2G9IA

Crystal structure of homolog of f420-0:gamma-glutamyl ligase from archaeoglobus fulgidus reveals a novel fold.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
249
structure length
233
Chain Sequence
b'MRVEVFPVEGLPLIKEGDDLAELISSRVRFEDGDVLVVCSTVISKAEGRIRRLEEFNPSERAKEIAARIGKPAEFVQAVLEESEEVLLDFPFLLVKAKFGNVCVNAGIDASNVEEGSLLLPPLDPDGSAEKLRRRILELTGKRVGVIITDTNGRCFRRGVVGFAIGISGVKAMKDWVTVECVADEIAAFANLLMGGIPAVVVRGLNVAGEGSMEEIYRSEEEDVIRRCLKRCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F420-0:gamma-glutamyl ligase
publication title Structure of an amide bond forming F(420):gamma-glutamyl ligase from Archaeoglobus fulgidus -- a member of a new family of non-ribosomal peptide synthases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ligase
total genus 61
structure length 233
sequence length 249
chains with identical sequence B
ec nomenclature ec 6.3.2.31: Coenzyme F420-0:L-glutamate ligase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01996 F420_ligase F420-0:Gamma-glutamyl ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.100 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; CofE-like 2g9iA01
3.90.1660.10 Alpha Beta Alpha-Beta Complex CofE-like fold CofE-like domain 2g9iA02
2PHNA 2G9IA
chains in the Genus database with same CATH superfamily
2Z1TA 2LBTA 3WGJA 4C8IA 1QVGF 3RE3A 1OFUA 4F6RB 1QU9A 4TV8A 4O4JA 5J2TA 2H8EA 3S06A 4RQOA 1YHQF 4O4LA 3I56F 3TD4A 3HWUA 1UFYA 5IYZA 2ZODA 3E20B 5CB4B 4EB6A 4BT2A 3HJWC 1JFFA 4LNUA 4BT6A 5EIBC 4BVTA 3FPIA 2CSLA 1IV4A 3LWRC 3QHDA 1W581 1QD9A 4U3JB 2OHWA 2VXYA 3WGLA 4YJ3B 5EWRA 1U43A 2GVIA 4O4HB 3RYHB 3WGMA 3CMEF 1X7PA 5G4UC 1VQPF 4BVQA 3CPQA 2MQEA 4IHJB 3BYQA 2CZWA 5LP6A 1Q8RA 4WBNA 1W59A 1W5FA 4TUYB 5HP7A 3JATB 3S0HA 2KG4A 5ITZA 2CVLA 5IJ0B 3CMAF 3VYSC 4ZHYB 1YI2F 1CK2A 5EIBD 3CPWF 3V4DA 5JQGB 4G88A 1Z5WA 1VQLF 5J2UB 5LYJA 3RYIA 3FD6A 3CCSF 3JASB 2HX0A 3S03A 3MBMA 5EO3A 3P0ZA 4ERHA 2ZVYA 4I50B 4ZHQB 3C9SA 2RB9A 4I4TA 3C9TA 3G6EF 1W40A 3IMPA 3KIZA 2G9IA 1GO1A 1JJ2F 3J7AR 4G4XA 5IT9M 1W5BA 3EORA 3HKDB 3V7EA 1NMUB 2UYNB 2NMUA 3E1YA 2HVYD 1FFXB 1RLUA 5EB0A 3C9RA 5C8YB 5KMGA 3I55F 3I3FA 3AGKA 1VQNF 1K73H 4G4ZA 2QEXF 2Z01A 4X1IB 5B8FA 1M90H 2HP3A 4BVRA 3C8LA 1W41A 3ZO8A 3QTYA 4E6EA 1RLGA 1CLIA 1VQOF 1X25A 3MCAB 2Q1XA 1X52A 3UT5A 3LYBA 4C82A 3JVHA 4X1YA 2H8CA 5DCVA 3JALA 2DYYA 4O2BB 2HP0B 3LWPC 3HKBA 2Q1YA 3LWOC 3F0GA 3NVKE 1YITF 4BT7A 4B62A 1VHAA 3ZP4A 3WXMB 3OONA 2KTVA 5EZYA 2BO1A 2LBWA 4O4IB 5CA0B 1S72F 4TV9A 3TD5A 2DT4A 3CCMF 1JY8A 4LCKA 4X3MA 3CYPB 3KJKA 3RYCA 5LOVA 4ZK7A 5LXTB 5FNVA 1TUBB 3HAXD 3CC4F 1W42A 5GANK 4ZHWA 5EB1B 4FFBB 3JAWA 5HWEA 5JVDB 3CCJF 2UZHA 5HY1A 3N2KB 2AMTA 5JCOC 1GZ0A 3WPWA 2BTQB 2QTPA 2FGYA 5IJ9B 4O2AA 2Z1EA 3N2GA 3CD6F 2HS0A 5HY4A 3VI6A 2BTOA 2RHJA 3HKCB 5MN4A 4BT3A 5EYPB 4F6RA 1T0AA 5GONB 2UYJA 3N4YA 4C81A 1JFFB 4BY9D 1VQVA 5CA1B 1XBIA 3OBYA 3RYFA 2ZOVA 1JN1A 2VAMA 5EAZA 5CB4A 1Q7YH 1GO0A 4YJ2B 2ZF8A 2EWCA 1KQSF 5MN5A 1VQ5F 3ERNA 4EI9A 2VAWA 1ZWZA 4G4YA 1YJNF 4ZOLB 4BT5A 4U3JA 3CC2F 4YJ3A 1R1MA 1W2BF 4O4HA 1ODEA 3RYHA 5JH7B 4BT4A 3B6NA 1U40A 3M1XA 3IKFA 1W5EA 3LDTA 4NQ3A 3G4SF 2KTUA 2RHLA 2YXZA 4WBNB 3OBWA 1IV1A 3QUWA 3F0EA 3CC7F 3CCLF 4I55A 3RA5A 1TVKB 4IHJA 3CB2A 2IQQA 2W8BC 4C8GA 3NK6A 2QI2A 3CCUF 4EI7A 5FLXM 4TUYA 3R0PA 2HRYA 2VGMA 2I6DA 2GZLA 3JCMM 1KC8H 5IJ0A 2ALEA 4IIJB 3E22B 5JQGA 3LFOA 3G71F 5J2UA 3JASA 3VOBA 1DT9A 2H6LA 1U3PA 4ZHQA 1NJIH 1K8AH 2YYEA 4KWEA 1SA0B 2BTUA 3DDNA 4U39A 3ZOPA 5LA6A 2LCAA 3JARB 3HKDA 3IEQA 4BW0B 2UYNA 1N8RH 3CYQA 1FFXA 4C8EA 3VCZA 5G4VC 1OAPA 4ZI7B 5AVMA 5C8YA 2R751 3GTZA 3WGKA 1YJWF 3UT5B 4M8IA 4HNAB 1VQ8F 1KNJA 5KX5B 3CXCF 1VK3A 2CHTA 1VQ7F 1QVFF 3VO8A 2Z1UA 3WJRA 2HS3A 1FNKA 3JAKB 5BMVB 3HKBB 1W55A 2R6R1 3PAFA 4X20B 5LP6C 2WALA 4B46A 1Q86H 2HP0A 1W57A 1U3LA 3J81M 5FJ4C 3TD3A 3GHZA 1SDSA 3HKEB 2JNBA 2KGWA 3IEWA 1RA4A 2N48A 1X7OA 2HQSC 4TV9B 4X1KB 1XHOA 3F0DA 1VH8A 3O85A 3ESJA 4O4IA 2CW4A 5CA0A 5HY0A 3LWVC 2AIZP 3S0YA 3T80A 2PHNA 2GLZA 3JAWB 3VOAA 2CHSA 1M1KH 1TUBA 3IR9A 1YGYA 4TV8B 4O4JB 3K0TA 4G4VA 5J2TB 3J80M 3CCQF 4FFBA 4O4LB 4DRXA 5JVDA 5IYZB 5HXUA 2UYKA 1ONIA 2HRUA 3N2KA 3K14A 4EB6B 3I7TA 5A2QM 4LNUB 5IJ9A 4PWTA 3S02A 3F0FA 3CCRF 2PMPA 2Z1FA 3KJJA 3HKCA 1VQKF 1RQ7A 1KNKA 3D54A 5EYPA 2P6YA 3RYFB 3D01A 1UI9A 5GIPC 3NMUC 5GONA 1Q81H 1SZQA 4G4WA 5CA1A 3D00A 2L26A 2OTMA 2LBXA 4YJ2A 3VYTC 3VIUA 1FSZA 4TZZA 1CN7A 4BVSA 3HTNA 1GX1A 4B45A 1KD1H 3SIUA 2CWJA 5LP6B 1W3EX 4ZOLA 3VYUC 1H47A 1H48A 5ITZB 1Z5VA 3M84A 2UYPA 1JD1A 5JH7A 1IV3A 1Q82H 5LYJB 3RYIB 1W5AA 4I55B 1VQ4F 3JATA 2RHOA 3CCVF 3GYQA 1XV2A 3U0OA 3NK7A 3WGNA 3SIVA 2I6RA 3NVIB 3M4SA 4I4TB 1TVKA 3WJPA 1PF5A 1T0KB 1XRGA 1VQ9F 1K9MH 3KE1A 3ELCA 4I50A 1YIJF 3WPXA 2ZVZA 3IKEA 4IIJA 3E22A 5KMGB 5HP8A 3L7QA 1NQ3A 3V3TA 2VGNA 5MN6A 1YJ9F 3N4ZA 3P4EA 5JCOA 5LA6B 4DXDA 2B33A 3LWQC 3LMEA 1SA0A 3CG6A 1YQNA 2IG8A 4ZHVA 3PLAC 3FBAA 3ON1A 4X1IA 2OTLF 4XCQA 3JARA 4X1YB 2F9ZC 3JALB 3MQWA 4RHAA 3FD5A 3KHNA 5GAPK 4ZI7A 3S0WA 3MCQA 3MDOA 1QAHA 3F6MA 4O2BA 1VQ6F 1J7HA 2RHHA 2ZAUA 4HNAA 2OZBA 2IAFA 5KX5A 5EZYB 5GIOC 3K2XA 3VMFB 3RA6A 2QA4F 3WJQA 4B5CA 3JAKA 5BMVA 3OW2F 3FFMA 2V9YA 4R40B 2OTJF 4X20A 4NWOB 5GINC 1COMA 2HS4A 2VAPA 3RYCB 3Q8HA 5LOVB 3K12A 1H7MA 4X3LA 5FNVB 1IPAA 1IV2A 3HKEA 3C9UA 5HXZA 4NUTA 4C4WC 5HY2A 4EI8A 2K1SA 3DC2A 3V7QA 4X1KA 1DBFA 5LXTA 3VTIC 3P10A 3CCEF 1VQMF 2AIFA 3JAMM 3ZP7A 1RQ2A 4O2AB 1FNJA 1PXWA 2FC3A 3N2GB 1E7KA 4DRXB
chains in the Genus database with same CATH topology
2PHNA 2G9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PHN A;  2G9I A; 
#chains in the Genus database with same CATH topology
 2Z1T A;  2LBT A;  3WGJ A;  4C8I A;  1QVG F;  3RE3 A;  1OFU A;  4F6R B;  1QU9 A;  4TV8 A;  4O4J A;  5J2T A;  2H8E A;  3S06 A;  4RQO A;  1YHQ F;  4O4L A;  3I56 F;  3TD4 A;  3HWU A;  1UFY A;  5IYZ A;  2ZOD A;  3E20 B;  5CB4 B;  4EB6 A;  4BT2 A;  3HJW C;  1JFF A;  4LNU A;  4BT6 A;  5EIB C;  4BVT A;  3FPI A;  2CSL A;  1IV4 A;  3LWR C;  3QHD A;  1W58 1;  1QD9 A;  4U3J B;  2OHW A;  2VXY A;  3WGL A;  4YJ3 B;  5EWR A;  1U43 A;  2GVI A;  4O4H B;  3RYH B;  3WGM A;  3CME F;  1X7P A;  5G4U C;  1VQP F;  4BVQ A;  3CPQ A;  2MQE A;  4IHJ B;  3BYQ A;  2CZW A;  5LP6 A;  1Q8R A;  4WBN A;  1W59 A;  1W5F A;  4TUY B;  5HP7 A;  3JAT B;  3S0H A;  2KG4 A;  5ITZ A;  2CVL A;  5IJ0 B;  3CMA F;  3VYS C;  4ZHY B;  1YI2 F;  1CK2 A;  5EIB D;  3CPW F;  3V4D A;  5JQG B;  4G88 A;  1Z5W A;  1VQL F;  5J2U B;  5LYJ A;  3RYI A;  3FD6 A;  3CCS F;  3JAS B;  2HX0 A;  3S03 A;  3MBM A;  5EO3 A;  3P0Z A;  4ERH A;  2ZVY A;  4I50 B;  4ZHQ B;  3C9S A;  2RB9 A;  4I4T A;  3C9T A;  3G6E F;  1W40 A;  3IMP A;  3KIZ A;  2G9I A;  1GO1 A;  1JJ2 F;  3J7A R;  4G4X A;  5IT9 M;  1W5B A;  3EOR A;  3HKD B;  3V7E A;  1NMU B;  2UYN B;  2NMU A;  3E1Y A;  2HVY D;  1FFX B;  1RLU A;  5EB0 A;  3C9R A;  5C8Y B;  5KMG A;  3I55 F;  3I3F A;  3AGK A;  1VQN F;  1K73 H;  4G4Z A;  2QEX F;  2Z01 A;  4X1I B;  5B8F A;  1M90 H;  2HP3 A;  4BVR A;  3C8L A;  1W41 A;  3ZO8 A;  3QTY A;  4E6E A;  1RLG A;  1CLI A;  1VQO F;  1X25 A;  3MCA B;  2Q1X A;  1X52 A;  3UT5 A;  3LYB A;  4C82 A;  3JVH A;  4X1Y A;  2H8C A;  5DCV A;  3JAL A;  2DYY A;  4O2B B;  2HP0 B;  3LWP C;  3HKB A;  2Q1Y A;  3LWO C;  3F0G A;  3NVK E;  1YIT F;  4BT7 A;  4B62 A;  1VHA A;  3ZP4 A;  3WXM B;  3OON A;  2KTV A;  5EZY A;  2BO1 A;  2LBW A;  4O4I B;  5CA0 B;  1S72 F;  4TV9 A;  3TD5 A;  2DT4 A;  3CCM F;  1JY8 A;  4LCK A;  4X3M A;  3CYP B;  3KJK A;  3RYC A;  5LOV A;  4ZK7 A;  5LXT B;  5FNV A;  1TUB B;  3HAX D;  3CC4 F;  1W42 A;  5GAN K;  4ZHW A;  5EB1 B;  4FFB B;  3JAW A;  5HWE A;  5JVD B;  3CCJ F;  2UZH A;  5HY1 A;  3N2K B;  2AMT A;  5JCO C;  1GZ0 A;  3WPW A;  2BTQ B;  2QTP A;  2FGY A;  5IJ9 B;  4O2A A;  2Z1E A;  3N2G A;  3CD6 F;  2HS0 A;  5HY4 A;  3VI6 A;  2BTO A;  2RHJ A;  3HKC B;  5MN4 A;  4BT3 A;  5EYP B;  4F6R A;  1T0A A;  5GON B;  2UYJ A;  3N4Y A;  4C81 A;  1JFF B;  4BY9 D;  1VQV A;  5CA1 B;  1XBI A;  3OBY A;  3RYF A;  2ZOV A;  1JN1 A;  2VAM A;  5EAZ A;  5CB4 A;  1Q7Y H;  1GO0 A;  4YJ2 B;  2ZF8 A;  2EWC A;  1KQS F;  5MN5 A;  1VQ5 F;  3ERN A;  4EI9 A;  2VAW A;  1ZWZ A;  4G4Y A;  1YJN F;  4ZOL B;  4BT5 A;  4U3J A;  3CC2 F;  4YJ3 A;  1R1M A;  1W2B F;  4O4H A;  1ODE A;  3RYH A;  5JH7 B;  4BT4 A;  3B6N A;  1U40 A;  3M1X A;  3IKF A;  1W5E A;  3LDT A;  4NQ3 A;  3G4S F;  2KTU A;  2RHL A;  2YXZ A;  4WBN B;  3OBW A;  1IV1 A;  3QUW A;  3F0E A;  3CC7 F;  3CCL F;  4I55 A;  3RA5 A;  1TVK B;  4IHJ A;  3CB2 A;  2IQQ A;  2W8B C;  4C8G A;  3NK6 A;  2QI2 A;  3CCU F;  4EI7 A;  5FLX M;  4TUY A;  3R0P A;  2HRY A;  2VGM A;  2I6D A;  2GZL A;  3JCM M;  1KC8 H;  5IJ0 A;  2ALE A;  4IIJ B;  3E22 B;  5JQG A;  3LFO A;  3G71 F;  5J2U A;  3JAS A;  3VOB A;  1DT9 A;  2H6L A;  1U3P A;  4ZHQ A;  1NJI H;  1K8A H;  2YYE A;  4KWE A;  1SA0 B;  2BTU A;  3DDN A;  4U39 A;  3ZOP A;  5LA6 A;  2LCA A;  3JAR B;  3HKD A;  3IEQ A;  4BW0 B;  2UYN A;  1N8R H;  3CYQ A;  1FFX A;  4C8E A;  3VCZ A;  5G4V C;  1OAP A;  4ZI7 B;  5AVM A;  5C8Y A;  2R75 1;  3GTZ A;  3WGK A;  1YJW F;  3UT5 B;  4M8I A;  4HNA B;  1VQ8 F;  1KNJ A;  5KX5 B;  3CXC F;  1VK3 A;  2CHT A;  1VQ7 F;  1QVF F;  3VO8 A;  2Z1U A;  3WJR A;  2HS3 A;  1FNK A;  3JAK B;  5BMV B;  3HKB B;  1W55 A;  2R6R 1;  3PAF A;  4X20 B;  5LP6 C;  2WAL A;  4B46 A;  1Q86 H;  2HP0 A;  1W57 A;  1U3L A;  3J81 M;  5FJ4 C;  3TD3 A;  3GHZ A;  1SDS A;  3HKE B;  2JNB A;  2KGW A;  3IEW A;  1RA4 A;  2N48 A;  1X7O A;  2HQS C;  4TV9 B;  4X1K B;  1XHO A;  3F0D A;  1VH8 A;  3O85 A;  3ESJ A;  4O4I A;  2CW4 A;  5CA0 A;  5HY0 A;  3LWV C;  2AIZ P;  3S0Y A;  3T80 A;  2PHN A;  2GLZ A;  3JAW B;  3VOA A;  2CHS A;  1M1K H;  1TUB A;  3IR9 A;  1YGY A;  4TV8 B;  4O4J B;  3K0T A;  4G4V A;  5J2T B;  3J80 M;  3CCQ F;  4FFB A;  4O4L B;  4DRX A;  5JVD A;  5IYZ B;  5HXU A;  2UYK A;  1ONI A;  2HRU A;  3N2K A;  3K14 A;  4EB6 B;  3I7T A;  5A2Q M;  4LNU B;  5IJ9 A;  4PWT A;  3S02 A;  3F0F A;  3CCR F;  2PMP A;  2Z1F A;  3KJJ A;  3HKC A;  1VQK F;  1RQ7 A;  1KNK A;  3D54 A;  5EYP A;  2P6Y A;  3RYF B;  3D01 A;  1UI9 A;  5GIP C;  3NMU C;  5GON A;  1Q81 H;  1SZQ A;  4G4W A;  5CA1 A;  3D00 A;  2L26 A;  2OTM A;  2LBX A;  4YJ2 A;  3VYT C;  3VIU A;  1FSZ A;  4TZZ A;  1CN7 A;  4BVS A;  3HTN A;  1GX1 A;  4B45 A;  1KD1 H;  3SIU A;  2CWJ A;  5LP6 B;  1W3E X;  4ZOL A;  3VYU C;  1H47 A;  1H48 A;  5ITZ B;  1Z5V A;  3M84 A;  2UYP A;  1JD1 A;  5JH7 A;  1IV3 A;  1Q82 H;  5LYJ B;  3RYI B;  1W5A A;  4I55 B;  1VQ4 F;  3JAT A;  2RHO A;  3CCV F;  3GYQ A;  1XV2 A;  3U0O A;  3NK7 A;  3WGN A;  3SIV A;  2I6R A;  3NVI B;  3M4S A;  4I4T B;  1TVK A;  3WJP A;  1PF5 A;  1T0K B;  1XRG A;  1VQ9 F;  1K9M H;  3KE1 A;  3ELC A;  4I50 A;  1YIJ F;  3WPX A;  2ZVZ A;  3IKE A;  4IIJ A;  3E22 A;  5KMG B;  5HP8 A;  3L7Q A;  1NQ3 A;  3V3T A;  2VGN A;  5MN6 A;  1YJ9 F;  3N4Z A;  3P4E A;  5JCO A;  5LA6 B;  4DXD A;  2B33 A;  3LWQ C;  3LME A;  1SA0 A;  3CG6 A;  1YQN A;  2IG8 A;  4ZHV A;  3PLA C;  3FBA A;  3ON1 A;  4X1I A;  2OTL F;  4XCQ A;  3JAR A;  4X1Y B;  2F9Z C;  3JAL B;  3MQW A;  4RHA A;  3FD5 A;  3KHN A;  5GAP K;  4ZI7 A;  3S0W A;  3MCQ A;  3MDO A;  1QAH A;  3F6M A;  4O2B A;  1VQ6 F;  1J7H A;  2RHH A;  2ZAU A;  4HNA A;  2OZB A;  2IAF A;  5KX5 A;  5EZY B;  5GIO C;  3K2X A;  3VMF B;  3RA6 A;  2QA4 F;  3WJQ A;  4B5C A;  3JAK A;  5BMV A;  3OW2 F;  3FFM A;  2V9Y A;  4R40 B;  2OTJ F;  4X20 A;  4NWO B;  5GIN C;  1COM A;  2HS4 A;  2VAP A;  3RYC B;  3Q8H A;  5LOV B;  3K12 A;  1H7M A;  4X3L A;  5FNV B;  1IPA A;  1IV2 A;  3HKE A;  3C9U A;  5HXZ A;  4NUT A;  4C4W C;  5HY2 A;  4EI8 A;  2K1S A;  3DC2 A;  3V7Q A;  4X1K A;  1DBF A;  5LXT A;  3VTI C;  3P10 A;  3CCE F;  1VQM F;  2AIF A;  3JAM M;  3ZP7 A;  1RQ2 A;  4O2A B;  1FNJ A;  1PXW A;  2FC3 A;  3N2G B;  1E7K A;  4DRX B; 
#chains in the Genus database with same CATH homology
 2PHN A;  2G9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...