2G9IA

Crystal structure of homolog of f420-0:gamma-glutamyl ligase from archaeoglobus fulgidus reveals a novel fold.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
249
structure length
233
Chain Sequence
MRVEVFPVEGLPLIKEGDDLAELISSRVRFEDGDVLVVCSTVISKAEGRIRRLEEFNPSERAKEIAARIGKPAEFVQAVLEESEEVLLDFPFLLVKAKFGNVCVNAGIDASNVEEGSLLLPPLDPDGSAEKLRRRILELTGKRVGVIITDTNGRCFRRGVVGFAIGISGVKAMKDWVTVECVADEIAAFANLLMGGIPAVVVRGLNVAGEGSMEEIYRSEEEDVIRRCLKRCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F420-0:gamma-glutamyl ligase
publication title Structure of an amide bond forming F(420):gamma-glutamyl ligase from Archaeoglobus fulgidus -- a member of a new family of non-ribosomal peptide synthases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ligase
total genus 61
structure length 233
sequence length 249
chains with identical sequence B
ec nomenclature ec 6.3.2.31: Coenzyme F420-0:L-glutamate ligase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01996 F420_ligase F420-0:Gamma-glutamyl ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.100 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; CofE-like 2g9iA01
3.90.1660.10 Alpha Beta Alpha-Beta Complex CofE-like fold CofE-like domain 2g9iA02
2PHNA 2G9IA
chains in the Genus database with same CATH superfamily
1NJIH 1U40A 3HKCB 3JCMM 4LNUA 4BVTA 2LBXA 1K8AH 4PWTA 3OW2F 1Q8RA 4LCKA 1VH8A 4BT3A 3JAWB 4O4LA 3RYIA 3CCVF 3ZP7A 5EZYA 2CZWA 2G9IA 5HP8A 1VQ5F 4U3JA 5MN4A 2BTOA 1VQLF 3G71F 3TD4A 2BTUA 3J81M 3N2GA 5LYJA 1VQPF 4X1IA 5JH7A 4BVQA 4ZOLA 3KJKA 4O4HA 2HX0A 3D01A 3UT5A 2WALA 3N2KA 3JVHA 3VOBA 3C9SA 3V3TA 5BMVA 4O4LB 3RYIB 3FD5A 4C82A 3K14A 5JQGA 2H8EA 2B33A 1SZQA 2IAFA 1Z5VA 3IKEA 5CA0A 3CCQF 1TUBA 5LXTA 5LYJB 4X1IB 5JH7B 1YJ9F 4ZOLB 3VI6A 4O4HB 3U0OA 5GIPC 1U3LA 3UT5B 4I55A 3I56F 5BMVB 4EI7A 3LMEA 1KNKA 3VOAA 4BT6A 5KMGA 5JQGB 3HJWC 5LP6B 1FFXB 1UI9A 2OTJF 4EI9A 4DXDA 1TUBB 2P6YA 2ALEA 2OHWA 1Q86H 1W59A 2DYYA 5EO3A 3PLAC 1VQKF 3WGNA 1X7OA 4FFBA 3ON1A 5KMGB 2HVYD 3WXMB 2PHNA 4C4WC 3M1XA 1DBFA 2GLZA 2HS0A 1NMUB 4O4IA 5IYZA 3HKDA 5HP7A 3CC7F 1U43A 1J7HA 5LOVA 3J80M 1OAPA 4FFBB 5GIOC 1QVGF 2PMPA 3LWVC 3V4DA 3WPWA 2QEXF 3P0ZA 4G4XA 3RYHA 1ODEA 1SDSA 3QTYA 1VQOF 3CCRF 1H7MA 3IEWA 3WGLA 3CD6F 3OONA 5IYZB 5GANK 1ONIA 5EYPB 3TD3A 4I4TA 5LOVB 1M1KH 4TV8A 5LA6B 3RYHB 3CCEF 4IIJA 4I50B 3E1YA 2IG8A 1QVFF 2ZOVA 4ZHQA 5KX5B 4B5CA 3ERNA 3OBYA 3CCMF 5A2QM 1RA4A 3VCZA 2OTMA 1K9MH 4TV9B 4BVSA 2W8BC 2OTLF 3HKBA 1YI2F 1KQSF 1PF5A 3G4SF 1W41A 3CCSF 3QUWA 4IIJB 1U3PA 3D00A 1KNJA 1YHQF 3M4SA 4B46A 1S72F 2L26A 4EI8A 2VAPA 3DC2A 5FLXM 2KG4A 4BW0B 3LYBA 2OZBA 5J2TA 3AGKA 5EWRA 1CN7A 1NQ3A 2Z1UA 2H6LA 3HTNA 4RHAA 3HKBB 4X1KA 4X20B 5IT9M 2I6RA 2NMUA 1Q82H 4IHJA 3P10A 4YJ2A 4TZZA 4C81A 3LWOC 2HP3A 3CCUF 2GZLA 4WBNA 3N4ZA 4LNUB 1TVKA 3DDNA 5FJ4C 2ZF8A 1W55A 4HNAA 3CMAF 5JVDA 3CC2F 5EIBC 3K2XA 5HY1A 3VYTC 3CB2A 5EZYB 1QD9A 3GHZA 4F6RA 3WJQA 4ZHWA 4U3JB 1X52A 1RQ7A 3VYUC 4O2BA 2CW4A 4KWEA 3CMEF 2QI2A 5EIBD 1W5AA 1ZWZA 3N2GB 2RB9A 1H47A 3HKEA 4WBNB 1TVKB 3S03A 3N2KB 4YJ3A 1JD1A 4C8GA 2YYEA 3E20B 4HNAB 4U39A 3I55F 3ESJA 3IKFA 3VIUA 3F0FA 4F6RB 2UZHA 1M90H 3C9UA 1IV4A 5IJ9A 2BTQB 5HXUA 2IQQA 3IEQA 5LP6C 4DRXA 5CA0B 5LXTB 3HKEB 5GONA 1XV2A 5C8YA 2R751 4EB6A 4YJ3B 3KHNA 4C8IA 4I55B 3ZOPA 1VHAA 2QA4F 2UYPA 3GYQA 4R40B 1W581 4XCQA 2Z01A 5IJ9B 4TUYA 5B8FA 2EWCA 3S0WA 1UFYA 3F0EA 4B45A 3FD6A 4DRXB 1W5FA 1QU9A 3GTZA 3KJJA 1SA0A 5JCOA 4ERHA 5HY4A 3CPQA 4EB6B 1VQMF 1W42A 2ZVYA 2AIFA 3WGJA 2H8CA 1VQ9F 1YQNA 2HQSC 1W40A 3JAMM 2QTPA 3RA5A 3K0TA 2Q1XA 1COMA 3JASA 2UYKA 1VQ7F 1E7KA 3RYFA 5FNVA 1W5EA 4O4IB 4ZK7A 4BT7A 1SA0B 3HKDB 3F6MA 3M84A 3TD5A 4X1YA 2Z1TA 5EAZA 4B62A 4G4YA 3VO8A 1XHOA 4O2AA 5EB0A 5CA1A 3VMFB 5J2UA 3LWQC 3LWPC 3JASB 3I7TA 1RLGA 2HS4A 2LBTA 5GINC 1H48A 2V9YA 4O4JA 5FNVB 3RYFB 2FC3A 4G4ZA 2CHTA 4X1YB 4I4TB 3MCQA 1JY8A 3I3FA 3CPWF 1W2BF 4NWOB 3BYQA 4O2AB 5J2UB 1KD1H 4TV8B 4BT2A 1Z5WA 1W3EX 1XBIA 3CG6A 4ZHQB 3RE3A 3V7EA 4O4JB 3E22A 5HXZA 2RHLA 3ELCA 1VQVA 3NVKE 3S02A 3S06A 5G4UC 2HRUA 1GX1A 3CYQA 3O85A 4NQ3A 2ZODA 4G88A 2N48A 3FBAA 1IPAA 3C9RA 5CB4A 2Z1EA 1PXWA 1Q81H 1IV3A 2MQEA 2GVIA 3E22B 3Q8HA 1FNKA 3R0PA 4X3MA 5IJ0A 2FGYA 2HS3A 3CYPB 4NUTA 5J2TB 1W5BA 2KTVA 3HWUA 3CXCF 3MCAB 1YIJF 3J7AR 4X1KB 1GZ0A 3N4YA 2VGMA 2UYJA 4IHJB 4YJ2B 3ZO8A 5CB4B 3C9TA 1GO0A 1GO1A 2LCAA 3F0GA 5IJ0B 3EORA 2RHOA 1YITF 1K73H 3P4EA 1VQ6F 3RYCA 5JVDB 3JALA 4BT5A 3NVIB 5G4VC 1JN1A 3PAFA 3WGKA 5LP6A 4O2BB 1FFXA 5EB1B 3SIUA 2CHSA 3WGMA 3FFMA 4E6EA 1CLIA 2VAWA 1YGYA 2LBWA 1X7PA 1YJWF 3VTIC 3FPIA 1JFFA 3RYCB 3NMUC 5HWEA 3SIVA 2UYNA 2HP0A 4ZI7A 3JALB 2KGWA 3JAKA 1RQ2A 3S0YA 2VAMA 4G4WA 2ZAUA 3OBWA 3VYSC 1W57A 2AIZP 4BVRA 1XRGA 5GONB 3WJPA 4M8IA 5C8YB 2I6DA 5MN5A 4BY9D 3B6NA 5GAPK 1VK3A 1JFFB 3QHDA 4RQOA 3KIZA 3WJRA 1T0AA 3CCLF 2UYNB 1R1MA 2HP0B 4ZI7B 2RHHA 3JAKB 1YJNF 3F0DA 5HY0A 2RHJA 4TUYB 1FNJA 3LDTA 2JNBA 2CWJA 1KC8H 1DT9A 5ITZA 2HRYA 4BT4A 2VGNA 2Z1FA 2ZVZA 1VQ8F 3WPXA 1VQ4F 1QAHA 2K1SA 5JCOC 5EYPA 3CC4F 2BO1A 3IR9A 3JARA 1CK2A 3ZP4A 5MN6A 2R6R1 3L7QA 5LA6A 1N8RH 3D54A 2CVLA 3V7QA 3LWRC 4I50A 1X25A 3C8LA 3T80A 3NK7A 5KX5A 1Q7YH 1FSZA 2Q1YA 5ITZB 1T0KB 2KTUA 4G4VA 3HAXD 1OFUA 3RA6A 3LFOA 3JATA 5AVMA 5CA1B 4TV9A 2CSLA 3IMPA 3JARB 2DT4A 3MBMA 3NK6A 3S0HA 4ZHVA 3KE1A 2F9ZC 4C8EA 3HKCA 1JJ2F 1IV2A 5DCVA 2VXYA 2AMTA 3K12A 3JAWA 2YXZA 3JATB 5HY2A 3MQWA 3CCJF 3MDOA 1VQNF 4X3LA 4X20A 3G6EF 4ZHYB 1IV1A 1RLUA
chains in the Genus database with same CATH topology
2PHNA 2G9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PHN A;  2G9I A; 
#chains in the Genus database with same CATH topology
 1NJI H;  1U40 A;  3HKC B;  3JCM M;  4LNU A;  4BVT A;  2LBX A;  1K8A H;  4PWT A;  3OW2 F;  1Q8R A;  4LCK A;  1VH8 A;  4BT3 A;  3JAW B;  4O4L A;  3RYI A;  3CCV F;  3ZP7 A;  5EZY A;  2CZW A;  2G9I A;  5HP8 A;  1VQ5 F;  4U3J A;  5MN4 A;  2BTO A;  1VQL F;  3G71 F;  3TD4 A;  2BTU A;  3J81 M;  3N2G A;  5LYJ A;  1VQP F;  4X1I A;  5JH7 A;  4BVQ A;  4ZOL A;  3KJK A;  4O4H A;  2HX0 A;  3D01 A;  3UT5 A;  2WAL A;  3N2K A;  3JVH A;  3VOB A;  3C9S A;  3V3T A;  5BMV A;  4O4L B;  3RYI B;  3FD5 A;  4C82 A;  3K14 A;  5JQG A;  2H8E A;  2B33 A;  1SZQ A;  2IAF A;  1Z5V A;  3IKE A;  5CA0 A;  3CCQ F;  1TUB A;  5LXT A;  5LYJ B;  4X1I B;  5JH7 B;  1YJ9 F;  4ZOL B;  3VI6 A;  4O4H B;  3U0O A;  5GIP C;  1U3L A;  3UT5 B;  4I55 A;  3I56 F;  5BMV B;  4EI7 A;  3LME A;  1KNK A;  3VOA A;  4BT6 A;  5KMG A;  5JQG B;  3HJW C;  5LP6 B;  1FFX B;  1UI9 A;  2OTJ F;  4EI9 A;  4DXD A;  1TUB B;  2P6Y A;  2ALE A;  2OHW A;  1Q86 H;  1W59 A;  2DYY A;  5EO3 A;  3PLA C;  1VQK F;  3WGN A;  1X7O A;  4FFB A;  3ON1 A;  5KMG B;  2HVY D;  3WXM B;  2PHN A;  4C4W C;  3M1X A;  1DBF A;  2GLZ A;  2HS0 A;  1NMU B;  4O4I A;  5IYZ A;  3HKD A;  5HP7 A;  3CC7 F;  1U43 A;  1J7H A;  5LOV A;  3J80 M;  1OAP A;  4FFB B;  5GIO C;  1QVG F;  2PMP A;  3LWV C;  3V4D A;  3WPW A;  2QEX F;  3P0Z A;  4G4X A;  3RYH A;  1ODE A;  1SDS A;  3QTY A;  1VQO F;  3CCR F;  1H7M A;  3IEW A;  3WGL A;  3CD6 F;  3OON A;  5IYZ B;  5GAN K;  1ONI A;  5EYP B;  3TD3 A;  4I4T A;  5LOV B;  1M1K H;  4TV8 A;  5LA6 B;  3RYH B;  3CCE F;  4IIJ A;  4I50 B;  3E1Y A;  2IG8 A;  1QVF F;  2ZOV A;  4ZHQ A;  5KX5 B;  4B5C A;  3ERN A;  3OBY A;  3CCM F;  5A2Q M;  1RA4 A;  3VCZ A;  2OTM A;  1K9M H;  4TV9 B;  4BVS A;  2W8B C;  2OTL F;  3HKB A;  1YI2 F;  1KQS F;  1PF5 A;  3G4S F;  1W41 A;  3CCS F;  3QUW A;  4IIJ B;  1U3P A;  3D00 A;  1KNJ A;  1YHQ F;  3M4S A;  4B46 A;  1S72 F;  2L26 A;  4EI8 A;  2VAP A;  3DC2 A;  5FLX M;  2KG4 A;  4BW0 B;  3LYB A;  2OZB A;  5J2T A;  3AGK A;  5EWR A;  1CN7 A;  1NQ3 A;  2Z1U A;  2H6L A;  3HTN A;  4RHA A;  3HKB B;  4X1K A;  4X20 B;  5IT9 M;  2I6R A;  2NMU A;  1Q82 H;  4IHJ A;  3P10 A;  4YJ2 A;  4TZZ A;  4C81 A;  3LWO C;  2HP3 A;  3CCU F;  2GZL A;  4WBN A;  3N4Z A;  4LNU B;  1TVK A;  3DDN A;  5FJ4 C;  2ZF8 A;  1W55 A;  4HNA A;  3CMA F;  5JVD A;  3CC2 F;  5EIB C;  3K2X A;  5HY1 A;  3VYT C;  3CB2 A;  5EZY B;  1QD9 A;  3GHZ A;  4F6R A;  3WJQ A;  4ZHW A;  4U3J B;  1X52 A;  1RQ7 A;  3VYU C;  4O2B A;  2CW4 A;  4KWE A;  3CME F;  2QI2 A;  5EIB D;  1W5A A;  1ZWZ A;  3N2G B;  2RB9 A;  1H47 A;  3HKE A;  4WBN B;  1TVK B;  3S03 A;  3N2K B;  4YJ3 A;  1JD1 A;  4C8G A;  2YYE A;  3E20 B;  4HNA B;  4U39 A;  3I55 F;  3ESJ A;  3IKF A;  3VIU A;  3F0F A;  4F6R B;  2UZH A;  1M90 H;  3C9U A;  1IV4 A;  5IJ9 A;  2BTQ B;  5HXU A;  2IQQ A;  3IEQ A;  5LP6 C;  4DRX A;  5CA0 B;  5LXT B;  3HKE B;  5GON A;  1XV2 A;  5C8Y A;  2R75 1;  4EB6 A;  4YJ3 B;  3KHN A;  4C8I A;  4I55 B;  3ZOP A;  1VHA A;  2QA4 F;  2UYP A;  3GYQ A;  4R40 B;  1W58 1;  4XCQ A;  2Z01 A;  5IJ9 B;  4TUY A;  5B8F A;  2EWC A;  3S0W A;  1UFY A;  3F0E A;  4B45 A;  3FD6 A;  4DRX B;  1W5F A;  1QU9 A;  3GTZ A;  3KJJ A;  1SA0 A;  5JCO A;  4ERH A;  5HY4 A;  3CPQ A;  4EB6 B;  1VQM F;  1W42 A;  2ZVY A;  2AIF A;  3WGJ A;  2H8C A;  1VQ9 F;  1YQN A;  2HQS C;  1W40 A;  3JAM M;  2QTP A;  3RA5 A;  3K0T A;  2Q1X A;  1COM A;  3JAS A;  2UYK A;  1VQ7 F;  1E7K A;  3RYF A;  5FNV A;  1W5E A;  4O4I B;  4ZK7 A;  4BT7 A;  1SA0 B;  3HKD B;  3F6M A;  3M84 A;  3TD5 A;  4X1Y A;  2Z1T A;  5EAZ A;  4B62 A;  4G4Y A;  3VO8 A;  1XHO A;  4O2A A;  5EB0 A;  5CA1 A;  3VMF B;  5J2U A;  3LWQ C;  3LWP C;  3JAS B;  3I7T A;  1RLG A;  2HS4 A;  2LBT A;  5GIN C;  1H48 A;  2V9Y A;  4O4J A;  5FNV B;  3RYF B;  2FC3 A;  4G4Z A;  2CHT A;  4X1Y B;  4I4T B;  3MCQ A;  1JY8 A;  3I3F A;  3CPW F;  1W2B F;  4NWO B;  3BYQ A;  4O2A B;  5J2U B;  1KD1 H;  4TV8 B;  4BT2 A;  1Z5W A;  1W3E X;  1XBI A;  3CG6 A;  4ZHQ B;  3RE3 A;  3V7E A;  4O4J B;  3E22 A;  5HXZ A;  2RHL A;  3ELC A;  1VQV A;  3NVK E;  3S02 A;  3S06 A;  5G4U C;  2HRU A;  1GX1 A;  3CYQ A;  3O85 A;  4NQ3 A;  2ZOD A;  4G88 A;  2N48 A;  3FBA A;  1IPA A;  3C9R A;  5CB4 A;  2Z1E A;  1PXW A;  1Q81 H;  1IV3 A;  2MQE A;  2GVI A;  3E22 B;  3Q8H A;  1FNK A;  3R0P A;  4X3M A;  5IJ0 A;  2FGY A;  2HS3 A;  3CYP B;  4NUT A;  5J2T B;  1W5B A;  2KTV A;  3HWU A;  3CXC F;  3MCA B;  1YIJ F;  3J7A R;  4X1K B;  1GZ0 A;  3N4Y A;  2VGM A;  2UYJ A;  4IHJ B;  4YJ2 B;  3ZO8 A;  5CB4 B;  3C9T A;  1GO0 A;  1GO1 A;  2LCA A;  3F0G A;  5IJ0 B;  3EOR A;  2RHO A;  1YIT F;  1K73 H;  3P4E A;  1VQ6 F;  3RYC A;  5JVD B;  3JAL A;  4BT5 A;  3NVI B;  5G4V C;  1JN1 A;  3PAF A;  3WGK A;  5LP6 A;  4O2B B;  1FFX A;  5EB1 B;  3SIU A;  2CHS A;  3WGM A;  3FFM A;  4E6E A;  1CLI A;  2VAW A;  1YGY A;  2LBW A;  1X7P A;  1YJW F;  3VTI C;  3FPI A;  1JFF A;  3RYC B;  3NMU C;  5HWE A;  3SIV A;  2UYN A;  2HP0 A;  4ZI7 A;  3JAL B;  2KGW A;  3JAK A;  1RQ2 A;  3S0Y A;  2VAM A;  4G4W A;  2ZAU A;  3OBW A;  3VYS C;  1W57 A;  2AIZ P;  4BVR A;  1XRG A;  5GON B;  3WJP A;  4M8I A;  5C8Y B;  2I6D A;  5MN5 A;  4BY9 D;  3B6N A;  5GAP K;  1VK3 A;  1JFF B;  3QHD A;  4RQO A;  3KIZ A;  3WJR A;  1T0A A;  3CCL F;  2UYN B;  1R1M A;  2HP0 B;  4ZI7 B;  2RHH A;  3JAK B;  1YJN F;  3F0D A;  5HY0 A;  2RHJ A;  4TUY B;  1FNJ A;  3LDT A;  2JNB A;  2CWJ A;  1KC8 H;  1DT9 A;  5ITZ A;  2HRY A;  4BT4 A;  2VGN A;  2Z1F A;  2ZVZ A;  1VQ8 F;  3WPX A;  1VQ4 F;  1QAH A;  2K1S A;  5JCO C;  5EYP A;  3CC4 F;  2BO1 A;  3IR9 A;  3JAR A;  1CK2 A;  3ZP4 A;  5MN6 A;  2R6R 1;  3L7Q A;  5LA6 A;  1N8R H;  3D54 A;  2CVL A;  3V7Q A;  3LWR C;  4I50 A;  1X25 A;  3C8L A;  3T80 A;  3NK7 A;  5KX5 A;  1Q7Y H;  1FSZ A;  2Q1Y A;  5ITZ B;  1T0K B;  2KTU A;  4G4V A;  3HAX D;  1OFU A;  3RA6 A;  3LFO A;  3JAT A;  5AVM A;  5CA1 B;  4TV9 A;  2CSL A;  3IMP A;  3JAR B;  2DT4 A;  3MBM A;  3NK6 A;  3S0H A;  4ZHV A;  3KE1 A;  2F9Z C;  4C8E A;  3HKC A;  1JJ2 F;  1IV2 A;  5DCV A;  2VXY A;  2AMT A;  3K12 A;  3JAW A;  2YXZ A;  3JAT B;  5HY2 A;  3MQW A;  3CCJ F;  3MDO A;  1VQN F;  4X3L A;  4X20 A;  3G6E F;  4ZHY B;  1IV1 A;  1RLU A; 
#chains in the Genus database with same CATH homology
 2PHN A;  2G9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...