IT4B 2QDBA 4OEMB 2YYZA 3NTIA 1PTOC 3TZDA 5D6JB 1V5TA 1EOVA 2N4FA 1S3SG 4H2AA 3U4VA 2PIAA 3NTHA 5LMUL 2B2WA 4C3JB 2VB3X 5G55A 1ASZA 1W6KA 3L0OA 1EQQA 2HUGA 3S17H 4A93G 1FGBD 3DBLI 4KKTA 3AV8A 4AQYQ 4PZ6A 4DV5L 1CHQD 1LT4D 3J80L 4BKGA 4ZUIA 1QOHA 4K81A 2L9HA 2F0SA 1XQQA 1N62A 4BVUC 2BE5D 2H4OA 5LMUQ 4WQOB 1FD6A 2V1YA 2WHIA 1WTXA 5IP4D 4A3EB 4FA6A 2DLBA 3VR2A 2EJMA 3KDFA 4XQQA 3E5SA 1YZ6A 2EJFC 1V9PA 3E9IA 2BA1A 4IO9A 4ALPA 3VAWA 3H94A 1WFQA 2JWZA 1SXTA 2NZHA 2X38A 3I2ZA 4L8JA 4A3KG 2K1FA 2HCIA 3D4DA 1WWTA 1AARA 4A75A 1VQBA 5DEHA 4F7XA 2D2QA 1YI2A 2QCPX 3GTGH 5AFWA 4DN4M 4M01A 3RNBC 1DJRD 5LNK1 1YQBA 4HMJA 2HHHQ 2IY1B 3M62B 3RNEC 3A4RA 1FYCA 5M5YH 1GC7A 2SEBD 5J18A 3D32A 3I73A 5EE9A 3AEGB 3M3JA 1VCIA 5M3MB 4G7OC 2MWSB 2Q5WD 2D07B 4ME3A 1TT2A 1IBMQ 4MGIE 4M8NA 1MG4A 2DYOA 5L37A 2RDGA 4JI0L 2KZRA 2ZT9C 4H7BA 4AJYB 2Z0EB 2L12A 1B1ZA 1HUMA 4J6HA 2RBMA 3PHWB 4MJSB 2C7MB 3M4PA 3ZLZA 2JX5A 4MTNA 2IDYA 3P4SB 5LHY1 1TY0A 2M00A 4A3DH 3LXFA 3Q69A 3J7ZC 1IBKQ 5CV7A 3IXSA 4HXDA 5LMNL 4EUTA 4WJOA 1K8MA 1WR1A 4P71A 2O4XA 4A3LH 3HOZB 1YQ4B 5ELCA 2PQAA 1Z9FA 2VUMG 1H95A 4MDKE 5AZHA 1VQ5A 2DBYA 2KBNA 1YNJD 3D4WA 3GE8C 3J81i 4LUVA 3W2DA 2EY2A 3MEFA 4RFBA 1S5BD 4GNXB 1C77A 2SDFA 1V97A 4E71A 3CQZH 3MXUA 4GIVA 1B4OA 1VS0A 4CJ1B 4DV6L 3H15A 2OQ0A 4A20A 3AE2B 1KAAA 1KJTA 1HNZQ 2WXOA 3I8ZA 2IWHA 4QQBX 2ENBA 5LXIB 3C1FA 1OQRA 1K53A 3J81j 4BY7B 4PZ7A 4US9A 3GS2A 1HH2P 1TJEA 3DWQA 2RKSA 4KGRA 3CCSA 3RYTA 4M00A 2V9HA 5KNBA 4P74A 1XTCD 1PZJD 2ICIA 2PMZB 3T13A 5HGTA 1G291 1XNQL 1YN5A 3DMUA 1YJNA 2B63B 4GKJL 1QZHA 1I4RA 1PDXA 3AB5A 4B6WA 5DLQE 2JXMB 4PMWA 2MQHA 5IT9L 3DUZA 2OQKA 2QEJC 3BG3A 2RPVA 2LS01 3L08A 1YMHE 5IOIA 5KYIA 3NVYA 1SNPA 3TN2A 2ZPNA 3OLMD 1ML0D 2M9VA 3T51B 3NUHB 1CJEA 4DA2A 3P20A 2F4VL 2O6VA 2GOWA 3TMEA 4C2MH 4W9DA 1VDZA 2KFKA 2FCSA 3AXCA 5CX3A 1MSHA 3K0YA 1AP0A 4C3HH 1PGAA 1LV9A 1VF5C 4YCVA 2BDNA 2MP1A 3G71A 3MTNB 4HWIB 1EEFD 2PZUA 3GTJB 2PE6B 1WF9A 3VR6A 1CKMA 2KANA 1JALA 2IHEA 4A3EH 3J9CA 4PQXA 1UBIA 1PH8A 1QOFA 2L3ZA 4UP7A 5ELDA 5C3EG 1KM7A 1N8RC 1YJIA 5IP7G 1J8IA 4IWPA 4JX1C 3VTUA 3OWEB 2Z6KC 1EO6A 4XT3B 3P2BA 4IALA 3I5JC 4NAWB 5JOBA 2MP2A 4GXBA 3J7AV 1N32L 2L7RA 3OMGA 1NVID 4JI7L 2ATWA 1VQDA 1LTAD 1HXYD 1XWEA 4FNFA 2WDTB 1EY8A 3NEMA 1B8AA 2G9DA 4LK1C 4CDDC 5M3FH 2MP2B 4NAWA 1EYAA 1SMYD 4NMZA 5GROA 5TSSA 3CCRA 4HSPA 4DV6Q 2JE6I 4N9TA 2CVRA 1HQMC 1N34Q 3NZUA 3S9WA 2WNMA 2XVSA 2CCZA 3QJYA 1SRUA 2Y0SG 1TWGH 3I90A 4NPNA 4XDDA 2WXFA 2NVXH 5HKHA 1Q1EA 1BCPB 4XWTA 4P6VF 3SU8X 2L15A 5CBAE 1F77A 1OXSC 2AL3A 2KTFA 3W1SA 3ZO5B 2KFKB 1BXTA 1D1KA 4HCPB 1EUVB 3KLRA 3TEXA 4LK0M 2A69D 5C44B 1T6BX 4BOZB 4JI8Q 4R9WA 1OXVA 3I3CA 2E2IH 3S1RH 4X57B 5KYLA 4K7WA 2WQYB 4C3IB 1P0RA 4LJOB 4LF9Q 3UI3A 4J8QA 4DV2Q 3TEHB 3I63C 3HOUH 2UUBL 3JSVA 3NTKA 1HR0L 3W5VB 1G6ZA 2QJLA 2PZTA 2L8JA 2UU9L 5M5XB 2Z59B 1T0QC 4A3IG 2WB1B 1Z47A 4A3JH 4CDFC 1LT3D 1PFSA 3HOWH 2L32A 2R2OA 3U9SA 2E2HB 4R4OA 1D8LA 4BKSA 4DR1Q 4IM0A 5C4XG 4OVUA 1E8ZA 3B6YA 1ZUD2 1FL0A 5COYA 4NJ6A 5IYDG 2WB1G 2K05A 3D6CA 4CDCC 2K28A 1H9RA 3MA2B 1MHXA 3KYCD 3AMZA 3LJ3A 2ONQA 1WE7A 1Y1VB 2JA7H 1WZ0A 4OXPA 2F0IA 1FFVA 2AL6A 3NUCA 4GNXA 4NQKE 1XMQQ 4DR1L 2Z8LA 1PH4A 4L5SA 2YU9H 3MJWA 3I56A 4A3CG 5D2MB 5DM73 1JMCA 2Q2TA 1L1OC 2EELA 3V05A 4B08A 4FXKC 4KHPQ 1XYIA 1NAPA 3IAYA 3MC0B 3W3AA 1UF0A 1WJUA 1KIXA 4B0MA 1RODA 1J0GA 1J6QA 5C3XA 1LTRD 2F0TA 2KACA 4F7ZA 3PIOA 3HGBA 3S17B 4OWTB 1HZBA 4QF4A 2WINB 1SFOB 2KNBA 2H88B 4II2B 3Q3JA 4GDLB 1AE2A 4AYBB 3QK0A 1RFAA 4W9IA 5CHVC 1RIPA 1A3TA 2NVTH 4WAFA 3FPUB 3PZDA 1RDPD 3ZNZB 3A33B 1NMGA 3UIOB 1OGWA 4CYEA 4GLXA 4O42A 2KLCA 2MJDA 3GP7A 1A2UA 4K8JA 1J7CA 4QAYA 1V8CA 3B08A 2GRIA 2QKIC 1EF5A 5D7GA 1FVIA 1A63A 4FXGC 3CD6A 2R7ZB 4DR3L 3H7SA 4HCNB 1BUVT 3PUZA 3AECB 3URYA 3M85A 2JYTA 3DVNU 3C1EA 4IUTA 1E2WA 4P75A 4A3CH 4KKUA 3TS2A 2X8XX 4TMAB 3K5MA 2G3QB 5EE3A 5GXGB 1Y14B 1TXYA 1LTSD 1MJDA 2K04A 1HUNA 1QUQA 4I6LB 2HJ8A 1TKYA 2L0FA 4JWUC 3AE5B 2JA8H 4HPPA 1F9QA 1HJPA 3P1HA 5DCNA 3PTFC 2IGGA 4JLCA 1YNXA 1ZYRD 2DYBA 5T1IA 1UGJA 3AE4B 3MJ5A 3TJPA 4L5QA 1MBYA 4K5XA 4KJNA 1Z2MA 2MHJA 4TKNA 5FR6A 2XK5B 4WWPA 2IGDA 1H9SA 4DR6L 1YQ3B 3ZJUA 2E74C 1J7AA 1NEKB 1B53A 1V9JA 2A6ED 2UXCQ 3AM9A 2EXZA 2AEHA 4A3FG 4A3BH 2M19A 2CU3A 4ODGA 3Q6SA 3E0EA 3V2TA 1P8LA 3H8HA 4FF2A 4CKBA 4C4VB 4KI0A 3Q3OC 1N33L 1U4PA 3D31A 2Q8RE 1XMQL 1Y8OB 4KKSA 2LGDA 3RZOH 2FFKB 4RM9A 2QDLA 1GB4A 1GHJA 1GNUA 4DHZB 1KLUD 1PTOH 5EBDA 1KXLA 3IG3A 4I6NB 2PI2A 3UDXA 4B3MQ 1VMPA 1Q1OA 2G4SA 4MHEA 2J42A 2EY1A 3CMMB 2MBHA 4KSKC 4ACFA 3ICEA 1MHHE 3MFGA 1XLPA 1GUSA 3BYYB 4OWXB 2MNAA 2IO3B 3RLNA 4ILWA 2ID0A 1DM0B 2JK8A 2BB5A 2KWVB 1XLNA 2JQOA 4J15A 4XYQA 3BIID 4JI1Q 1HTQA 2KQ3A 1PRTB 4H13C 3N6RA 2J7QB 2E5LL 5FJ8G 2PE9A 2K22A 5ISRA 1PFBA 5I4DA 4TV3A 5CHFA 4JV5Q 3KBXA 4NPSA 3CMEA 2F3VA 2Z6KA 2WU2B 4HIOA 2VQFL 4QL5A 3WA0A 1QWYA 3IRBA 2A1AA 4LNQA 1MPEA 4HJ8A 4JI1L 4UY8C 1M94A 2F1MA 3C46A 1TS5A 1TWCH 1YNND 3Q3MC 3BWUD 2VUMB 4A3OA 3NQTA 2VZKB 1TWFB 1TQOA 1KAWA 2K6AA 1IBLQ 1JMLA 2N9LA 2PJHA 3AU4A 1SYGA 3APDA 4MSQB 3TEYA 3KF6B 1FM0D 2KHSA 1OO9B 2WXLA 1NBWA 2XEWA 2VW9A 1XJVA 2LGSA 5BMGA 1V49A 2L11A 1KF6B 1RYJA 4MGZE 4JI6Q 1ENFA 2BVCA 1LTLA 1SYFA 2EPBA 3HKZB 4CKEA 4FYDA 4WIPA 2N3SA 1QCBD 4ZOHC 4WAAA 2LSSA 2O2VB 3R7RA 4A3DG 1QNUA 4ZRIA 3NBHA 1NYRA 4KVGB 3LNNA 1N36L 2LXCA 2WLBA 2MJEA 4KIKA 1Y8NB 2EVBA 1ET9A 2K03A 1JE5A 4A3IB 3RNUA 3Q8BA 3A54A 2NZOA 2KQSA 3KWLA 2BF8B 1EY0A 2BE5C 2IT1A 2MLBA 2EDGA 5JZEB 2PTLA 3PVLA 2E6XA 5E3FA 1RF2D 4H44C 2UXBQ 2WX1A 1FPYA 4R8NA 2ES2A 1C79A 1N5WA 2CW0D 2CHWA 2L83A 3TEZA 3MTSA 4PZ8A 2KO3A 2LGYA 4A3EG 3GTKH 4HEDA 1HA6A 2R7DA 5JJKA 2V3SA 3NE5B 3RULA 1HNZL 1N6ZA 3RMKC 1WTQA 2GBKA 4BY1G 1WXQA 1PYBA 1I6HB 2EYOA 3EUB2 4I7AA 3VUYA 4QIWE 3DM3A 3U50C 2LHDA 3NELA 2W82A 4NQLB 2B2YC 2V4DA 4RKLA 1WTOA 1MJEA 5JH5C 2YVCA 1X56A 4OO1I 2ZXRA 1T5XD 1Y1WH 4HCSA 2GLSA 2H89B 4JI7Q 1E5WA 4XX5A 4LNOA 2FXQA 3K57A 5BYRA 4LFBQ 2MJ8A 5C3WA 1WCMG 1SIJA 1IYUA 1LXDA 1WGKA 3K5OA 1UEBA 3M9BA 4DXGA 1L0WA 1AZPA 2CWPA 1C78A 1P3QU 2J0JA 2N1WA 2EKIA 3L3OC 2C60A 4DXFA 2NMQA 4LAAA 1KRHA 3CF6E 5KHOA 3X0WA 3AU7A 2N55A 2F0FA 1BKBA 1RCVD 4LW1A 4JI8L 3J81L 1P16A 1IBLL 4JYAQ 4DGZA 3Q8AA 3SDLC 1TWHH 1XPOA 2C7HA 1JOOA 3GQBA 5CV6A 5CORA 3NY5A 3S1MB 2WKDA 2JA5G 1ZE3D 3V3XA 2WP9B 4F8CB 5IN7A 2IX1A 3H3VH 3PO0A 1MGSA 3FMCA 4DV7L 3MAQA 4LF9L 3LX0A 5M3FB 1RFKA 2VZKD 1CKNB 4X62L 4K7SA 5AEKB 1OQQA 2JPHA 4DNTB 3OW7A 3NHHA 1PH5A 4HIDA 4LFAL 3J80c 1BMLC 1TKEA 2VRRB 5FOBB 2R2QA 5HG2A 1KDCA 2HQEA 3R7QA 3Q6BA 1LT6D 3R3OA 4EQOA 3L17A 1VZ7A 1CUKA 2L1BA 2K5PA 2KHWB 2HHHL 2KVZA 4PT5A 3VTVA 1BNZA 2JVCA 3S16H 2B3GA 2N9KA 3I91A 3CPFA 2KQ7A 3H0GH 3HOWG 2E8GA 1QVFA 4KN4C 1IGCA 1PRTD 4KTAA 2JA6B 4FJYA 4A3MH 1TS4A 4DK0A 3UQAA 3K6OA 1HNXQ 3JSVB 2KKCA 3GTOB 4JL9A 2ZTEA 1C76A 1YEZA 4C7YA 2KCMA 1FCLA 3DVGX 2NVYB 4S3SA 4B3SQ 2MBEA 3BVZA 5IIFA 3OOCA 3K7AH 3GZNB 1XT9B 1NI3A 1TU2B 1TYGB 2Z0DB 1GC6A 2IBIB 5IYBH 3H7PA 3L7ZC 4KX6B 3E56A 4N9PA 2JRIB 1PFDA 2D5DA 3GTMH 2SOBA 3NWSA 2JU6X 3SFDB 2ZJQA 5GAHC 4GZYC 5IYCH 4BY7G 1D3ZA 1P1AA 5KNDA 2E2DC 5I9OA 1VQJA 4FF3A 1L7YA 1BDOA 1VQCA 1YHQA 3ZTCA 2QEXA 2WACA 2D3GA 1OTRB 3CW2C 2RD0A 2WXMA 3T1YQ 1B44D 2EY5A 4OVZA 3FVQA 4KDIC 3N1ZC 3R66C 3AE1B 2N9XA 5IAAC 2WXKA 2Z1CA 2D9UA 1F2RC 4C56C 1Q3LA 2FCQA 1AZQA 4QB4A 4RA8A 3F2BA 4ZCKA 4P72A 1K8GA 3ZTDA 1WRIA 2RHSB 3ECIA 3HOXG 4PV1C 4KHVA 2BYVE 4DV4Q 4DDID 1K50A 5EAYA 3VFKA 3PSIA 2RSNA 3LWUA 4DQOC 2ZZPB 4C80A 1LO5D 3TIXA 3RZFA 3CU7A 3J7A5 1VQGA 4X62Q 1TTNA 2A5UA 2MQJA 3M63B 4LTUA 2BKRB 2R92G 5GAEC 1E7VA 3CC2A 2LD9A 3OG5A 1RLFA 2NVTB 1M4VA 1PLFA 1TKWB 4V0BA 4YHHL 2NYZD 2R6GA 4RM8A 1L1OB 3AEDB 5FJ8H 1RD9D 4WWNA 2B39A 5CC4A 3PUWA 2K9XA 3ZGZA 2JYEA 1D5MC 4K1RB 3SFEB 1WX8A 4UHVA 4DV1L 4JI3Q 4LF4L 4YWGG 1TKGA 3NENA 2GB1A 3FILA 2RGFA 2ALYB 1SNDA 3HEJA 4NJCA 4HCEA 4J3OD 3U30A 3RNAC 1BVSA 1T0YA 3I72A 2DZIA 1GHKA 4WORA 2KWUB 4EEWA 2JJQA 1BBWA 2C35B 2F0GA 4BAXA 1EYDA 1S5FD 1VDVA 3GTQH 1WOCA 3B2FA 5M5WH 3GD7A 3BY4B 3GTJH 4HVBA 1XTDA 1SSNA 3V61A 3H09A 2KDEB 2KDFB 1B7YB 1SE9A 3BJUA 3F2CA 2CR5A 4RHSA 5IP7H 4RMAA 2R7FA 1STGA 2PYKA 1C8CA 2JA8B 4HLEA 3NS1A 3SHQA 1KNAA 1FJGQ 1PTOD 2R61A 2E75C 4JQWC 2FIDA 3X3MA 5EE0A 1DOYA 3T56B 5GAGC 1I3QH 4QCLA 2SNMA 2C9WB 4B95A 4IN3A 1BBXC 2WAQE 1EUJA 2WX0A 1KLGD 1LABA 2TMPA 1NR2A 2DUDA 3Q24A 4BXXG 4FXCA 3Q22A 2PVGC 3GTOH 2HTHA 2WXIA 1UBQA 4ZLTF 3ERQA 2QILA 3GE3C 4EOYA 4Q5VA 4RWSC 2AMCB 4GDLA 4CJ2C 2K8HA 3NVWA 1WD1A 1TT5B 4CBVA 1Q81C 4FO2A 2WXJA 3VH4B 1K3BC 2WXQA 4LDTD 5AJ3L 1HTPA 1VQFA 3ONSA 4ME5A 1ROEA 1E8YA 3GZNI 2LUMA 3F1ZA 1PH9A 1HTOA 3ULJA 3DBRI 4HN7A 5D14A 3FRPB 1PH2A 1V86A 5KHQA 5I9PA 4QUCA 3AE6B 4KK7A 1M8AA 3JC66 5CBEE 2FUG1 4EQPA 3HIZA 1IYJB 3I7FA 1MG8A 5M5WB 1YITA 2MO1A 1EU3A 3JAMc 5JJIA 5BYSA 5L95C 3VHTC 3L13A 1BCPD 5BN3A 5T1GA 1VQ4A 4YTNB 3SDZA 3X3NA 1H9JA 4LMQD 1YNNC 1VQOA 4DAYB 4A3GH 2R3ZA 3A9JB 1PGBA 5LLIA 2DJFC 3VR5A 4NJ7A 1SB3C 3PO2G 2JA6G 1FMAD 2V3NA 3BVGA 2IPKD 2KCTA 2GVAA 3RR5A 3J7AF 1XEEA 1HR0Q 3AU5A 1C9FA 2H5XA 4JBMA 1PGXA 1FRDA 1K8AC 1O7YA 2N7JA 4DV1Q 4XT1B 3TCAA 4IJLA 3ND9A 4RCNA 4C3JH 2XSCA 1UUPA 4OL7A 3ZVVA 1MI0A 2WXRA 3DWAA 1PA6A 3ULPA 4EQNA 2LRWA 4DV0Q 3RN2A 2NS5A 5M3MH 1HR0W 3IAM1 3DBSA 2JY6A 5IP9G 3KH0A 2NBWB 4WURA 3EIVA 1GD7A 1SMYC 4A3BG 1PDQA 2K5VA 1JWBD 2F0QA 4GN5A 5G3LF 4XDCA 4EKUA 3CAMA 2A68C 1S5DD 4IG7B 1KNEA 4J1MA 4OGQC 2R92H 2K5HA 4HPLB 1I50B 3BS1A 3SXHA 2HQLA 2BPSA 3KJPA 1R4PB 3DM1A 3VR4A 5IWAQ 4IUPA 3MC9A 1QUQB 1WH3A 1CT1D 1A8VA 4LUZA 3PRZA 1CK1A 5EPKA 4FJZA 4PS8A 2G4DB 1GPXA 2G5DA 3PZ8A 4OX9Q 1NENB 1Y1WB 1ZXIA 1I4XA 2B2UC 1XO3A 3PLUA 4R3DA 4YIJA 2XBBC 1B70B 1EFWA 1E7PB 4G4KA 2M8SA 2PEAA 3EHVA 2FHTA 2RVLA 1Y1VH 4DUYQ 2YV5A 1F2ZA 1G51A 5KGUA 5IWAL 3HOUG 3PUYA 3C8YA 1VZ6A 4ZRPA 4CO7A 1UE7A 1K83H 2RA4A 4RKBA 5EJWA 1YN3A 4D2KA 3KK7A 2GBJA 4OX9L 2F4IA 1ILPA 1FNUA 1GUTA 3IVFA 4WWOA 4JGHB 4IM2A 2EOTA 3RLFA 2K5NA 1E90A 4ZAIA 4A93H 1TS3A 2LKVA 2K4KA 5IODA 1WYGA 3DXJC 2LFIA 3U8ZA 1QZGA 1YOVB 1E10A 5EGTA 1VCBA 3FP9A 4ZKCB 3SK4A 2KJ6A 1H9KA 2I07B 4TRDA 1SE3A 3BU2A 3M4YA 4OWWB 4YWLA 3AE8B 2ZCCA 3S14B 3I4NG 4BKSD 1VQEA 2Q2HA 1UAPA 3R3MA 4IM3A 5KEEA 1WJ4A 2M2LA 2Z4HA 1OXXK 5KRUA 4FHKA 3ETRA 1IP9A 4P73A 1EL0A 3PO3B 4LFCL 1PZID 3FEWX 4A76A 2EIFA 3EJIA 3AE9B 4LDTB 1XPRA 2BS3B 4DFAA 2GBNA 3AEEB 4R1JA 2JZ3B 5G3LD 4LFAQ 4A3DB 2F0JA 2FUHB 3N52A 2CH4W 5EKLA 1A62A 4KHZA 2RHQB 1ICWA 1WGHA 1OTCA 3DOWA 2KD0A 4G7ZC 1M90C 2O6VB 1KRTA 3NBHB 4G57A 4LF6L 4RGNA 2Y5BB 3PO3G 1SYCA 3STBD 1U9RA 3C2PA 2KDMA 2N78A 2KC2A 1HZ9A 1UZXB 2OTJA 3DCGA 1FNWA 3DHGC 3PF5A 3WAMA 1FO4A 1D4BA 1KC8C 3TMPB 3R2TA 5EPJA 2UUCQ 4PYZA 1X3FA 3GO5A 4DNIA 2GBRA 2A8VA 3KUDB 3VYSA 4CHTB 1JICA 4W9CA 4ZYNA 5FLMH 1DCZA 4BS9A 4P16A 3VVWB 4B0EA 4HDQA 3TS0A 3JAME 3L10B 4DK5A 4HIKA 1WGGA 1Y56A 3HM3A 4A3LG 1N63A 2E5LQ 3PT2B 1L5PA 1HEZE 1WMHB 1HNWL 1SJED 3HVZA 4K6DA 4AQ7A 4W9JA 3DLLA 3DBRB 4DPGA 4NZLB 3SD5A 4K14A 5JHAA 4X3TA 1SNCA 3JAMi 4UDUC 3KJOA 1R4MI 1STAA 3HOYH 3LDZE 4KKIA 1S5ED 1SE4A 2JT4B 1UH6A 3KYDD 3OIQA 4DV3Q 4C1NK 1LT5D 2KN4A 4RF1A 4R4TA 2BH8A 3BZCA 3DPDA 1IYFA 1CA6A 3CCJA 2AQ2B 4M8MA 3V62A 5BMIA 2FJ2A 2PI2E 3I9V1 1K3RA 1PTOB 3Q8CA 1DOKA 4G7HC 3N1YC 5FLXL 2M1MA 3PREA 3ZNHB 1UELA 3JAML 4MJSA 3RUZA 3BYTB 1V5OA 5KNCA 3ZXVA 1KLVA 1SJHD 1SAPA 3NPPA 3H6NA 4C3HG 4NDXA 1FRRA 4POGA 2UXCL 3JVZX 2WV6D 5E7NA 3H0GG 4GGQA 1VQ6A 1VQ8A 1GAQB 1A2TA 4AP4C 3EVQA 4KGTA 4XYCA 2ZXOA 3HKZE 1GB1A 2LUEA 1GM5A 2L0CA 3A0JA 4BBSB 2K6DB 1B50A 3Q3FA 4WJ3M 1K8RB 2PLPA 1JOKA 4A3BB 4LFCQ 5J3BA 2LHEA 1WJJA 3MXGA 3PPAA 4A3FB 4G11A 5D94A 3N20C 1U4MA 3D8GA 4YTPB 3CHBD 4TSSA 2B29A 4AYBE 2WYQA 3ITPA 2IYDB 1KHIA 5CV5A 1KQSA 4UAIA 4BBNC 1II3A 2N8NA 3CRLC 1I6HH 1E3PA 2N49A 3HOYG 1WJ6A 2KJHB 3HK0A 4G50A 4P1BC 1IBXB 4YY3Q 1SGHA 4GN4B 2Z9HA 2V4LA 4OZBA 4HAEA 4XQNA 3KFUA 2F03A 1EF1A 5C0XG 2INDC 1ILQA 2LRUA 4IDIA 4GN3B 4X66L 1GOZA 1HZ5A 4NXML 1EIGA 4Q0FA 3CMAA 3GTLB 1GKHA 4KZCA 3CF5A 4LCDE 4JPSA 3VH3B 3T16A 2ZJPA 4HJ9A 4HPMB 1GUOA 1QE6A 4JI0Q 3A55A 2NBVB 3W5OA 1BOSA 3J80i 1I94Q 2EYJA 1X3EA 3AE3B 2H1EA 4IKGA 3Q2AC 3R2IA 2K32A 1KDBA 1S3OA 1YX5B 4N9F4 3VYRA 5I6YA 4JBWA 2KDBA 4GLVB 1C4PA 2J0KA 4KHPL 4MEMA 5C4XH 4K3CA 1O7IA 2Z4IA 4JBKA 1N61A 3N3KB 2OT2A 2NTSA 2KT7A 2RSUA 4XGAB 3A1QB 2OTLA 3W1YA 3HHMA 2ASBA 2LZ6A 1JCKB 3I55A 1L1OA 3HOXH 4G3XB 2YTVA 1NSNS 3U7DA 4MELA 2PNHA 5JHBA 3BZDB 1DONA 1DZ1A 4M0WA 3E9HA 2BTEA 3AB9A 1WR6E 4REZA 3T1HQ 1TWFH 2BA0A 2WXGA 3DEOA 2UUAQ 4QY7A 1WI5A 1VQMA 1XCTL 3CCLA 1JQYD 2A73B 3T8MA 1AEXA 3RD2A 1SDFA 1B3QA 2UXDQ 3ZW3A 4US8A 3K7UC 3CQZB 2KVMA 3KF6A 2UU7A 1E0ZA 3NS8A 2Q2IA 2ON8A 5BN4A 3RMHA 3G7LA 3MEHA 3PUXA 4DAYA 3H3VI 1BO0A 3RCZA 4DU9A 3G6EA 2IO1B 4CQNA 3HOZG 2LXKA 1JRUA 3STBC 1G8ZD 1Q5WB 3VTWA 5HFYA 1NTGA 1HZCA 1X1MA 2XWJB 1MSGA 2K75A 3A5UA 2DZJA 2NZ1D 4KY6A 2JA8G 1WGYA 3LWEA 1JJ2A 4GKJQ 1A3VA 1JB3A 1KFYB 3K7AB 1PXUA 2BGFA 3TBLD 3VRAB 1E2ZA 5LL6X 3QWNA 1E0BA 4DAPA 1PYWD 2A6HC 2QW7A 2PMVA 5EE1A 1MJCA 1XCQL 4L2YA 2AQ1B 4OONA 3TDQA 1XPUA 4OO1H 1ZOYB 4JK1C 5C4XB 2FMMA 3NJTA 3NOBA 4M1UB 1Q90A 3GTMB 1LLRD 1V1OA 3PLVA 3PCOB 4KV6A 3I4OA 2V1CC 1DOIA 2NVQH 1DGJA 2KOXA 4OZAA 4IQZA 4K8IA 3S16B 2EZVA 1V8QA 3LGJA 3V96A 1UE6A 3B2GA 5J2RA 1NE3A 3EN2A 1WRDB 2KAJA 1Z7TA 3UDIA 4NXMQ 3GV3A 4MM3A 1IBKL 4S0RA 4GB9A 2CQOA 1Q82C 4X66Q 2K5QA 4C3HB 1K8OA 2CJNA 3B0AA 3HM6X 3U4EG 2DWQA 1YNJC 3I4LA 3ZNGC 5DNFA 3A8JE 3I4NB 1D5XC 1ZW7A 3A74A 3AEAB 4NNJB 4IPCA 4X65L 1R4MB 1V2YA 4OIKA 3C3LA 4MIUA 3FKIH 4B3RQ 2WAQB 3DDCB 3OAWA 4R4IA 3M4OB 3GOEA 4J6IA 2JXXA 4XQJA 1YHBA 3ML8A 3VYUA 4B3ML 4FJVB 2ASQA 4JYAL 2GMIC 4K0KL 2JEBI 1G2SA 3S1QB 3T3OA 1VQHA 4HSVA 5LL6S 4WFN3 3KLWA 3H3VC 2XK5A 1GO3E 2DYMA 3I70A 4X65Q 1EWHA 5DPTA 4PG3A 4RMFA 3P4PB 2CU1A 4JE3B 5HY6A 1D1IA 3OWFA 4DUZL 1ENCA 3FDTA 4KD3A 3MP9A 3S1NH 2D3AA 2MBQA 3QX1A 4IUNA 2JP1A 4R4CA 3RPFC 4JI4L 2K01A 2C9OA 4DR3Q 4JV5L 1EYCA 4ANUA 1WCMH 1H9MA 2QSDA 4X3UA 1FNVA 4A90A 1NUCA 4LF7L 4HJAA 2J0TD 2DY8A 4A9AA 1SYDA 1A0IA 4IOAA 2VS1A 1B3AA 2DGYA 1V81A 4MGKE 4ANVA 2KVRA 1ASYA 3PHXB 2HDMA 1PFMA 1EZ6A 3SK5A 4G0NB 4XDXA 2RR9A 3NVVA 4XWWA 2ZEQA 1FFUA 1XLOA 1EY4A 5NUCA 3K80C 3DVNV 4IJHA 3PUVA 1C4QA 2ZJDA 2PNRC 5GMVA 4TQ0A 3SE0A 1LYLA 4MH8A 5H92C 3O13A 1R9TB 4M0WB 1M1KC 3W9CB 3IFDA 4CJ0B 2NN6H 4NY0A 2EJGC 1LTBD 5AUKA 3VA7A 3EECA 2P5ZX 1L2FA 3PIO3 2XIWA 3NP8A 2LVOA 2WDRB 1ZXTA 2QDFA 3HP3A 3CCEA 2RPQA 2IGHA 1STYA 2BYTA 2VY3A 1EM7A 2HD3A 1GJZA 5A35A 2KK8A 4YSYB 1YD8U 1U4AA 2L0TA 3UIPB 4KGSA 1F2LA 4ZRKA 1RHPA 2MO0A 2E2JH 2QHOA 5C2TB 4A6QA 3P1MA 4RGTA 1LM0A 4R8IA 4U68A 4DDGD 3UE0A 2K8BA 1KRSA 3I4NH 3ZRCA 1WFYA 3LB8C 2KHIA 2AKWB 1WX9A 4B9KA 3PSEB 1LQBA 4IWOA 3CRKC 4NXNL 2BWFA 3A7LA 1NJIC 1OEYA 2C5CA 3ZDTA 1DOXA 2BOSA 4EVOA 2JA5B 1LM8B 2W3RA 4ANXA 1FJGL 3RZDH 3RNFC 2UWQA 3MHSD 2PZWA 1K52A 1F52A 3F2DA 1RM6C 1BT0A 3A9JA 4YSZB 2VXWA 1F9JA 3EBEA 5C44H 1KD1C 3WALA 5IKCM 3GTQB 3TP5A 4IFDJ 4WQMA 1RAXA 3DHHC 4BKTA 2M17A 1GUGA 2ZVNA 3H9DA 4YHHQ 3Q8DA 4DK1A 2ZPYA 3KWVA 1IUEA 4LF7Q 3M3YH 3DWPA 3NZ3A 4WJQA 3QOLA 2QMTA 2KENA 3PV0A 4BBRG 2LJ5A 2FE8A 4EQ5A 3EA6A 1G91A 5G2NA 4X3SA 5AJ3Q 1QOGA 3I4MH 2K52A 1C9OA 1AE3A 1X65A 1I4HA 5IYDH 2EYLA 4L1BA 3K5NA 2KX0A 1CKNA 3DEPA 4X6AH 1XMOQ 2Q8IB 2ZVOA 2EE1A 3ENEA 1MIUA 1AH9A 1Z5SB 1JJCB 1UD7A 2G45B 4C1NI 2C5LC 5M5YB 2JSVX 4MT5A 1WYWB 3TREA 3AEVA 3IBEA 2L52A 2I5HA 1IYVA 2IX0A 4DV7Q 3MFYA 4HMIA 2LASA 3EFUA 3MXPA 2K6QA 2X69A 1X9NA 1ISNA 4DR4L 4W9LA 4EFOA 4LLGM 3P4RB 2KWDA 1E7ZA 2K33A 3ABVB 1X54A 5KIXA 3PQIA 1TIFA 1XF5L 3TQYA 3VYTA 3S2HH 1L4ZB 1UWMA 1PFNA 1B9MA 4GOPA 1WTWA 4B3TQ 4BA2I 5TR5A 4A3KB 2D11A 1TZ1A 1U4RA 3H0GB 3N1XC 4FP5D 4YXDB 5BN5A 2EYPA 1WY8A 5LMNQ 4K2LA 3K9OB 3RD4A 4DR4Q 1JB7A 1O7LA 3E3XA 3KLSX 3KW5B 3S1MH 3T4AC 2HDEA 2HCCA 1FGUA 2F0OA 3AQQA 1HA5A 4XTCS 3N30A 4PS7A 4XIGS 1I7HA 2LMCA 4MGYE 4RF0A 4UP9A 3E0JA 2A5HA 3WDNA 2W9NA 1T3QA 2Z0SA 3KDFB 3IL8A 1N33Q 1EWYC 1GG3A 2WWZA 2MPMA 1U0LA 4LF8Q 2OF1A 3PIPA 5ELNA 3R93A 2BWES 1TY2A 1VR9A 2DJGC 2K39A 4PYUA 2KOLA 3Q23A 1KABA 4ZHPA 2AHOB 4A93B 3W5UB 3KUZA 1ET6A 4A8XC 1PRTF 1ZEQX 2WGSA 1NY4A 4A3MG 2KXJA 3PMFA 4C3JG 1NI2A 4HROA 4F87A 3ZXRA 5EPLA 5G5GA 4KD4A 3PIP3 1ZPSA 2LXAA 2UYZB 3BK2A 2FIFA 1BBUA 3G6JB 2F0EA 3IHPC 4A3MB 4U673 4FF4A 3HOVH 1Q0WB 1WYDA 2IY5B 2MA9B 1Q12A 1VQKA 2VL6A 4KIKB 3UF8A 3E9SA 4XXEA 2ZJRA 1S72A 4UP8A 4N58A 3ONAB 4AUQC 1IL8A 3FHWA 2O2LD 1HZ6A 2PVOD 2N88A 3NXWA 2I2YA 1XNRQ 1NYQA 4HDOA 1B9RA 2R93H 2XRSD 3APFA 3FPPA 1TS2A
chains in the Genus database with same CATH topology
1TVXA 1I4PA 1FD7D 1W6JA 1TWCB 1D5ZC 1V43A 3FAHA 1BQQT 1RKNA 2A6EC 1BF4A 1O78A 3AH7A 3CKIB 3M3YB 1ZDXA 4TQUS 2N0SB 1I4QA 5H8YE 3AMUA 2PO4A 3D3RA 1IKMA 4HKQA 4ITKA 1GUWA 3S2HB 1ZYRC 4N59A 2R92B 3S15B 1U4LA 2HTME 4Q2JA 5JXVA 1RTOA 2FBWB 3MVVA 2F0KA 3IFTA 1UNSA 2HDLA 5D3DA 3EFXD 3CIRB 2B2YA 2MUYA 1TZOA 5DM63 3A8KE 1QOBA 2QF7A 5C4JB 2F0MA 5JEAJ 4EGVA 1T5EA 2MGSA 4ID6A 2O5IC 3HUIA 1EZ8A 1ACCA 3KLSA 4MM3B 5JVH3 1X32A 3BVMA 4WRDA 2X6LA 2EY6A 3MHBA 4I65A 3MWYW 4K5WA 1GJXA 1H9SB 1LTTD 3KF8A 3IAS1 2KMMA 2EYFA 1ZKOA 3T3NA 2JYOA 4WWMA 2ZW1A 1E6EB 4KN7C 3SR6A 1SE2A 2RQXA 2JZPA 1TWHB 1DD2A 1G2TA 1DYQA 2QIEB 1L4DB 4PMBA 1SNQA 1F2RI 1MVKA 3M7NA 3VR9B 5E4XA 1NCVA 3QG1A 1YN4A 1AYFA 2AUJD 2KUMA 2Y3AA 5D3IB 2DNEA 3N9YC 1VLBA 3TP8A 1X3QA 1A6XA 4ZRQA 5IGFA 5C5LA 4C2MB 1BCPC 5E1FA 1QG7A 2PQEA 2W54A 1BCPF 1S4ZA 3SHLA 3Q8FA 3IT6B 2A69C 2VB2X 3TUOA 3P63A 3D6WA 2X6GA 3BK1A 4ZRZA 2ZW0A 1MD2D 2B2UA 3VR3A 5C4ZA 4B9XA 1JE4A 5AUIA 1EEID 1VF7A 3KUPA 3DWMA 4HJGE 5D65A 3SVMA 1E9MA 1RTNA 1EWCA 2KEDA 1XXGA 5C0XH 2OEDA 1C4CA 1I4GA 1IW7D 5IOCA 2Y0SB 4ZUJA 3NRZA 1CTMA 2F0VA 2PW7A 2JEAI 3M7GA 3VR8B 3LYYA 3NSWA 1L0XB 1ZDVA 2INNE 2F0UA 5C3JB 1HRJA 4K2KA 4RHRA 1CZGA 2V3PA 3AE7B 2F0NA 1CQVA 4Y7NB 2WXHA 3RZOB 3P4QB 3A7AB 2KJXA 4ARCA 1FXIA 1O80A 3AEFB 2AWNA 3OIPA 2G1EA 5ELBA 2NTTA 3AEBB 2W3SA 1IKLA 1EY9A 1JWUD 5F2DA 2KQ4X 4LJZC 5I2XA 2WXPA 2KA7A 5ELFA 5BMHA 2D2CC 1IW7C 2G9HD 1STNA 1SYBA 4NKLA 2IL8A 3DWGC 3WOEA 4A55A 1C48A 4IUVA 3TSSA 2CQAA 3I4MB 2XWBB 1CA5A 1FR3A 2J53A 3K58A 3UI2A 1JQ4A 2WIIB 2LY7A 4BBRB 4DF7A 2GI9A 3QIAA 1BUIC 2LFNA 3OHXC 3DHQA 3U9OA 1R4QB 5C4HA 2B2VC 4KJOA 5IGCA 1JRPA 3NWTA 1B9NA 1RWSA 3WOFA 3OPOA 1QJOA 4YSXB 5HURA 1F9SA 2GA4B 4IOIE 1QB5D 2RSOA 1MI2A 2ICEC 1SNOA 4DAVA 2BS4B 2LGIA 1J7BA 3FILB 3MHZA 1WD0A 3S1NB 2B2WC 2FMCA 5CR3A 1OXTA 2SAKA 1SEBD 2BT6A 3IKJA 5JEAG 4OW0A 3FC4A 3HS0C 1AFPA 2L1AA 2LMCB 2WS3B 1N5XA 2PCFB 2JQRB 1OXUA 3NBIA 5MPOA 1VRAB 4BA1I 1XLQA 1EY7A 1SF0A 2KEEA 4C7ZA 2L5TA 1WTVA 1HPCA 4IFDG 3PZ7A 3ND8A 1CI3M 4CKCA 1E2VA 3BDOA 4MN3A 1ESFA 3HOVB 5E6JA 3TZUA 1TIID 5C0XJ 4OHJA 2PKOA 5I6WA 4EE2A 5CV4A 4IFDH 5IGEA 5K36G 4NAMA 1OFFA 2E3TA 1HCZA 4F8MA 4IUQA 3HG9A 4OIJA 5FK9C 4JWSC 1STHA 3A8IE 4QUFA 2INPE 2O5JC 3A56A 1JC7A 4C3IG 5K36H 5JJZA 2AQ3B 4O1NA 1SSOA 2PW9A 1HFNA 1L6VA 4PMCA 4L23A 4IFDI 2Y5CA 2D62A 5CV8A 1F2YA 3SEBA 3HVDA 4K6LA 1WTPA 3H91A 2CW0C 4HRSA 1GXDC 1EU4A 1AWDA 2WU5B 3B9JA 3EQLC 5CV9A 2J52A 2XN9C 2F0WA 4BY1B 1JWMD 1FXAA 3GV6A 4V190 4NW2A 2BBCA 3F2UA 2RDFA 4HTHA 1Q8IA 1I6VC 3MZ5A 1PMRA 2B2TC 4A3GB 2E76C 1PUTA 4B9WA 2BB6A 4CGYB 2IX3A 4USAA 1VMCA 1A70A 2KCCA 1QOAA 1Z6HA 2JSOA 4XYOA 2PPBC 3NVZA 3L4PA 2F0PA 2BCOA 1JWAD 2M56B 4IZ8A 1EQTA 1XX8A 3VA5A 5FO9B 4WJWA 3KQ4A 2LJIA 1V1PB 5JAVA 1CQFA 2FINB 4PNYA 4RNAA 1A3UA 1EFID 2NUCA 1DOLA 1F2MA 3TP7A 2KCNA 4RAUC 2RMMA 5EQ0A 2B2VA 5JVG3 4RGMA 1QF6A 1IGDA 1V1PA 2DY7A 1QQRA 2BW2A 1JORA 3D4RA 3S1RB 5FLXE 3I57A 1QT9A 3Q8EA 2BS2B 2J4XA 1A15A 2DNCA 2K1BA 4ZHOA 2AUKA 1JOQA 3J81E 3HOUB 4ARIA 1K83B 2B2TA 2I46A 2WDQB 2NVXB 2J7ZA 2OXPA 3OSOA 2M0AA 2B8GA 4FXDA 3SR1A 1Q10A 1Q1BA 3AN1A 1WVLA 1S5CD 5T8IA 1PRTC 3HZXA 2KECA 1CZWA 3MXNA 2OHFA 1SNMA 2LEKA 4YTMB 1D2BA 1HTLD 4NP5A 1UEAB 5M9OA 2D5GA 2W55A 2MEKA 4QMGA 2F0HA 5C6AA 1IBXA 4A3JB 2B8FA 4RCOA 5IGBA 2NVQB 3T53B 5IGGA 2WKCA 1QLBB 4Z9CB 5JEAH 3HOYB 4KY5A 1KTKA 3ZJTA 4GDKB 2L55A 5C5MA 4X3KA 2E2IB 3PO2B 1EQVA 5JPNC 3RFZB 4XE0A 4P2CB 4ULLA 1CM9A 5A2QE 3SK6A 5JPMC 1VZ8A 1AW7A 1I3QB 1STBA 1L6UA 1D6EC 3J80E 5DAUA 3KBGA 2I38A 2E2JB 5HI1A 3GTGB 1FCCC 3P42A 3E6ZX 1IHZA 4IUUA 5IT9E 1WSPA 5G5HA 5I2YA 3K5LA 2F0LA 2CJOA 3J7YW 1YJJA 1GUNA 2Y5PA 3TEWA 4I7ZC 3GTPB 5IGDA 1ENAA 5CYUA 2JWUA 1QILA 4BWGB 2NB0A 5CGKA 2YEPB 2ZXPA 2DN8A 1PZKD 2A74C 1O7ZA 4M8AA 4E6IA 2SNSA 2MHVA 2MH7A 3EROA 1JROA 4TQ1A 5FR3A 4ZK9B 4WH4A 2L4NA 2XRQD 3NK9A 1NR4A 2ACZB 4HEA1 1FEHA 3NQIA 2K3UA 4IURA 4L6TB 2K0PA 3BDLA 1RJTA 4GLSC 3OMCA 1ZP0B 5A2QL 1ONLA 1F9RA 1HFGA 3TP6A 1DOMA 1HHVA 3VRBB 3P75A 3BDCA 1LTGD 3WCQA 4TKOB 2NWGA 1B2TA 2NN6G 3S2DB 1AN8A 1SBBB 2WP8J 3ZQ4A 3K59A 3ZJVA 1LTID 1F0ZA 4RH6A 1QNKA 4L63B 3SK8A 5EKKA 2V4IB 2IJ0A 4MACA 1CHPD 2OEOA 1TR5A 2K7VA 3R8BA 3RZDB 1TWAB 1C4AA 3U7ZA 2VNUD 1YNTE 4ZKBB 4FVMA 4ZQ3A 3HOXB 1JR0D 1X3PA 1JW9D 5ELEA 1CFMA 2NBFA 3ZYYX 1JWSD 3Q0AA 1ZXHA 4HR7B 5CMDA 5FO8B 2XNAC 1UWXA 2JXTA 3QB3A 2IW3A 1WTRA 4KMUC 4ABNA 4RGOS 1EY6A 2RDHA 2F0DA 2MJ3A 2A68D 1TWGB 1P7FA 1F9PA 1EIHA 1Y8PB 3L9AX 2V0GA 4HKZE 1SYEA 3P7JA 1R7SA 2WDVB 2A6HD 4OZCA 5J1ZA 1CZPA 2YEPF 4YT0B 3EGRA 4OO1G 2JA7B 2NN6I 5E4WC 1FIQA 4KKJA 5C3EB 3FKIB 1K51A 1HQRD 5EKIA 5J22A 2F3WA 2EYHA 1DXMA 4ZYSA 2BDOA 5EBCA 4FF1A 3HOWB 1N60A 2K5WA 1KDAA 1EY5A 1ESRA 5FKAC 1QKZA 2CHBD 4KY7A 4F88A 1LACA 1PTOF 5FO7B 3GTKB 1J9OA 5C0XI 1KH0A 4AS1A 5K5PA 1BR9A 3GB1A 2R93B 1P7EA 3HRDD 3HRZC 2TSSA 3VQIA 3U2SC 2Q8TA 1L0YB 4H0LC 5J39A 3H6MA 5HHDG 2AWOA 3U52E 3QO2A 2WXNA 1EOTA 2B76B 1VJKA 1STEA 2AX5A 2EYMA 4K5VA 3CWIA 4QIWB 3TBIB 5BYQA 1L0VB 2PW5A 1Y69U 4DNRB 2YU9B 1WCMB 4N6EB 3QOJA 2K5DA 3IT4B 2QDBA 2YYZA 3NTIA 1PTOC 3TZDA 4H2AA 2PIAA 3NTHA 2B2WA 4C3JB 2VB3X 1W6KA 2HUGA 1FGBD 4KKTA 3AV8A 1CHQD 1LT4D 3J80L 4ZUIA 1QOHA 2L9HA 2F0SA 1N62A 2BE5D 2H4OA 1FD6A 1WTXA 4A3EB 2DLBA 3VR2A 2EJMA 4XQQA 3E5SA 2EJFC 2BA1A 3H94A 1SXTA 2X38A 4L8JA 2HCIA 3D4DA 1WWTA 5DEHA 4F7XA 2QCPX 5AFWA 4DN4M 1DJRD 5LNK1 4HMJA 1FYCA 2SEBD 3I73A 5EE9A 3AEGB 1VCIA 5M3MB 4G7OC 2Q5WD 1TT2A 2DYOA 2RDGA 2ZT9C 4H7BA 2L12A 1B1ZA 1HUMA 4J6HA 2RBMA 2JX5A 2IDYA 3P4SB 3Q69A 5LHY1 1TY0A 2M00A 3LXFA 5CV7A 3IXSA 1K8MA 2O4XA 3HOZB 1YQ4B 5ELCA 2DBYA 1YNJD 3D4WA 3W2DA 2EY2A 4RFBA 1S5BD 1C77A 2SDFA 1V97A 3MXUA 1B4OA 4CJ1B 3AE2B 1KAAA 2WXOA 3I8ZA 2IWHA 2ENBA 3C1FA 1OQRA 1K53A 4BY7B 4US9A 3GS2A 1TJEA 3DWQA 2RKSA 4KGRA 5KNBA 1XTCD 1PZJD 2ICIA 2PMZB 3T13A 5HGTA 1G291 1YN5A 3DMUA 2B63B 1I4RA 1PDXA 3AB5A 4PMWA 2JXMB 5IT9L 3DUZA 2QEJC 3BG3A 2RPVA 2LS01 1YMHE 5KYIA 3NVYA 1SNPA 3TN2A 1ML0D 2M9VA 3T51B 3NUHB 1CJEA 4DA2A 3P20A 3TMEA 1VDZA 1MSHA 3K0YA 1AP0A 1PGAA 1LV9A 1VF5C 2BDNA 2MP1A 1EEFD 2PZUA 3GTJB 3VR6A 1JALA 3J9CA 4PQXA 1QOFA 5ELDA 1YJIA 4JX1C 1J8IA 3OWEB 4XT3B 4IALA 4NAWB 5JOBA 3J7AV 3OMGA 1NVID 1LTAD 1HXYD 1XWEA 4FNFA 1EY8A 2G9DA 4LK1C 1EYAA 1SMYD 4NMZA 5TSSA 4HSPA 2JE6I 4N9TA 2CVRA 1HQMC 3S9WA 2WNMA 2XVSA 3QJYA 3I90A 4XDDA 2WXFA 1Q1EA 1BCPB 4XWTA 4P6VF 5CBAE 1F77A 1OXSC 3W1SA 1BXTA 1D1KA 3KLRA 3TEXA 4LK0M 2A69D 5C44B 1T6BX 4R9WA 1OXVA 3I3CA 5KYLA 2WQYB 4C3IB 3UI3A 4J8QA 3W5VB 3NTKA 1G6ZA 2QJLA 2PZTA 5M5XB 2WB1B 1Z47A 1LT3D 2L32A 3U9SA 2E2HB 1ZUD2 5COYA 3D6CA 2K05A 2K28A 1H9RA 3MA2B 1MHXA 3AMZA 2ONQA 1Y1VB 2F0IA 1FFVA 3NUCA 2Z8LA 5DM73 2EELA 3V05A 4B08A 4FXKC 1XYIA 1NAPA 3IAYA 3MC0B 3W3AA 4B0MA 1RODA 5C3XA 1LTRD 2F0TA 2KACA 3HGBA 3S17B 4QF4A 2WINB 1SFOB 2H88B 4GDLB 4AYBB 1A3TA 4WAFA 3FPUB 1RDPD 4O42A 2MJDA 3GP7A 1A2UA 4K8JA 1J7CA 1V8CA 2GRIA 2QKIC 5D7GA 4FXGC 2R7ZB 1BUVT 3PUZA 3AECB 3URYA 3M85A 2JYTA 3C1EA 4IUTA 1E2WA 4KKUA 4TMAB 3K5MA 5EE3A 5GXGB 1LTSD 2K04A 1HUNA 1TKYA 4JWUC 3AE5B 1F9QA 3P1HA 2IGGA 1ZYRD 5T1IA 1UGJA 3AE4B 3MJ5A 1MBYA 4K5XA 4KJNA 2IGDA 1H9SA 1YQ3B 3ZJUA 2E74C 1J7AA 1NEKB 1B53A 2A6ED 3AM9A 2EXZA 2M19A 2CU3A 4ODGA 3Q6SA 3V2TA 3H8HA 4FF2A 4CKBA 4KI0A 1U4PA 3D31A 2Q8RE 1Y8OB 4KKSA 2FFKB 1GB4A 1GHJA 1KLUD 1PTOH 5EBDA 1VMPA 2J42A 4MHEA 2EY1A 1MHHE 3MFGA 1XLPA 1GUSA 3BYYB 4ILWA 2ID0A 1DM0B 2BB5A 1XLNA 4XYQA 3BIID 2KQ3A 1PRTB 4H13C 3N6RA 2K22A 5ISRA 1PFBA 5I4DA 3KBXA 2F3VA 2WU2B 1QWYA 1MPEA 2F1MA 3C46A 1TS5A 1YNND 3BWUD 2VUMB 3NQTA 2VZKB 1TWFB 1TQOA 2K6AA 2N9LA 1JMLA 1SYGA 3TEYA 1FM0D 2KHSA 1OO9B 2WXLA 5BMGA 2L11A 1KF6B 1RYJA 1ENFA 1SYFA 2EPBA 3HKZB 4CKEA 4FYDA 1QCBD 4ZOHC 1QNUA 3NBHA 1NYRA 3LNNA 2WLBA 2MJEA 1Y8NB 2EVBA 1ET9A 2K03A 4A3IB 3Q8BA 3A54A 3KWLA 1EY0A 2BE5C 2IT1A 2EDGA 2PTLA 2E6XA 5E3FA 1RF2D 4H44C 4R8NA 1C79A 1N5WA 2CW0D 3TEZA 2L83A 3MTSA 1HA6A 4HEDA 3NE5B 1WTQA 1WXQA 1I6HB 2EYOA 3EUB2 2LHDA 2W82A 2B2YC 2V4DA 4RKLA 1WTOA 4OO1I 2ZXRA 1T5XD 4HCSA 2H89B 3K57A 5BYRA 2MJ8A 5C3WA 1SIJA 1IYUA 1WGKA 3K5OA 4DXGA 1AZPA 1C78A 2EKIA 3L3OC 4DXFA 2NMQA 4LAAA 1KRHA 3AU7A 2N55A 2F0FA 3J81L 1RCVD 3Q8AA 4DGZA 1JOOA 3GQBA 5CV6A 5CORA 3V3XA 3S1MB 2WKDA 1ZE3D 2WP9B 2IX1A 3PO0A 1MGSA 3FMCA 3MAQA 3LX0A 5M3FB 1RFKA 2VZKD 1OQQA 4DNTB 3OW7A 3NHHA 1BMLC 1TKEA 5FOBB 5HG2A 1KDCA 2HQEA 1LT6D 3R3OA 4EQOA 1VZ7A 2L1BA 2K5PA 4PT5A 1BNZA 2N9KA 3I91A 4KN4C 1IGCA 1PRTD 4KTAA 2JA6B 1TS4A 4DK0A 3K6OA 3GTOB 1C76A 4C7YA 1FCLA 2NVYB 4S3SA 3BVZA 5IIFA 3OOCA 1NI3A 1TU2B 1TYGB 3L7ZC 3E56A 4N9PA 1PFDA 2D5DA 2SOBA 3NWSA 2JU6X 3SFDB 4GZYC 5KNDA 2E2DC 5I9OA 4FF3A 1BDOA 2WACA 2WXMA 1B44D 2EY5A 4OVZA 3FVQA 3AE1B 2WXKA 2Z1CA 2D9UA 1F2RC 4C56C 1Q3LA 1AZQA 4QB4A 4RA8A 1WRIA 4PV1C 4KHVA 1K50A 2RSNA 3LWUA 4DQOC 4C80A 1LO5D 3CU7A 4LTUA 2NVTB 1M4VA 1PLFA 1TKWB 4V0BA 2NYZD 2R6GA 3AEDB 1RD9D 2B39A 5CC4A 3PUWA 2K9XA 3ZGZA 2JYEA 1D5MC 3SFEB 4YWGG 1TKGA 2GB1A 3FILA 1SNDA 3HEJA 4NJCA 4HCEA 4J3OD 3I72A 1GHKA 4WORA 2F0GA 1EYDA 1S5FD 1VDVA 3B2FA 3GD7A 1SSNA 3H09A 4RHSA 1STGA 2PYKA 1C8CA 2JA8B 3NS1A 1KNAA 1PTOD 2R61A 2E75C 3X3MA 5EE0A 1DOYA 3T56B 4QCLA 2SNMA 4IN3A 1BBXC 1KLGD 1LABA 2TMPA 1NR2A 3Q24A 4FXCA 3Q22A 2PVGC 2WXIA 4ZLTF 3ERQA 2QILA 4Q5VA 4RWSC 4CJ2C 3NVWA 1WD1A 4CBVA 4FO2A 2WXJA 2WXQA 1HTPA 4ME5A 1ROEA 2LUMA 4HN7A 5D14A 3FRPB 5I9PA 4QUCA 3AE6B 4KK7A 1M8AA 5CBEE 2FUG1 4EQPA 5M5WB 1EU3A 5BYSA 1BCPD 5BN3A 5T1GA 4YTNB 3X3NA 3SDZA 1H9JA 4LMQD 1YNNC 2R3ZA 1PGBA 3VR5A 1SB3C 1FMAD 2V3NA 3BVGA 2IPKD 3J7AF 1XEEA 1PGXA 1FRDA 2N7JA 1O7YA 4XT1B 3ND9A 4RCNA 2XSCA 1UUPA 4OL7A 1MI0A 2WXRA 3DWAA 4EQNA 3IAM1 4WURA 1SMYC 1PDQA 1JWBD 2F0QA 5G3LF 4XDCA 2A68C 1S5DD 1KNEA 4J1MA 4OGQC 1I50B 3BS1A 3SXHA 1R4PB 3DM1A 3VR4A 4IUPA 1CT1D 1CK1A 5EPKA 1GPXA 3PZ8A 1NENB 1Y1WB 1ZXIA 1I4XA 2B2UC 1XO3A 4R3DA 4YIJA 1E7PB 4G4KA 2FHTA 2RVLA 1F2ZA 5KGUA 3C8YA 4ZRPA 3PUYA 1VZ6A 2RA4A 4RKBA 5EJWA 1YN3A 4D2KA 3KK7A 1ILPA 2F4IA 1FNUA 1GUTA 2EOTA 3RLFA 4ZAIA 1TS3A 2LKVA 5IODA 1WYGA 3DXJC 2LFIA 1E10A 5EGTA 4ZKCB 3SK4A 1H9KA 2I07B 4TRDA 1SE3A 3M4YA 3AE8B 3S14B 1UAPA 5KEEA 2M2LA 2Z4HA 1OXXK 5KRUA 3ETRA 1EL0A 3PO3B 1PZID 3FEWX 3AE9B 3EJIA 2BS3B 4DFAA 3AEEB 5G3LD 4A3DB 2F0JA 3N52A 5EKLA 4KHZA 1ICWA 4G7ZC 4G57A 4RGNA 1SYCA 1U9RA 3C2PA 2KDMA 1FNWA 1D4BA 1FO4A 3R2TA 5EPJA 3GO5A 3VYSA 4CHTB 1JICA 1DCZA 4BS9A 4P16A 4B0EA 3JAME 1Y56A 1N63A 1L5PA 1HEZE 1SJED 3HVZA 4K6DA 4AQ7A 4NZLB 4K14A 4X3TA 1SNCA 4KKIA 4UDUC 1STAA 1S5ED 1SE4A 3OIQA 4C1NK 1LT5D 2KN4A 4RF1A 1CA6A 2AQ2B 5BMIA 2FJ2A 3I9V1 1PTOB 3Q8CA 1DOKA 4G7HC 5FLXL 3JAML 3RUZA 3BYTB 5KNCA 1SJHD 1SAPA 3NPPA 4C3HG 4NDXA 1FRRA 2WV6D 1GAQB 1A2TA 3EVQA 4KGTA 2ZXOA 1GB1A 2L0CA 4BBSB 1B50A 2PLPA 1JOKA 4A3BB 2LHEA 3MXGA 4A3FB 1U4MA 3D8GA 4YTPB 3CHBD 4TSSA 3ITPA 5CV5A 4UAIA 1C9FA 1II3A 3CRLC 1IBXB 4OZBA 4HAEA 4XQNA 2F03A 5C0XG 1ILQA 4IDIA 1GOZA 1HZ5A 1EIGA 4Q0FA 3GTLB 4JPSA 3T16A 1GUOA 1QE6A 3A55A 1BOSA 3AE3B 2EYJA 4IKGA 2H1EA 3R2IA 2K32A 1KDBA 3VYRA 5I6YA 4JBWA 1C4PA 2Z4IA 1N61A 2OT2A 2NTSA 1JCKB 1NSNS 3BZDB 1DONA 1DZ1A 4M0WA 2BTEA 3AB9A 4REZA 2BA0A 2WXGA 3DEOA 1XCTL 1JQYD 2A73B 1AEXA 1SDFA 4US8A 3CQZB 2KVMA 1E0ZA 2ON8A 5BN4A 3RMHA 3G7LA 3MEHA 3PUXA 4DAYA 1BO0A 4DU9A 4CQNA 1G8ZD 5HFYA 2XWJB 1MSGA 2NZ1D 4KY6A 3LWEA 1A3VA 1JB3A 1KFYB 3K7AB 1PXUA 3VRAB 1E2ZA 5LL6X 3QWNA 1E0BA 4DAPA 1PYWD 2A6HC 2PMVA 5EE1A 1XCQL 4L2YA 2AQ1B 3TDQA 4OO1H 1ZOYB 4JK1C 5C4XB 2FMMA 4M1UB 1Q90A 3GTMB 1LLRD 1V1OA 4KV6A 1DOIA 1DGJA 4OZAA 4IQZA 4K8IA 3S16B 2EZVA 1V8QA 3B2GA 3V96A 2KAJA 1Z7TA 3GV3A 1K8OA 3U4EG 2K5QA 4C3HB 2CJNA 2DWQA 1YNJC 3I4LA 5DNFA 3A8JE 3I4NB 1D5XC 3AEAB 4OIKA 3C3LA 4MIUA 2WAQB 3M4OB 4XQJA 3VYUA 2JEBI 1G2SA 3S1QB 3T3OA 4HSVA 5LL6S 4WFN3 3H3VC 2DYMA 3I70A 1EWHA 4JE3B 3P4PB 1D1IA 3OWFA 1ENCA 3FDTA 4KD3A 3MP9A 4IUNA 2JP1A 3RPFC 2K01A 2C9OA 1EYCA 1H9MA 2QSDA 4X3UA 1FNVA 4A90A 1NUCA 2J0TD 2DY8A 4A9AA 1SYDA 1B3AA 2HDMA 1PFMA 1EZ6A 3SK5A 4XDXA 3NVVA 4XWWA 1FFUA 1XLOA 1EY4A 5NUCA 3PUVA 1C4QA 2PNRC 4TQ0A 3SE0A 4MH8A 5H92C 3O13A 1R9TB 3W9CB 3IFDA 4CJ0B 2NN6H 2EJGC 1LTBD 5AUKA 3VA7A 3PIO3 2XIWA 3NP8A 2WDRB 1ZXTA 3HP3A 2IGHA 1STYA 2BYTA 1EM7A 5A35A 4YSYB 4KGSA 1F2LA 1RHPA 5C2TB 4A6QA 3P1MA 4RGTA 4R8IA 4U68A 3LB8C 3CRKC 3A7LA 2C5CA 1DOXA 2BOSA 4EVOA 2JA5B 2W3RA 2PZWA 1K52A 1RM6C 4YSZB 2VXWA 3GTQB 3TP5A 4IFDJ 4WQMA 1GUGA 4DK1A 3KWVA 1IUEA 3DWPA 3NZ3A 3QOLA 2QMTA 3PV0A 2FE8A 1G91A 3EA6A 4X3SA 1QOGA 1I4HA 2EYLA 4L1BA 3K5NA 3DEPA 2Q8IB 2EE1A 4C1NI 5M5YB 2JSVX 4MT5A 2L52A 1IYVA 2IX0A 3MFYA 4HMIA 3MXPA 2X69A 4LLGM 3P4RB 2KWDA 2K33A 3ABVB 5KIXA 1XF5L 3VYTA 1L4ZB 1UWMA 1PFNA 1B9MA 1WTWA 4BA2I 4A3KB 1U4RA 3H0GB 4YXDB 4FP5D 5BN5A 2EYPA 4K2LA