2G9IA

Crystal structure of homolog of f420-0:gamma-glutamyl ligase from archaeoglobus fulgidus reveals a novel fold.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
249
structure length
233
Chain Sequence
MRVEVFPVEGLPLIKEGDDLAELISSRVRFEDGDVLVVCSTVISKAEGRIRRLEEFNPSERAKEIAARIGKPAEFVQAVLEESEEVLLDFPFLLVKAKFGNVCVNAGIDASNVEEGSLLLPPLDPDGSAEKLRRRILELTGKRVGVIITDTNGRCFRRGVVGFAIGISGVKAMKDWVTVECVADEIAAFANLLMGGIPAVVVRGLNVAGEGSMEEIYRSEEEDVIRRCLKRCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an amide bond forming F(420):gamma-glutamyl ligase from Archaeoglobus fulgidus -- a member of a new family of non-ribosomal peptide synthases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ligase
molecule keywords F420-0:gamma-glutamyl ligase
total genus 61
structure length 233
sequence length 249
chains with identical sequence B
ec nomenclature ec 6.3.2.31: Coenzyme F420-0:L-glutamate ligase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01996 F420_ligase F420-0:Gamma-glutamyl ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.100 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; CofE-like 2g9iA01
3.90.1660.10 Alpha Beta Alpha-Beta Complex CofE-like fold CofE-like domain 2g9iA02
2PHNA 2G9IA
chains in the Genus database with same CATH superfamily
5LOVB 1U40A 1ZWZA 5IJ0A 1FNKA 2LCAA 5HY1A 4FFBA 3RE3A 5HXZA 4ZHQB 3CD6F 4WBNA 3RYIA 3LWRC 3S0YA 4C8GA 2YXZA 5CB4A 5EYPA 3OW2F 4ZHYB 3CMAF 1YJNF 1VQKF 1H47A 3G4SF 2HS4A 1IPAA 3E20B 2B33A 1QD9A 3KJJA 1RQ7A 4C8IA 2K1SA 3AGKA 4G4VA 1IV3A 3VYSC 4C81A 2ALEA 2CWJA 3J80M 2HRUA 2BO1A 3J7AR 4B5CA 5LOVA 3NVIB 3CG6A 1KNJA 3R0PA 1CLIA 3JASB 4YJ3A 4FFBB 1NMUB 1ONIA 1VQPF 3DC2A 5LP6A 4DRXA 1XBIA 3MDOA 1YITF 3RYFA 3WGKA 1Q7YH 4ZHQA 3N2KA 1XHOA 4X1IB 2LBTA 3V7EA 3CCQF 4WBNB 2RHHA 2Z1TA 3C9SA 3JAMM 1IV2A 2AIFA 3WGJA 4R40B 2VAWA 4O4HB 3K14A 5FLXM 2CVLA 5LP6C 4EI9A 4DXDA 1VQVA 3CCVF 5EB1B 5IJ9B 3RYCA 5GONB 4RHAA 2P6YA 3GTZA 1U3PA 3JALA 2FC3A 5EO3A 5LA6A 2BTOA 2QI2A 3FBAA 5C8YB 3HKEB 4G4YA 3OBWA 5HXUA 4TV8B 5GIOC 3WGMA 5LYJB 2RHLA 3JASA 4YJ3B 3MQWA 4KWEA 1GX1A 3WXMB 3RYFB 3JVHA 1RQ2A 3LWQC 1J7HA 3CCMF 4IIJB 3LMEA 2AIZP 4O4IB 4X20A 2LBXA 1K8AH 1W5EA 1W3EX 2R6R1 1VH8A 5LXTA 5CA0B 3F0DA 2H8EA 1W40A 4G88A 3M1XA 4IHJA 1OFUA 3Q8HA 2ZVZA 2UYKA 3HKDB 5EIBD 3I56F 2NMUA 3HKCB 2BTUA 5DCVA 1GO0A 3PAFA 3LWPC 1Z5WA 3QHDA 4YJ2A 1U43A 3F0EA 1N8RH 3C9UA 4BVSA 4LNUA 1QVGF 3O85A 1COMA 1GO1A 4C82A 4F6RB 4I50A 1Q8RA 5JQGB 3IKEA 5GAPK 1W5AA 4HNAB 4BT6A 5JH7A 1OAPA 3CCUF 1RLGA 3E22B 4TUYA 4BT3A 4O2BB 2HRYA 2JNBA 2R751 3N4ZA 5IT9M 3VOAA 3CPQA 3RYHA 2YYEA 1Q86H 1SA0A 1KD1H 2KTUA 3HKBA 3S0WA 5LXTB 5KX5A 5CA0A 5MN4A 3RA6A 1TVKA 4U3JB 4IHJB 2OHWA 2HP0A 1W5FA 3P10A 3HKCA 3J81M 4B62A 3I7TA 2GVIA 3V3TA 4YJ2B 1FFXB 1JFFB 2QA4F 5FNVA 4I4TB 2V9YA 3DDNA 3D00A 2GLZA 4NQ3A 4I55B 2H8CA 2KG4A 3WPWA 1T0KB 4HNAA 5HY0A 3F0GA 3L7QA 5IYZB 1YHQF 3ZO8A 3E22A 4TUYB 3CPWF 4O2BA 1GZ0A 3S02A 2HQSC 1YI2F 2N48A 3HJWC 3VYUC 1VK3A 2OTLF 3UT5B 2UYNA 3JATA 2L26A 4B45A 5HY4A 5MN5A 1TVKB 4U3JA 1KNKA 3CC2F 3HWUA 3V7QA 1CN7A 1QVFF 5G4VC 3F0FA 3NMUC 1FFXA 3VI6A 2VAMA 2ZVYA 2CSLA 2RHOA 4X1YB 3M84A 2RHJA 4EI8A 3WGLA 4G4XA 5EAZA 5FJ4C 1W57A 3N2GA 3CYPB 2UZHA 5J2UB 3C8LA 5IYZA 1SDSA 1VQNF 5J2TB 3NK7A 1W2BF 1VQ8F 3WJPA 1W59A 4E6EA 5EIBC 2CHSA 3JATB 3IMPA 4RQOA 1E7KA 1W42A 3RYIB 2F9ZC 3JAKB 3CC4F 1UI9A 2DT4A 3NVKE 3TD3A 1M1KH 1ODEA 3U0OA 4O2AB 5ITZB 4ZI7B 2CW4A 1PF5A 2UYJA 2G9IA 4M8IA 3QUWA 4O4LA 4X1YA 3CB2A 3OBYA 1H7MA 3JAWA 2PMPA 3KE1A 3N2GB 2MQEA 5J2UA 1W5BA 2VXYA 3RA5A 4G4ZA 1VQ5F 5AVMA 1YIJF 2FGYA 3BYQA 5LP6B 4B46A 3MCQA 3GYQA 1VQLF 3ERNA 3MBMA 2HS0A 3G71F 5GINC 3ZP7A 2GZLA 5CB4B 3K2XA 5EYPB 3I3FA 4C8EA 3LWVC 3JAKA 1T0AA 2ZOVA 3PLAC 2LBWA 1Q82H 1KQSF 2OTMA 4X1KB 1W55A 3EORA 1CK2A 3RYCB 1NJIH 2ZF8A 3LYBA 1X52A 3JALB 1X7OA 5LA6B 2BTQB 3CXCF 3P4EA 3SIVA 1IV1A 1TUBA 3KIZA 4NUTA 3IKFA 4PWTA 3V4DA 3HKEA 3IEWA 2Z01A 5JVDB 4EB6A 5CA1B 3LWOC 1U3LA 5GANK 4DRXB 3CMEF 3VCZA 3N2KB 4X1IA 2RB9A 1VQMF 1VQ7F 1K9MH 4IIJA 1IV4A 4BY9D 2IAFA 1NQ3A 3QTYA 4BW0B 3VO8A 3HAXD 4O4HA 3TD4A 4BVRA 3WJRA 2Z1FA 3GHZA 2DYYA 4X3MA 1YJ9F 4X20B 4X1KA 1YGYA 1QAHA 5IJ9A 1KC8H 4ZOLA 5BMVA 3FPIA 5GONA 3FFMA 5JCOA 3JARB 3CCRF 2HX0A 4G4WA 5KMGB 3OONA 5HY2A 2PHNA 3G6EF 1X25A 3HKDA 5C8YA 3S03A 1DT9A 1TUBB 1W41A 4BVTA 4LCKA 3IR9A 1M90H 3JCMM 4TV8A 1Z5VA 3KJKA 5LYJA 4EB6B 5CA1A 5JVDA 3KHNA 3D01A 3CCLF 3WGNA 4LNUB 2H6LA 4ZHWA 4O4JA 4X3LA 3HTNA 3SIUA 1YJWF 3B6NA 3CCSF 5JH7B 4O4IA 4BT4A 3ELCA 4ERHA 3WPXA 3E1YA 4TV9B 3WJQA 2VAPA 1YQNA 1DBFA 2HP3A 3N4YA 2ZAUA 3RYHB 1S72F 1R1MA 2KTVA 5EB0A 4ZOLB 5BMVB 3NK6A 2AMTA 3JARA 2QTPA 3FD6A 5KMGA 1UFYA 2CZWA 3TD5A 3C9RA 5MN6A 3I55F 1K73H 3CYQA 3LFOA 3K12A 5B8FA 2VGMA 1VQOF 2I6DA 2HVYD 2ZODA 1JD1A 1H48A 1JN1A 1XV2A 3VIUA 5FNVB 3VOBA 4F6RA 3CC7F 4I50B 4BT7A 5JQGA 3ZP4A 5HP7A 3C9TA 4O4JB 5HWEA 4I55A 2UYPA 2OZBA 4BVQA 2OTJF 3VTIC 2W8BC 1FNJA 2CHTA 1PXWA 3IEQA 5EZYB 5A2QM 4TV9A 4BT5A 3LDTA 1SA0B 3HKBB 5HP8A 5KX5B 3UT5A 4EI7A 4ZK7A 2UYNB 1SZQA 3VYTC 2Q1XA 5EWRA 2Q1YA 2HP0B 4C4WC 3ZOPA 3MCAB 5JCOC 1FSZA 1JFFA 3CCEF 1RLUA 2HS3A 4I4TA 1VHAA 2KGWA 3S06A 3VMFB 1VQ4F 2I6RA 3P0ZA 3ESJA 4U39A 2VGNA 2EWCA 4TZZA 2WALA 5GIPC 1XRGA 5IJ0B 3ON1A 1QU9A 1JJ2F 5EZYA 1Q81H 3K0TA 2QEXF 3CCJF 5J2TA 4XCQA 2IG8A 2Z1UA 3D54A 5G4UC 1X7PA 2IQQA 3S0HA 1VQ6F 3T80A 1VQ9F 3FD5A 1RA4A 3F6MA 1JY8A 4O2AA 4BT2A 4ZI7A 5ITZA 3M4SA 1W581 4O4LB 4NWOB 3JAWB 2Z1EA 4ZHVA
chains in the Genus database with same CATH topology
2PHNA 2G9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PHN A;  2G9I A; 
#chains in the Genus database with same CATH topology
 5LOV B;  1U40 A;  1ZWZ A;  5IJ0 A;  1FNK A;  2LCA A;  5HY1 A;  4FFB A;  3RE3 A;  5HXZ A;  4ZHQ B;  3CD6 F;  4WBN A;  3RYI A;  3LWR C;  3S0Y A;  4C8G A;  2YXZ A;  5CB4 A;  5EYP A;  3OW2 F;  4ZHY B;  3CMA F;  1YJN F;  1VQK F;  1H47 A;  3G4S F;  2HS4 A;  1IPA A;  3E20 B;  2B33 A;  1QD9 A;  3KJJ A;  1RQ7 A;  4C8I A;  2K1S A;  3AGK A;  4G4V A;  1IV3 A;  3VYS C;  4C81 A;  2ALE A;  2CWJ A;  3J80 M;  2HRU A;  2BO1 A;  3J7A R;  4B5C A;  5LOV A;  3NVI B;  3CG6 A;  1KNJ A;  3R0P A;  1CLI A;  3JAS B;  4YJ3 A;  4FFB B;  1NMU B;  1ONI A;  1VQP F;  3DC2 A;  5LP6 A;  4DRX A;  1XBI A;  3MDO A;  1YIT F;  3RYF A;  3WGK A;  1Q7Y H;  4ZHQ A;  3N2K A;  1XHO A;  4X1I B;  2LBT A;  3V7E A;  3CCQ F;  4WBN B;  2RHH A;  2Z1T A;  3C9S A;  3JAM M;  1IV2 A;  2AIF A;  3WGJ A;  4R40 B;  2VAW A;  4O4H B;  3K14 A;  5FLX M;  2CVL A;  5LP6 C;  4EI9 A;  4DXD A;  1VQV A;  3CCV F;  5EB1 B;  5IJ9 B;  3RYC A;  5GON B;  4RHA A;  2P6Y A;  3GTZ A;  1U3P A;  3JAL A;  2FC3 A;  5EO3 A;  5LA6 A;  2BTO A;  2QI2 A;  3FBA A;  5C8Y B;  3HKE B;  4G4Y A;  3OBW A;  5HXU A;  4TV8 B;  5GIO C;  3WGM A;  5LYJ B;  2RHL A;  3JAS A;  4YJ3 B;  3MQW A;  4KWE A;  1GX1 A;  3WXM B;  3RYF B;  3JVH A;  1RQ2 A;  3LWQ C;  1J7H A;  3CCM F;  4IIJ B;  3LME A;  2AIZ P;  4O4I B;  4X20 A;  2LBX A;  1K8A H;  1W5E A;  1W3E X;  2R6R 1;  1VH8 A;  5LXT A;  5CA0 B;  3F0D A;  2H8E A;  1W40 A;  4G88 A;  3M1X A;  4IHJ A;  1OFU A;  3Q8H A;  2ZVZ A;  2UYK A;  3HKD B;  5EIB D;  3I56 F;  2NMU A;  3HKC B;  2BTU A;  5DCV A;  1GO0 A;  3PAF A;  3LWP C;  1Z5W A;  3QHD A;  4YJ2 A;  1U43 A;  3F0E A;  1N8R H;  3C9U A;  4BVS A;  4LNU A;  1QVG F;  3O85 A;  1COM A;  1GO1 A;  4C82 A;  4F6R B;  4I50 A;  1Q8R A;  5JQG B;  3IKE A;  5GAP K;  1W5A A;  4HNA B;  4BT6 A;  5JH7 A;  1OAP A;  3CCU F;  1RLG A;  3E22 B;  4TUY A;  4BT3 A;  4O2B B;  2HRY A;  2JNB A;  2R75 1;  3N4Z A;  5IT9 M;  3VOA A;  3CPQ A;  3RYH A;  2YYE A;  1Q86 H;  1SA0 A;  1KD1 H;  2KTU A;  3HKB A;  3S0W A;  5LXT B;  5KX5 A;  5CA0 A;  5MN4 A;  3RA6 A;  1TVK A;  4U3J B;  4IHJ B;  2OHW A;  2HP0 A;  1W5F A;  3P10 A;  3HKC A;  3J81 M;  4B62 A;  3I7T A;  2GVI A;  3V3T A;  4YJ2 B;  1FFX B;  1JFF B;  2QA4 F;  5FNV A;  4I4T B;  2V9Y A;  3DDN A;  3D00 A;  2GLZ A;  4NQ3 A;  4I55 B;  2H8C A;  2KG4 A;  3WPW A;  1T0K B;  4HNA A;  5HY0 A;  3F0G A;  3L7Q A;  5IYZ B;  1YHQ F;  3ZO8 A;  3E22 A;  4TUY B;  3CPW F;  4O2B A;  1GZ0 A;  3S02 A;  2HQS C;  1YI2 F;  2N48 A;  3HJW C;  3VYU C;  1VK3 A;  2OTL F;  3UT5 B;  2UYN A;  3JAT A;  2L26 A;  4B45 A;  5HY4 A;  5MN5 A;  1TVK B;  4U3J A;  1KNK A;  3CC2 F;  3HWU A;  3V7Q A;  1CN7 A;  1QVF F;  5G4V C;  3F0F A;  3NMU C;  1FFX A;  3VI6 A;  2VAM A;  2ZVY A;  2CSL A;  2RHO A;  4X1Y B;  3M84 A;  2RHJ A;  4EI8 A;  3WGL A;  4G4X A;  5EAZ A;  5FJ4 C;  1W57 A;  3N2G A;  3CYP B;  2UZH A;  5J2U B;  3C8L A;  5IYZ A;  1SDS A;  1VQN F;  5J2T B;  3NK7 A;  1W2B F;  1VQ8 F;  3WJP A;  1W59 A;  4E6E A;  5EIB C;  2CHS A;  3JAT B;  3IMP A;  4RQO A;  1E7K A;  1W42 A;  3RYI B;  2F9Z C;  3JAK B;  3CC4 F;  1UI9 A;  2DT4 A;  3NVK E;  3TD3 A;  1M1K H;  1ODE A;  3U0O A;  4O2A B;  5ITZ B;  4ZI7 B;  2CW4 A;  1PF5 A;  2UYJ A;  2G9I A;  4M8I A;  3QUW A;  4O4L A;  4X1Y A;  3CB2 A;  3OBY A;  1H7M A;  3JAW A;  2PMP A;  3KE1 A;  3N2G B;  2MQE A;  5J2U A;  1W5B A;  2VXY A;  3RA5 A;  4G4Z A;  1VQ5 F;  5AVM A;  1YIJ F;  2FGY A;  3BYQ A;  5LP6 B;  4B46 A;  3MCQ A;  3GYQ A;  1VQL F;  3ERN A;  3MBM A;  2HS0 A;  3G71 F;  5GIN C;  3ZP7 A;  2GZL A;  5CB4 B;  3K2X A;  5EYP B;  3I3F A;  4C8E A;  3LWV C;  3JAK A;  1T0A A;  2ZOV A;  3PLA C;  2LBW A;  1Q82 H;  1KQS F;  2OTM A;  4X1K B;  1W55 A;  3EOR A;  1CK2 A;  3RYC B;  1NJI H;  2ZF8 A;  3LYB A;  1X52 A;  3JAL B;  1X7O A;  5LA6 B;  2BTQ B;  3CXC F;  3P4E A;  3SIV A;  1IV1 A;  1TUB A;  3KIZ A;  4NUT A;  3IKF A;  4PWT A;  3V4D A;  3HKE A;  3IEW A;  2Z01 A;  5JVD B;  4EB6 A;  5CA1 B;  3LWO C;  1U3L A;  5GAN K;  4DRX B;  3CME F;  3VCZ A;  3N2K B;  4X1I A;  2RB9 A;  1VQM F;  1VQ7 F;  1K9M H;  4IIJ A;  1IV4 A;  4BY9 D;  2IAF A;  1NQ3 A;  3QTY A;  4BW0 B;  3VO8 A;  3HAX D;  4O4H A;  3TD4 A;  4BVR A;  3WJR A;  2Z1F A;  3GHZ A;  2DYY A;  4X3M A;  1YJ9 F;  4X20 B;  4X1K A;  1YGY A;  1QAH A;  5IJ9 A;  1KC8 H;  4ZOL A;  5BMV A;  3FPI A;  5GON A;  3FFM A;  5JCO A;  3JAR B;  3CCR F;  2HX0 A;  4G4W A;  5KMG B;  3OON A;  5HY2 A;  2PHN A;  3G6E F;  1X25 A;  3HKD A;  5C8Y A;  3S03 A;  1DT9 A;  1TUB B;  1W41 A;  4BVT A;  4LCK A;  3IR9 A;  1M90 H;  3JCM M;  4TV8 A;  1Z5V A;  3KJK A;  5LYJ A;  4EB6 B;  5CA1 A;  5JVD A;  3KHN A;  3D01 A;  3CCL F;  3WGN A;  4LNU B;  2H6L A;  4ZHW A;  4O4J A;  4X3L A;  3HTN A;  3SIU A;  1YJW F;  3B6N A;  3CCS F;  5JH7 B;  4O4I A;  4BT4 A;  3ELC A;  4ERH A;  3WPX A;  3E1Y A;  4TV9 B;  3WJQ A;  2VAP A;  1YQN A;  1DBF A;  2HP3 A;  3N4Y A;  2ZAU A;  3RYH B;  1S72 F;  1R1M A;  2KTV A;  5EB0 A;  4ZOL B;  5BMV B;  3NK6 A;  2AMT A;  3JAR A;  2QTP A;  3FD6 A;  5KMG A;  1UFY A;  2CZW A;  3TD5 A;  3C9R A;  5MN6 A;  3I55 F;  1K73 H;  3CYQ A;  3LFO A;  3K12 A;  5B8F A;  2VGM A;  1VQO F;  2I6D A;  2HVY D;  2ZOD A;  1JD1 A;  1H48 A;  1JN1 A;  1XV2 A;  3VIU A;  5FNV B;  3VOB A;  4F6R A;  3CC7 F;  4I50 B;  4BT7 A;  5JQG A;  3ZP4 A;  5HP7 A;  3C9T A;  4O4J B;  5HWE A;  4I55 A;  2UYP A;  2OZB A;  4BVQ A;  2OTJ F;  3VTI C;  2W8B C;  1FNJ A;  2CHT A;  1PXW A;  3IEQ A;  5EZY B;  5A2Q M;  4TV9 A;  4BT5 A;  3LDT A;  1SA0 B;  3HKB B;  5HP8 A;  5KX5 B;  3UT5 A;  4EI7 A;  4ZK7 A;  2UYN B;  1SZQ A;  3VYT C;  2Q1X A;  5EWR A;  2Q1Y A;  2HP0 B;  4C4W C;  3ZOP A;  3MCA B;  5JCO C;  1FSZ A;  1JFF A;  3CCE F;  1RLU A;  2HS3 A;  4I4T A;  1VHA A;  2KGW A;  3S06 A;  3VMF B;  1VQ4 F;  2I6R A;  3P0Z A;  3ESJ A;  4U39 A;  2VGN A;  2EWC A;  4TZZ A;  2WAL A;  5GIP C;  1XRG A;  5IJ0 B;  3ON1 A;  1QU9 A;  1JJ2 F;  5EZY A;  1Q81 H;  3K0T A;  2QEX F;  3CCJ F;  5J2T A;  4XCQ A;  2IG8 A;  2Z1U A;  3D54 A;  5G4U C;  1X7P A;  2IQQ A;  3S0H A;  1VQ6 F;  3T80 A;  1VQ9 F;  3FD5 A;  1RA4 A;  3F6M A;  1JY8 A;  4O2A A;  4BT2 A;  4ZI7 A;  5ITZ A;  3M4S A;  1W58 1;  4O4L B;  4NWO B;  3JAW B;  2Z1E A;  4ZHV A; 
#chains in the Genus database with same CATH homology
 2PHN A;  2G9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...