2GA1A

Crystal structure of a duf433 member protein (ava_0674) from anabaena variabilis atcc 29413 at 2.00 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
MNKKTQLLEVIAALPEELVDQALNYVQMLQNPIQITPGVCGGQARIRNTRIPVWTLVAYRQQGAPDKELLANYPGLTAEDLSAAWHYYEQNPEQIDREIAQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein of unknown function DUF433
publication title Crystal structure of (YP_321193.1) from Anabaena variabilis ATCC 29413 at 2.00 A resolution
rcsb
source organism Anabaena variabilis
molecule tags Unknown function
total genus 30
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04255 DUF433 Protein of unknown function (DUF433)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ga1A02
1.20.5.800 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Alr1493-like domains 2ga1A01
3SZTA 3LA3A 1SD4A 2FE3A 4MQ9F 5JVTA 2OU2A 4ENMA 2LNBA 3BROA 2PI0A 4YG2F 2Q2EA 5L3CA 3J80K 4L0YB 4MTEA 5HS8A 2STTA 4IRGA 4UVCA 2KKOA 3ZMZA 3I4PA 2RNJA 1TQMA 2EV6A 2QBYB 4XLNF 5D4RA 1BOAA 4RB3C 4EJOA 4ZZLA 3HYIA 3J81K 2EV0A 4QLCU 5LGNA 5LEKA 2PQ8A 3GXOA 4HX4A 5KK1A 2R7FA 4R79A 2IVMA 1KU3A 5CLSA 3E3VA 5DCMA 1MJAA 4UHTA 5HLHA 4XRFA 2ACJA 2W84A 2UXXA 3LFKA 3IC7A 3U2RA 3MZHA 2M1BA 2MD5A 1I6XA 2DK5A 3I64A 4O6JA 3K69A 3TO6A 3EYYA 2D1VA 4A0ZA 5H6QA 3KZZA 1D3YA 2EA2A 1UHMA 3SQNA 4CYDA 5L3EA 2X4HA 3SZPA 2D2WA 4HF1A 2CW0F 1Z1DA 4B09A 2COMA 2QVOA 3KE2A 4N0BA 5ICCA 5HDKA 3QAHA 2L4AA 1ZYRF 1U2WA 4A6DA 1O57A 1XSVA 4U0WA 1IZ1A 4A12A 1BJAA 3QP5A 3RYRA 4XBFA 4KIBA 4KMUX 3CO7C 4IXAA 1YO5C 1Z05A 3BPVA 2V1XA 1MZBA 4KT5C 4EGYA 4K2EA 2L4MA 5FD5A 4LLGF 2EV5A 4JBAA 2VOOA 1CF7B 2P4WA 2Y0MA 1KU9A 2V1DA 5E8IA 1GXQA 2DQRA 5J6XA 1A04A 1S8NA 1OKRA 3U1DA 1WSUA 3L09A 5H6RA 4M6YA 1FYMA 4FT8A 1JHHA 1BN5A 4MGRA 1EH6A 3VEPA 3T8RA 5TRDA 1P4AA 1ZG1A 4MHGA 5FO5A 3CUQC 5LHGA 3V8LA 2GQQA 4G7ZF 2IP2A 1K7AA 1WKMA 2VN2A 5LGUA 1HKQA 3F6OA 1LEBA 1MDMB 2ISZA 4OMYA 3CUQB 1BI1A 3E6MA 2EFWA 4HX8A 4D0PA 3FM5A 5L3FA 2EFOA 1GVJA 4U88A 1HXDA 1LJ9A 1SD6A 4M73A 4WWCA 2EJRA 4N9IA 1ULYA 1PUEE 3ABTA 1IRFA 4G7OF 2XAQA 2HZTA 2KIUA 4ESBA 4S04A 3V7CA 1I1GA 4HQMA 5LBQA 1CGPA 4OU0A 3ISPA 3E5QA 3LA2A 4KFCA 1O3TA 2GIVA 1DDNA 1XN7A 3JSOA 3RKWA 2VXZA 4KYWA 2ADUA 1Z9CA 1FPQA 3JSPA 3O3KA 4CHUA 2CFXA 3NEUA 1TLHB 2P8TA 4EJWA 4WXDA 2D1HA 5F64A 2O61A 4OIQF 3FXRA 1RNLA 5BPDA 4PGHA 4YIFA 2JT1A 5FD6A 3HSRA 3F3XA 3ERED 3GX4X 1TNTA 3L7WA 4YFNF 4UUVA 2RQPA 2IW5A 3HIFA 3O2PE 3KP4A 3KETA 1ZRFA 2K27A 4DQ2A 2CYYA 1BI3A 2ZFWA 4L18B 2UWMA 2NRAC 3W6KB 4MTDA 2F5DA 3N4MA 1XCBA 1HW1A 2BEOA 4UV9A 2GA2A 1ODDA 3G73A 1OPCA 5LGTA 3WTVC 4ETSA 5EEGA 1H0MA 1C0WA 4IPAA 2VE8A 4LG0A 4I02A 2X0LA 1KQ8A 3EETA 4P9FA 3TKYA 1T2KA 2MC3A 5K5QA 4M9XA 3DV8A 2HKOA 3EUHA 3MQ0A 2QM3A 3H92A 4EM2A 3RIRA 5D8LB 1TW2A 1W4MA 1P2FA 1QNTA 5HDNA 2DPDA 1F1ZA 1B4AA 3P9IA 5DCFA 2P5KA 4EVIA 2H09A 2HTJA 4Z2YA 4EMSA 1BBYA 1WRJA 1U78A 3DQVC 3QPHA 3RKYA 4EJUA 4RS8A 3ZMSA 3HRTA 1JGSA 2V9VA 1W7PA 4KUMA 3RYPA 3LA7A 3QRFF 2DPUA 4KN7X 3GEZA 4EJTA 4HF2A 4R8HA 3TGNA 2PBIA 5LRRA 2NNNA 1HW2A 1B9NA 2HWVA 3MCZA 4HW0A 2PEXA 2M87A 1ZGAA 1RIOH 3V8JA 1H9TA 3GUDA 4ZYHA 1EH8A 1USSA 1B59A 1ZAOA 4I09A 3HHGA 1TQIA 2R7DA 2O8XA 2ZBKA 4L9JA 2HOEA 4R1HA 3R0JA 3M7GA 1XB4A 2RGVA 3C18A 1G3TA 3FMSA 5JHUA 1IRGA 2QQBA 4HF0A 4I0BA 3F8MA 2HQNA 2EB7A 2A61A 2ZCWA 1R22A 2H27A 5D8KB 3GFLA 4WX9A 4A0XA 3NRVA 4Q5SF 2RN7A 1ZRCA 1NHAA 2QENA 3TOAA 4KN4X 2OQGA 3I5UA 1XDUA 3M8FA 2DFIA 1DUXC 3DEUA 3HOTA 1TNSA 4BXUA 1T39A 2W85A 3BZ6A 3BJ6A 2UXNA 1D8KA 2ZKZA 3WTUC 5ED4A 2EA4A 3FHZA 1HBXG 4WF2A 2DAOA 4U7BA 3L00A 4G8XA 3MZYA 2E7WA 2DK8A 2OZ6A 3E6CC 5E1ZB 5BS6A 4OOIA 2PMHA 2FA5A 2MA3A 5FB2A 4KA4A 4KIFA 4EM0B 3E5UA 1V4RA 2RKHA 2VBYA 1UCRA 1J2XA 4KICA 3C7JA 4CZZA 1MDMA 1F9NA 2ZJ2A 5TJJA 3F8CA 4AIKA 1F4KA 2MLGA 1T6SA 5H20A 1LVAA 1SFXA 1G3YA 1GXPA 5BMZA 3M1EA 2YR2A 2JSCA 3C3WA 3OV8A 4RGUA 3LWFA 3J7AO 4LK0F 4OINF 2XAGA 3K1MA 2H6CA 1T0FA 5D5XB 5DDGA 2K02A 1F5TA 3GZ5A 2VBXA 2YU3A 1R5HA 1LDDA 5AONA 4A2UA 1L3LA 5HLIA 1FOKA 3IHUA 1QZYA 3LSTA 4Y15A 2HYFA 4RAYA 4BHPA 3R6SA 3CTAA 1IXCA 1K79A 4M9ZA 2PMUA 3WTXC 1WI9A 4P5OA 2JPBA 3M8EA 2IT0A 1BC7C 2Q8KA 4I0AA 4EQQA 1S7AA 3F8FA 4HX7A 3QU6A 2G7UA 2K4JA 2KJCA 3ABUA 1U6GA 5L3BA 2STWA 4N9HA 3K1NA 2H94A 1LQ1A 1KGSA 2H6BA 2M8EA 4FX0A 3FMQA 4I98B 1ZHFA 3BWGA 4WCGA 3RI4A 5AIPA 1Z7UA 1IN6A 1I5ZA 1U5TC 2P6TA 2QQ9A 2RVCA 2WTEA 4UVBA 1YFHA 1YLFA 2DI3A 1ZH5A 5J8CA 3IRRA 2CGPA 4B8XA 5A2QZ 5LHHA 4MNUA 2AXLA 1KYWA 2XROA 3NQOA 1HKTA 2XUBA 4RB0A 2Z99A 2HGCA 4EV0A 1AWCA 1U5TB 1JXSA 5HVQC 3C1DA 1MJ9A 1YW8A 2DBBA 2R3SA 3EYIA 1D8JA 1XMAA 3ROUA 2VBWA 1MKMA 2XAJA 4OIRF 1W5SA 1UHWA 1R23A 2G9WA 2C6YA 2F5EA 3B73A 2A07F 2FMLA 3T8TA 3G3ZA 3PQKA 1O7FA 3TOBA 1O7LA 2P5LC 2VE9A 1ZLJA 3WE2A 1BIAA 5LLQA 1OMIA 1FYKA 5HOOA 4Y13A 2O6GE 1ZRDA 4Q47A 5D4SA 2ZMEA 2HKXA 1FSEA 4UNOA 1E2XA 3ZMDA 4ZYDA 3K0LA 3WE3A 3BJAA 4RGXA 3V4GA 1ON1A 3ULQB 3GFMA 1QQIA 1LDJA 4ENJA 3K1PA 2OD5A 1PP8F 1K78B 4S05A 3B02A 1XD7A 2P7VB 3OOPA 1IAWA 4Q4ZF 3VFZA 3ZMUA 4U7DA 1XSDA 5LRSA 5CYVA 5E1WA 5DV5A 4LD5A 2K4BA 4OMZA 5J8FA 1MGTA 3ZP5A 3DPLC 3KZYA 1LNWA 5CVRA 2EFNA 5IT9K 2MH9A 2FMYA 3DF8A 3KP5A 1U3EM 3I71A 1AOYA 2EFQA 3WG9A 4ASNA 2QUFA 2CQKA 2ISYA 1B1BA 1S7OA 2Z3YA 1Y0UA 1VTNC 4A5NA 3VODA 1YYVA 2IJLA 2JPCA 3WU0A 4O3MA 4LMYA 3TQNA 1YIOA 5EEHA 5DCMB 1RI7A 1FY7A 4G9YA 3WTYC 1FZPB 2BYVE 3T0YA 4HV5A 1E17A 1QO0D 4GXOA 3KLOA 3DXJF 4O5VA 2V79A 2V1UA 2OAZA 3E6BA 3REOA 5FGMA 2HS5A 2DT5A 5ILSA 2ZO4A 1T98A 1ZARA 2PJPA 4LLLA 3D5LA 5A2QK 4NQWA 4HOBA 5ICFA 4KMFA 5E20A 2KIMA 3WGHA 4P96A 5E1XA 4L9NA 4LFUA 5KVRA 2M30A 3T1BA 4IHSA 2KIFA 3TO9A 3FWEA 1OR7A 2NS0A 4JQFA 1V3FA 2P7CB 2K7LA 3CDHA 3DPTA 1PDNC 4ENKA 1GHCA 4DNCA 3GZ6A 1Z6RA 1MJBA 3F6VA 1QZZA 2L54A 5D5WB 2HDCA 2IPQX 1YW9A 3GWZA 4IF4A 3IWFA 2QBYA 4AWXB 1RUOA 2WWYA 3GO5A 1SAXA 1KA8A 2JTVA 1U8RA 1SD7A 4CICA 3GVAA 3ZPLA 2ZNZA 1SFEA 2QWWA 5BQTA 4HLXA 2HYGD 1YS6A 1FX7A 3V7SA 3HSEA 3F22A 3D0SA 2EWNA 4UVAA 5DD4A 1R7JA 3LQRA 3ZQ7A 2KRFA 4M6XA 1I1SA 5L3DA 2DW4A 2HTSA 3L9FA 3ZMTA 2L01A 2Y48A 4HV6A 4E70A 5ICGA 5CJ9A 4A0YA 3E5XA 3KEOA 1EH7A 1TTYA 3I0TA 3WODF 2VC0A 2DO7A 4KIGA 3I59B 4ESFA 3I58A 3HRUA 3IWZA 5E8GA 4FHTA 2VONA 2W57A 4L9VA 1G4DA 3WGIA 1ZG3A 2CO5A 2FBIA 1XMKA 3QP6A 1XGNA 5BOXA 2BE5F 2W25A 3CLOA 3WU1B 3MWMA 2FEZA 4LB5A 1BM9A 1K6OA 1FBQA 2Z9OA 4M9SA 4MEXF 4HLYA 1FBUA 4Q48A 5DUKA 1P4WA 1CF7A 5LEJA 2MLKA 5DUIA 1FP2A 4BHBA 2OA4A 2XASA 3F23A 3KEQA 1HKSA 1Q1HA 2QQAA 3CJNA 3L2CA 1P4XA 3GFIA 1O3QA 3SFZA 1KQ9A 1IXRC 2O0YA 2ESNA 4EJVA 2XVCA 2XV4S 2CWEA 2RC4A 2L3DA 4CO8A 4GYGA 4XLPF 1EV7A 4YFKF 3HTUA 1ON2A 1S3JA 3ZMVA 2XKOA 2ZNYA 2P6SA 2CSOA 1H9GA 3EDPA 2XHKA 3SHFA 2Z5UA 3HSFA 4F7ZA 4AIJA 4OIPF 2XKPA 4GCVA 1TQPA 6PAXA 4PGGA 4CDGA 3CUQA 4GGGA 3FM3A 2F5FA 2VT2A 3FX3A 1QGPA 1G3SA 1LB2A 2IRFG 2YPRA 1BIBA 4IJAA 3E97A 1IUYA 2GXGA 4ESJA 1R36A 1XGMA 4L5JA 3WTWC 3Q5FA 1XCVA 2V6CA 2E1CA 1RZ4A 4HQEA 1QBJA 1SMYF 1KU2A 1JHFA 2F5CA 1IF1A 2DTRA 1W5TA 3TO7A 3JTHA 5D6FA 1FNNA 3TDZC 4PCQA 5IT9Z 3FXQA 1SMTA 4AIHA 2OZUA 1REPC 4G6QA 3CO6C 2HEOA 3W6JB 4WXCA 2WV0A 2GXBA 1TW3A 4IVNA 1O3RA 1USTA 5ERIA 1Z6TA 1O3SA 4GO1A 5K5OA 3GFJA 3SXYA 1ZG5A 1FSHA 3VOEA 2PN6A 1W7PB 4G6DA 1YQAA 1IN8A 4ENNA 1Z91A 1J59A 4U0VA 5LHIA 3CUOA 5E17F 4BAYA 2EK5A 3O6BB 3MAJA 4ZH4F 2EFPA 3FZVA 3WGGA 2DQLA 4H0EA 1L0OC 1OYWA 3I53A 1BC8C 4Y17A 1T38A 3E6DA 2DLLA 4BYYA 3K9TA 3TDUC 4L0ZB 1YW7A 3RKXA 1R58A 4I01A 4IRHA 4ZZDA 2XIGA 4EGZA 3M9AA 3KP7A 4HBLA 1G3WA 2A69F 4G7HF 4A5MA 2Y75A 3LAJA 2B0LA 3GF2A 3IKVA 3F8NA 2J5OA 5HS7A 3HOSA 4BQAA 4NHJA 1DP7P 3F21A 2LF7A 3IKTA 2VOPA 5F1RA 1ZGJA 4M71A 1FWZA 1WWXA 2BBYA 2O03A 2UZKA 4WK8F 1R1UA 1B6AA 2E1NA 2LSOA 2M45A 5FLXZ 1W7PD 3QPTA 1G6NA 2GA1A 4KNYA 3HTSB 4CGZA 4LJZF 3H3ZA 1FT9A 3ML6A 1SD5A 2W24A 4CXFA 4MQVA 3F8BA 4I7HA 2FF4A 2J5PA 3KLNA 4RB2C 4I2OA 1ZN2A 2ZXJA 1HQCA 4AD9A 4BH9A 4QWQA 4IHTA 4RGSA 3IL2A 1FBSA 1S6LA 1J5YA 3ZN0A 3I59A 3RPUA 3H3UA 4EM1A 2TDXA 3FXUA 1IN7A 2FBKA 2RDPA 2LKPA 3U9GA 3JAMZ 3WTTC 1UB9A 2QYOA 2NNYA 1J9IA 3VB2A 3KP6A 3WTZA 3T5XA 2PG4A 2D45A 4OIOF 2ETHA 3WTSC 1I27A 2LDUA 1FP1D 2XGXA 1YTYA 3FF5A 4TV7A 5CVJA 4JK1X 1ZLKA 4YIIA 1D5VA 2FBHA 2FNPA 2G7HA 1KYZA 5L3GA 3Q9SA 4NB5A 3S2WA 4IRIA 5ILUA 2OQRA 1HSTA 4RAZA 5AIQA 1IXSB 2NAZA 2FXAA 4HZFA 1OYIA 3PQJA 2GZWA 4RGRA 2LF8A 2HFHA 1BI0A 4P55A 3HHHA 1R5GA 1R1VA 3DFGA 1YS7A 1B9MA 4FX4A 3MFKA 1S29A 1J0RA 3BP8A 5HLGA 2FNAA 5BPIA 5DEQA 3BY6A 3Q9VA 2YX7A 4HA8A 4ON0A 3DKWA 4MEYF 2XAFA 1STZA 1UFMA 3R61A 4L5IA 2Z33A 3R0AA 1IN5A 5JFRA 2GWRA 4A6EA 2VT3A 1XSXA 1XGSA 2FU4A 4ZYEA 2VC1A 4U0YA 1ZREA 1FC3A 2K86A 2XRNA 5JI6A 3KP3A 5ICEA 5D5UB 2MBFA 3K2ZA 5FFZA 5CVVA 4LK1F 3IRQA 4YFXF 4AVPA 3BPXA 2VBZA 2ESHA 3ECHA 4XSZF 2QZ8A 3J80Z 2JZYA 2KJBA 3N97A 1KU7A 1P92A 4M74A 2QLZA 1X3UA 4LB6B 2ELHA 1FLIA 2MH2A 4LGWA 5FLXK 4UXNA 1LDKB 1HSJA 1RUNA 5CVUA 3RTRA 2NYXA 2OBPA 2PLYA 2FOKA 4P9UA 3HRSA 4HYEA 3J81Z 2FSWA 1SFUA 2P5VA 5D6EA 3ZN1A 2L02A 2CG4A 3V7RA 2A3SA 3PFIA 3QOPA 2AS5F 2IA0A 2ZMEB 4PDKA 2WC2A 1FYLA 2F2EA 1QPMA 4L9TA 4XSXF 3EQLF 3RDIA 1J7KA 3GW2A 1MD0A 1JE8A 1DPUA 2HR3A 4LLNA 3GLXA 5K1YA 5HDGA 3QU3A 1BI2A 2XAHA 2BGCA 5K5RA 4RB1A 2YX4A 3ELKA 1LEAA 1P6RA 2DU9A 3P9KA 4G94A 3JAMK 1U5TA 3I54A 1WQ2A 4KDPA 2JRTA 1YG2A 4M72A 1TBXA 2A5YB 1DPRA 3R60A 2BV6A 3GYHX 4PZJA 3F72A 2FQ3A 2GAUA 4HAMA 3HUGA 3BJOA 3R4KA 2A6EF 2HQRA 1XGOA 3KP2A 3AAFA 2RV8A 5CVIA 1OYYA 1IW7F 3RJPA 2E7XA 2IA1A 2O3FA 3ECOA 5DD8A 4ZYGA 3HRMA 3P7NA 3V8KA 3DP7A 1XDSA 4BNCA 5F6FA 1R1TA 3COAC 3MEXA 5JR3A 5ILVA 3FMRA 1PP7U 2A6HF 1HW5A 2IA2A 3JTGA 3P9CA 2FRHA 2PFBA 3BDDA 5E18F 1R00A 2Q0OA 1ONVA 4UV8A 3LAPA 5IT3A 1K78A 1IN4A 4WXHA 1KQ0A 2M5WA 2A68F 4HDUA 3KFWX 2VODA 3RPQA 3KCCA 1J75A 4LG0B 3BOQA 2YSRA 5D5VB 4HDVA 5FFXA 3LQQA 5DYMA 5HS9A 3JW4A 4BHCA 4GYIA
chains in the Genus database with same CATH superfamily
3CJQB 3SZTA 3LA3A 4WBAA 3CCUP 2CUFA 4W97A 1FDOA 1SD4A 2FE3A 5FLMJ 2M8GX 1O4XA 2ZB9A 4MQ9F 1DH3A 1NTZE 1HA8A 5JVTA 2OU2A 5EGOB 4ENMA 2LNBA 3OAKA 1BGYG 3H1IG 4N4OB 3BROA 1MZ9A 4NC8A 1G2HA 2XGEA 4DW6A 2PI0A 4YG2F 2K9YA 4YTPC 2Q2EA 5KLVJ 5L3CA 4DBRA 3L37A 3CC2I 3OIPA 2NXNB 3J80K 4L0YB 4E7LA 3G4SP 2IS1A 2E74C 1NWQA 3WU2H 4MTEA 1W2EA 4AU7A 1YQ3C 1E3PA 2CFOA 2BW3B 2O8KA 1IDZA 3NARA 5HS8A 2STTA 3L72D 2VRSA 2IBDA 2MG4A 4IRGA 3L2VA 1TU3F 3CZ6A 4UVCA 1HCRA 1NG6A 2KKOA 3ZMZA 3I4PA 2V6EA 2IS4A 1K8AQ 1MH3A 1WMKA 1AKHB 4CH7A 2RNJA 2KLOA 3GHGA 2N9YB 1CI6A 4HRIA 2B88A 1TQMA 2BCCG 2EV6A 3FXJA 3LOCA 2QBYB 2X6WA 1EZVI 2E76D 3H1LE 4C7NB 4XLNF 2O3JA 1WPKA 1RQUA 3SDGA 3ABVC 5D4RA 1WI3A 3AE3C 1BOAA 4E4HA 4RB3C 1A35A 3CX5H 1JJ6C 3EWKA 3V6IA 1PFIA 3KDPB 4A3JJ 4EJOA 4ZZLA 5IYCJ 1GTWA 3HYIA 3J81K 2EV0A 2BY0A 1FJKA 1L0LG 4GKGA 2XKMA 1JCCA 3D6ZA 4QLCU 5LGNA 5LEKA 1KQLA 2PQ8A 3GXOA 4HX4A 5KK1A 2R7FA 4R79A 2HPMA 2E74B 2IVMA 2H8PD 5APTA 3L74E 2Y9ZA 1SAUA 1KU3A 4XORA 5CLSA 3E3VA 1LWUC 5DCMA 1MJAA 1NTKJ 1PGPA 5APWA 1T3JA 3ZDMA 4PUSA 4UHTA 1K4SA 5HLHA 4XRFA 2HVSA 2CQXA 1L4AD 2ACJA 1N7SD 2W84A 2UXXA 3LFKA 3H1IE 1CSBA 3ABKH 2BVMA 3IC7A 3W3CA 3JRGA 1XTAA 3ZQGA 1P7JA 2XPVA 4XFJA 1KQSO 2CK3H 4WVZA 3U2RA 1H88C 3MZHA 3H5AA 2WV1A 2KIKA 2YKQA 2M1BA 1U9NA 1X3ZB 5IOZA 2MD5A 4Y28J 4Y99C 1SQBK 1I6XA 2DK5A 4JYKA 3G71P 4II2A 3I64A 4O6JA 3K69A 5F08A 3TO6A 3EYYA 3N4XA 1Y47A 2D1VA 4A0ZA 2LXCB 1PGQA 2R7RA 5KKZB 5H6QA 4NNJA 1LFBA 3S2HJ 1LP1B 3KQGA 3SWYA 2BZTA 3KZZA 4RM2A 1LWUB 1AHDP 1A6IA 2E36A 4Y33A 4ZDOA 2PJRA 1KYOE 4BL0B 4B47A 1LTIC 1D3YA 3FWNA 2EA2A 1UHMA 3SQNA 4C30A 4KISA 3F89A 1T08B 4CYDA 4B43A 5L3EA 3I56I 2X4HA 3SZPA 1A6QA 1JMBA 1NKNA 1OZHA 2D2WA 2CS3A 4HF1A 3E0JB 4Y52J 2CW0F 3L71E 1Z1DA 3C2GA 4LIUA 4B09A 2L7MP 2ZYGA 3PNYA 2COMA 2QVOA 2VI6A 3KE2A 3QYBA 4HSRA 4Y99B 2OYHC 1VQ9P 1GDTA 4N0BA 2LKXA 2ZT9C 5ICCA 2R5BA 5HDKA 2DFEA 4A3GJ 3AG3H 1JY2N 1X4PA 1MNDA 2ELKA 2FXPA 3QAHA 2L4AA 4BE1A 1ZYRF 1U2WA 1D1CA 4A6DA 3S3OA 2Q1KA 1O57A 1XSVA 4U0WA 1DIPA 1IZ1A 4HEA2 2Q3EA 2HYJA 1XMXA 2H8WA 2N9BA 3AE1C 4A12A 2IGKA 3WG7H 2W8ZA 3B8EB 1BJAA 3QP5A 3RYRA 4C7RA 4XBFA 1Z77A 3DU5A 4KIBA 1UAAA 1MIJA 1SQQK 3CC7P 2AHQA 3CCVP 1HC8A 4KMUX 2JMWA 4DOZA 3CO7C 3PO2J 3K70C 2M9HA 4M3FA 1CZQA 3PTZA 1V55H 4IXAA 2OYHB 2G0EA 1YO5C 2A06G 1SQBE 2Q3IA 5AVWB 1Z05A 2ZT9B 1JUNA 1RR7A 3VYSB 3BPVA 2V1XA 1KD1Q 3H1ID 1MZBA 3R2PA 3TF5A 4KT5C 3Q5RA 4EGYA 4K2EA 2L4MA 1FDMA 5FD5A 4LLGF 2EV5A 4JBAA 2JA7J 2VOOA 1CF7B 3S2DJ 1HTLC 4QMAA 1N8RQ 2OC6A 2P4WA 3EFGA 2Z1DA 2EIMH 1K61A 2Y0MA 1KB9E 3V2PA 1KU9A 1POGA 3B4SA 2E74D 4OWFA 2V1DA 5E8IA 1GXQA 2DQRA 1P84H 3L73G 4BGDA 1T56A 2X51A 1W1WE 2DA4A 1OWAA 3HGYA 5J6XA 1A04A 1S8NA 2H88C 1OKRA 3U1DA 1WSUA 4BWNA 3OYNA 1IGNA 1IRXA 5IY5H 3L09A 3VP9A 4B48A 3MD0A 1J1DC 5H6RA 4M6YA 1WRGA 2BCCD 2KIQA 1M1JC 1FYMA 1HH0A 4FT8A 2Q5UA 1JHHA 3ZQCA 1BN5A 4MGRA 1HBWA 4RAFA 3L71D 3PH0A 1TL8A 3OSFA 1EH6A 3VEPA 2MFZA 3T8RA 5LD2C 3CP2A 3MKLA 1QZEA 5TRDA 4NDLA 2CPBA 3BASA 1P4AA 1ZG1A 4MHGA 4G6TB 3CUQC 5FO5A 5LHGA 1SQQE 3CX5D 4L74A 3Q2YA 2FOWA 2HPCA 3JRHA 1OVUA 3V8LA 2WQYC 1PZQA 2GQQA 2CH0A 2PFXA 3FX0A 1LT9A 3OIQA 2NPSA 2VJ5A 4G7ZF 1L0NJ 5KKZC 1G8XA 2VIXA 2IP2A 1K7AA 1E79H 2O01J 1J1DB 2WTYA 2I1KA 1WKMA 2P58A 2L9SA 3NXSA 2VN2A 4H13B 4U3FJ 1T0FC 5LGUA 2R32A 2LXBA 2QCOA 4YXDC 1HKQA 5EF6A 4BACA 4DZOA 3I5CA 3F6OA 3ABMH 1LEBA 1GW4A 3OYHA 4IOAF 1MDMB 1QVTA 1VQOP 2ISZA 4ZC3A 2YXRB 3H1KG 4OMYA 1DGRM 3CCEP 3AG2H 2KPMA 1FZEA 1ETWA 1TC3C 3CUQB 5APXA 1FOWA 1Z0XA 1BI1A 2QJYC 3E6MA 2EFWA 1E0EA 1P84E 1BE3E 1YYCA 3FXEA 4HX8A 4D0PA 1OFCX 1T95A 4IKFA 2CV1A 3FM5A 4E6KG 5L3FA 2EFOA 1GVJA 3LFUA 2ZJSE 2OTJP 1Y0NA 4U88A 3S3NA 1IK9A 2WY8Q 1F36A 4DJAA 2ECBA 1K4TA 4YELA 1ERDA 5CCGA 1SFCC 1HXDA 2XB0X 1UG0A 2JA5J 2LFBA 3EPZA 1QHHD 1LJ9A 1SD6A 3HBLA 5AW5B 3V2NA 4AYBA 1N2DC 3AE5C 4M73A 1SQVJ 4BRYA 4E7SA 3HOZJ 4WWCA 2EJRA 4N9IA 1IFNA 1ULYA 1JTHB 1PUEE 3ABTA 2ZT9D 2LYCA 3HB9A 1USEA 1IRFA 2W82A 3HTKA 4G7OF 4GRIA 2JJLA 3C1LA 2XAQA 5TGTA 3QODA 3GTQJ 1AQTA 1GLNA 2HZTA 2KIUA 4ESBA 4J00A 4S04A 2QJYB 1X58A 2M3EA 3V7CA 2IGNA 2XNDH 3A2AA 2VKVA 4U87A 1I1GA 4HQMA 5LBQA 5JVGF 2R5ZA 4MN4C 3VMXA 4BS9A 1GW3A 1CGPA 4OU0A 3BCCJ 3ISPA 3E5QA 3LA2A 1FDIA 3SSUA 4KFCA 1O3TA 2GIVA 1FE6A 1JUPA 3MKZA 4BKXA 3K70D 1SQQD 1DDNA 2A06D 3H1KE 3LIDA 1XN7A 3JSOA 2VXZA 3RKWA 4KYWA 5IYBJ 2ADUA 1DD3A 2NVUB 1Z9CA 2P1JA 1FPQA 4AYBN 3JSPA 3VP8A 1J09A 5EFWB 2VXDA 3O3KA 4CHUA 1A02F 2QSFX 2E1MC 2CFXA 3AEGC 2W1OA 2IFMA 3ESWB 4MFDA 3NEUA 4NPDA 3O8HA 1TLHB 5GTIC 1P7IA 2P8TA 4CCMA 1EJ9A 1BR4A 4D5CA 4EJWA 2BHZA 1KZUB 1S9KE 4XLHA 3IR9A 4PV1D 3TGUE 1KMIZ 4HYTB 3L73D 4WXDA 2D1HA 1GU5A 5F64A 2XGDA 2O61A 4OIQF 2QM8A 1QVGO 3FXRA 2ZVNB 3BATA 1RNLA 2M4KA 5BPDA 2Z5IA 2OF7A 4PGHA 4YIFA 2HODB 2W83C 3H1HJ 2JT1A 2TCTA 5FD6A 1OW6A 5DJUB 3HSRA 4B86A 3F3XA 3ERED 1FZCC 2E5ZA 1P84D 3GX4X 1TNTA 3L7WA 4YFNF 4UUVA 1BE3D 1S5LX 2KSEA 2QIWA 2RQPA 2IW5A 3HIFA 4FE7A 1KZHA 1YRNA 1JM0A 4H13D 2O1KA 4O9BA 3O2PE 3KP4A 3KETA 1ZRFA 2K27A 4DQ2A 2CYYA 2E1MB 1BI3A 2X6XA 2ZFWA 2I1JA 4L73A 5AVXB 2K9QA 4L18B 2UWMA 2NRAC 3W6KB 4MTDA 2F5DA 4UB8C 3N4MA 1JJ8C 2CW8A 1XCBA 1R4MB 2JN6A 2V9KA 2JUCA 2XF6A 4FE4A 1SFOJ 4X1EA 1HW1A 2M0BA 3L36A 3CC4P 2BEOA 4UV9A 3HE4B 2DXIA 2GA2A 1ODDA 3G73A 2K37A 4EYYQ 4TT3H 1OPCA 2P2UA 3CCLP 5LGTA 3K5BA 2D5VA 1S5LC 2I5UA 5DM6F 3WTVC 1H8AA 4ETSA 1DD4A 5EEGA 1A31A 2YS9A 1H0MA 1UIIA 3CCYA 1G59A 1C0WA 4IPAA 1URQA 2VE8A 3A01A 1V5GA 1QX8A 3VSKA 4LG0A 4IL6X 1SQXJ 1KORA 2NVQJ 4I02A 3TBIA 4V2GA 2M7BA 5GTIE 2X0LA 1ITYA 2YKPA 1ENHA 1KQ8A 3EETA 1YJ9P 3TNUB 3BQZA 4P9FA 3H1LJ 2UUZA 3TKYA 3CF5F 1T2KA 2PGDA 3H1KD 2MC3A 1YI2I 2R0QC 5K5QA 2WA0A 1OCOH 4M9XA 3DV8A 1JUMA 2HKOA 3EUHA 2JA8J 1OVVA 2YXQB 1R8EA 5TJHA 1S72I 3MQ0A 2QM3A 1WJBA 1ZR2A 3L74J 3CCSI 3H92A 4IL6C 4V2FA 5KAFC 3JRAA 4EM2A 1M57D 2BEZF 4JOMA 4BXXJ 4IEJA 2F5VA 2DOEA 2L0KA 3RIRA 1TW2A 5D8LB 4QIWN 3JRBA 1ZRTD 1W4MA 5C4JJ 1S9KD 1P2FA 3JRIA 2HQAA 2NVTJ 1QNTA 3FK6A 3MMYB 3TGUD 5HDNA 5EJCA 2DPDA 1F1ZA 1B4AA 3P9IA 5DCFA 1GU4A 1OCCH 3NAUA 1BSHA 2ZMEC 1APLC 2P5KA 4EVIA 1G2CA 4UB8E 3ZQFA 4IOIH 2H09A 3BRTB 2HTJA 4Z2YA 4AYCA 1BJZA 3G1OA 4EMSA 3WUUA 3MN2A 1BBYA 1WRJA 3TSIA 2K5CA 4HNTA 3DBRB 3KX2A 1U78A 1S5LE 3DQVC 3QPHA 1X0TA 3RKYA 4EJUA 2D2CC 3V4WA 2PMZA 2DOAA 5CQGA 5CCHC 4S0HB 2E71A 2XSDC 2N1TA 4RS8A 4ZDPA 3OSGA 3ZMSA 1KFNA 1HVVA 3AG4H 3LSMA 3CLQA 1UJ8A 3L75J 3HRTA 5M5XJ 3KYLA 1PP9J 4GDOA 1JGSA 1YJNP 2V9VA 2JJ7A 4KT6A 1KILC 1Q90D 4BJ6C 2PRRA 1W7PA 4KUMA 3RYPA 4HKZH 3RK3C 3V2RA 3H32B 1OCZH 3HXLA 3LA7A 2QA4P 3QRFF 2DPUA 3SJMA 2V7QH 4KN7X 3I9V2 3OL3A 1V5EA 3FKJA 3GEZA 3SEZA 4EJTA 3HUSC 2O01H 4BEHB 3AEBC 4HF2A 1FBMA 1S2EA 5K7ZA 2D2CB 4IL6E 5KAFE 2PX9A 1BL0A 4R8HA 3PFYA 1RKWA 3BCAA 3TGNA 2PBIA 4DYQA 2K9JA 2KK7A 3MGNA 2WB1A 4QPOA 5LRRA 1EC5A 2NNNA 2PMZN 5C4XJ 5M5WJ 3Q3DA 1HW2A 1B9NA 1L0NG 2HWVA 1N75A 3MCZA 1ZK8A 1LTJA 1YE9A 1QVFO 4HW0A 2C9LY 2PEXA 3G9RA 4U3FG 1XG1A 3G2BA 2M87A 4B3AA 1KILB 3M9BA 1HF9A 1ZGAA 1YHQP 3BLYA 1RIOH 1PPJE 3V8JA 1H9TA 3GUDA 4KHXA 3RK3B 4ZYHA 3OR2C 1EH8A 1BW6A 1USSA 1B59A 1ZAOA 4I09A 3HHGA 5DTDA 1WHUA 2QG4A 3CI9A 2M0MA 2QRXA 1TQIA 2R7DA 4IFDK 3T97A 2O8XA 4UUSA 2ZBKA 1UZCA 2YNYA 2WBMA 3SFDC 3H1JJ 4L9JA 2CQ7A 2HOEA 4R1HA 3VOPA 3R0JA 2DMQA 2EH3A 2L9RA 2JA6J 3M7GA 1NKZB 1XB4A 2RGVA 1W2BO 2HVQA 1Z3XA 3C18A 3S9OA 5AW9B 5F27A 1KILE 3F9KA 2WB1N 1G3TA 2A05A 3FMSA 5JHUA 2BY1A 1VQ5I 5AW8B 1IRGA 2DJIA 4EATA 3CWBG 2DA3A 3RK3E 3BG7A 2QQBA 4HF0A 4I0BA 4WWIA 1BCCJ 1Y56A 3F8MA 3PHLA 3NTNA 5FKMA 3TP3A 2E76C 2LVSA 2HQNA 4HH2A 5M5YJ 2EB7A 2A61A 3HC7A 3B5ND 2ZCWA 1R22A 2H27A 1M1EB 3GTOJ 2IBZG 3P8MC 3ZCOA 5D8KB 2Z4EA 3C8VA 3L2UA 1VQLP 3GFLA 2ZJPF 3K7AJ 2HOTA 5J1RA 3RSNA 2CUEA 5B1AH 4WX9A 2X9DA 4A0XA 2KZJA 3NRVA 3RL0B 3G6EI 4RESB 4Q5SF 2FYUK 2L5QA 3IAOA 2RN7A 1ZRCA 1BR1A 1NHAA 1SVOA 2QENA 4HPQA 3TOAA 1IRZA 1J1EB 2DMPA 3BCCG 4KN4X 3ZGKA 2B89A 2OQGA 5HLTA 3I5UA 1XDUA 3M8FA 3QYEA 2E75C 1JUSA 2DFIA 1DUXC 1JKPC 4BY1J 2VPLA 2FYUG 3MTUE 3DEUA 3HOTA 4M6VA 1TNSA 1TT5B 4BXUA 1T39A 2W85A 3BZ6A 1TWAJ 4H4KC 3BJ6A 1NTMK 2UXNA 1D8KA 2BVLA 2ZKZA 4I99C 2E76B 4JBZA 4E7JA 3GMEA 4ITVA 2X1EA 4B44A 2H1KA 3WTUC 5ED4A 2EA4A 1FAVA 1ZW0A 3DTKA 3FHZA 3DCFA 1NTMG 1NYHA 4D7NA 4NPFX 3M06A 1HBXG 2ZFCA 2LBFA 4WF2A 4IHWA 4D7MA 2LD5A 2Y2ZA 3Q0VA 2F4OB 1A36A 1AA0A 3AECC 1ETOA 5AVSB 3D6YA 1UMQA 4P1WA 1QPIA 3E1RA 4M3LA 4M3DA 3WUTA 1NAYA 2DAOA 4M3EA 2NS7A 1JO5A 4U7BA 3L00A 4BBRJ 2D2CD 4F92B 4G8XA 2E75B 4DBQA 1R4NB 5CCHD 3MZYA 1Q7YQ 2E7WA 4PJ0C 2IBZE 2VJJA 4IHVA 4JYCA 2YKOA 2DK8A 3BR1A 5CBNA 3CCJP 3HD7C 2OZ6A 2X6OA 2R4GA 3E6CC 2A6TA 3V4QA 4XR6A 4RJTA 2QJPC 5E1ZB 2QEXI 3FGAD 5BS6A 5AW1B 4OOIA 1K6YA 3CCUI 2PMHA 2FA5A 3W6VA 1KILD 1ZMEC 2MA3A 1X22A 2F6CA 5FB2A 2A45H 4KA4A 2R3CA 4Z1MH 4KIFA 4EM0B 3L4FA 3V2QA 3RK3D 5EEAA 5FKNA 4E7ZA 4E7IA 4AUWA 1X79B 3E5UA 1V4RA 1RR8C 2RKHA 2VBYA 2FYUE 3PO3J 1UCRA 2QE7H 2OYIA 1EKEA 2E35A 4JX5A 4LIVA 4DGWB 4NC6A 1M1JA 4EOTA 3G1LA 4RKUJ 1YX3A 2KYVA 1J2XA 1U0JA 4KICA 1Y39A 1JMMA 2A45G 3O6QA 1RETA 1PGOA 3C7JA 1Y8RB 2ZYAA 4CZZA 1XTCC 2E42A 1MDMA 1F9NA 3Q1MA 1L0ND 1NTME 2ZJ2A 2WSCJ 5TJJA 2HU9A 4F3QA 3S1RJ 2YIUC 3HD7B 3RPUD 4QPQA 4U3FD 3F8CA 3VMYA 1SQXG 2QJPB 4AIKA 1F4KA 3D5RC 3M0DC 2MLGA 1WZ2A 3CXHH 2HNHA 2E5NA 1T6SA 3TK1A 5H20A 1FOSF 1LVAA 1SFXA 2IYPA 1TWHJ 3RL0g 2KQRA 4DZPA 3HE5B 1G3YA 3JC22 1GXPA 5BMZA 3PNTA 2WPQA 4BY7J 5K7HA 1R5LA 1LE8B 2DMUA 3M1EA 1ZELA 2YR2A 2JSCA 3C3WA 3OV8A 3PSFA 4RGUA 3LWFA 3J7AO 1QL1A 2HLOA 3SEQA 3L70J 3BG5A 3OIOA 4LK0F 4OINF 2XAGA 3K1MA 2H6CA 4PJ0E 1T0FA 5D5XB 5DDGA 2K02A 1MMNA 2HPIA 3GZ5A 4XLFA 1F5TA 2R92J 1KYOI 2VBXA 1GL2C 2M5AB 3RL0D 2YU3A 4XKWA 1R5HA 3OWTA 2FX0A 1LDDA 1Q2NA 5IP7J 2FYZA 3FBNB 3FXDA 5J3LA 5AONA 4BBSJ 2NZ2A 5CKTA 4A2UA 4B3XA 3U21A 1L3LA 5HLIA 1FOKA 2XF5A 3IHUA 3WU2C 1WT6A 3CWBD 1QZYA 5KJ7A 2B9SA 3LSTA 1ZP0C 2QM7A 1OCRH 2HYFA 1WH7A 2DA2A 4Y15A 1R71A 1AVOA 4ZKUA 4RAYA 5B1BH 1L0LK 1T8ZA 1IC2A 4WY4A 4BHPA 3OR1C 4D6TG 3R6SA 4FQGA 2IBZD 1MH4A 4DZJA 2V1NA 5J47A 3M9QA 1SVLA 4AM3A 2NS8A 3PUBA 3G71I 3M4OJ 4EI2A 3CTAA 1IXCA 1K79A 4M9ZA 1NH4A 1SFCA 2PMUA 3GLLA 3WTXC 4PD4I 1JEKA 1WI9A 2HOAA 3H5NA 4BXLA 2KLUA 4P5OA 2JPBA 3M8EA 2IT0A 1GL2B 1JY3O 1BC7C 2YU9J 1AV1A 2Q8KA 1D7MA 5AW6B 2WSFH 2O7OA 3BCCD 1T6AA 3L75G 4I0AA 4EQQA 5CBOA 1NVOA 2DOFA 1S7AA 5F0FA 1BGYE 4N6JA 2FYUD 3F8FA 4HX7A 2E75D 5BVZA 3QU6A 2G7UA 3OS2A 4PFOA 2K4JA 2L5GB 1QEXA 4J19A 1JY2O 3MP7B 4XN0A 3CXHE 1RESA 2YMKA 2W90A 2KJCA 3ABUA 2QEXP 1X2MA 4BJTA 4CYCB 1U6GA 3AE7C 5L3BA 4JPZB 3OOUA 2STWA 2HXIA 1Z21A 2R7QA 4N9HA 3K1NA 4XKCA 4BJ5C 1NTMD 1ZXGA 3K4NA 5FROA 2SPZA 5AW0B 3D70A 2PAJA 2RMZA 2AQEA 2H94A 1EZVG 1ZLLA 2Y0CA 2ZXHA 1Y6IA 4AIDA 1KGSA 1LQ1A 3MZ8A 1SVMA 2H6BA 3EFFK 3ASNH 2W6JH 3HJEA 2P0WA 2M8EA 1KB9I 4FX0A 3K6GA 5AW3B 3WMM0 2KZVA 3FMQA 3WU2E 2WITA 3SDBA 3U59A 4I98B 4QSHA 1D5YA 5APUA 1OCTC 1ZHFA 1B8IA 3BR0A 2B7EA 2BCCE 3BWGA 2I8DA 2AEMA 1OW8A 4D6TE 4WCGA 3RI4A 5AIPA 2KS1A 2FBWC 4ZNCA 1Z7UA 4X0GA 4N78D 3MUDC 1IN6A 1I5ZA 3PM1A 3ABLH 3CCVI 3CC7I 2EBIA 4I76A 2RVCA 1U5TC 2QQ9A 2MD0A 2P6TA 2WTEA 2DDAA 4PJLA 3CJTB 4UVBA 3HOVJ 2KHMA 2VLAA 1YFHA 1L0LE 3HD7D 1N77A 4NPEA 1MMAA 2H89C 1ZKGA 1RF0C 1YLFA 2DI3A 2KDZA 5DM7F 1FJLA 1ZH5A 2DA6A 2CJJA 1W36C 5J8CA 1R5SA 3IRRA 2CGPA 3FDYA 4B8XA 5A2QZ 4X6AJ 5FKOA 3DBHB 2AXLA 4MNUA 5LHHA 3CX5E 3H1JG 3LW5H 3M0AA 4L75A 4W7YA 3P8CD 1KYWA 2QGUA 2R7OA 4JX6A 2XROA 3NQOA 1HKTA 1FC2C 1OIPA 2CPSA 3FXLA 5JHFA 2XUBA 2K1AA 2L2OA 3AEDC 4IFMA 4RB0A 2FFDC 1EDLA 2LY1A 1M7LA 1FIPA 1Z67A 3FXOA 3ASOH 5FJ8J 3E7KA 3ERMA 3M8JA 3PUFA 3BTLA 5EG0A 1VQ6P 2QKLB 5KNLA 4JYBA 3BT9A 3Q0UA 3KYQA 2Z99A 2HGCA 4NUBA 3D1NI 1VQ7I 4EV0A 3GTKJ 1AWCA 1VPCA 2VKEA 1U5TB 2G8YA 2MKVA 1NAFA 2EIJH 2RREA 1JXSA 5HVQC 1OISA 3C1DA 5J1UA 3CPWO 1MJ9A 3DWLE 4FETA 1YW8A 2DBBA 1MBEA 2R3SA 3WHBA 1XMAA 3ROUA 3EYIA 1D8JA 5AVVB 2VBWA 1MKMA 2KZGA 3EUAA 3KPEA 2XAJA 1BGYD 2VQGA 2WSEJ 4OIRF 3OYMA 2DYSH 1LGHB 5BU8B 1W5SA 3C9IA 3S1KA 3CXHD 5F04A 1JTXA 2FFDB 1FIAA 3BR2A 1UHWA 4A3CJ 1R23A 2G9WA 1N7LA 2C6YA 3HUGB 2F5EA 4PV1C 3B73A 3ZQIA 2FMLA 4LG3A 2A07F 1SQPK 1DQUA 3T8TA 2FYNB 2LR8A 3G3ZA 4PJMA 3UKGA 1GL2D 3TEDA 3K4LA 3KYCB 1N86A 3PQKA 2TRTA 1O7FA 3D5SC 2ZSHB 3U1KA 3TOBA 1O7LA 1MUUA 2E60A 3KPHA 2P5LC 3FIWA 1SQPG 3C2BA 3A2KA 5KHDA 2VE9A 4XOPA 3LSIA 1ETVA 1ZLJA 2JSPA 1HLVA 1B72A 2LRDA 3WE2A 4H13C 4XA4A 1FZCA 1BIAA 5LLQA 2B87A 4D6TD 1OMIA 1WVRA 3K4CA 1RPWA 4XQFA 1YJWI 1FYKA 2KNCA 2W6AA 4XM3A 5HOOA 1RF1C 3CCRP 4BE2A 2DMTA 3MKYB 1SS1A 2WWWA 1ZQ3P 4IZZA 1L0LD 4Y13A 2O6GE 1H89A 2MW8A 1VQOI 2ID6A 1LT1A 1ZRDA 4Q47A 5D4SA 4PV1B 3LSKA 2ZJQF 2ZMEA 2HKXA 3CCEI 1FSEA 2UV1A 2GXAA 3BVHA 4BQOA 3L1PA 1VFCA 2A06E 2R5YA 2HFED 4UNOA 2KI7B 4ANJA 1E2XA 2LOOA 3L75D 3IN6A 5AVYB 3ZMDA 4ZYDA 1RE3A 3AEFC 3BZCA 1GD2E 4XONA 3AEEC 2QSHX 3VPRA 1TWFJ 3L2WA 2HOSA 3K0LA 3P7KA 2DA5A 3F5HA 3WE3A 2JK3A 2M3AA 2HQ5A 3BJAA 4RGXA 3KIOA 2R44A 3V4GA 2DTZA 1ON1A 4RO0A 5AVTB 3ZXSA 3ULQB 1L2PA 3GFMA 2NVXJ 1DGWY 1VQPI 1K05A 1QQIA 1LDJA 3HEFA 1MSFC 1Y9BA 4ZKPA 4ENJA 1RF1B 5E3OA 3USSA 1H0TA 3L73E 2ZXEB 3VMZA 3OYIA 2VPRA 3HZJA 2OQQA 3AKZA 3K1PA 3JSVC 4RLQA 5FKKA 2OD5A 1PP8F 1K78B 1OCPA 4S05A 4CCOA 5KCMA 3B02A 1XD7A 1NU1J 3CD6P 3OYGA 4XLEA 1OW7A 2XAUA 2P7VB 1S7EA 1ZR4A 2E43A 4CA0A 3FWLA 1ETYA 3OOPA 3PNVA 1UELB 1NJIQ 2W6BA 3HOYJ 3HUSA 2OJED 4MIMA 4E7KA 5KLVK 4HG2A 1IAWA 4Q4ZF 3VFZA 2GUSA 3ZMUA 2K9NA 2KXPB 3M3YJ 2J5UA 4U7DA 2RKLA 3CMAI 1XSDA 1X19A 1F43A 5E3LA 5LRSA 3L70G 3A7OA 5CYVA 1W36D 5KLVG 2ZJRF 1HGVA 2NPSC 5AW2B 3GHGC 5E1WA 4C2MJ 2KLVA 2KZIA 2QJKC 5DV5A 1VQ4I 1QLED 1HUCA 4YXWH 4LD5A 2K4BA 4OMZA 2JKVA 3JCUH 3H25A 2FY8A 4MFEA 5J8FA 5E79H 2HG5D 2QVAA 3NMDA 3L72J 3VYTB 4AUXA 1MGTA 3OMYA 3ZP5A 3DPLC 2WVRA 2Q2EB 1JKOC 3KZYA 1EXIA 1D0YA 2VQHA 4BXFA 1LNWA 5CVRA 1BDCA 1FZGA 1D1AA 3CMMA 1JT0A 1BDDA 2MC4A 1ZN5A 2EFNA 5IT9K 1RKTA 2FMYA 2MH9A 3KYDB 3DF8A 3HKZN 2KUBA 3KP5A 3H0DA 1U3EM 3I71A 2E2IJ 1LPQA 1AOYA 2EFQA 2E19A 4YRVA 3WHCA 3WG9A 3GHGB 4ASNA 2QUFA 2CQKA 2EZIA 2ISYA 2QJKB 1B1BA 2IGOA 1SC7A 3GTPJ 1S7OA 2Z3YA 3B6CA 1NTKG 1ORKA 1Y0UA 5GAGJ 3RK2C 5M3FJ 1VTNC 3I4NJ 3QH9A 3O8GA 4A5NA 3TW7A 1JY3P 1ZRTE 2P7JA 2LKMA 3VODA 4ZDLA 1YYVA 1FOXA 2KRHA 2IJLA 2JPCA 3TYYA 3CC4I 3WU0A 3ZQHA 4HSTA 4O3MA 4LMYA 3TQNA 3S14J 3P32A 1JT6A 3CMEI 3BTCA 3MD2A 1FOSE 1R9TJ 5KLVE 1IJWC 1YIOA 3RZDJ 5EEHA 3CCLI 3B6AA 5DCMB 1J2JB 1SQPD 1RI7A 4IOCF 1FY7A 1L4AA 2EILH 4G9YA 1N7SA 3H9JA 2M8RA 4LC1A 1D0XA 1MBJA 3WTYC 4M3BA 4PJJA 2BYVE 3E7LA 3T0YA 4HV5A 1FZPB 1E17A 2YO2A 1UHSA 1QO0D 1HJBA 1HJ0A 1PJRA 4GXOA 4C3IJ 2WT7B 3BR3A 2Y69H 1A02J 1NTZJ 3KLOA 3S8PA 3DXJF 4O5VA 1YJ9I 2V79A 3PP5A 1N73A 5IPAA 3RK2B 3RCOA 2V1UA 1BW5A 4XK4A 2OAZA 3E6BA 1Z3YA 4RA2A 3OW2O 3REOA 1MNMC 3MIWA 5FGMA 4ZMDA 4C3JJ 4DIQA 2HS5A 2DT5A 3H1CA 5ILSA 2ZO4A 1T98A 1ZARA 2PJPA 2AEFA 2I10A 4XLAA 3V42A 4LLLA 3D5LA 3CMYA 5A2QK 4NQWA 2PJRB 3VWBA 4HOBA 5M1BA 4Y4RA 1PV3A 1X1CA 5ICFA 4KMFA 1PUFA 1HOMA 1KQGB 2H1LA 3QOEA 5E20A 2NRGA 3B5NC 2KIMA 3WGHA 4P96A 3M91A 4RLFA 5FRMA 5E1XA 4L9NA 4LFUA 5KVRA 3I55P 2QQ8A 3CP8A 2M30A 3T1BA 1W0UA 2FKWB 4U7JA 1U7MA 5APYA 4IHSA 2KIFA 3TO9A 5EGOA 2EPFA 3LNQA 1E3OC 3DEWA 3FWEA 4IHYA 3V5BA 1OR7A 2M2EA 3BRVB 2K9SA 4XOTA 1G1JA 2NS0A 4JQFA 1V3FA 5DJTB 3AE9C 2E2HJ 2P7CB 2O5RA 2K7LA 3CDHA 3DPTA 1E3HA 1PDNC 4ENKA 1GHCA 4DNCA 3GZ6A 1Z6RA 1VQ8I 3H1IJ 3B5NB 1MJBA 3BR5A 2BW3A 3K4BA 1OQYA 1YJNI 2R7XA 1GK4A 3F6VA 1VDFA 2E34A 1BOBA 4MLOA 2IS2A 5KLVD 4OAZA 1ZV8A 1U57A 1QZZA 3CF2A 2L54A 5D5WB 2HDCA 2IPQX 1YW9A 1AKHA 2J58A 3GWZA 3I3LA 2Q1ZB 4IF4A 3IWFA 1IO2A 2XU6A 2LR2A 2P10A 1FJPA 2QBYA 4C7NA 3DLAA 4AWXB 1RUOA 2WWYA 3GO5A 1SAXA 1YBKA 1RE4C 1KA8A 3HM5A 2JTVA 4QTRA 1EDIA 1TWGJ 1U8RA 3OS1A 2KMUA 2P67A 1SD7A 1XC5A 4CICA 3GVAA 3ZPLA 2ZNZA 1SFEA 2QWWA 4F93B 3QYFA 5BQTA 4HLXA 2BCCJ 4F55A 2HYGD 2BASA 1YS6A 2KFDA 3BTIA 3ZR8X 1FX7A 3V7SA 1YI2P 3HSEA 1GUUA 1LNQA 2W00A 3F22A 1YHQI 1LT9C 3L71J 3D0SA 2EWNA 4UVAA 5GTHH 1KONA 5DD4A 1R7JA 3LQRA 3ZQ7A 2FXOA 1LFPA 2A5WA 2C0WA 2R7UA 1GT0C 2KRFA 2OCEA 2XB5A 1FMVA 4M6XA 4XNFA 3JR9A 1NTKD 1L0NK 2XNXA 3W68A 2EINH 5GTHC 1I1SA 2WAQA 4G12A 1OX3A 1Q86Q 1X1AA 2EQRA 3LMMA 5L3DA 3RK2D 2CV0A 1EQ7A 3SFIA 1G1IA 1M8OB 2DW4A 2HTSA 3L9FA 3ZMTA 1HWTC 5CQEA 2L01A 2Y48A 4EIJA 3PL8A 2XV5A 1LP1A 4C46A 1ACIA 3AE2C 2HPCB 4HV6A 2CQQA 1FS0E 1LWUA 1VQMP 2M34A 4E70A 2IX7C 3HE4A 2KL4A 5ICGA 1LT9B 2V9PA 3E1IA 2ECCA 5CJ9A 2MABA 3CESA 3HOXJ 4A0YA 3KHUA 3FISA 1VL2A 5K5GB 2O1JA 3E5XA 3QQAA 1GV5A 4XMYA 1SQBJ 5CCGC 3KEOA 1OLTA 3AG1H 1H88A 1EH7A 4ZTFA 1TTYA 3I0TA 2JEEA 1NU1G 1VQLI 2DW3A 3WODF 2VC0A 3IUOA 4H44C 2W27A 3RL0C 2DO7A 3BG6A 3DKXA 4KIGA 1DU0A 1CW5A 3K10A 3I59B 4ESFA 3A02A 1X1BA 2KRCA 1WCMJ 4YEJA 3CCMP 3I58A 2WAQN 3HRUA 1J1EC 4D1QA 3IWZA 5EZHA 3FK7A 1SQVK 2ELJA 3AE4C 2JUGA 3CCQP 5E8GA 3F0CA 4XIDA 4KJMA 4FHTA 3VYUB 2VONA 2W57A 4L9VA 2XC7A 4BDYA 3Q0WA 1G4DA 3WGIA 1A5JA 1UG2A 1S1CX 1SQVG 1YOVB 1ZG3A 2CO5A 2FBIA 1XMKA 2L7ZA 3QP6A 1XGNA 3M9HA 1Z56A 5GTHE 1IV8A 2V4HA 5BOXA 4PSWA 3MUDA 2BE5F 1EXJA 3DU6A 2W25A 1LJ2A 1SLQA 3I4MJ 3KXDA 3CLOA 1SVFA 3L72G 1L0NE 2OYHA 4H44B 3CL3D 3WU1B 4U3FE 3LL7A 3MWMA 3GLMA 2FEZA 5GAEJ 4LB5A 1MMGA 3OYFA 1BM9A 2NVYJ 1FBQA 1LUJB 1K6OA 2Z9OA 4M9SA 4MEXF 5GADJ 4HLYA 1FBUA 4Q48A 1JTYA 5DUKA 1P4WA 5AVQB 2DT7B 2BXZA 1CF7A 2ZAEB 3A5TA 5LEJA 3JRCA 2MLKA 1NTCA 5DUIA 4AC0A 1Y1WJ 1SQQJ 3RBZA 2WAEA 2OTLP 1FP2A 1VQKI 2R5ZB 1Q1VA 3TDKA 4BHBA 3SWFA 3RKQA 2OA4A 2XASA 3F23A 4XKBA 3B71A 2VJ4A 3KEQA 1HKSA 3GG2A 3A0HH 2DFFA 1Q1HA 1WJFA 2QQAA 1YIJP 3OYKA 3M1CA 3CJNA 3L2CA 1P4XA 3GFIA 1O3QA 2IXSA 3SFZA 3OYBA 2AXCA 3CWBE 1Y1VJ 1KQ9A 3IF4A 1IXRC 2O0YA 1QA6A 1SQVE 2EIKH 1E5WA 3W67A 5IYDJ 3VN0A 2ME6A 3H1HG 3VDXA 3BTJA 1GZLA 2ESNA 4EJVA 4BDZA 2XVCA 1YITP 2XV4S 3IH3A 4I7ZB 5J1YA 2CWEA 4IX7A 1BE3J 4XRMA 2RC4A 3U1AA 5CHXA 1AU7A 2L3DA 5J40A 5M3MJ 3G6EP 1X9VA 4CO8A 4GYGA 1YQ4C 4XLPF 1H8AC 2IYOA 5J4VA 1EV7A 1NTZG 2AQFA 3E1SA 4YFKF 3HTUA 1ON2A 3HRNA 1IO4A 2LP0A 2YIUB 1NK2P 2NPSD 3BCCE 1Y8AA 3GW6A 1S3JA 3ZMVA 2NOGA 4GT1A 2XKOA 2H8RA 1KQFB 2IAIA 2P6SA 2CSOA 2ZNYA 4GOEA 1H9GA 3CJRB 3EDPA 1YRNB 2XHKA 3NFQA 3SHFA 4OVNF 2WPVB 2N8GA 1VQNP 2Z5UA 2XPWA 3HSFA 2CMPA 1T33A 1MNEA 1SQXK 3G4SI 3QPLA 2RH0A 2WPRA 3SYTA 1T2KC 3S3MA 1FOYA 3BQYA 4F7ZA 2VL8A 4AIJA 4OIPF 2H43A 2XKPA 5E3MA 1SEUA 1Z7LA 4GCVA 3CXHI 1RY3A 3IH2A 2BY3A 3EUHC 2UWJE 3AFHA 3GCMA 1TQPA 2X85A 4PGGA 5BNGA 3CUQA 1S9HA 3ZOBA 4GGGA 4CDGA 3FM3A 6PAXA 2F5FA 4E7HA 2VT2A 3FX3A 1QGPA 2EZKA 4DOJA 1G3SA 1Q81Q 2JWAA 2KT0A 3H1LG 1LB2A 2IRFG 2YPRA 1BIBA 3N7NA 4ZTJA 2R7WA 3W2WA 3RBXA 3H1KJ 2JQ7A 3TW6A 2RN0A 3A01B 4WB4A 3FBIB 4IJAA 5CCGD 1D1BA 2Y0SA 3HOUJ 3E97A 1IUYA 4N78E 2GXGA 4ESJA 1MMDA 1R36A 2MYSA 2XDVA 1XGMA 3NWTA 4L5JA 4XLCA 2Y0EA 4H44D 4OGQC 3WTWC 3PIPF 3Q5FA 3S32A 3L74G 1XCVA 1JTHA 2V6CA 2ZFUA 2E1CA 1RZ4A 4RDUA 2OV7A 1I39A 4HQEA 1QBJA 1SMYF 1KU2A 2YUSA 3JRDA 2CRGA 1JHFA 2F5CA 1IF1A 2B9BA 2DTRA 3TGUJ 1BSNA 3P8CE 1W5TA 5C44J 2VJIA 4KITB 1SQVD 3TO7A 2N1TC 3JTHA 5D6FA 2JA2A 2XF7A 3S16J 4Z6YA 3C2HA 3DPUA 2QSIA 4NBQA 3CX5I 1FNNA 2AO9A 1IK7A 3TDZC 1KYOH 5AVRB 4PCQA 5IT9Z 3FXQA 1SMTA 4AIHA 3OYJA 3ZRGA 1G2CB 2OZUA 1V54H 2ZSIB 4G6QA 3CO6C 1REPC 1PGJA 2Y0SN 4OGQB 5APVA 1SQXE 2HEOA 2LREA 3W6JB 4WXCA 3J7AY 1ETKA 2WV0A 2BEQD 2HYNA 2GXBA 4HB1A 1DX7A 4ASVA 1TW3A 3GBGA 4JQ0D 1AQ5A 1D0ZA 2Y9YA 4IVNA 1O3RA 1PP9G 3EQ2A 2R93J 1USTA 5ERIA 4IQ4A 1M1KQ 1KC8Q 1Z6TA 1IV6A 2DJNA 3L71G 3VYRB 5E3NA 1O3SA 2N1TB 3CC2P 4GO1A 1FU1A 3MHVA 5K5OA 1X1PA 1LTJC 1VQ9I 4PD4H 1EDJA 4A3BJ 3GFJA 3SXYA 1U7JA 3ITKA 2JVGA 1ZG5A 2E5TA 2HODA 1FSHA 3VOEA 2PN6A 4OWRB 4II3A 1W7PB 2K3PA 4G6DA 1YQAA 1IN8A 4H0LC 2CV2A 4ENNA 1WJ5A 1Z91A 1J59A 4U0VA 3CDLA 1IC8A 3PRJA 1LTBC 2DA1A 5CPRB 1DEBA 5B5EH 4ZJZA 3H1HD 4GDFA 5LHIA 2WT7A 3P5JA 1MBHA 4LITA 1VQ6I 2GBYA 2LY9A 3CUOA 1VI0A 5E17F 4BAYA 1LTGC 2K9JB 2EK5A 5B5EC 3O6BB 1HGZA 2GOXB 3MAJA 4ZH4F 2EFPA 2MGQA 3FZVA 1LTJB 1SQBG 3WGGA 3GMAA 2DQLA 1NTZD 3FHNA 3LSRA 1KB9H 4H0EA 1L0OC 1OYWA 2DODA 3I53A 3L75E 1BC8C 3GF3A 2E1OA 4XN3A 1V5FA 1AVYA 4Y17A 3SZGA 1PP9E 1URQD 3PLNA 2EZLA 4H0LB 4IO9F 1T38A 3E6DA 4YIRX 1RHZB 2DLLA 1JY3N 2IZ1A 4BYYA 2QKMB 1Q82Q 3K9TA 3TDUC 4L0ZB 3T97B 2XGCA 1YW7A 3UIAA 4UUSB 4TLFA 3TP0A 1KFMA 4RM3A 1QL2A 2E2JJ 4JX4A 4K35A 2FYNC 1VF5C 1PYVA 3RKXA 2OGUA 4GIFA 3TNUA 1T2KD 1R58A 1BCCG 4I01A 2OARA 4IRHA 2L7FP 1EZVE 3H35A 1BA5A 4ZZDA 1SQXD 2XIGA 1DP3A 4EGZA 3M9AA 3KP7A 4HBLA 4I6ZA 1G3WA 5H2FH 1XS9A 2BOLA 4N4NB 1GMJA 2X1DA 2A69F 3ZQQA 4G7HF 4A5MA 4C2UA 4PD4E 4B1RA 3H1LD 2Y75A 3LAJA 2B0LA 1LKXA 2DN0A 1MSEC 5H2FC 3A4CA 3CCRI 2K3FA 3I56P 3GF2A 1VF9A 3F8NA 3IKVA 3B5NA 3IP4B 2Q6QA 2JWTA 3BG3A 2Q9IA 3GTGJ 4A3DJ 2J5OA 5F0HA 5HS7A 1P84I 3A3YB 1VF5B 3HOSA 3L74D 4OGQD 3BR6A 5B5EE 1K73Q 3OYAA 3AE6C 5DS9A 2LY2A 1SQQG 4BQAA 1AA7A 3S15J 4NHJA 4PJNA 1DP7P 3HG9A 2XZRA 3F21A 2LF7A 3IKTA 2VOPA 2WPSA 3II6A 5F1RA 3H1JE 1SFKA 2KB7P 4MO7A 1ZGJA 1EA3A 4M71A 4CZCA 5APQA 1MFTA 2J59M 2DDBA 3H9GA 1FWZA 1ZOYC 1WWXA 2N1TD 1MW7A 2IDBA 1ETQA 2BBYA 2M7AA 2O03A 1WJAA 4BU2A 2UZKA 1OXZA 4WK8F 3OYCA 2ZC2A 1R1UA 3SWKA 1B6AA 2E1NA 4EDFA 1WJCA 1VQ7P 4A93J 2LSOA 3A1YA 1MBFA 2M45A 3QWLA 5FLXZ 1N78A 1BCCE 3S1QJ 1W7PD 1K9MQ 3QPTA 4AQRD 3K4JA 1G6NA 2GA1A 2LBFB 4KNYA 3M07A 3H32A 3HTSB 4CGZA 1EDKA 4LJZF 3H3ZA 2K88A 1FT9A 3CD6I 1KYOD 1BR2A 2OYIC 3ML6A 1BE3G 1PP9D 3A0BH 1SD5A 2W24A 4CXFA 5B3SH 1IJDB 2BY2A 1IFJA 1P9QC 4BEHA 2L9NA 3EUKL 3FXKA 4MQVA 1DEEG 3K2AA 2R5DA 2OTJI 5B66H 1RE4A 5CCHA 5H2FE 3VTPC 3A0BC 3F8BA 2AXTH 2GM4A 2WADA 2DYRH 4I7HA 2COBA 4B4CA 1R5ID 2FF4A 4HNVA 5C3EJ 3LSPA 3OS0A 2WSCH 3H6PA 1RC9A 2JVHA 1EZVD 2J5PA 3KLNA 2WY7Q 5B66C 3OYDA 4LLHA 5AW7B 2AXTC 4RB2C 1KTMA 4F52A 1N25A 2VUMJ 2XRLA 1KILA 3RZOJ 3K4MA 5GAHJ 1TP4A 2OUMA 2FD5A 4I2OA 1SQPE 1FTZA 1ZN2A 4H0LD 2V7QJ 2ZXJA 4PD4D 1HQCA 2AEJA 2K3RA 4M3GA 4AD9A 4BH9A 4UY8I 4QWQA 5EDNA 2OYIB 3GZNB 4JF7A 4IHTA 1M1JB 3QWOC 1MBGA 4RGSA 1YJWP 4A3MJ 2G3AA 3O6QB 3L35A 3IL2A 1FBSA 2R7VA 3GTJJ 1S6LA 2V4JC 1J5YA 5EZGA 3HKZA 1NG7A 3UNGC 3ZN0A 1FZFA 1FMWA 2X1CA 3I59A 4CSWA 3Q5PA 3DKYA 1SP4A 2KP8A 3H9QA 3CQZJ 2JDIH 2WAFA 1SQBD 3RPUA 5KJ7C 3H3UA 3UR3C 4EM1A 3H1JD 1IFDA 2TDXA 4XKVA 1XTGB 4CCLA 3FXUA 4CUGA 2DFHA 1IN7A 1LVKA 4IQJA 2FBKA 4WY4C 2ZVOB 2RDPA 2LKPA 2C0XA 4RMNA 1HF0A 1RH5B 5EYRA 1PVEA 4W1UA 2GIZA 3U9GA 3HGGA 3JAMZ 1USDA 2HDWA 3WTTC 1UB9A 2FJ1A 2QYOA 2Y30A 2NNYA 4J01A 1KB9D 2OYOA 2JP3A 1XPXA 3VB2A 3JCUC 1J9IA 3CWBJ 3TGUG 3A0BE 1VQPP 1VF5D 2P81A 3KP6A 5E79C 3WTZA 3T5XA 1BCCD 2PG4A 1GK6A 2D45A 4OIOF 3S1MJ 4W80A 2KISA 2ETHA 2Z2SB 3IH4A 4FTHA 3LIEA 5B66E 3WTSC 2AXTE 1I27A 1YX5A 1FP1D 2LDUA 2XGXA 4PSXA 1YTYA 1NTKK 4I6MC 2K9MA 3D71A 1NGMB 2X6YA 3FF5A 3Q3SA 2O01N 2OPTA 4TV7A 1HDDC 4I1LA 5CVJA 3S17J 4ABZA 5FKLA 1CI6B 4JK1X 1AJYA 1ZLKA 4WY4B 4YIIA 1D5VA 2FBHA 3J7YJ 4PFPA 4IFFA 1T3UA 5AW4B 2ZXIA 2FNPA 2G7HA 1KYZA 4JP0A 5L3GA 3MZWB 3Q9SA 3RQ4A 4NB5A 3S2WA 3U1CA 4IRIA 2FYUJ 1SFCB 5ILUA 5CJ0A 3CMAP 2OQRA 3HDDA 4YPCA 1NHLA 3L70E 3IV5A 1HSTA 5F0CA 3N05A 1TZLA 4RAZA 2L7KA 5AIQA 1IXSB 5GTIH 2NAZA 2FXAA 4HZFA 1VQ4P 1JY2P 1OYIA 1NTMJ 3DTEA 3OYEA 3IAS2 3PQJA 1PIXA 1I50J 1LTSC 3VYIA 2M0CA 2K9LA 5HODA 2GZWA 2K40A 2LF8A 3LSHA 4RGRA 4C9YA 3I55I 4W7ZA 2HFHA 3JCUE 3RGUA 1BI0A 4P55A 4A3FJ 3QPSA 1IDYA 2LC2A 3HHHA 5E79E 1NO4A 1R5GA 2B63J 2R7ZJ 1R1VA 3DFGA 1YS7A 1B9MA 1K83J 2K85A 3IAM2 4FX4A 3MFKA 1WFXA 4LOCA 3JRFA 1UIXA 3CDIA 5KAIH 3X2QH 1LFUP 2JO1A 1S29A 1J0RA 3BP8A 3NWSA 5HLGA 1R49A 4UB8H 2Y0DA 2FNAA 4XL9A 5HNHA 5BPIA 1B8IB 1KV4A 3DTIA 5AVZB 2E5YA 4A3LJ 5KAIC 1NTKE 2KS1B 5DEQA 3BY6A 3OY9A 2F4IA 2YX7A 3Q9VA 4CCJA 4HA8A 4ON0A 2R7SA 5L8RJ 3DKWA 4MEYF 4RBOA 1M56D 4OH8B 2XAFA 3S1NJ 1STZA 1S5LH 1UFMA 1TT0A 2PP6A 3R61A 2EZHA 3PSIA 4FISA 3HD7A 4F91B 2IPPA 3CMEP 2ME0A 4L5IA 2Z33A 3R0AA 1IN5A 1VNDA 5JFRA 2POHA 3H0GJ 3HE5A 1Y8QB 2GWRA 2OCCH 1X3WB 3BCBA 2DCEA 3TL4X 4A6EA 4FASD 2Y31A 2HZDA 5J4YA 1LE8A 2WSEH 2VT3A 1XSXA 1FZCB 1XGSA 2FU4A 5LFAA 1I3AA 4ZYEA 4DJGA 3G1MA 4D9JA 2RQQA 2VC1A 3HL2A 2VQLA 4U0YA 5FRNA 1ZREA 1FC3A 2K86A 3DEEA 4IHXA 1FZAA 2XRNA 3FXMA 5JI6A 2LTPA 3KP3A 5ICEA 5AVUB 5EG0B 3GTMJ 5D5UB 2M5AA 1BGYJ 4NC7A 5CMZA 3RQIA 2VQCA 3LSJA 2MBFA 1R6RA 2XPUA 3K2ZA 5FFZA 5JLWA 3GTLJ 2C9NY 2GUVA 3PJSK 3L70D 4XRSA 4IL6H 5KAFH 4DYRA 1QVUA 1JKRC 2QA4I 5KJ7D 2BXYA 3WUVA 5CVVA 3AL0C 4C3HJ 3M0DA 4UB6H 4LK1F 3IRQA 4YFXF 4AVPA 1OJLA 1XX5A 3BPXA 2VBZA 3LSGA 4WY4D 2ESHA 3ECHA 4XSZF 5HNFA 2QZ8A 3J80Z 3J7ZI 2JR8A 4UB6C 1JKQC 2LK2A 1IUFA 1WGXA 2JZYA 2LH9A 4Y3OA 2IFNA 2KJBA 1H89C 1AFOA 5KAIE 3N97A 1KU7A 1SFCD 1P92A 4M74A 4BE0A 1EF4A 2ICWG 2W4SA 1RQVA 2QLZA 1X3UA 4LB6B 5GPCA 2ELHA 1FLIA 2VKHA 1GL2A 2W48A 2MH2A 4D6TJ 4LGWA 2QF7A 2ZXWH 3A03A 4A69C 5FLXK 4UXNA 1RE3C 1VQMI 1PPJG 2GLOA 2LG4A 2ZXXA 1LDKB 1HSJA 4CCNA 3AE8C 1RUNA 5CVUA 3S4RA 4A3EJ 1IFIA 2F48A 3RTRA 1FZBA 3S93A 2KDOA 1L0LJ 2JWDA 2NYXA 2OBPA 4KT0J 1S72P 2PLYA 3AL0B 1B72B 2M3BA 2FOKA 3CCSP 2B87B 4P9UA 3HRSA 4HYEA 3K4KA 3J81Z 5CJ4A 2OTKE 2FSWA 5IOYA 1SFUA 1YTZI 2P5VA 5D6EA 2DT6A 4CYCA 1ZTRA 1I6HJ 2KNCB 1X1DA 4L76A 3ZN1A 4CPGA 1VQ8P 2L02A 2FUG2 2RAEA 2CU7A 4C2TA 2CG4A 3TMOA 3KEYA 3V7RA 3OJAB 3CCMI 2A3SA 3PFIA 3QOPA 3BZKA 2AS5F 1IFMA 2IA0A 1U9OA 3L2RA 2ZMEB 2WSFJ 4PDKA 3CCQI 4FCYA 2X48A 1X2NA 2WC2A 1FYLA 2F2EA 2R5YB 5C39A 3H36A 3FKIJ 5BU5A 4K3AA 1QPMA 3H5RA 1JI8A 4L9TA 1NU1K 4XSXF 4HNUA 3EQLF 2NPSB 3RDIA 1MFZA 1J7KA 3L2QA 2LMDA 3GW2A 2W7NA 1PL5A 1OVRA 1GVDA 1QRYA 4L5EA 2O9LA 4UB6E 1IZNB 1MD0A 4KJZA 1JE8A 1DPUA 1SANA 2KP6A 4RAGA 2Q7CA 1H0TB 2HR3A 1X8YA 1X4OA 4LGDE 4Y7NJ 3OYLA 4LLNA 3GLXA 5K1YA 5HDGA 3QU3A 1BI2A 1FEXA 2IBZI 3O8ZA 2XAHA 1ZGWA 2BGCA 5K5RA 4DCKA 4DT0A 4RB1A 2YX4A 3ELKA 1LEAA 1P6RA 2DU9A 4AVZA 2NOJB 1DU6A 4XE5B 3DBLB 2L9VA 1IFPA 2HDDA 2GOMA 5JLXA 5KTBA 3P9KA 1JOCA 2OTLI 2WSSH 2HI3A 3HUSB 4G94A 2LLKA 5TISH 4OAYA 1U8BA 1QGKB 4UUTA 3JAMK 3HPHA 3ZQLA 3PJRA 1U5TA 3VMAA 3I54A 2JRMA 2Z16A 1TWCJ 1WQ2A 4KDPA 5TISC 1M90Q 4BRYB 4BQQA 1RF0A 1FTTA 1YIJI 1LTAC 2Z5HA 3LW5J 2JRTA 1YG2A 2LKSA 4M72A 9ANTA 3HTKB 4I2LC 1CQTA 1TBXA 2A5YB 1DPRA 4BUPA 3BC8A 3R60A 2WZ7A 1W5CC 2BV6A 3MKWB 4PZJA 3GYHX 2QSGX 3KZIH 4R4LA 1NOHA 2FFDA 3F72A 2FQ3A 2GAUA 4HAMA 1JB0J 4I7ZC 3Q5SA 1WH5A 1WJEA 3HUGA 1YITI 3ONQA 3BJOA 3CCJI 3KZIC 3H3VK 1NU1E 2ID3A 2YMYA 1MV8A 3R4KA 1ETXA 2A6EF 2HQRA 2ZYDA 2IEKA 1XGOA 3KP2A 3AAFA 1I3QJ 2CUJA 2RV8A 2IS6A 1L4AC 4GODA 5CVIA 1N7SC 1VQ5P 5GPAA 1OYYA 2RNGA 2XSJC 4A7PA 2FXMA 2VB6A 1IW7F 1HDPA 5K7FA 3A0HC 3L73J 3RJPA 2XDJA 2E7XA 2YO3A 1MMSA 2IA1A 2O3FA 3ECOA 5DD8A 4ZYGA 1VQNI 2V7FA 3OL4A 4HJGH 2F4MB 2M4GA 3HRMA 3VSLA 1SQPJ 2L91A 1N73C 2V26A 3MVPA 4BQNA 2VKDA 3P7NA 1JCDA 1NTZK 3JREA 2CQNA 5APSA 3DLLF 3GF7A 3V8KA 3L72E 3DP7A 1XDSA 4BNCA 2CUZA 2KSJA 2FQ4A 4V19K 2A45I 5TISE 1NH3A 1PPJD 2WMMA 1RRJA 2ITAA 4PJ0H 2DMNA 5GP9A 1JGGA 5F6FA 1JNMA 1S4XA 4D5FA 2IGMA 1L4AB 1R1TA 3MEXA 5JR3A 3COAC 1N7SB 1URQC 5ILVA 3FMRA 3HPGA 4EEFG 1PP7U 2A6HF 3OA7A 1W5CE 2BHYA 2R7TA 3AEAC 1HW5A 2IA2A 1NK3P 3JTGA 1T8IA 3P9CA 2FRHA 1KN7A 4N3YB 5KLIC 2HVRA 4GOFA 4A3KJ 1VQKP 2PFBA 3BDDA 1VZ0A 1RF1A 3W2AA 1LTTC 2VASA 3KZIE 1N73B 5E18F 1R00A 2HXOA 3W2VA 2MJZA 2Q0OA 4CCKA 1ONVA 1IG7A 4UV8A 1W0TA 3HOWJ 3LAPA 1YTZT 1WJDA 2IZ0A 5IT3A 1K78A 1GV2A 3BG9A 1K04A 5IP9J 1OR7C 2H7HA 1IN4A 5IP6A 3PIOF 4WXHA 1KQ0A 4ZYAA 2KOGA 4NQWB 4DYCA 2M5WA 2A68F 4HDUA 2MSYA 3KFWX 4PK4A 5FLVA 2VODA 3A0HE 4XICA 1URQB 3R4YA 3IFMA 3H1HE 1QHGA 2CW7A 4GFBA 4ASWA 3RPQA 1PUFB 3KCCA 1J75A 4LG0B 4R4MA 3BOQA 2YSRA 5D5VB 1QU3A 4HDVA 1NU1D 4A3IJ 5FFXA 5F1JA 5KLIB 2DA7A 3LQQA 5DYMA 5HS9A 3JW4A 3SFEC 4BHCA 4GYIA 1MBKA 4XRSG
chains in the Genus database with same CATH topology
3SZTA 3LA3A 1SD4A 2FE3A 4MQ9F 5JVTA 2OU2A 4ENMA 2LNBA 3BROA 2PI0A 4YG2F 2Q2EA 5L3CA 3J80K 4L0YB 4MTEA 5HS8A 2STTA 4IRGA 4UVCA 2KKOA 3ZMZA 3I4PA 2RNJA 1TQMA 2EV6A 2QBYB 4XLNF 5D4RA 1BOAA 4RB3C 4EJOA 4ZZLA 3HYIA 3J81K 2EV0A 4QLCU 5LGNA 5LEKA 2PQ8A 3GXOA 4HX4A 5KK1A 2R7FA 4R79A 2IVMA 1KU3A 5CLSA 3E3VA 5DCMA 1MJAA 4UHTA 5HLHA 4XRFA 2ACJA 2W84A 2UXXA 3LFKA 3IC7A 3U2RA 3MZHA 2M1BA 2MD5A 1I6XA 2DK5A 3I64A 4O6JA 3K69A 3TO6A 3EYYA 2D1VA 4A0ZA 5H6QA 3KZZA 1D3YA 2EA2A 1UHMA 3SQNA 4CYDA 5L3EA 2X4HA 3SZPA 2D2WA 4HF1A 2CW0F 1Z1DA 4B09A 2COMA 2QVOA 3KE2A 4N0BA 5ICCA 5HDKA 3QAHA 2L4AA 1ZYRF 1U2WA 4A6DA 1O57A 1XSVA 4U0WA 1IZ1A 4A12A 1BJAA 3QP5A 3RYRA 4XBFA 4KIBA 4KMUX 3CO7C 4IXAA 1YO5C 1Z05A 3BPVA 2V1XA 1MZBA 4KT5C 4EGYA 4K2EA 2L4MA 5FD5A 4LLGF 2EV5A 4JBAA 2VOOA 1CF7B 2P4WA 2Y0MA 1KU9A 2V1DA 5E8IA 1GXQA 2DQRA 5J6XA 1A04A 1S8NA 1OKRA 3U1DA 1WSUA 3L09A 5H6RA 4M6YA 1FYMA 4FT8A 1JHHA 1BN5A 4MGRA 1EH6A 3VEPA 3T8RA 5TRDA 1P4AA 1ZG1A 4MHGA 5FO5A 3CUQC 5LHGA 3V8LA 2GQQA 4G7ZF 2IP2A 1K7AA 1WKMA 2VN2A 5LGUA 1HKQA 3F6OA 1LEBA 1MDMB 2ISZA 4OMYA 3CUQB 1BI1A 3E6MA 2EFWA 4HX8A 4D0PA 3FM5A 5L3FA 2EFOA 1GVJA 4U88A 1HXDA 1LJ9A 1SD6A 4M73A 4WWCA 2EJRA 4N9IA 1ULYA 1PUEE 3ABTA 1IRFA 4G7OF 2XAQA 2HZTA 2KIUA 4ESBA 4S04A 3V7CA 1I1GA 4HQMA 5LBQA 1CGPA 4OU0A 3ISPA 3E5QA 3LA2A 4KFCA 1O3TA 2GIVA 1DDNA 1XN7A 3JSOA 3RKWA 2VXZA 4KYWA 2ADUA 1Z9CA 1FPQA 3JSPA 3O3KA 4CHUA 2CFXA 3NEUA 1TLHB 2P8TA 4EJWA 4WXDA 2D1HA 5F64A 2O61A 4OIQF 3FXRA 1RNLA 5BPDA 4PGHA 4YIFA 2JT1A 5FD6A 3HSRA 3F3XA 3ERED 3GX4X 1TNTA 3L7WA 4YFNF 4UUVA 2RQPA 2IW5A 3HIFA 3O2PE 3KP4A 3KETA 1ZRFA 2K27A 4DQ2A 2CYYA 1BI3A 2ZFWA 4L18B 2UWMA 2NRAC 3W6KB 4MTDA 2F5DA 3N4MA 1XCBA 1HW1A 2BEOA 4UV9A 2GA2A 1ODDA 3G73A 1OPCA 5LGTA 3WTVC 4ETSA 5EEGA 1H0MA 1C0WA 4IPAA 2VE8A 4LG0A 4I02A 2X0LA 1KQ8A 3EETA 4P9FA 3TKYA 1T2KA 2MC3A 5K5QA 4M9XA 3DV8A 2HKOA 3EUHA 3MQ0A 2QM3A 3H92A 4EM2A 3RIRA 5D8LB 1TW2A 1W4MA 1P2FA 1QNTA 5HDNA 2DPDA 1F1ZA 1B4AA 3P9IA 5DCFA 2P5KA 4EVIA 2H09A 2HTJA 4Z2YA 4EMSA 1BBYA 1WRJA 1U78A 3DQVC 3QPHA 3RKYA 4EJUA 4RS8A 3ZMSA 3HRTA 1JGSA 2V9VA 1W7PA 4KUMA 3RYPA 3LA7A 3QRFF 2DPUA 4KN7X 3GEZA 4EJTA 4HF2A 4R8HA 3TGNA 2PBIA 5LRRA 2NNNA 1HW2A 1B9NA 2HWVA 3MCZA 4HW0A 2PEXA 2M87A 1ZGAA 1RIOH 3V8JA 1H9TA 3GUDA 4ZYHA 1EH8A 1USSA 1B59A 1ZAOA 4I09A 3HHGA 1TQIA 2R7DA 2O8XA 2ZBKA 4L9JA 2HOEA 4R1HA 3R0JA 3M7GA 1XB4A 2RGVA 3C18A 1G3TA 3FMSA 5JHUA 1IRGA 2QQBA 4HF0A 4I0BA 3F8MA 2HQNA 2EB7A 2A61A 2ZCWA 1R22A 2H27A 5D8KB 3GFLA 4WX9A 4A0XA 3NRVA 4Q5SF 2RN7A 1ZRCA 1NHAA 2QENA 3TOAA 4KN4X 2OQGA 3I5UA 1XDUA 3M8FA 2DFIA 1DUXC 3DEUA 3HOTA 1TNSA 4BXUA 1T39A 2W85A 3BZ6A 3BJ6A 2UXNA 1D8KA 2ZKZA 3WTUC 5ED4A 2EA4A 3FHZA 1HBXG 4WF2A 2DAOA 4U7BA 3L00A 4G8XA 3MZYA 2E7WA 2DK8A 2OZ6A 3E6CC 5E1ZB 5BS6A 4OOIA 2PMHA 2FA5A 2MA3A 5FB2A 4KA4A 4KIFA 4EM0B 3E5UA 1V4RA 2RKHA 2VBYA 1UCRA 1J2XA 4KICA 3C7JA 4CZZA 1MDMA 1F9NA 2ZJ2A 5TJJA 3F8CA 4AIKA 1F4KA 2MLGA 1T6SA 5H20A 1LVAA 1SFXA 1G3YA 1GXPA 5BMZA 3M1EA 2YR2A 2JSCA 3C3WA 3OV8A 4RGUA 3LWFA 3J7AO 4LK0F 4OINF 2XAGA 3K1MA 2H6CA 1T0FA 5D5XB 5DDGA 2K02A 1F5TA 3GZ5A 2VBXA 2YU3A 1R5HA 1LDDA 5AONA 4A2UA 1L3LA 5HLIA 1FOKA 3IHUA 1QZYA 3LSTA 4Y15A 2HYFA 4RAYA 4BHPA 3R6SA 3CTAA 1IXCA 1K79A 4M9ZA 2PMUA 3WTXC 1WI9A 4P5OA 2JPBA 3M8EA 2IT0A 1BC7C 2Q8KA 4I0AA 4EQQA 1S7AA 3F8FA 4HX7A 3QU6A 2G7UA 2K4JA 2KJCA 3ABUA 1U6GA 5L3BA 2STWA 4N9HA 3K1NA 2H94A 1LQ1A 1KGSA 2H6BA 2M8EA 4FX0A 3FMQA 4I98B 1ZHFA 3BWGA 4WCGA 3RI4A 5AIPA 1Z7UA 1IN6A 1I5ZA 1U5TC 2P6TA 2QQ9A 2RVCA 2WTEA 4UVBA 1YFHA 1YLFA 2DI3A 1ZH5A 5J8CA 3IRRA 2CGPA 4B8XA 5A2QZ 5LHHA 4MNUA 2AXLA 1KYWA 2XROA 3NQOA 1HKTA 2XUBA 4RB0A 2Z99A 2HGCA 4EV0A 1AWCA 1U5TB 1JXSA 5HVQC 3C1DA 1MJ9A 1YW8A 2DBBA 2R3SA 3EYIA 1D8JA 1XMAA 3ROUA 2VBWA 1MKMA 2XAJA 4OIRF 1W5SA 1UHWA 1R23A 2G9WA 2C6YA 2F5EA 3B73A 2A07F 2FMLA 3T8TA 3G3ZA 3PQKA 1O7FA 3TOBA 1O7LA 2P5LC 2VE9A 1ZLJA 3WE2A 1BIAA 5LLQA 1OMIA 1FYKA