2G9XB

Structure of thr 160 phosphorylated cdk2/cyclin a in complex with the inhibitor nu6271
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
262
structure length
262
Chain Sequence
b'GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 2
publication title Searching for Cyclin-Dependent Kinase Inhibitors Using a New Variant of the Cope Elimination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 97
structure length 262
sequence length 262
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2g9xB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2g9xB02
3EOCB 3BLRB 1H1SB 4F7JB 4F70B 2QDJA 3O0GD 1H1RB 2C5NB 3BLQB 4F7LB 4IMYB 4EORB 1OI9B 3F5XB 4TTHA 2BKZB 2WIPB 3MI9B 2R7GA 4BCIB 5L2WB 2I53A 4I3ZB 4EOPB 4ELJA 1D3UB 4KRDB 4YOOA 1OIUB 1H27B 1JKWA 3MY1B 2UUEB 4NSTB 4EC8B 4YC3B 1URCB 1JOWA 2V22B 4EOIB 1G3NC 2C6TB 5BNJB 2WPAB 1C9BA 4BCQB 3H4CA 1OGUB 1GUXA 2W2HA 2W9ZA 4BCMD 1E9HB 1OKWB 4EOQB 2C5VB 1F5QB 2UZDB 1H1QB 5I5ZB 1AISB 3BHTB 2UZLB 3MY5B 4EOMB 4EOOB 4F6WB 2F2CA 3QHWB 1FINB 4CFXB 4ELLA 3TNWB 1OL2B 5ACBA 5ICPB 1JSUB 1GUXB 2B9RA 2C5OB 1OL1B 4BCND 4ROEA 4CFMB 4BCPB 2G9XB 1H4LD 1ZP2A 4CXAB 2WHBB 5HBHB 1OIYB 3RGFB 1VYWB 4F6SB 2JGZB 4BCOB 1P5EB 1PKDB 1W98B 3QHRB 4CRLB 4F7NB 5LMKB 4CFVB 4BCJB 1JSTB 4YOZA 2W99A 2IW8B 3BHVB 4EONB 4UN0A 1H25B 4F7SB 1VOLA 2WXVB 3BLHB 4RODA 1FVVB 4CFNB 1UNHD 3K7AM 2WFYB 4EOLB 5HBEB 5IDNB 3TNIB 3DDQB 4CFUD 1KXUA 3G33B 2WMAB 4BCKB 4CFWB 1H1PB 4BCMB 2WMBB 3TN8B 2X1NB 4EOKB 2UZEB 3DOGB 1QMZB 2PK9B 1H26B 5HNBB 5IDPB 5LQFB 2UZBB 2W96A 2WIHB 4II5B 2CJMB 4OR5B 1H24B 2BPMB 4ROCA 2CCIB 3EJ1B 2IW9B 2IVXA 4BCNB 1AD6A 1H28B 1BU2A 1N4MA 3TNHB 1VINA 4FX3B 3M03A 3MIAB 4G6LB 4OGRB 2I40B 2WEVB 5HVYB 2EUFA 1GH6B 2IW6B 5HBJB 3LQ5B 5FGKB 4EOJB 1XO2A 2W9FA 1GY3B 5HQ0B 1UNGD 4BCQD 2C5XB 5EFQB 5CEIB 3EIDB 4YOSA 4F6UB 4KRCB 5IF1B 1O9KA 2PHGA 2PK2A 4Y72B 4BCFB 3BHUB 4BCGB 4BCHB 1TFBA 3POMA 2C4GB 4EC9B 5CYIB 1O9KB 4EOSB 1UNLD 1OKVB 4CFUB 2CCHB 3DDPB 2PMIB
chains in the Genus database with same CATH superfamily
3BG9A 3O0GD 1H1RB 4BBSM 3BLQB 4NC6A 4HLQA 4IMYB 2BKZB 2KR6A 4I3ZB 1D3UB 4KRDB 1FKMA 1OIUB 4YC3B 4EOIB 2C6TB 1C9BA 2CYZB 3QXEB 4OB3B 1F5QB 3QWLA 1H1QB 5I5ZB 3BHTB 4EOMB 3HZJA 1OL2B 4BBRM 3HBLA 1JSUB 2B9RA 3RGFB 1VYWB 4AI6A 2JGZB 4QSHA 1PKDB 4CRLB 3QYEA 3WVEB 4HNUA 1FVVB 3K7AM 2WFYB 4BXXX 4EOLB 2BS4A 4CFUD 2QFZA 3BG3A 3DOGB 5HNBB 5IDPB 1H26B 5EJCA 5LQFB 4OR5B 4ROCA 3EJ1B 2IW9B 1AD6A 1H28B 4OGRB 3LQ5B 3TW6A 2W9FA 5HQ0B 4BCQD 2C5XB 3EIDB 4AKIA 3X25B 3A8OB 3HO8A 1UGQB 3POMA 1OKVB 4CFUB 2CCHB 3EOCB 4F70B 2ZPHB 2C5NB 4F7LB 3F5XB 3X24B 2KMGA 2R7GA 2I53A 3MY1B 4EC8B 4Z6YA 4BCQB 1OGUB 1GUXA 4MIMA 1UGPB 2W9ZA 4BCMD 4EOQB 1AISB 3MY5B 2CZ7B 2F2CA 3TNWB 3BG5A 1GUXB 4HL4A 2C5OB 4ROEA 3GTMS 2G9XB 4CXAB 5HBHB 2ZPEB 2BS3A 3PO3S 5LMKB 2IW8B 3HHTB 4LOCA 4UN0A 1VOLA 2WXVB 4RODA 2DPPB 2ZPGB 2ZZDB 5IDNB 3TNIB 3DDQB 3NDQA 4AKHA 2ZPBB 2G77A 4JX4A 4CFWB 1H1PB 4BCMB 3TN8B 2X1NB 3QYGB 2UZBB 2WIHB 2CJMB 1H24B 3DTOA 2IVXA 4M6VA 3TNHB 3QZ9B 3M03A 3MIAB 4JX5A 2IW6B 1GY3B 2CZ1B 2D0QB 3WVDB 5CEIB 4BY1X 4ZGJB 4F6UB 4KRCB 2PK2A 4BCFB 3BHUB 4BCHB 2C4GB 4EC9B 5CYIB 4EOSB 3DDPB 3DL1A 3BLRB 4F7JB 3TW7A 2QDJA 4EORB 1OI9B 2WIPB 1H27B 1JKWA 2QF7A 5BNJB 2WPAB 2CZ6B 1E9HB 1OKWB 2C5VB 2UZDB 2UZLB 2ZPIB 1FINB 4CFXB 5ACBA 3VKGA 5ICPB 1OL1B 4BCND 4CFMB 4MFEA 1H4LD 1UGSB 2DD4B 2WHBB 3A8MB 4F6SB 2QGSA 4BCOB 1P5EB 1W98B 3QHRB 4CFVB 4YOZA 3A8GB 2W99A 4EONB 1H25B 4FM4B 1UNHD 3X20B 5HBEB 2IN3A 1QLBA 2WMAB 2ZPFB 4EOKB 2PK9B 3QYBA 4II5B 2BPMB 2CCIB 4OB0B 4BCNB 3A8LB 2I40B 5HVYB 2LW4A 1GH6B 4EOJB 1XO2A 3VYHB 3X28B 4BY7X 3VKHA 1UNGD 2DMEA 5IF1B 3A8HB 1O9KA 2PHGA 4Y72B 1E7PA 2CZ0B 2AHJB 1UGRB 1O9KB 3X26B 1V29B 2BS2A 1H1SB 4TTHA 3MI9B 4BCIB 5L2WB 4EOPB 4ELJA 4YOOA 1ENWA 4OB2B 2UUEB 4NSTB 1URCB 1JOWA 2V22B 3DJBA 1G3NC 2QDYB 3H4CA 2W2HA 4HNTA 1AHJB 4EOOB 4F6WB 3QHWB 4AKGA 4ELLA 4MFDA 4BCPB 1ZP2A 1OIYB 2ZCFB 4ZGEB 4F7NB 4BCJB 1JSTB 3BHVB 4F7SB 3BLHB 4CFNB 1IREB 3VYGB 2PJQA 2WJ9A 1KXUA 3G33B 4BCKB 2WMBB 2UZEB 1QMZB 3QZ5B 2W96A 1TD6A 3HB9A 2DXBB 4HNVA 1BU2A 1N4MA 1VINA 4FX3B 4G6LB 2WEVB 2EUFA 3QYHB 5FGKB 5HBJB 5DQWA 5EFQB 2DXCB 4YOSA 3B57A 4JX6A 4BCGB 1TFBA 2QQ8A 4OB1B 1UNLD 3KHIA 5IHYA 5DQVA 2DD5B 4ZGDB 2PMIB
chains in the Genus database with same CATH topology
3EOCB 3BLRB 1H1SB 4F7JB 4F70B 2QDJA 3O0GD 1H1RB 2C5NB 3BLQB 4F7LB 4IMYB 4EORB 1OI9B 3F5XB 4TTHA 2BKZB 2WIPB 3MI9B 2R7GA 4BCIB 5L2WB 2I53A 4I3ZB 4EOPB 4ELJA 1D3UB 4KRDB 4YOOA 1OIUB 1H27B 1JKWA 3MY1B 2UUEB 4NSTB 4EC8B 4YC3B 1URCB 1JOWA 2V22B 4EOIB 1G3NC 2C6TB 5BNJB 2WPAB 1C9BA 4BCQB 3H4CA 1OGUB 1GUXA 2W2HA 2W9ZA 4BCMD 1E9HB 1OKWB 4EOQB 2C5VB 1F5QB 2UZDB 1H1QB 5I5ZB 1AISB 3BHTB 2UZLB 3MY5B 4EOMB 4EOOB 4F6WB 2F2CA 3QHWB 1FINB 4CFXB 4ELLA 3TNWB 1OL2B 5ACBA 5ICPB 1JSUB 1GUXB 2B9RA 2C5OB 1OL1B 4BCND 4ROEA 4CFMB 4BCPB 2G9XB 1H4LD 1ZP2A 4CXAB 2WHBB 5HBHB 1OIYB 3RGFB 1VYWB 4F6SB 2JGZB 4BCOB 1P5EB 1PKDB 1W98B 3QHRB 4CRLB 4F7NB 5LMKB 4CFVB 4BCJB 1JSTB 4YOZA 2W99A 2IW8B 3BHVB 4EONB 4UN0A 1H25B 4F7SB 1VOLA 2WXVB 3BLHB 4RODA 1FVVB 4CFNB 1UNHD 3K7AM 2WFYB 4EOLB 5HBEB 5IDNB 3TNIB 3DDQB 4CFUD 1KXUA 3G33B 2WMAB 4BCKB 4CFWB 1H1PB 4BCMB 2WMBB 3TN8B 2X1NB 4EOKB 2UZEB 3DOGB 1QMZB 2PK9B 1H26B 5HNBB 5IDPB 5LQFB 2UZBB 2W96A 2WIHB 4II5B 2CJMB 4OR5B 1H24B 2BPMB 4ROCA 2CCIB 3EJ1B 2IW9B 2IVXA 4BCNB 1AD6A 1H28B 1BU2A 1N4MA 3TNHB 1VINA 4FX3B 3M03A 3MIAB 4G6LB 4OGRB 2I40B 2WEVB 5HVYB 2EUFA 1GH6B 2IW6B 5HBJB 3LQ5B 5FGKB 4EOJB 1XO2A 2W9FA 1GY3B 5HQ0B 1UNGD 4BCQD 2C5XB 5EFQB 5CEIB 3EIDB 4YOSA 4F6UB 4KRCB 5IF1B 1O9KA 2PHGA 2PK2A 4Y72B 4BCFB 3BHUB 4BCGB 4BCHB 1TFBA 3POMA 2C4GB 4EC9B 5CYIB 1O9KB 4EOSB 1UNLD 1OKVB 4CFUB 2CCHB 3DDPB 2PMIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EOC B;  3BLR B;  1H1S B;  4F7J B;  4F70 B;  2QDJ A;  3O0G D;  1H1R B;  2C5N B;  3BLQ B;  4F7L B;  4IMY B;  4EOR B;  1OI9 B;  3F5X B;  4TTH A;  2BKZ B;  2WIP B;  3MI9 B;  2R7G A;  4BCI B;  5L2W B;  2I53 A;  4I3Z B;  4EOP B;  4ELJ A;  1D3U B;  4KRD B;  4YOO A;  1OIU B;  1H27 B;  1JKW A;  3MY1 B;  2UUE B;  4NST B;  4EC8 B;  4YC3 B;  1URC B;  1JOW A;  2V22 B;  4EOI B;  1G3N C;  2C6T B;  5BNJ B;  2WPA B;  1C9B A;  4BCQ B;  3H4C A;  1OGU B;  1GUX A;  2W2H A;  2W9Z A;  4BCM D;  1E9H B;  1OKW B;  4EOQ B;  2C5V B;  1F5Q B;  2UZD B;  1H1Q B;  5I5Z B;  1AIS B;  3BHT B;  2UZL B;  3MY5 B;  4EOM B;  4EOO B;  4F6W B;  2F2C A;  3QHW B;  1FIN B;  4CFX B;  4ELL A;  3TNW B;  1OL2 B;  5ACB A;  5ICP B;  1JSU B;  1GUX B;  2B9R A;  2C5O B;  1OL1 B;  4BCN D;  4ROE A;  4CFM B;  4BCP B;  2G9X B;  1H4L D;  1ZP2 A;  4CXA B;  2WHB B;  5HBH B;  1OIY B;  3RGF B;  1VYW B;  4F6S B;  2JGZ B;  4BCO B;  1P5E B;  1PKD B;  1W98 B;  3QHR B;  4CRL B;  4F7N B;  5LMK B;  4CFV B;  4BCJ B;  1JST B;  4YOZ A;  2W99 A;  2IW8 B;  3BHV B;  4EON B;  4UN0 A;  1H25 B;  4F7S B;  1VOL A;  2WXV B;  3BLH B;  4ROD A;  1FVV B;  4CFN B;  1UNH D;  3K7A M;  2WFY B;  4EOL B;  5HBE B;  5IDN B;  3TNI B;  3DDQ B;  4CFU D;  1KXU A;  3G33 B;  2WMA B;  4BCK B;  4CFW B;  1H1P B;  4BCM B;  2WMB B;  3TN8 B;  2X1N B;  4EOK B;  2UZE B;  3DOG B;  1QMZ B;  2PK9 B;  1H26 B;  5HNB B;  5IDP B;  5LQF B;  2UZB B;  2W96 A;  2WIH B;  4II5 B;  2CJM B;  4OR5 B;  1H24 B;  2BPM B;  4ROC A;  2CCI B;  3EJ1 B;  2IW9 B;  2IVX A;  4BCN B;  1AD6 A;  1H28 B;  1BU2 A;  1N4M A;  3TNH B;  1VIN A;  4FX3 B;  3M03 A;  3MIA B;  4G6L B;  4OGR B;  2I40 B;  2WEV B;  5HVY B;  2EUF A;  1GH6 B;  2IW6 B;  5HBJ B;  3LQ5 B;  5FGK B;  4EOJ B;  1XO2 A;  2W9F A;  1GY3 B;  5HQ0 B;  1UNG D;  4BCQ D;  2C5X B;  5EFQ B;  5CEI B;  3EID B;  4YOS A;  4F6U B;  4KRC B;  5IF1 B;  1O9K A;  2PHG A;  2PK2 A;  4Y72 B;  4BCF B;  3BHU B;  4BCG B;  4BCH B;  1TFB A;  3POM A;  2C4G B;  4EC9 B;  5CYI B;  1O9K B;  4EOS B;  1UNL D;  1OKV B;  4CFU B;  2CCH B;  3DDP B;  2PMI B; 
#chains in the Genus database with same CATH topology
 3BG9 A;  3O0G D;  1H1R B;  4BBS M;  3BLQ B;  4NC6 A;  4HLQ A;  4IMY B;  2BKZ B;  2KR6 A;  4I3Z B;  1D3U B;  4KRD B;  1FKM A;  1OIU B;  4YC3 B;  4EOI B;  2C6T B;  1C9B A;  2CYZ B;  3QXE B;  4OB3 B;  1F5Q B;  3QWL A;  1H1Q B;  5I5Z B;  3BHT B;  4EOM B;  3HZJ A;  1OL2 B;  4BBR M;  3HBL A;  1JSU B;  2B9R A;  3RGF B;  1VYW B;  4AI6 A;  2JGZ B;  4QSH A;  1PKD B;  4CRL B;  3QYE A;  3WVE B;  4HNU A;  1FVV B;  3K7A M;  2WFY B;  4BXX X;  4EOL B;  2BS4 A;  4CFU D;  2QFZ A;  3BG3 A;  3DOG B;  5HNB B;  5IDP B;  1H26 B;  5EJC A;  5LQF B;  4OR5 B;  4ROC A;  3EJ1 B;  2IW9 B;  1AD6 A;  1H28 B;  4OGR B;  3LQ5 B;  3TW6 A;  2W9F A;  5HQ0 B;  4BCQ D;  2C5X B;  3EID B;  4AKI A;  3X25 B;  3A8O B;  3HO8 A;  1UGQ B;  3POM A;  1OKV B;  4CFU B;  2CCH B;  3EOC B;  4F70 B;  2ZPH B;  2C5N B;  4F7L B;  3F5X B;  3X24 B;  2KMG A;  2R7G A;  2I53 A;  3MY1 B;  4EC8 B;  4Z6Y A;  4BCQ B;  1OGU B;  1GUX A;  4MIM A;  1UGP B;  2W9Z A;  4BCM D;  4EOQ B;  1AIS B;  3MY5 B;  2CZ7 B;  2F2C A;  3TNW B;  3BG5 A;  1GUX B;  4HL4 A;  2C5O B;  4ROE A;  3GTM S;  2G9X B;  4CXA B;  5HBH B;  2ZPE B;  2BS3 A;  3PO3 S;  5LMK B;  2IW8 B;  3HHT B;  4LOC A;  4UN0 A;  1VOL A;  2WXV B;  4ROD A;  2DPP B;  2ZPG B;  2ZZD B;  5IDN B;  3TNI B;  3DDQ B;  3NDQ A;  4AKH A;  2ZPB B;  2G77 A;  4JX4 A;  4CFW B;  1H1P B;  4BCM B;  3TN8 B;  2X1N B;  3QYG B;  2UZB B;  2WIH B;  2CJM B;  1H24 B;  3DTO A;  2IVX A;  4M6V A;  3TNH B;  3QZ9 B;  3M03 A;  3MIA B;  4JX5 A;  2IW6 B;  1GY3 B;  2CZ1 B;  2D0Q B;  3WVD B;  5CEI B;  4BY1 X;  4ZGJ B;  4F6U B;  4KRC B;  2PK2 A;  4BCF B;  3BHU B;  4BCH B;  2C4G B;  4EC9 B;  5CYI B;  4EOS B;  3DDP B;  3DL1 A;  3BLR B;  4F7J B;  3TW7 A;  2QDJ A;  4EOR B;  1OI9 B;  2WIP B;  1H27 B;  1JKW A;  2QF7 A;  5BNJ B;  2WPA B;  2CZ6 B;  1E9H B;  1OKW B;  2C5V B;  2UZD B;  2UZL B;  2ZPI B;  1FIN B;  4CFX B;  5ACB A;  3VKG A;  5ICP B;  1OL1 B;  4BCN D;  4CFM B;  4MFE A;  1H4L D;  1UGS B;  2DD4 B;  2WHB B;  3A8M B;  4F6S B;  2QGS A;  4BCO B;  1P5E B;  1W98 B;  3QHR B;  4CFV B;  4YOZ A;  3A8G B;  2W99 A;  4EON B;  1H25 B;  4FM4 B;  1UNH D;  3X20 B;  5HBE B;  2IN3 A;  1QLB A;  2WMA B;  2ZPF B;  4EOK B;  2PK9 B;  3QYB A;  4II5 B;  2BPM B;  2CCI B;  4OB0 B;  4BCN B;  3A8L B;  2I40 B;  5HVY B;  2LW4 A;  1GH6 B;  4EOJ B;  1XO2 A;  3VYH B;  3X28 B;  4BY7 X;  3VKH A;  1UNG D;  2DME A;  5IF1 B;  3A8H B;  1O9K A;  2PHG A;  4Y72 B;  1E7P A;  2CZ0 B;  2AHJ B;  1UGR B;  1O9K B;  3X26 B;  1V29 B;  2BS2 A;  1H1S B;  4TTH A;  3MI9 B;  4BCI B;  5L2W B;  4EOP B;  4ELJ A;  4YOO A;  1ENW A;  4OB2 B;  2UUE B;  4NST B;  1URC B;  1JOW A;  2V22 B;  3DJB A;  1G3N C;  2QDY B;  3H4C A;  2W2H A;  4HNT A;  1AHJ B;  4EOO B;  4F6W B;  3QHW B;  4AKG A;  4ELL A;  4MFD A;  4BCP B;  1ZP2 A;  1OIY B;  2ZCF B;  4ZGE B;  4F7N B;  4BCJ B;  1JST B;  3BHV B;  4F7S B;  3BLH B;  4CFN B;  1IRE B;  3VYG B;  2PJQ A;  2WJ9 A;  1KXU A;  3G33 B;  4BCK B;  2WMB B;  2UZE B;  1QMZ B;  3QZ5 B;  2W96 A;  1TD6 A;  3HB9 A;  2DXB B;  4HNV A;  1BU2 A;  1N4M A;  1VIN A;  4FX3 B;  4G6L B;  2WEV B;  2EUF A;  3QYH B;  5FGK B;  5HBJ B;  5DQW A;  5EFQ B;  2DXC B;  4YOS A;  3B57 A;  4JX6 A;  4BCG B;  1TFB A;  2QQ8 A;  4OB1 B;  1UNL D;  3KHI A;  5IHY A;  5DQV A;  2DD5 B;  4ZGD B;  2PMI B; 
#chains in the Genus database with same CATH homology
 3EOC B;  3BLR B;  1H1S B;  4F7J B;  4F70 B;  2QDJ A;  3O0G D;  1H1R B;  2C5N B;  3BLQ B;  4F7L B;  4IMY B;  4EOR B;  1OI9 B;  3F5X B;  4TTH A;  2BKZ B;  2WIP B;  3MI9 B;  2R7G A;  4BCI B;  5L2W B;  2I53 A;  4I3Z B;  4EOP B;  4ELJ A;  1D3U B;  4KRD B;  4YOO A;  1OIU B;  1H27 B;  1JKW A;  3MY1 B;  2UUE B;  4NST B;  4EC8 B;  4YC3 B;  1URC B;  1JOW A;  2V22 B;  4EOI B;  1G3N C;  2C6T B;  5BNJ B;  2WPA B;  1C9B A;  4BCQ B;  3H4C A;  1OGU B;  1GUX A;  2W2H A;  2W9Z A;  4BCM D;  1E9H B;  1OKW B;  4EOQ B;  2C5V B;  1F5Q B;  2UZD B;  1H1Q B;  5I5Z B;  1AIS B;  3BHT B;  2UZL B;  3MY5 B;  4EOM B;  4EOO B;  4F6W B;  2F2C A;  3QHW B;  1FIN B;  4CFX B;  4ELL A;  3TNW B;  1OL2 B;  5ACB A;  5ICP B;  1JSU B;  1GUX B;  2B9R A;  2C5O B;  1OL1 B;  4BCN D;  4ROE A;  4CFM B;  4BCP B;  2G9X B;  1H4L D;  1ZP2 A;  4CXA B;  2WHB B;  5HBH B;  1OIY B;  3RGF B;  1VYW B;  4F6S B;  2JGZ B;  4BCO B;  1P5E B;  1PKD B;  1W98 B;  3QHR B;  4CRL B;  4F7N B;  5LMK B;  4CFV B;  4BCJ B;  1JST B;  4YOZ A;  2W99 A;  2IW8 B;  3BHV B;  4EON B;  4UN0 A;  1H25 B;  4F7S B;  1VOL A;  2WXV B;  3BLH B;  4ROD A;  1FVV B;  4CFN B;  1UNH D;  3K7A M;  2WFY B;  4EOL B;  5HBE B;  5IDN B;  3TNI B;  3DDQ B;  4CFU D;  1KXU A;  3G33 B;  2WMA B;  4BCK B;  4CFW B;  1H1P B;  4BCM B;  2WMB B;  3TN8 B;  2X1N B;  4EOK B;  2UZE B;  3DOG B;  1QMZ B;  2PK9 B;  1H26 B;  5HNB B;  5IDP B;  5LQF B;  2UZB B;  2W96 A;  2WIH B;  4II5 B;  2CJM B;  4OR5 B;  1H24 B;  2BPM B;  4ROC A;  2CCI B;  3EJ1 B;  2IW9 B;  2IVX A;  4BCN B;  1AD6 A;  1H28 B;  1BU2 A;  1N4M A;  3TNH B;  1VIN A;  4FX3 B;  3M03 A;  3MIA B;  4G6L B;  4OGR B;  2I40 B;  2WEV B;  5HVY B;  2EUF A;  1GH6 B;  2IW6 B;  5HBJ B;  3LQ5 B;  5FGK B;  4EOJ B;  1XO2 A;  2W9F A;  1GY3 B;  5HQ0 B;  1UNG D;  4BCQ D;  2C5X B;  5EFQ B;  5CEI B;  3EID B;  4YOS A;  4F6U B;  4KRC B;  5IF1 B;  1O9K A;  2PHG A;  2PK2 A;  4Y72 B;  4BCF B;  3BHU B;  4BCG B;  4BCH B;  1TFB A;  3POM A;  2C4G B;  4EC9 B;  5CYI B;  1O9K B;  4EOS B;  1UNL D;  1OKV B;  4CFU B;  2CCH B;  3DDP B;  2PMI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...