2G9IA

Crystal structure of homolog of f420-0:gamma-glutamyl ligase from archaeoglobus fulgidus reveals a novel fold.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
249
structure length
233
Chain Sequence
MRVEVFPVEGLPLIKEGDDLAELISSRVRFEDGDVLVVCSTVISKAEGRIRRLEEFNPSERAKEIAARIGKPAEFVQAVLEESEEVLLDFPFLLVKAKFGNVCVNAGIDASNVEEGSLLLPPLDPDGSAEKLRRRILELTGKRVGVIITDTNGRCFRRGVVGFAIGISGVKAMKDWVTVECVADEIAAFANLLMGGIPAVVVRGLNVAGEGSMEEIYRSEEEDVIRRCLKRCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an amide bond forming F(420):gamma-glutamyl ligase from Archaeoglobus fulgidus -- a member of a new family of non-ribosomal peptide synthases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ligase
molecule keywords F420-0:gamma-glutamyl ligase
total genus 61
structure length 233
sequence length 249
chains with identical sequence B
ec nomenclature ec 6.3.2.31: Coenzyme F420-0:L-glutamate ligase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01996 F420_ligase F420-0:Gamma-glutamyl ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.100 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; CofE-like 2g9iA01
3.90.1660.10 Alpha Beta Alpha-Beta Complex CofE-like fold CofE-like domain 2g9iA02
2PHNA 2G9IA
chains in the Genus database with same CATH superfamily
3ZOPA 4TV9A 4ZI7A 3NK6A 2HP3A 3FFMA 3CCSF 4I55B 3C9RA 1SA0B 1U43A 3S0WA 5BMVB 2UYKA 4I4TA 3MBMA 5HWEA 5J2TB 3DDNA 4O4HA 1VQ9F 1H47A 3SIVA 3HKBA 5EWRA 1NJIH 2Z1UA 2GVIA 3KHNA 4I50B 3KE1A 3CCLF 1U3LA 2CZWA 5JH7A 1IV2A 3OBYA 2AMTA 3L7QA 4RHAA 1SZQA 3WGLA 5FLXM 4BVQA 3CC2F 2DYYA 5CA0A 3PAFA 3SIUA 2VAWA 3D01A 5JVDA 4YJ3A 4EB6B 5CB4B 2CVLA 1UI9A 2MQEA 2QEXF 4BY9D 3I55F 3B6NA 5GONA 1T0KB 3HTNA 1W55A 5IJ0A 2BTUA 2HS4A 3LYBA 5LA6B 4O2BA 4BT5A 4C8GA 5MN6A 1JFFB 3T80A 3CYPB 1CK2A 4X3LA 4C4WC 3JASB 4LNUA 4BT7A 1CLIA 3F0FA 5EO3A 3E20B 3TD5A 2VAMA 1RQ7A 3JCMM 4XCQA 1N8RH 1S72F 1Q86H 3ON1A 1GO0A 4O4JB 1YIJF 3VO8A 5CA1A 1JY8A 2R751 5HY4A 3M4SA 2N48A 4YJ2A 1OAPA 2Z1EA 3LDTA 3ZP4A 1W41A 1W57A 1VQ5F 2H8CA 3DC2A 5JCOA 1ZWZA 5GANK 3F6MA 3LFOA 1W5AA 1QVFF 4G4XA 1K9MH 1XBIA 3RYHA 1H48A 4F6RB 5LP6C 1VH8A 4G4WA 3LWPC 4ZHWA 1XHOA 3JAWA 1YJ9F 2B33A 3WPXA 4O4HB 4ZHQA 3N2GB 1YJNF 1U40A 1VK3A 3I7TA 3QUWA 1VQ6F 3CG6A 5J2UB 4TUYA 4U39A 3ELCA 3GYQA 2LBXA 3KJJA 3WGMA 4C81A 5HXUA 3RYFB 4EI9A 2L26A 3E22B 4NUTA 5EYPA 1Z5VA 4B46A 3C9TA 5KX5A 1SDSA 1RA4A 5JVDB 1TUBB 5GIPC 3BYQA 4X1IB 3AGKA 3VI6A 1W5EA 3OW2F 5LYJB 1FNKA 2BTQB 1Q81H 2V9YA 1J7HA 3LWVC 3CCQF 2VXYA 4FFBA 1UFYA 2KTUA 3K14A 1VQ4F 1VQOF 4O2BB 3HKDB 3RA5A 1M1KH 5IT9M 5BMVA 2Z1FA 5GIOC 3MDOA 1VQ8F 1FFXA 5EZYB 1GO1A 1GX1A 4LCKA 3G6EF 5HY2A 4EI8A 1X25A 4I50A 3UT5A 3IR9A 3G4SF 3JAKB 5G4UC 2AIZP 5IJ9B 2OTJF 3V7QA 2FC3A 3HKCA 2QA4F 1Q8RA 4O2AA 3F0GA 2CW4A 4HNAB 3LMEA 3CXCF 3C9SA 3JATA 2OTLF 1T0AA 5FNVA 2VGMA 4ZHQB 2BTOA 4I55A 4B5CA 4EI7A 2KG4A 4X1YB 3IKEA 2VGNA 3VOAA 1U3PA 2JNBA 5LP6B 3CCMF 5J2TA 1ODEA 3JASA 1QU9A 3CCEF 2K1SA 4TUYB 3LWOC 2RHLA 2HRYA 2ZVYA 4C8IA 1R1MA 3RA6A 4C8EA 2Z1TA 2OTMA 3P10A 5EIBC 5HY0A 4O4LA 3RYIB 4TV8A 5KX5B 3RYCB 4X3MA 1OFUA 3N2KB 4IHJA 1IV4A 3S02A 2UYNA 3Q8HA 3IKFA 1W5BA 5JQGA 2BO1A 4ZOLB 1YHQF 4ZI7B 3MCAB 3VYTC 3JALA 3K2XA 4PWTA 1JD1A 4G4YA 5ITZA 1FSZA 3K12A 1JN1A 3HKEB 3CCJF 4O4IA 3WXMB 2F9ZC 3GHZA 3S0HA 5HY1A 2ZF8A 2CWJA 3FD6A 1NMUB 4TZZA 1XV2A 5LOVA 1KNJA 1TUBA 2ZOVA 1NQ3A 4U3JB 5C8YB 1YGYA 1W581 2HX0A 2NMUA 1W2BF 4X1KB 2P6YA 3ERNA 4BT6A 4BT4A 3IEWA 3QTYA 4X1YA 2UZHA 3CPWF 2VAPA 2RHJA 4NWOB 4DRXA 5LP6A 3R0PA 3EORA 3NVKE 5EB1B 5KMGB 5GINC 3VCZA 3JARB 4C82A 3C9UA 4ZK7A 3S0YA 1VQLF 1W3EX 5GAPK 2HP0B 1IV1A 2H8EA 3NVIB 5B8FA 5LXTA 2CHSA 4IHJB 4R40B 2IAFA 3VYUC 3VYSC 4HNAA 1Z5WA 2FGYA 2IQQA 4X1IA 3HJWC 2R6R1 3LWQC 4ZHYB 1X52A 5IYZA 1YITF 2G9IA 4WBNA 2PHNA 3WGJA 1W5FA 4F6RA 4RQOA 2QI2A 4IIJA 3C8LA 4B62A 2QTPA 4EB6A 3MCQA 5CB4A 1K73H 2ZVZA 2CHTA 3WPWA 4O4IB 1QVGF 2LBTA 1PXWA 2ZAUA 4TV9B 5HXZA 3HWUA 1YJWF 3D54A 4O4LB 1SA0A 2ALEA 3FPIA 4M8IA 1JFFA 3JAKA 3S03A 3RYFA 5EB0A 1TVKA 1XRGA 5EAZA 2OZBA 4X20A 1VQVA 3VMFB 2RB9A 1W59A 2GZLA 3NMUC 3JVHA 3VOBA 3NK7A 3CD6F 5JQGB 4YJ2B 5G4VC 3CB2A 3G71F 3N4ZA 1KD1H 3F0DA 5HP8A 3WGNA 3CYQA 1KNKA 1PF5A 5KMGA 5DCVA 1X7PA 3FD5A 3D00A 3M1XA 2WALA 1Q7YH 1E7KA 3HKEA 3F0EA 3WJQA 5HP7A 1FFXB 2HQSC 5MN5A 4BVTA 3E1YA 2DT4A 1KC8H 2HP0A 5IJ0B 3ESJA 3WGKA 3N2GA 3HAXD 1IPAA 3JAMM 4DXDA 3P4EA 2KTVA 5LXTB 3WJPA 3RYCA 1YI2F 3OONA 4G4ZA 3CPQA 4U3JA 2RHHA 1VQPF 4O2AB 3HKBB 3CC7F 4B45A 3IMPA 3ZP7A 4WBNB 4O4JA 1VQMF 3S06A 5CA1B 2UYNB 2UYJA 3WJRA 3TD4A 4IIJB 4ZOLA 3RE3A 5A2QM 3FBAA 3CMAF 2ZODA 3V7EA 3N4YA 5FNVB 3TD3A 3CCRF 4G88A 1RLGA 1CN7A 4FFBB 3J7AR 3VTIC 4NQ3A 3RYHB 3OBWA 3HKDA 2I6DA 2RHOA 1RLUA 5GONB 1VHAA 5EIBD 2LBWA 1X7OA 3CMEF 1TVKB 2LCAA 3I3FA 4TV8B 2UYPA 5LOVB 4I4TB 2HVYD 3UT5B 1Q82H 1ONIA 4BVSA 3U0OA 5C8YA 2OHWA 1YQNA 3VIUA 5JCOC 5IJ9A 1FNJA 1IV3A 2Q1XA 3E22A 4X1KA 5EYPB 4BT2A 1QAHA 2AIFA 3QHDA 2Q1YA 4ZHVA 3V3TA 1VQ7F 2GLZA 2Z01A 5JH7B 2YYEA 2I6RA 2PMPA 5LYJA 1VQNF 3CCVF 2YXZA 5FJ4C 3JALB 3ZO8A 1RQ2A 1W42A 3JATB 3J81M 1COMA 2CSLA 2HS3A 5CA0B 5ITZB 4BVRA 2W8BC 5AVMA 3JARA 4YJ3B 4G4VA 4KWEA 3KJKA 2KGWA 2H6LA 3JAWB 2HS0A 5EZYA 1JJ2F 5LA6A 3PLAC 3GTZA 1DT9A 1GZ0A 4X20B 1DBFA 1K8AH 3KIZA 3RYIA 2HRUA 4LNUB 5J2UA 4BT3A 3M84A 1VQKF 2EWCA 1W40A 4ERHA 1M90H 3P0ZA 5IYZB 3HKCB 4BW0B 3LWRC 3CC4F 1H7MA 3O85A 3IEQA 3N2KA 3CCUF 3MQWA 2IG8A 3J80M 1QD9A 3V4DA 4DRXB 3I56F 1KQSF 4E6EA 5MN4A 3K0TA
chains in the Genus database with same CATH topology
2PHNA 2G9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PHN A;  2G9I A; 
#chains in the Genus database with same CATH topology
 3ZOP A;  4TV9 A;  4ZI7 A;  3NK6 A;  2HP3 A;  3FFM A;  3CCS F;  4I55 B;  3C9R A;  1SA0 B;  1U43 A;  3S0W A;  5BMV B;  2UYK A;  4I4T A;  3MBM A;  5HWE A;  5J2T B;  3DDN A;  4O4H A;  1VQ9 F;  1H47 A;  3SIV A;  3HKB A;  5EWR A;  1NJI H;  2Z1U A;  2GVI A;  3KHN A;  4I50 B;  3KE1 A;  3CCL F;  1U3L A;  2CZW A;  5JH7 A;  1IV2 A;  3OBY A;  2AMT A;  3L7Q A;  4RHA A;  1SZQ A;  3WGL A;  5FLX M;  4BVQ A;  3CC2 F;  2DYY A;  5CA0 A;  3PAF A;  3SIU A;  2VAW A;  3D01 A;  5JVD A;  4YJ3 A;  4EB6 B;  5CB4 B;  2CVL A;  1UI9 A;  2MQE A;  2QEX F;  4BY9 D;  3I55 F;  3B6N A;  5GON A;  1T0K B;  3HTN A;  1W55 A;  5IJ0 A;  2BTU A;  2HS4 A;  3LYB A;  5LA6 B;  4O2B A;  4BT5 A;  4C8G A;  5MN6 A;  1JFF B;  3T80 A;  3CYP B;  1CK2 A;  4X3L A;  4C4W C;  3JAS B;  4LNU A;  4BT7 A;  1CLI A;  3F0F A;  5EO3 A;  3E20 B;  3TD5 A;  2VAM A;  1RQ7 A;  3JCM M;  4XCQ A;  1N8R H;  1S72 F;  1Q86 H;  3ON1 A;  1GO0 A;  4O4J B;  1YIJ F;  3VO8 A;  5CA1 A;  1JY8 A;  2R75 1;  5HY4 A;  3M4S A;  2N48 A;  4YJ2 A;  1OAP A;  2Z1E A;  3LDT A;  3ZP4 A;  1W41 A;  1W57 A;  1VQ5 F;  2H8C A;  3DC2 A;  5JCO A;  1ZWZ A;  5GAN K;  3F6M A;  3LFO A;  1W5A A;  1QVF F;  4G4X A;  1K9M H;  1XBI A;  3RYH A;  1H48 A;  4F6R B;  5LP6 C;  1VH8 A;  4G4W A;  3LWP C;  4ZHW A;  1XHO A;  3JAW A;  1YJ9 F;  2B33 A;  3WPX A;  4O4H B;  4ZHQ A;  3N2G B;  1YJN F;  1U40 A;  1VK3 A;  3I7T A;  3QUW A;  1VQ6 F;  3CG6 A;  5J2U B;  4TUY A;  4U39 A;  3ELC A;  3GYQ A;  2LBX A;  3KJJ A;  3WGM A;  4C81 A;  5HXU A;  3RYF B;  4EI9 A;  2L26 A;  3E22 B;  4NUT A;  5EYP A;  1Z5V A;  4B46 A;  3C9T A;  5KX5 A;  1SDS A;  1RA4 A;  5JVD B;  1TUB B;  5GIP C;  3BYQ A;  4X1I B;  3AGK A;  3VI6 A;  1W5E A;  3OW2 F;  5LYJ B;  1FNK A;  2BTQ B;  1Q81 H;  2V9Y A;  1J7H A;  3LWV C;  3CCQ F;  2VXY A;  4FFB A;  1UFY A;  2KTU A;  3K14 A;  1VQ4 F;  1VQO F;  4O2B B;  3HKD B;  3RA5 A;  1M1K H;  5IT9 M;  5BMV A;  2Z1F A;  5GIO C;  3MDO A;  1VQ8 F;  1FFX A;  5EZY B;  1GO1 A;  1GX1 A;  4LCK A;  3G6E F;  5HY2 A;  4EI8 A;  1X25 A;  4I50 A;  3UT5 A;  3IR9 A;  3G4S F;  3JAK B;  5G4U C;  2AIZ P;  5IJ9 B;  2OTJ F;  3V7Q A;  2FC3 A;  3HKC A;  2QA4 F;  1Q8R A;  4O2A A;  3F0G A;  2CW4 A;  4HNA B;  3LME A;  3CXC F;  3C9S A;  3JAT A;  2OTL F;  1T0A A;  5FNV A;  2VGM A;  4ZHQ B;  2BTO A;  4I55 A;  4B5C A;  4EI7 A;  2KG4 A;  4X1Y B;  3IKE A;  2VGN A;  3VOA A;  1U3P A;  2JNB A;  5LP6 B;  3CCM F;  5J2T A;  1ODE A;  3JAS A;  1QU9 A;  3CCE F;  2K1S A;  4TUY B;  3LWO C;  2RHL A;  2HRY A;  2ZVY A;  4C8I A;  1R1M A;  3RA6 A;  4C8E A;  2Z1T A;  2OTM A;  3P10 A;  5EIB C;  5HY0 A;  4O4L A;  3RYI B;  4TV8 A;  5KX5 B;  3RYC B;  4X3M A;  1OFU A;  3N2K B;  4IHJ A;  1IV4 A;  3S02 A;  2UYN A;  3Q8H A;  3IKF A;  1W5B A;  5JQG A;  2BO1 A;  4ZOL B;  1YHQ F;  4ZI7 B;  3MCA B;  3VYT C;  3JAL A;  3K2X A;  4PWT A;  1JD1 A;  4G4Y A;  5ITZ A;  1FSZ A;  3K12 A;  1JN1 A;  3HKE B;  3CCJ F;  4O4I A;  3WXM B;  2F9Z C;  3GHZ A;  3S0H A;  5HY1 A;  2ZF8 A;  2CWJ A;  3FD6 A;  1NMU B;  4TZZ A;  1XV2 A;  5LOV A;  1KNJ A;  1TUB A;  2ZOV A;  1NQ3 A;  4U3J B;  5C8Y B;  1YGY A;  1W58 1;  2HX0 A;  2NMU A;  1W2B F;  4X1K B;  2P6Y A;  3ERN A;  4BT6 A;  4BT4 A;  3IEW A;  3QTY A;  4X1Y A;  2UZH A;  3CPW F;  2VAP A;  2RHJ A;  4NWO B;  4DRX A;  5LP6 A;  3R0P A;  3EOR A;  3NVK E;  5EB1 B;  5KMG B;  5GIN C;  3VCZ A;  3JAR B;  4C82 A;  3C9U A;  4ZK7 A;  3S0Y A;  1VQL F;  1W3E X;  5GAP K;  2HP0 B;  1IV1 A;  2H8E A;  3NVI B;  5B8F A;  5LXT A;  2CHS A;  4IHJ B;  4R40 B;  2IAF A;  3VYU C;  3VYS C;  4HNA A;  1Z5W A;  2FGY A;  2IQQ A;  4X1I A;  3HJW C;  2R6R 1;  3LWQ C;  4ZHY B;  1X52 A;  5IYZ A;  1YIT F;  2G9I A;  4WBN A;  2PHN A;  3WGJ A;  1W5F A;  4F6R A;  4RQO A;  2QI2 A;  4IIJ A;  3C8L A;  4B62 A;  2QTP A;  4EB6 A;  3MCQ A;  5CB4 A;  1K73 H;  2ZVZ A;  2CHT A;  3WPW A;  4O4I B;  1QVG F;  2LBT A;  1PXW A;  2ZAU A;  4TV9 B;  5HXZ A;  3HWU A;  1YJW F;  3D54 A;  4O4L B;  1SA0 A;  2ALE A;  3FPI A;  4M8I A;  1JFF A;  3JAK A;  3S03 A;  3RYF A;  5EB0 A;  1TVK A;  1XRG A;  5EAZ A;  2OZB A;  4X20 A;  1VQV A;  3VMF B;  2RB9 A;  1W59 A;  2GZL A;  3NMU C;  3JVH A;  3VOB A;  3NK7 A;  3CD6 F;  5JQG B;  4YJ2 B;  5G4V C;  3CB2 A;  3G71 F;  3N4Z A;  1KD1 H;  3F0D A;  5HP8 A;  3WGN A;  3CYQ A;  1KNK A;  1PF5 A;  5KMG A;  5DCV A;  1X7P A;  3FD5 A;  3D00 A;  3M1X A;  2WAL A;  1Q7Y H;  1E7K A;  3HKE A;  3F0E A;  3WJQ A;  5HP7 A;  1FFX B;  2HQS C;  5MN5 A;  4BVT A;  3E1Y A;  2DT4 A;  1KC8 H;  2HP0 A;  5IJ0 B;  3ESJ A;  3WGK A;  3N2G A;  3HAX D;  1IPA A;  3JAM M;  4DXD A;  3P4E A;  2KTV A;  5LXT B;  3WJP A;  3RYC A;  1YI2 F;  3OON A;  4G4Z A;  3CPQ A;  4U3J A;  2RHH A;  1VQP F;  4O2A B;  3HKB B;  3CC7 F;  4B45 A;  3IMP A;  3ZP7 A;  4WBN B;  4O4J A;  1VQM F;  3S06 A;  5CA1 B;  2UYN B;  2UYJ A;  3WJR A;  3TD4 A;  4IIJ B;  4ZOL A;  3RE3 A;  5A2Q M;  3FBA A;  3CMA F;  2ZOD A;  3V7E A;  3N4Y A;  5FNV B;  3TD3 A;  3CCR F;  4G88 A;  1RLG A;  1CN7 A;  4FFB B;  3J7A R;  3VTI C;  4NQ3 A;  3RYH B;  3OBW A;  3HKD A;  2I6D A;  2RHO A;  1RLU A;  5GON B;  1VHA A;  5EIB D;  2LBW A;  1X7O A;  3CME F;  1TVK B;  2LCA A;  3I3F A;  4TV8 B;  2UYP A;  5LOV B;  4I4T B;  2HVY D;  3UT5 B;  1Q82 H;  1ONI A;  4BVS A;  3U0O A;  5C8Y A;  2OHW A;  1YQN A;  3VIU A;  5JCO C;  5IJ9 A;  1FNJ A;  1IV3 A;  2Q1X A;  3E22 A;  4X1K A;  5EYP B;  4BT2 A;  1QAH A;  2AIF A;  3QHD A;  2Q1Y A;  4ZHV A;  3V3T A;  1VQ7 F;  2GLZ A;  2Z01 A;  5JH7 B;  2YYE A;  2I6R A;  2PMP A;  5LYJ A;  1VQN F;  3CCV F;  2YXZ A;  5FJ4 C;  3JAL B;  3ZO8 A;  1RQ2 A;  1W42 A;  3JAT B;  3J81 M;  1COM A;  2CSL A;  2HS3 A;  5CA0 B;  5ITZ B;  4BVR A;  2W8B C;  5AVM A;  3JAR A;  4YJ3 B;  4G4V A;  4KWE A;  3KJK A;  2KGW A;  2H6L A;  3JAW B;  2HS0 A;  5EZY A;  1JJ2 F;  5LA6 A;  3PLA C;  3GTZ A;  1DT9 A;  1GZ0 A;  4X20 B;  1DBF A;  1K8A H;  3KIZ A;  3RYI A;  2HRU A;  4LNU B;  5J2U A;  4BT3 A;  3M84 A;  1VQK F;  2EWC A;  1W40 A;  4ERH A;  1M90 H;  3P0Z A;  5IYZ B;  3HKC B;  4BW0 B;  3LWR C;  3CC4 F;  1H7M A;  3O85 A;  3IEQ A;  3N2K A;  3CCU F;  3MQW A;  2IG8 A;  3J80 M;  1QD9 A;  3V4D A;  4DRX B;  3I56 F;  1KQS F;  4E6E A;  5MN4 A;  3K0T A; 
#chains in the Genus database with same CATH homology
 2PHN A;  2G9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...