2G9XB

Structure of thr 160 phosphorylated cdk2/cyclin a in complex with the inhibitor nu6271
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
262
structure length
262
Chain Sequence
GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 2
publication title Searching for Cyclin-Dependent Kinase Inhibitors Using a New Variant of the Cope Elimination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 97
structure length 262
sequence length 262
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2g9xB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2g9xB02
4IMYB 1H24B 1H1PB 4EOPB 1C9BA 4BCIB 1JSUB 1OKVB 4EOMB 4EOIB 3F5XB 2UZEB 3TNHB 4F7NB 3MI9B 1GH6B 1G3NC 2R7GA 4II5B 4KRDB 4TTHA 2QDJA 1GUXA 4OGRB 2I40B 4EC9B 2C5OB 4EONB 2V22B 1QMZB 1JOWA 4ROEA 2C5NB 3O0GD 1OIYB 2WIHB 3BLHB 3DDPB 1GUXB 3QHWB 2IW9B 4ELJA 3MY5B 1O9KA 4CFVB 2WIPB 1VINA 4F6SB 5EFQB 4EORB 4BCND 1VOLA 2WXVB 2I53A 2CCHB 4BCNB 1P5EB 5HBJB 2IVXA 2JGZB 2B9RA 3LQ5B 4UN0A 4BCHB 2F2CA 1PKDB 4F7JB 1D3UB 4EOQB 5ACBA 1H1RB 2UZLB 2BKZB 2PK2A 1UNGD 4BCGB 4BCJB 1H26B 5IDPB 4BCPB 4BCQD 5L2WB 1W98B 1ZP2A 1H27B 3EOCB 3RGFB 4EOJB 3H4CA 5LQFB 2W96A 1AISB 3DOGB 4BCKB 4YOOA 1OL1B 2C4GB 4YOZA 2PHGA 2UZBB 1H25B 4CFNB 3EIDB 4F6UB 4EOSB 1H1QB 1OL2B 1BU2A 4G6LB 3M03A 5ICPB 2G9XB 4BCMD 1JSTB 3QHRB 4CXAB 5HQ0B 1URCB 3BHVB 5CEIB 1FVVB 1F5QB 2CJMB 5FGKB 5BNJB 2WFYB 4EOKB 1FINB 1JKWA 1E9HB 2BPMB 4CFXB 3BHUB 2W99A 1UNHD 3MIAB 1H1SB 1OGUB 5IF1B 1VYWB 1XO2A 2C5VB 2W2HA 1UNLD 5HVYB 2WHBB 2W9ZA 4BCQB 4NSTB 3BHTB 4F7LB 4YC3B 2WPAB 3TNWB 1OI9B 2WEVB 3G33B 4FX3B 4F6WB 3BLQB 2PMIB 2IW6B 2X1NB 2PK9B 1H28B 2EUFA 2C6TB 4YOSA 3TNIB 5LMKB 4CFWB 1KXUA 2CCIB 4CFUD 3POMA 4BCMB 4BCFB 2UZDB 1GY3B 4EOOB 3K7AM 5HNBB 4CFMB 5IDNB 3EJ1B 4KRCB 4F70B 4CFUB 4I3ZB 2IW8B 1OKWB 4EC8B 2UUEB 4CRLB 4RODA 4EOLB 5HBHB 2WMAB 1OIUB 1AD6A 1TFBA 3MY1B 4BCOB 1N4MA 4F7SB 5CYIB 2W9FA 4ROCA 4ELLA 4OR5B 5HBEB 2C5XB 5I5ZB 3TN8B 3BLRB 1O9KB 3DDQB 1H4LD 4Y72B 2WMBB
chains in the Genus database with same CATH superfamily
3A8LB 1H24B 3GTMS 4QSHA 2I40B 3X25B 1JOWA 5IHYA 3DDPB 1GUXB 2IW9B 2CZ7B 5EFQB 4EORB 2ZPIB 2CCHB 4AKGA 3A8MB 3LQ5B 4UN0A 3WVDB 3VKGA 3BG3A 3HZJA 1H26B 1H27B 4EOJB 2ZPBB 4AKIA 2W96A 1AISB 4BCKB 1OL1B 4CFNB 4F6UB 4BBRM 4G6LB 3M03A 4BCMD 3QHRB 4CXAB 2ZPFB 2CJMB 3X24B 5FGKB 5BNJB 4AKHA 4CFXB 3PO3S 3MIAB 1OGUB 5IF1B 1XO2A 2C5VB 2LW4A 1OI9B 4HL4A 2X1NB 3DL1A 3QZ5B 1H28B 4CFUD 3QYEA 2BS4A 2QGSA 5HNBB 4CFMB 1TD6A 5IDNB 3WVEB 2UUEB 4CRLB 4RODA 4BBSM 1AD6A 4HNVA 4MFDA 5HBEB 1O9KB 1H4LD 4Y72B 2ZPEB 2DMEA 1OKVB 3HB9A 4EOMB 2UZEB 4NC6A 1GH6B 2KR6A 3HO8A 4II5B 4EONB 1QMZB 3QHWB 4ELJA 1O9KA 4CFVB 5DQVA 4BCND 3TW6A 2B9RA 2CZ6B 2DXBB 4F7JB 3BG5A 2UZLB 2BS3A 4BCGB 1W98B 3QWLA 3RGFB 1UGSB 2BS2A 3QXEB 3EIDB 2D0QB 4EOSB 1OL2B 1BU2A 5ICPB 2G9XB 3DTOA 4AI6A 1FINB 1JKWA 3BHUB 1UNHD 1H1SB 4MFEA 3VKHA 1UNLD 1QLBA 2W9ZA 4BCQB 3BHTB 3TNWB 2QFZA 2WEVB 4F6WB 2PMIB 2PK9B 2ZPHB 2C6TB 4YOSA 3TNIB 4BCFB 4JX6A 1GY3B 4EOOB 3A8GB 3X28B 3EJ1B 4KRCB 4CFUB 4I3ZB 2CYZB 2WJ9A 4EOLB 1OIUB 3X26B 3MY1B 4ROCA 1N4MA 4LOCA 4OB0B 4EOPB 1C9BA 1JSUB 4HLQA 2QQ8A 4MIMA 3F5XB 3HHTB 3MI9B 4KRDB 2QDJA 4Z6YA 4OGRB 2V22B 4ROEA 2C5NB 3O0GD 2WIPB 3VYGB 1VOLA 2G77A 4BCNB 2F2CA 4EOQB 5ACBA 1UGQB 2PK2A 4BCPB 2PJQA 4JX5A 3H4CA 2QDYB 4YOZA 2UZBB 1H25B 3QYHB 1JSTB 4FM4B 5HQ0B 2KMGA 1URCB 1E9HB 2BPMB 1ENWA 2W99A 4OB2B 5DQWA 1VYWB 4OB3B 3QYGB 2W2HA 4F7LB 3G33B 3KHIA 4M6VA 2IW6B 2EUFA 4BXXX 5LMKB 4CFWB 4BCMB 2IW8B 1V29B 1TFBA 3NDQA 4F7SB 3A8OB 2ZZDB 4OR5B 5I5ZB 2C5XB 3TN8B 3BLRB 3BG9A 1H1PB 3HBLA 4IMYB 1IREB 4BCIB 4EOIB 4BY1X 3TNHB 4F7NB 1G3NC 2R7GA 4JX4A 4TTHA 1GUXA 4EC9B 2C5OB 1OIYB 2WIHB 3BLHB 2CZ0B 2DXCB 3MY5B 4HNTA 3A8HB 4OB1B 1VINA 4F6SB 2WXVB 2I53A 2AHJB 1P5EB 3QYBA 5HBJB 2IVXA 2JGZB 4BCHB 1PKDB 1D3UB 1H1RB 2BKZB 1UNGD 4BCJB 5IDPB 3DJBA 5L2WB 4BCQD 1ZP2A 3EOCB 1E7PA 2IN3A 5LQFB 3DOGB 4YOOA 2C4GB 2PHGA 1H1QB 4BY7X 2CZ1B 1AHJB 3BHVB 2QF7A 5CEIB 1FVVB 1F5QB 2DPPB 3QZ9B 2WFYB 4EOKB 5EJCA 4ZGEB 4ZGJB 5HVYB 2WHBB 4NSTB 4YC3B 2WPAB 2DD4B 4FX3B 3BLQB 1UGRB 1FKMA 1KXUA 2CCIB 3POMA 2UZDB 3TW7A 3K7AM 4F70B 3X20B 1OKWB 4HNUA 4EC8B 4ZGDB 1UGPB 2DD5B 2WMAB 5HBHB 4BCOB 2ZPGB 5CYIB 2W9FA 4ELLA 3VYHB 2ZCFB 3B57A 3DDQB 2WMBB
chains in the Genus database with same CATH topology
4IMYB 1H24B 1H1PB 4EOPB 1C9BA 4BCIB 1JSUB 1OKVB 4EOMB 4EOIB 3F5XB 2UZEB 3TNHB 4F7NB 3MI9B 1GH6B 1G3NC 2R7GA 4II5B 4KRDB 4TTHA 2QDJA 1GUXA 4OGRB 2I40B 4EC9B 2C5OB 4EONB 2V22B 1QMZB 1JOWA 4ROEA 2C5NB 3O0GD 1OIYB 2WIHB 3BLHB 3DDPB 1GUXB 3QHWB 2IW9B 4ELJA 3MY5B 1O9KA 4CFVB 2WIPB 1VINA 4F6SB 5EFQB 4EORB 4BCND 1VOLA 2WXVB 2I53A 2CCHB 4BCNB 1P5EB 5HBJB 2IVXA 2JGZB 2B9RA 3LQ5B 4UN0A 4BCHB 2F2CA 1PKDB 4F7JB 1D3UB 4EOQB 5ACBA 1H1RB 2UZLB 2BKZB 2PK2A 1UNGD 4BCGB 4BCJB 1H26B 5IDPB 4BCPB 4BCQD 5L2WB 1W98B 1ZP2A 1H27B 3EOCB 3RGFB 4EOJB 3H4CA 5LQFB 2W96A 1AISB 3DOGB 4BCKB 4YOOA 1OL1B 2C4GB 4YOZA 2PHGA 2UZBB 1H25B 4CFNB 3EIDB 4F6UB 4EOSB 1H1QB 1OL2B 1BU2A 4G6LB 3M03A 5ICPB 2G9XB 4BCMD 1JSTB 3QHRB 4CXAB 5HQ0B 1URCB 3BHVB 5CEIB 1FVVB 1F5QB 2CJMB 5FGKB 5BNJB 2WFYB 4EOKB 1FINB 1JKWA 1E9HB 2BPMB 4CFXB 3BHUB 2W99A 1UNHD 3MIAB 1H1SB 1OGUB 5IF1B 1VYWB 1XO2A 2C5VB 2W2HA 1UNLD 5HVYB 2WHBB 2W9ZA 4BCQB 4NSTB 3BHTB 4F7LB 4YC3B 2WPAB 3TNWB 1OI9B 2WEVB 3G33B 4FX3B 4F6WB 3BLQB 2PMIB 2IW6B 2X1NB 2PK9B 1H28B 2EUFA 2C6TB 4YOSA 3TNIB 5LMKB 4CFWB 1KXUA 2CCIB 4CFUD 3POMA 4BCMB 4BCFB 2UZDB 1GY3B 4EOOB 3K7AM 5HNBB 4CFMB 5IDNB 3EJ1B 4KRCB 4F70B 4CFUB 4I3ZB 2IW8B 1OKWB 4EC8B 2UUEB 4CRLB 4RODA 4EOLB 5HBHB 2WMAB 1OIUB 1AD6A 1TFBA 3MY1B 4BCOB 1N4MA 4F7SB 5CYIB 2W9FA 4ROCA 4ELLA 4OR5B 5HBEB 2C5XB 5I5ZB 3TN8B 3BLRB 1O9KB 3DDQB 1H4LD 4Y72B 2WMBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IMY B;  1H24 B;  1H1P B;  4EOP B;  1C9B A;  4BCI B;  1JSU B;  1OKV B;  4EOM B;  4EOI B;  3F5X B;  2UZE B;  3TNH B;  4F7N B;  3MI9 B;  1GH6 B;  1G3N C;  2R7G A;  4II5 B;  4KRD B;  4TTH A;  2QDJ A;  1GUX A;  4OGR B;  2I40 B;  4EC9 B;  2C5O B;  4EON B;  2V22 B;  1QMZ B;  1JOW A;  4ROE A;  2C5N B;  3O0G D;  1OIY B;  2WIH B;  3BLH B;  3DDP B;  1GUX B;  3QHW B;  2IW9 B;  4ELJ A;  3MY5 B;  1O9K A;  4CFV B;  2WIP B;  1VIN A;  4F6S B;  5EFQ B;  4EOR B;  4BCN D;  1VOL A;  2WXV B;  2I53 A;  2CCH B;  4BCN B;  1P5E B;  5HBJ B;  2IVX A;  2JGZ B;  2B9R A;  3LQ5 B;  4UN0 A;  4BCH B;  2F2C A;  1PKD B;  4F7J B;  1D3U B;  4EOQ B;  5ACB A;  1H1R B;  2UZL B;  2BKZ B;  2PK2 A;  1UNG D;  4BCG B;  4BCJ B;  1H26 B;  5IDP B;  4BCP B;  4BCQ D;  5L2W B;  1W98 B;  1ZP2 A;  1H27 B;  3EOC B;  3RGF B;  4EOJ B;  3H4C A;  5LQF B;  2W96 A;  1AIS B;  3DOG B;  4BCK B;  4YOO A;  1OL1 B;  2C4G B;  4YOZ A;  2PHG A;  2UZB B;  1H25 B;  4CFN B;  3EID B;  4F6U B;  4EOS B;  1H1Q B;  1OL2 B;  1BU2 A;  4G6L B;  3M03 A;  5ICP B;  2G9X B;  4BCM D;  1JST B;  3QHR B;  4CXA B;  5HQ0 B;  1URC B;  3BHV B;  5CEI B;  1FVV B;  1F5Q B;  2CJM B;  5FGK B;  5BNJ B;  2WFY B;  4EOK B;  1FIN B;  1JKW A;  1E9H B;  2BPM B;  4CFX B;  3BHU B;  2W99 A;  1UNH D;  3MIA B;  1H1S B;  1OGU B;  5IF1 B;  1VYW B;  1XO2 A;  2C5V B;  2W2H A;  1UNL D;  5HVY B;  2WHB B;  2W9Z A;  4BCQ B;  4NST B;  3BHT B;  4F7L B;  4YC3 B;  2WPA B;  3TNW B;  1OI9 B;  2WEV B;  3G33 B;  4FX3 B;  4F6W B;  3BLQ B;  2PMI B;  2IW6 B;  2X1N B;  2PK9 B;  1H28 B;  2EUF A;  2C6T B;  4YOS A;  3TNI B;  5LMK B;  4CFW B;  1KXU A;  2CCI B;  4CFU D;  3POM A;  4BCM B;  4BCF B;  2UZD B;  1GY3 B;  4EOO B;  3K7A M;  5HNB B;  4CFM B;  5IDN B;  3EJ1 B;  4KRC B;  4F70 B;  4CFU B;  4I3Z B;  2IW8 B;  1OKW B;  4EC8 B;  2UUE B;  4CRL B;  4ROD A;  4EOL B;  5HBH B;  2WMA B;  1OIU B;  1AD6 A;  1TFB A;  3MY1 B;  4BCO B;  1N4M A;  4F7S B;  5CYI B;  2W9F A;  4ROC A;  4ELL A;  4OR5 B;  5HBE B;  2C5X B;  5I5Z B;  3TN8 B;  3BLR B;  1O9K B;  3DDQ B;  1H4L D;  4Y72 B;  2WMB B; 
#chains in the Genus database with same CATH topology
 3A8L B;  1H24 B;  3GTM S;  4QSH A;  2I40 B;  3X25 B;  1JOW A;  5IHY A;  3DDP B;  1GUX B;  2IW9 B;  2CZ7 B;  5EFQ B;  4EOR B;  2ZPI B;  2CCH B;  4AKG A;  3A8M B;  3LQ5 B;  4UN0 A;  3WVD B;  3VKG A;  3BG3 A;  3HZJ A;  1H26 B;  1H27 B;  4EOJ B;  2ZPB B;  4AKI A;  2W96 A;  1AIS B;  4BCK B;  1OL1 B;  4CFN B;  4F6U B;  4BBR M;  4G6L B;  3M03 A;  4BCM D;  3QHR B;  4CXA B;  2ZPF B;  2CJM B;  3X24 B;  5FGK B;  5BNJ B;  4AKH A;  4CFX B;  3PO3 S;  3MIA B;  1OGU B;  5IF1 B;  1XO2 A;  2C5V B;  2LW4 A;  1OI9 B;  4HL4 A;  2X1N B;  3DL1 A;  3QZ5 B;  1H28 B;  4CFU D;  3QYE A;  2BS4 A;  2QGS A;  5HNB B;  4CFM B;  1TD6 A;  5IDN B;  3WVE B;  2UUE B;  4CRL B;  4ROD A;  4BBS M;  1AD6 A;  4HNV A;  4MFD A;  5HBE B;  1O9K B;  1H4L D;  4Y72 B;  2ZPE B;  2DME A;  1OKV B;  3HB9 A;  4EOM B;  2UZE B;  4NC6 A;  1GH6 B;  2KR6 A;  3HO8 A;  4II5 B;  4EON B;  1QMZ B;  3QHW B;  4ELJ A;  1O9K A;  4CFV B;  5DQV A;  4BCN D;  3TW6 A;  2B9R A;  2CZ6 B;  2DXB B;  4F7J B;  3BG5 A;  2UZL B;  2BS3 A;  4BCG B;  1W98 B;  3QWL A;  3RGF B;  1UGS B;  2BS2 A;  3QXE B;  3EID B;  2D0Q B;  4EOS B;  1OL2 B;  1BU2 A;  5ICP B;  2G9X B;  3DTO A;  4AI6 A;  1FIN B;  1JKW A;  3BHU B;  1UNH D;  1H1S B;  4MFE A;  3VKH A;  1UNL D;  1QLB A;  2W9Z A;  4BCQ B;  3BHT B;  3TNW B;  2QFZ A;  2WEV B;  4F6W B;  2PMI B;  2PK9 B;  2ZPH B;  2C6T B;  4YOS A;  3TNI B;  4BCF B;  4JX6 A;  1GY3 B;  4EOO B;  3A8G B;  3X28 B;  3EJ1 B;  4KRC B;  4CFU B;  4I3Z B;  2CYZ B;  2WJ9 A;  4EOL B;  1OIU B;  3X26 B;  3MY1 B;  4ROC A;  1N4M A;  4LOC A;  4OB0 B;  4EOP B;  1C9B A;  1JSU B;  4HLQ A;  2QQ8 A;  4MIM A;  3F5X B;  3HHT B;  3MI9 B;  4KRD B;  2QDJ A;  4Z6Y A;  4OGR B;  2V22 B;  4ROE A;  2C5N B;  3O0G D;  2WIP B;  3VYG B;  1VOL A;  2G77 A;  4BCN B;  2F2C A;  4EOQ B;  5ACB A;  1UGQ B;  2PK2 A;  4BCP B;  2PJQ A;  4JX5 A;  3H4C A;  2QDY B;  4YOZ A;  2UZB B;  1H25 B;  3QYH B;  1JST B;  4FM4 B;  5HQ0 B;  2KMG A;  1URC B;  1E9H B;  2BPM B;  1ENW A;  2W99 A;  4OB2 B;  5DQW A;  1VYW B;  4OB3 B;  3QYG B;  2W2H A;  4F7L B;  3G33 B;  3KHI A;  4M6V A;  2IW6 B;  2EUF A;  4BXX X;  5LMK B;  4CFW B;  4BCM B;  2IW8 B;  1V29 B;  1TFB A;  3NDQ A;  4F7S B;  3A8O B;  2ZZD B;  4OR5 B;  5I5Z B;  2C5X B;  3TN8 B;  3BLR B;  3BG9 A;  1H1P B;  3HBL A;  4IMY B;  1IRE B;  4BCI B;  4EOI B;  4BY1 X;  3TNH B;  4F7N B;  1G3N C;  2R7G A;  4JX4 A;  4TTH A;  1GUX A;  4EC9 B;  2C5O B;  1OIY B;  2WIH B;  3BLH B;  2CZ0 B;  2DXC B;  3MY5 B;  4HNT A;  3A8H B;  4OB1 B;  1VIN A;  4F6S B;  2WXV B;  2I53 A;  2AHJ B;  1P5E B;  3QYB A;  5HBJ B;  2IVX A;  2JGZ B;  4BCH B;  1PKD B;  1D3U B;  1H1R B;  2BKZ B;  1UNG D;  4BCJ B;  5IDP B;  3DJB A;  5L2W B;  4BCQ D;  1ZP2 A;  3EOC B;  1E7P A;  2IN3 A;  5LQF B;  3DOG B;  4YOO A;  2C4G B;  2PHG A;  1H1Q B;  4BY7 X;  2CZ1 B;  1AHJ B;  3BHV B;  2QF7 A;  5CEI B;  1FVV B;  1F5Q B;  2DPP B;  3QZ9 B;  2WFY B;  4EOK B;  5EJC A;  4ZGE B;  4ZGJ B;  5HVY B;  2WHB B;  4NST B;  4YC3 B;  2WPA B;  2DD4 B;  4FX3 B;  3BLQ B;  1UGR B;  1FKM A;  1KXU A;  2CCI B;  3POM A;  2UZD B;  3TW7 A;  3K7A M;  4F70 B;  3X20 B;  1OKW B;  4HNU A;  4EC8 B;  4ZGD B;  1UGP B;  2DD5 B;  2WMA B;  5HBH B;  4BCO B;  2ZPG B;  5CYI B;  2W9F A;  4ELL A;  3VYH B;  2ZCF B;  3B57 A;  3DDQ B;  2WMB B; 
#chains in the Genus database with same CATH homology
 4IMY B;  1H24 B;  1H1P B;  4EOP B;  1C9B A;  4BCI B;  1JSU B;  1OKV B;  4EOM B;  4EOI B;  3F5X B;  2UZE B;  3TNH B;  4F7N B;  3MI9 B;  1GH6 B;  1G3N C;  2R7G A;  4II5 B;  4KRD B;  4TTH A;  2QDJ A;  1GUX A;  4OGR B;  2I40 B;  4EC9 B;  2C5O B;  4EON B;  2V22 B;  1QMZ B;  1JOW A;  4ROE A;  2C5N B;  3O0G D;  1OIY B;  2WIH B;  3BLH B;  3DDP B;  1GUX B;  3QHW B;  2IW9 B;  4ELJ A;  3MY5 B;  1O9K A;  4CFV B;  2WIP B;  1VIN A;  4F6S B;  5EFQ B;  4EOR B;  4BCN D;  1VOL A;  2WXV B;  2I53 A;  2CCH B;  4BCN B;  1P5E B;  5HBJ B;  2IVX A;  2JGZ B;  2B9R A;  3LQ5 B;  4UN0 A;  4BCH B;  2F2C A;  1PKD B;  4F7J B;  1D3U B;  4EOQ B;  5ACB A;  1H1R B;  2UZL B;  2BKZ B;  2PK2 A;  1UNG D;  4BCG B;  4BCJ B;  1H26 B;  5IDP B;  4BCP B;  4BCQ D;  5L2W B;  1W98 B;  1ZP2 A;  1H27 B;  3EOC B;  3RGF B;  4EOJ B;  3H4C A;  5LQF B;  2W96 A;  1AIS B;  3DOG B;  4BCK B;  4YOO A;  1OL1 B;  2C4G B;  4YOZ A;  2PHG A;  2UZB B;  1H25 B;  4CFN B;  3EID B;  4F6U B;  4EOS B;  1H1Q B;  1OL2 B;  1BU2 A;  4G6L B;  3M03 A;  5ICP B;  2G9X B;  4BCM D;  1JST B;  3QHR B;  4CXA B;  5HQ0 B;  1URC B;  3BHV B;  5CEI B;  1FVV B;  1F5Q B;  2CJM B;  5FGK B;  5BNJ B;  2WFY B;  4EOK B;  1FIN B;  1JKW A;  1E9H B;  2BPM B;  4CFX B;  3BHU B;  2W99 A;  1UNH D;  3MIA B;  1H1S B;  1OGU B;  5IF1 B;  1VYW B;  1XO2 A;  2C5V B;  2W2H A;  1UNL D;  5HVY B;  2WHB B;  2W9Z A;  4BCQ B;  4NST B;  3BHT B;  4F7L B;  4YC3 B;  2WPA B;  3TNW B;  1OI9 B;  2WEV B;  3G33 B;  4FX3 B;  4F6W B;  3BLQ B;  2PMI B;  2IW6 B;  2X1N B;  2PK9 B;  1H28 B;  2EUF A;  2C6T B;  4YOS A;  3TNI B;  5LMK B;  4CFW B;  1KXU A;  2CCI B;  4CFU D;  3POM A;  4BCM B;  4BCF B;  2UZD B;  1GY3 B;  4EOO B;  3K7A M;  5HNB B;  4CFM B;  5IDN B;  3EJ1 B;  4KRC B;  4F70 B;  4CFU B;  4I3Z B;  2IW8 B;  1OKW B;  4EC8 B;  2UUE B;  4CRL B;  4ROD A;  4EOL B;  5HBH B;  2WMA B;  1OIU B;  1AD6 A;  1TFB A;  3MY1 B;  4BCO B;  1N4M A;  4F7S B;  5CYI B;  2W9F A;  4ROC A;  4ELL A;  4OR5 B;  5HBE B;  2C5X B;  5I5Z B;  3TN8 B;  3BLR B;  1O9K B;  3DDQ B;  1H4L D;  4Y72 B;  2WMB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...