2GA1A

Crystal structure of a duf433 member protein (ava_0674) from anabaena variabilis atcc 29413 at 2.00 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
MNKKTQLLEVIAALPEELVDQALNYVQMLQNPIQITPGVCGGQARIRNTRIPVWTLVAYRQQGAPDKELLANYPGLTAEDLSAAWHYYEQNPEQIDREIAQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of (YP_321193.1) from Anabaena variabilis ATCC 29413 at 2.00 A resolution
rcsb
source organism Anabaena variabilis
molecule tags Unknown function
molecule keywords Protein of unknown function DUF433
total genus 30
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04255 DUF433 Protein of unknown function (DUF433)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ga1A02
1.20.5.800 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Alr1493-like domains 2ga1A01
3P9CA 3ML6A 4M73A 1KYWA 4R1HA 3SQNA 4YFKF 2D45A 1Z9CA 3PFIA 4JK1X 4CICA 2FF4A 1I1GA 4M72A 3MZYA 1QQIA 1S6LA 2QQBA 5E8IA 3V8KA 2FEZA 1H0MA 3GWZA 1IW7F 4KA4A 2PLYA 3WE3A 2DT5A 1W4MA 1MJBA 2ZO4A 2P5LC 4UHTA 3F23A 2IA1A 5A2QK 4G94A 1HKSA 3EDPA 2PMHA 1BM9A 1LDKB 4ZYDA 4WF2A 3VFZA 1DUXC 3WTXC 4Q5SF 1FT9A 2QWWA 4S04A 3ROUA 5HDKA 2CG4A 1WQ2A 4OIQF 4HLXA 3FM5A 2MH9A 3ABTA 1DDNA 3TDZC 5D4SA 5HLGA 5TJJA 4AD9A 3E5XA 4EGYA 3RI4A 2VC0A 3V8JA 1RUNA 2OU2A 4KMFA 2NAZA 1XGSA 3S2WA 1B4AA 1YYVA 2MC3A 2F5FA 2MBFA 3BJ6A 4U88A 3I64A 3GZ5A 3I5UA 4O3MA 3RPQA 5F6FA 2VBZA 4BQAA 1BI3A 3QP5A 1O3TA 3BPXA 1OYWA 3GUDA 2ZMEA 4DQ2A 3BJOA 3OV8A 3ZN1A 2ZNYA 3F8MA 4CHUA 3GX4X 1SMTA 2FBKA 1BI1A 1S7OA 4LJZF 4HLYA 4MTEA 5IT9K 4AIJA 2BE5F 3KP3A 5L3EA 2K27A 1QNTA 4KICA 3T8TA 3J80K 2XV4S 4GGGA 4UV9A 4LK1F 2GIVA 5CVRA 5DCFA 5DCMA 5LGTA 1Z7UA 1YLFA 4HQMA 3NQOA 3RKYA 2MA3A 3ZMSA 2RDPA 2P6SA 4EV0A 3WTWC 1IN7A 2UXXA 3N4MA 1ON2A 3VODA 1ZAOA 1XN7A 4LD5A 3HSEA 2A6HF 2ZBKA 1BN5A 3HTUA 4WCGA 1LEBA 1BC8C 3IC7A 4RGUA 5FGMA 2EFPA 2C6YA 4RAZA 4Q47A 1LVAA 4PZJA 3T0YA 2VE8A 1KQ9A 5EEHA 1R1TA 1FX7A 1B9MA 3MCZA 5K5OA 3E5UA 3IWZA 1SMYF 4PCQA 3KP7A 3IRRA 2A07F 1ZG5A 1GXQA 4CXFA 3RDIA 4OU0A 3LWFA 3ZP5A 2VBWA 1FSEA 2XAGA 2NYXA 2VN2A 2K4JA 4HDUA 4KN4X 4KNYA 4ETSA 3M7GA 4MNUA 2COMA 3CDHA 3L09A 3L7WA 2ELHA 3MEXA 4Q48A 4U0WA 3WU0A 1YO5C 2DI3A 1VTNC 3FHZA 1MDMA 5BPIA 1HW1A 1IZ1A 2XROA 3WGGA 1EH6A 4O6JA 1HW5A 2Q8KA 1ON1A 2V1DA 2O3FA 2OZ6A 2HTJA 2L01A 2DPDA 2EFWA 5BOXA 4LLNA 4LFUA 4EGZA 5E1WA 5L3DA 2F5DA 5IT9Z 4JBAA 4P9FA 3BP8A 3H92A 2QQ9A 3NRVA 3F8NA 2PI0A 1Y0UA 2IJLA 1TW2A 1ZREA 1NHAA 4ZYGA 4B8XA 2GA1A 3I4PA 1KQ8A 1P2FA 3E5QA 3KLNA 1XCBA 4LLGF 3M8EA 2FXAA 2FNPA 4ZYHA 4I01A 1FOKA 1MD0A 2DK5A 2A5YB 3EETA 1YIOA 3KCCA 1YW7A 5ED4A 1Z91A 4RAYA 1ZRCA 4H0EA 2P7CB 4BAYA 3JTGA 1FBSA 3I54A 1USSA 4IF4A 1J7KA 4U0VA 4EJWA 3Q9VA 2UWMA 2WC2A 3HTSB 2F2EA 1J0RA 4HQEA 1RIOH 2DQLA 3D0SA 5D8LB 3ELKA 5D6FA 1KU9A 2DK8A 3MWMA 1CGPA 2PQ8A 5K5QA 2EJRA 4HF0A 6PAXA 1F5TA 3GEZA 2XGXA 2E1CA 1CF7B 1H9GA 1MJAA 2M30A 1ZH5A 1EH8A 1FNNA 1GVJA 4OOIA 3HIFA 2HFHA 4GXOA 2ZKZA 1CF7A 2E1NA 2OZUA 4I7HA 3F72A 2M45A 4L0YB 3JAMZ 1LEAA 2XAQA 2DQRA 4PGGA 4XRFA 5FLXK 5H6RA 1MGTA 1F9NA 1TQMA 1TLHB 1G6NA 4YIFA 3WTVC 1D3YA 4DNCA 1YTYA 1XSDA 3HRSA 5ICCA 5K1YA 5LRRA 2CWEA 2DFIA 2FMYA 5ILVA 4A6EA 4KIBA 4IRHA 2STWA 2EA4A 2K7LA 4Y15A 1I6XA 3M9AA 4BHPA 4YIIA 2EFNA 5D4RA 2HOEA 3BWGA 2Y75A 2RC4A 2X4HA 1K79A 1D8KA 3EQLF 2XASA 3ECHA 1UB9A 2F5EA 3WTTC 1SFEA 5E1XA 2WWYA 2E7WA 4GYIA 2FBIA 3ZMUA 1T39A 1PP8F 1IN8A 3W6KB 3V7SA 3IL2A 2P7VB 1B6AA 1IXCA 3I58A 2M1BA 5HLHA 4Z2YA 2DPUA 4IRIA 4P5OA 1R58A 5E8GA 5JHUA 3RTRA 4KMUX 2A61A 2QENA 3SZTA 2PBIA 2QBYA 3WE2A 2G7HA 4F7ZA 4WXDA 4GCVA 1GXPA 3RKXA 2O6GE 5BPDA 2KKOA 5JR3A 3KZYA 2OA4A 4MHGA 1HXDA 1XGOA 2H6BA 2J5OA 4A0ZA 5AIPA 4G6QA 2DO7A 1PDNC 1UHMA 2VODA 5J6XA 5FLXZ 2D2WA 1L0OC 4TV7A 3DF8A 3F8CA 3GYHX 5AIQA 4G6DA 1LB2A 1BI2A 3QP6A 4RGSA 4LK0F 3JTHA 2M87A 5DD4A 5BQTA 1W7PD 2HKXA 3FMSA 1REPC 1ZG3A 1LJ9A 4MTDA 2XRNA 1G3TA 4IJAA 4BXUA 4UV8A 2CSOA 3E6CC 1T2KA 3ZMZA 3CLOA 3CO6C 2A69F 1ZHFA 1W5SA 3R6SA 5L3FA 1ZGAA 2W85A 1HQCA 3CUQA 2CYYA 1ZRDA 4YFNF 5ILUA 2W24A 4AVPA 2ZJ2A 3ECOA 3GXOA 4FX4A 3SFZA 3DPLC 4OIRF 3KP6A 2NNYA 5HS8A 1Z6TA 4BHBA 4IVNA 3CO7C 4KYWA 1Z1DA 2RN7A 3U1DA 4LG0A 2MLGA 3E6DA 3BOQA 1RUOA 1MZBA 2YR2A 4FHTA 2AS5F 2HZTA 4U7DA 1STZA 5HDNA 1O3QA 1J2XA 1IXRC 4BH9A 2XAFA 5LHHA 4ENNA 3F6OA 1AWCA 4L0ZB 1G3WA 1J75A 2Z5UA 1S3JA 2EWNA 2YSRA 5FO5A 1PP7U 2HS5A 3BROA 3LAPA 3ZPLA 3V7CA 4RB1A 5FD6A 3LA2A 4IRGA 1YW8A 1FBUA 1ZYRF 3L9FA 1XDSA 2IRFG 2L02A 3CTAA 3KFWX 3R0JA 2DU9A 1WWXA 2FRHA 1F4KA 3ZMDA 5IT3A 1J5YA 1R22A 1YQAA 5CLSA 1JHFA 2CO5A 2D1VA 1HSJA 2FMLA 3FF5A 2IA0A 2Q0OA 2KJCA 1XSXA 1MJ9A 5DV5A 1XSVA 4EQQA 4MGRA 2XAHA 4WWCA 2MLKA 4ZZDA 2BBYA 2HGCA 2A6EF 2B0LA 1J59A 1Q1HA 5L3GA 4KDPA 3GFMA 3C1DA 4RB3C 3I0TA 4L9JA 4KFCA 1LNWA 3ABUA 1S29A 3R0AA 2RVCA 4ZZLA 2QQAA 1ZRFA 1SAXA 5ERIA 2GXGA 1A04A 4L9VA 1BIBA 2R7FA 3BPVA 2GZWA 3LA3A 2JTVA 4EM0B 1FC3A 2VT3A 3ISPA 2ZNZA 3QRFF 4LG0B 1G3YA 3IWFA 1FBQA 4U7BA 2CQKA 3E6BA 5BMZA 4KT5C 3G3ZA 2KJBA 2CGPA 1IRGA 2ISYA 1OYYA 1KU2A 2PFBA 4Y13A 3NEUA 2PMUA 1DPRA 3J7AO 3HRUA 1P4WA 3GFLA 3O6BB 5AONA 5FD5A 5ICEA 1QBJA 4I02A 3GVAA 3V7RA 2FNAA 3HOTA 2V6CA 4P55A 3LFKA 3D5LA 3K1NA 3J80Z 2EA2A 2KIFA 4ZYEA 3FWEA 1FYMA 5H20A 3T1BA 3GF2A 3DKWA 1FWZA 1WI9A 4L9NA 3R61A 1YG2A 3FX3A 2O03A 4A0XA 1UFMA 4OINF 2GA2A 3P9KA 2R3SA 5F64A 2HEOA 2Y0MA 3MAJA 3L00A 1I1SA 3BDDA 4CO8A 3R60A 2H94A 1SD7A 1XCVA 3EYIA 1FYLA 3HUGA 4E70A 3DV8A 1WKMA 3TO9A 1ZGJA 2V1UA 2VC1A 2K02A 3F22A 2P5VA 4I2OA 1MKMA 4CDGA 3DP7A 3HRTA 3RIRA 5ICGA 5JI6A 2LKPA 2KIUA 5CVJA 4ENMA 1EV7A 2DLLA 1TNTA 1QZYA 2P6TA 2UXNA 2RKHA 2FOKA 1E17A 4K2EA 2KIMA 4OMZA 5CYVA 1FP1D 2K4BA 3C18A 4BNCA 1G4DA 3M8FA 1Z05A 4HV6A 3COAC 3FMRA 4A5NA 2FBHA 2RGVA 2YU3A 1JE8A 1LDDA 4I0AA 2XHKA 3LSTA 2FE3A 2KRFA 3QU6A 1GHCA 4JQFA 5A2QZ 4G9YA 4RGRA 1BC7C 1C0WA 1U3EM 4LB5A 2W84A 4WXCA 3N97A 2HR3A 3KP5A 5L3CA 4CGZA 2HKOA 4LB6B 3V4GA 3RKWA 2GWRA 3FM3A 2L3DA 1BJAA 4XSZF 2Q2EA 2OD5A 3O2PE 5E17F 3J81K 2RNJA 1BIAA 2JPBA 2BEOA 5E18F 4CZZA 1FPQA 2OAZA 1D8JA 3IRQA 3SZPA 2A3SA 2EV5A 1OKRA 4KUMA 3DFGA 3KP4A 2PN6A 1R7JA 3V8LA 1QGPA 3WTUC 4ENKA 1U8RA 3H3ZA 1IF1A 2MH2A 4RB2C 2MD5A 3KETA 3GW2A 4QLCU 3J81Z 3R4KA 5LRSA 3GZ6A 5ICFA 2IVMA 2IA2A 2QZ8A 2QUFA 2FA5A 2RQPA 2JRTA 3VB2A 1BOAA 3KE2A 1OR7A 3O3KA 3OOPA 1S7AA 4Q4ZF 2G7UA 2HTSA 3ZN0A 2QLZA 1D5VA 4EJUA 5HOOA 4M6XA 3IHUA 4N9IA 1ODDA 3P7NA 3QAHA 2QVOA 1LDJA 4XLPF 3B02A 3GFIA 4G7HF 5HS9A 3TO7A 3WGHA 3K2ZA 4IPAA 4AWXB 1U2WA 5J8CA 3CUQC 3KZZA 3WTSC 2BV6A 2CFXA 2Z33A 2R7DA 4HW0A 2Y48A 4EM2A 3W6JB 4MQ9F 5LGUA 3TQNA 4PDKA 1SD5A 4NHJA 4O5VA 1XMKA 2X0LA 2VBYA 1RI7A 2WV0A 2VONA 4R79A 4HAMA 4KN7X 2XIGA 4HOBA 1JHHA 5D5UB 3LA7A 1IN5A 4A12A 2ESHA 3IKTA 2EFQA 4I98B 2IT0A 2DTRA 1JGSA 3WTYC 3F8FA 4UVBA 3CUQB 5LEJA 2L54A 2LF7A 2NRAC 2EK5A 2ZXJA 5E20A 3Q5FA 1ZN2A 1YFHA 1EH7A 3CJNA 2EB7A 2WTEA 4XBFA 3AAFA 2J5PA 4EJOA 2XKOA 1OPCA 3BJAA 4GO1A 5CVIA 3JSOA 2ZCWA 4UXNA 5DDGA 3HRMA 2IP2A 3ULQB 5LBQA 2FSWA 3Q9SA 3K1PA 1KU3A 2BYVE 3E6MA 4CYDA 3WU1B 1K7AA 1J9IA 4FX0A 5LHIA 2OBPA 2BGCA 1O7LA 1KQ0A 2W25A 2YPRA 3DPTA 5HDGA 5F1RA 2GAUA 1BI0A 4G7OF 1I5ZA 1R36A 3KEOA 4G8XA 1KGSA 3QOPA 2O61A 4A6DA 4ESFA 2FU4A 5J8FA 5DYMA 4A5MA 2G9WA 3K9TA 2GQQA 5LLQA 1ULYA 5E1ZB 3WGIA 1FP2A 2STTA 3CUOA 3C3WA 3DQVC 1L3LA 2Z3YA 4ASNA 5LGNA 1FY7A 1TQIA 5CVVA 4FT8A 4NB5A 3LAJA 1SFXA 5LEKA 3VEPA 3BZ6A 1IAWA 2V79A 3G73A 2V1XA 2CW0F 1ZARA 1T38A 3K1MA 1IN6A 1BBYA 2GXBA 1K78A 5TRDA 4OIPF 1X3UA 3TKYA 2VOOA 1ONVA 3I59A 1YS7A 3LQQA 4WX9A 1FYKA 2Z99A 5DUIA 2DW4A 4HV5A 3PQJA 5EEGA 4HBLA 3RYRA 1ZLKA 4I0BA 4I09A 2QBYB 2ZFWA 2A68F 1UHWA 4EMSA 3QPHA 4ENJA 3WTZA 2EV6A 2OQGA 4M9XA 2F5CA 2L4MA 1XGMA 4MQVA 4L5JA 2HYFA 4BYYA 2H27A 4EJVA 3KLOA 2EFOA 4HYEA 2PJPA 2W57A 1TW3A 4L9TA 3WODF 1HKQA 4RB0A 3K69A 3U9GA 4HX7A 1HSTA 3TOAA 3ERED 4ON0A 2P5KA 1HW2A 1B59A 4RS8A 3P9IA 3FXUA 1MDMB 2QYOA 1IN4A 3RYPA 1WSUA 1U6GA 3IKVA 1P92A 3HHHA 4UNOA 3HOSA 2LNBA 1V3FA 3T5XA 2HWVA 1QO0D 1RNLA 1F1ZA 2L4AA 4A2UA 4ZH4F 1U5TA 2H09A 4LMYA 5D5WB 4HX4A 3SHFA 4UVAA 3K0LA 1P4AA 5KVRA 1ZLJA 3TOBA 2VXZA 1B9NA 2JSCA 3MQ0A 1W7PA 1OYIA 3E97A 3JW4A 1XGNA 1W5TA 1TBXA 2NS0A 1B1BA 5D5XB 3I53A 2V9VA 5D8KB 4ESJA 3HHGA 1ZG1A 3QPTA 1LQ1A 3FXQA 4M71A 1FSHA 1WRJA 3EUHA 1KU7A 1K6OA 1IXSB 2ACJA 3KP2A 4HZFA 5KK1A 1QZZA 1I27A 4P9UA 2AXLA 5K5RA 2DBBA 5DCMB 1H9TA 1JXSA 1TQPA 1P6RA 2P4WA 4D0PA 3F21A 1QPMA 4S05A 5DD8A 4OMYA 1E2XA 1FLIA 1U5TB 1R1UA 3WG9A 2M8EA 2IPQX 2IW5A 2OQRA 1YS6A 1V4RA 2FQ3A 4A0YA 4PGHA 4EM1A 1DPUA 3F3XA 3GO5A 4IXAA 4AIHA 2DAOA 2K86A 2ZMEB 4RGXA 2M5WA 5D5VB 4N9HA 1XB4A 4EJTA 1S8NA 5DUKA 5HS7A 4HF2A 2YX4A 4LGWA 2E7XA 4HX8A 5D6EA 1KA8A 1XMAA 1U78A 1W7PB 3FXRA 3JAMK 4L5IA 1DP7P 1T0FA 1O57A 3TO6A 2HQRA 4UVCA 4M6YA 5JVTA 2O8XA 3H3UA 4WXHA 1TNSA 2XUBA 5FFZA 3ZMTA 3I59B 5FB2A 4N0BA 1O3SA 5FFXA 1XD7A 2HQNA 4P96A 4L18B 1SFUA 4YFXF 2PEXA 1R1VA 2PG4A 3FZVA 3REOA 3F6VA 3U2RA 2NNNA 2YX7A 3RPUA 3HSFA 3ZMVA 4GYGA 4R8HA 2XVCA 3I71A 2HYGD 4AIKA 1SD6A 3VOEA 4IHSA 1HBXG 3DXJF 5L3BA 4QWQA 1KYZA 1FZPB 3QU3A 4EVIA 3KEQA 1U5TC 2EV0A 1IUYA 4WK8F 3TDUC 4M9ZA 4BHCA 3EYYA 1TTYA 5DEQA 1AOYA 1HKTA 4Y17A 1O7FA 1R5GA 2VT2A 3B73A 4M9SA 1R23A 1OMIA 3T8RA 2HDCA 2O0YA 1T98A 2JPCA 1K78B 4G7ZF 5ILSA 3GFJA 2LDUA 4MEYF 5BS6A 2TDXA 2JT1A 3MFKA 3RJPA 2LSOA 4XLNF 4XSXF 2Z9OA 4U0YA 3F8BA 3L2CA 5HVQC 1G3SA 4OIOF 3SXYA 1RZ4A 1T6SA 2XKPA 5H6QA 3HSRA 1PUEE 2ADUA 4HF1A 2UZKA 4ESBA 2ESNA 2D1HA 4UUVA 1UCRA 2VBXA 5CJ9A 3LQRA 3M1EA 1O3RA 1IRFA 3E3VA 1SD4A 4NQWA 2JZYA 4B09A 2P8TA 4LLLA 1Z6RA 3JSPA 5HLIA 3DEUA 4KIFA 1R5HA 3MZHA 4MEXF 1XDUA 1USTA 1YW9A 2QM3A 4KIGA 3TGNA 5LHGA 2XAJA 2ETHA 1P4XA 4HDVA 3BY6A 3HYIA 3GLXA 2RV8A 2ISZA 3FMQA 4YG2F 3C7JA 5CVUA 1R00A 3ZQ7A 4IHTA 4HA8A 4M74A 2VOPA 2LF8A 2VE9A 2H6CA 3PQKA 5JFRA
chains in the Genus database with same CATH superfamily
3P9CA 3ML6A 4M73A 3SFDC 3I3LA 1KYWA 2ZJPF 4OAZA 4C2MJ 2KLUA 3G1OA 4R1HA 4I76A 3SQNA 1A36A 2QM8A 1J1EB 5AW0B 3BG6A 4D6TJ 4YFKF 2FX0A 2RREA 1MZ9A 1R5LA 4ANJA 1Z9CA 2D45A 3PFIA 1IC8A 3CD6I 1A35A 2OGUA 2XDJA 4JK1X 4CICA 2FF4A 3S32A 1I1GA 1HWTC 2SPZA 2ZAEB 3VPRA 1DU6A 2RQQA 4M72A 4F93B 4FQGA 1U8BA 3MZYA 3KYQA 2JA7J 3Q5SA 1QQIA 1S6LA 2QQBA 5E8IA 1GMJA 3V8KA 1TWAJ 1R5ID 2EIMH 2FEZA 2KQRA 1H0MA 3WMM0 3JRIA 2L9RA 3GWZA 2C9NY 1IW7F 4KA4A 2PLYA 3IH4A 3WE3A 5F0FA 4NC6A 3B4SA 1W4MA 2DT5A 1LP1A 1MJBA 2LYCA 3HG9A 4A3LJ 2CUJA 1JOCA 3HE4A 5B5EH 1OW6A 2OYHA 1Q82Q 3SEQA 3BTLA 2ZO4A 4ZC3A 4Y7NJ 3L71D 1BR2A 2P5LC 1VQOI 1BGYD 2DA2A 2E5YA 4ZYAA 5IPAA 4UHTA 4DW6A 3CCLI 5KLVD 2G3AA 3F23A 2DA4A 2IA1A 1J09A 1GT0C 2R7VA 5A2QK 3K5BA 3ZQFA 2X1EA 4MFEA 4G94A 1HKSA 3EDPA 3AEAC 2PMHA 5AW8B 4IOIH 1BM9A 1LDKB 1BJZA 2HPMA 4V19K 3H1JE 4ZYDA 3TGUD 1U7MA 2PX9A 2KS1B 4WBAA 4ZKUA 1NHLA 5AVXB 3LOCA 5KKZB 4IL6X 4WF2A 3CJTB 3VFZA 1EA3A 3WTXC 1DUXC 4Q5SF 2TRTA 2DMPA 4X1EA 3SSUA 5CHXA 2O01J 4I7ZC 4RA2A 1FT9A 4PV1B 1KYOH 2QWWA 1YJWI 4S04A 3ROUA 2L91A 5HDKA 2CG4A 2J58A 3GF7A 3HD7B 4JF7A 3EUKL 3K70D 4GOEA 1ETOA 1ETQA 5EZGA 4BEHB 1HDDC 1WQ2A 3DEWA 1KILC 1LTJC 2KSEA 1ETKA 4OIQF 2K9LA 4HLXA 4L75A 3BG7A 3FM5A 3V2QA 2E71A 2MH9A 5J1UA 3CX5D 1WGXA 3ABTA 1DU0A 1DDNA 1UELB 1PGOA 3TDZC 5D4SA 1SQQK 2Q5UA 4H13D 4TT3H 4M3GA 5HLGA 4BDYA 1SFCA 2WY8Q 1EZVI 5CCGC 2NVXJ 5TJJA 4AD9A 2CU7A 3RKQA 2WQYC 1POGA 3E5XA 1CI6B 1Y8AA 4EGYA 3RI4A 2Y0CA 3AEBC 2VC0A 1K05A 1KFMA 3BRTB 3V8JA 1RUNA 5AVSB 4IFFA 1L0LK 3EFGA 2ZXEB 2OU2A 4IL6H 1P84H 1ETVA 5K7ZA 3QOEA 4J01A 1N73C 1DP3A 4KMFA 3CCVI 2W83C 2NAZA 3MGNA 1DQUA 1GK4A 1L0NE 3S2DJ 1XGSA 3S2WA 3QQAA 4I6MC 1LP1B 1B4AA 1S72P 1SEUA 1YYVA 2MC3A 1NU1G 5J1YA 3L72J 3D71A 3BTJA 2F5FA 3OYMA 3TSIA 2MBFA 3BJ6A 4HNTA 2FKWB 4HKZH 5JLWA 4U88A 5F04A 3S3OA 1L0NK 1IO4A 3I64A 1LTGC 3O8ZA 3GZ5A 3I5UA 3BATA 3DPUA 4IQ4A 4O3MA 3RPQA 5F6FA 2QE7H 2VBZA 1K61A 2W7NA 3RQ4A 1WJCA 2N9BA 5FKLA 4BQAA 4PJMA 2R5BA 1OCPA 2LG4A 1E3HA 1BI3A 2F4IA 2FJ1A 1JCDA 1W5CE 2BVMA 1IV6A 3QP5A 4CCLA 5J3LA 1Y39A 3ZQLA 3BPXA 1O3TA 2FQ4A 2WSEJ 1OYWA 1BE3G 3GUDA 4ZKPA 4DJGA 2ZMEA 4DQ2A 3BJOA 3L2UA 3OV8A 3ZN1A 2QSHX 2ZNYA 4BE1A 1VNDA 2WAEA 4A3MJ 1PIXA 4WY4D 1ETWA 3EUHC 2HYJA 3F8MA 4CHUA 4D6TE 3GX4X 4RBOA 3KDPB 3H1LD 4C9YA 4KITB 3CWBG 1VF5D 1SMTA 1PP9G 2FBKA 2N1TA 1GL2D 4CSWA 5KCMA 1BI1A 2XNXA 4HH2A 1S7OA 3H1LJ 1NU1J 5BNGA 1QZEA 1P7JA 4LJZF 2CPSA 3CCMI 2YU9J 2IFNA 3PJRA 3AE9C 3PRJA 4HLYA 1KC8Q 3C2HA 3CQZJ 4MTEA 5IT9K 5FKKA 1ITYA 1IFJA 4CCMA 4K3AA 4AIJA 1D0YA 2BE5F 2YNYA 3FWLA 2YO3A 2MFZA 1XMXA 3KP3A 3LFUA 2L9VA 5L3EA 1LWUB 2K27A 1QNTA 1L4AA 2YMKA 4KICA 3HPGA 1VQPI 3T8TA 4BKXA 2OARA 3TW6A 3TEDA 3J80K 4LITA 2IYOA 2XV4S 3LSKA 2O7OA 4GGGA 4UV9A 3CC2I 3E0JB 2OCCH 2QKMB 4C2TA 4LK1F 2GIVA 5CVRA 4TLFA 4NNJA 2A6TA 4ZTJA 5DCFA 5DCMA 5LGTA 2FYUD 2BCCD 2Y9YA 3K4BA 1Z7UA 1YLFA 4HQMA 3NQOA 1WMKA 2DYSH 3RKYA 2MA3A 3AE3C 3ZMSA 2R7SA 2RDPA 3GTKJ 2P6SA 4EV0A 1VQNI 4ZNCA 2QJPC 3CJQB 3H1IJ 3LSHA 3WTWC 1IN7A 2IAIA 2UXXA 5GADJ 3N4MA 1G2CB 1L0LG 1ON2A 1JMMA 1ZAOA 3VODA 1XN7A 4LD5A 1YJNP 3HSEA 2A6HF 2ZBKA 4BQOA 1BN5A 3KXDA 3HTUA 1Z0XA 3CJRB 4WCGA 5TGTA 5BU5A 1LEBA 1BC8C 4GDOA 1TC3C 2X1CA 1XC5A 3IC7A 3OR1C 4RGUA 1AQTA 1NTZJ 4QSHA 5FGMA 3B5NB 2CH0A 2EFPA 3JRGA 3L72D 5CBOA 2KLOA 2O01H 3S1QJ 2HXIA 2C6YA 4RAZA 2YXRB 2W6AA 4Q47A 3JREA 1LVAA 1BL0A 4PZJA 3T0YA 2VE8A 2Q2EB 3OYEA 1PUFB 3QWLA 1KQ9A 5EEHA 3ERMA 1KB9I 2LBFA 1R1TA 1FX7A 4QPOA 4BGDA 1GL2C 1B9MA 3MCZA 1JKRC 5K5OA 3E5UA 3IWZA 1D1BA 5AW2B 5IYCJ 1SMYF 4PCQA 2YS9A 4DZPA 1MBFA 1XPXA 2WITA 3KP7A 1LNQA 4E7ZA 3IRRA 2KMUA 2LR8A 1QHHD 2A07F 1ZG5A 2IBZD 4EEFG 1AA0A 2QSFX 1GXQA 3OL4A 4Y52J 2XKMA 4AUWA 3ABKH 2R4GA 2R5ZA 4CXFA 3K4JA 3RDIA 1B72B 2LXCB 2CMPA 2JA6J 4B47A 4OU0A 3LWFA 3ZP5A 2VBWA 1FSEA 1ZP0C 1HJ0A 4E7KA 2ME6A 1VQ7P 2XAGA 3L71J 2NYXA 2VN2A 3CF5F 1H89C 2QJKB 2KP8A 2K4JA 4HDUA 4KN4X 3IF4A 4A3CJ 4KNYA 1KMIZ 4ETSA 2E76D 3M7GA 3BC8A 1USEA 1MMDA 2QIWA 4MNUA 3M0AA 2COMA 1NWQA 3CDHA 1ZMEC 1HGVA 3TGUJ 2E5ZA 3L09A 3L7WA 2ELHA 3MEXA 4Q48A 2COBA 4JYBA 4U0WA 3WU0A 1YO5C 2DI3A 3RL0B 1VTNC 4WWIA 3FHZA 3D1NI 1MDMA 2ZJSE 1DGWY 1NO4A 5BPIA 1L0LD 1YI2P 1S1CX 1HW1A 1IZ1A 3CCJP 4ZJZA 2XROA 3WGGA 3HOVJ 1NYHA 1UMQA 1EH6A 1EZVE 4O6JA 2I1KA 5M5XJ 3H1HG 5CCGD 2NPSA 1HW5A 2ICWG 3SFEC 1NTZE 3CXHI 3B8EB 2Q8KA 1ON1A 2V1DA 1RE4A 4UUSA 2O3FA 2OZ6A 4M3LA 2HTJA 4BJ5C 2QF7A 2L01A 4H44D 2DPDA 5DTDA 2EFWA 3GTQJ 1X22A 2MC4A 5BOXA 1T3UA 3DU5A 4C7NB 3ABLH 2KL4A 4A3GJ 2VLAA 1SQQJ 4LLNA 3M3YJ 4LFUA 1WT6A 4U87A 4EGZA 1G59A 5E1WA 1EC5A 5L3DA 4XFJA 2F5DA 2IBZG 3U1KA 5IT9Z 3OYAA 4JBAA 4IZZA 1JY3N 4H44C 4CCJA 4P9FA 5C4JJ 3BP8A 2NZ2A 1R9TJ 3KQGA 4BQNA 3H1LE 2QGUA 5FRMA 2AXCA 3H92A 2QQ9A 3NRVA 2L9SA 4B86A 2O3JA 3F8NA 1JTXA 2LK2A 2PI0A 1T8ZA 1Y0UA 3KX2A 2IJLA 1TW2A 1N2DC 1ZREA 2DTZA 2G0EA 4XR6A 1VQ4P 5HODA 3L2QA 1IDZA 1T6AA 1NHAA 2WSFH 4ZYGA 4B8XA 1QX8A 1S2EA 2GA1A 3I4PA 1SQPD 1A6IA 3PP5A 4PJ0E 3DEEA 2DJIA 2LTPA 1MH3A 2XPVA 2YKQA 4H4KC 1KQ8A 1BA5A 2Q6QA 3F5HA 1P2FA 3E5QA 2VB6A 2HVSA 3KLNA 1XCBA 2DA7A 2DODA 3BQYA 1E3PA 3PM1A 1VQLP 3CD6P 4LLGF 5C39A 3HUGB 3M8EA 2FXAA 1FEXA 1FZBA 2M0BA 1TT0A 4F3QA 2FNPA 4BBSJ 4ZYHA 2M3BA 3S3NA 3GLLA 2LMDA 4I01A 1OFCX 1MD0A 2DK5A 1FOKA 3DCFA 5KAIC 1G1IA 1X3WB 2A5YB 3EETA 1YIOA 3KCCA 2KI7B 2ZXXA 1YW7A 2V1NA 1GLNA 4NC7A 2DA3A 1Z91A 2EIJH 4RAYA 5ED4A 1ZRCA 1ACIA 3H1HJ 3T97A 1L0NJ 1OQYA 2VQLA 2ZT9B 1UHSA 5E3NA 3P8CD 4HNVA 3ZDMA 2WSSH 3GHGA 2B87B 1PP9J 1N73B 4H0EA 1FOWA 2P7CB 4BAYA 2M0MA 2K9NA 3JTGA 3TGUG 1IFIA 2VRSA 2E74C 1ENHA 1FBSA 1PL5A 3BTIA 1NTKG 3AE4C 4WVZA 3I54A 1JY3O 2IS6A 3CC7I 5E3LA 2KZIA 4U3FE 2D2CC 1SQBK 1USSA 3BLYA 1QLED 1UJ8A 4I7ZB 4IF4A 2BOLA 4AYBA 1J7KA 4U0VA 1AKHA 3BR3A 3Q9VA 4N4NB 2LLKA 4B1RA 2WC2A 4EJWA 2UWMA 1UIXA 3B5NC 4OH8B 1BCCG 2JMWA 4LIUA 4A69C 2JDIH 1QEXA 3HTSB 2F2EA 1J0RA 3ZXSA 4AC0A 3FK7A 3R4YA 2LKXA 4HQEA 1RIOH 1MNEA 2DQLA 3D0SA 5H2FC 4W7ZA 3DKYA 5D8LB 3L2VA 1R5SA 3BR1A 4H0LC 1ZK8A 2IEKA 2UV1A 2KOGA 2YIUB 3ELKA 5D6FA 1KU9A 2DK8A 2QCOA 3FDYA 3CP2A 3MWMA 1X8YA 3HE5B 1CGPA 1DEBA 3H6PA 3JRFA 2PQ8A 2BHYA 5K5QA 3L73G 3HL2A 2EJRA 4XONA 1B8IA 1HA8A 2RH0A 2JUCA 5AW4B 2XPUA 1Q1VA 4HG2A 1HVVA 4HF0A 3RGUA 5B5EE 2R5YA 1F5TA 6PAXA 3GEZA 2XGXA 2E1CA 1M90Q 1CF7B 1H9GA 1MJAA 2M30A 1ZH5A 4JX5A 1EH8A 5E79E 3SEZA 2CUEA 1QVUA 2KS1A 3ONQA 1FNNA 1SQVD 1IJDB 1YHQP 2L0KA 1RE3A 3H5AA 1K04A 1GVJA 4OOIA 4E7JA 1M56D 3GTJJ 5DJTB 1LFBA 3G2BA 2JK3A 3CMEI 2K9JA 2Q7CA 3HIFA 2HFHA 3OYDA 5EYRA 4GXOA 1FIPA 2ZKZA 2E43A 2MD0A 2CFOA 1CF7A 2E1NA 2OZUA 4FISA 3F72A 4I7HA 1NTZG 4H44B 2M45A 4L0YB 3CX5E 3JAMZ 1LEAA 2ZMEC 1BR1A 2XAQA 2DQRA 3DU6A 1Z3XA 4PGGA 1SQXJ 2JA5J 4XE5B 2DMQA 4OGQC 3GTLJ 4XRFA 3LSJA 5FLXK 4EATA 5H6RA 1MGTA 1F9NA 1R71A 1TQMA 1W2EA 2VJJA 1TLHB 3OYHA 1G6NA 3S93A 4MO7A 4CYCA 1DEEG 5CCHA 2R93J 1ZN5A 4YIFA 3VTPC 1OCZH 3WTVC 1D3YA 4DNCA 4DZJA 3OYFA 4PSWA 4B44A 1YBKA 1YTYA 2R92J 2NRGA 2OPTA 4C7NA 5KAIH 1PGQA 1XSDA 3HRSA 1BCCJ 3A0HH 1OWAA 5ICCA 1SQQD 1YX5A 2POHA 1NGMB 1AJYA 5K1YA 1T33A 5LRRA 5B66H 2VPRA 5M1BA 2CWEA 2DFIA 2FMYA 2NPSB 1X4PA 5ILVA 3H35A 4A6EA 4OGQD 4UB6C 1CI6A 4KIBA 4GODA 3BTCA 3H5NA 4KT6A 4IRHA 1HH0A 2STWA 3L35A 1RRJA 1PGJA 2EA4A 2K7LA 3HGYA 4Y15A 2BCCE 3D70A 4F92B 3VYRB 4II3A 2WSFJ 4H0LB 1I6XA 1JMBA 3M9AA 1VQ4I 4BHPA 2FYZA 1VQPP 2Q3EA 4YIIA 2EFNA 5D4RA 4C3JJ 1VQ6I 2QJKC 3NXSA 4XRSG 3BCCJ 2HOEA 1EF4A 3BWGA 1VFCA 4RLFA 1JCCA 2D2CB 4J00A 2Y75A 1EDIA 5M5WJ 1JTHB 2RC4A 3DKXA 5KAFC 3VSLA 2BCCG 2X4HA 5EG0A 1PPJG 4FCYA 3ASNH 2BW3B 4RAFA 3HTKA 2UWJE 4UB8C 3DWLE 1K79A 3RK2C 1JUNA 1D8KA 2WPSA 1BGYE 1TU3F 3I55I 3EQLF 2KP6A 2XASA 2LD5A 3ECHA 1UB9A 2IS2A 2HFED 2VQHA 2HODA 1QHGA 2F5EA 3WTTC 5AVZB 1SQVG 5L8RJ 1X1BA 4EI2A 1Y56A 1YIJI 1SFEA 1SQXG 5E1XA 5AW3B 5KJ7D 3Q0UA 2WWYA 2E7WA 4GYIA 2QM7A 2WTYA 3PO3J 2FBIA 2KT0A 3JCUC 2XDVA 3ZMUA 1T39A 4DBQA 4CCOA 1IN8A 2L5QA 1PP8F 2OJED 3W6KB 2CQ7A 2IDBA 3V7SA 1HF9A 2FYUG 1SQVE 3AE7C 3IL2A 1FZFA 3IP4B 2H8PD 5JVGF 4A3DJ 3CMEP 2P7VB 1SC7A 1DGRM 3I4MJ 1B6AA 2GOXB 2WAFA 3B6CA 3K4LA 1IXCA 3I58A 4B3XA 1ZW0A 1LTIC 1GV5A 1MMAA 2M1BA 3H32B 4GKGA 4U3FD 3JSVC 5HLHA 3BR5A 1N78A 5J40A 4Z2YA 4YXDC 2DPUA 1HCRA 4IRIA 1ZR4A 1NTKK 1R4MB 1RPWA 2KIQA 5CJ0A 2JN6A 4P5OA 2RMZA 1R58A 2QEXP 2KRCA 5E8GA 5JHUA 3HM5A 1NG6A 3RTRA 4KMUX 3H1ID 2A61A 4BJ6C 2QENA 1SVFA 3SZTA 2PBIA 2QBYA 3WE2A 3TL4X 2G7HA 4RM2A 4F7ZA 1Y1WJ 4WXDA 1X58A 3L73E 1SQQE 2BCCJ 1X1AA 3DLAA 3A03A 4GCVA 2FYUJ 2IFMA 1FDIA 1IV8A 3TP3A 1TWFJ 2IS1A 1GXPA 3RKXA 2O6GE 3AEEC 3GHGB 5BPDA 1XTGB 2B88A 1S9KE 3LSIA 1YJ9P 2KKOA 5JR3A 3L70J 1OVRA 3VOPA 3KZYA 3VYTB 2OA4A 4MHGA 1KB9D 1HXDA 1ZOYC 4B3AA 2VL8A 1XGOA 2E19A 2IZ1A 1IDYA 3FXLA 1BE3E 4N4OB 2YKPA 3A7OA 3KZIE 1T95A 2H6BA 2J5OA 5AIPA 4G6QA 4A0ZA 2XC7A 2DO7A 1PDNC 1UHMA 2VODA 5J6XA 5FLXZ 2E76C 3M0DC 2D2WA 4PJLA 1L0OC 2WY7Q 4TV7A 2JVGA 3AG2H 3F0CA 3C2GA 4BY1J 3FX0A 1FC2C 2LH9A 2HLOA 3DF8A 2K5CA 3F8CA 1N86A 2R7TA 3GYHX 2WSCH 1VQMP 5AIQA 1MNDA 2CUZA 1V54H 4G6DA 1LB2A 1BI2A 1NU1D 1KQSO 3QP6A 4RGSA 3AE2C 4LK0F 2FXPA 3AL0B 3JTHA 1ZV8A 2M87A 3ZGKA 5DD4A 5BQTA 5F27A 3LSPA 3DLLF 4K35A 1W7PD 2HKXA 1EKEA 3BCBA 3FMSA 1REPC 1BSNA 1KILA 1NTMG 1LTJA 2AEJA 1ZG3A 1LJ9A 4MTDA 3W2WA 2XRNA 3L71E 3H25A 4EIJA 2EH3A 4D7NA 1G3TA 4IJAA 2ZYGA 2JO1A 4BXUA 4UV8A 2N8GA 2DJNA 2CSOA 4A3KJ 3KYLA 3E6CC 3FK6A 1T2KA 1IC2A 3FXEA 1UAAA 2W6JH 4Y28J 4Z6YA 1YOVB 1YRNB 1E79H 2BY2A 1JUSA 3ZMZA 4O9BA 5AVRB 3CLOA 1K6YA 1SVMA 2DMNA 3CO6C 4XIDA 2XF7A 2VASA 2A69F 5HNFA 1ZHFA 3HBLA 3RZOJ 2DXIA 1W5SA 2XF5A 2BY1A 3R6SA 1L4AC 4QMAA 1WPKA 1AV1A 2R7QA 5L3FA 4RLQA 1GL2A 3L75E 1GV2A 1AQ5A 4RM3A 1ZGAA 2W85A 2XZRA 1AA7A 1HQCA 3P5JA 1OCRH 1JJ6C 2VKDA 3CUQA 1FZCA 3MIWA 2CYYA 5J47A 1VPCA 2QJYB 2WPRA 3CX5I 3G6EP 1ZRDA 4XKCA 3VYUB 2CV2A 3H1JG 2C9LY 4YFNF 3J7YJ 3PSIA 1RQVA 2V26A 5ILUA 2W24A 2FUG2 3PNYA 3OYLA 1SFCB 1N7LA 4AVPA 3M9BA 4IFDK 2ZJ2A 2XSDC 3ECOA 3GXOA 4FX4A 2ITAA 1G2HA 3SFZA 4IKFA 4Y99B 3RK2B 3DPLC 3V2NA 4OIRF 2DFEA 3KP6A 2NNYA 5HS8A 1BE3J 1Z6TA 3W68A 1LFUP 2YUSA 4IVNA 2UUZA 4BHBA 3KYDB 3CO7C 1YI2I 4KYWA 1LTAC 3V6IA 1Z1DA 3CCUI 1SQPG 2RN7A 3LIEA 4RJTA 3IAOA 5KLVG 5APYA 3U1DA 3OYIA 4N3YB 2J5UA 4LG0A 1X3ZB 1PP9D 3L70G 1NTCA 2MLGA 1IO2A 1OR7C 3VDXA 2ZYDA 3E6DA 1X1DA 1L0ND 1RF0C 2DT6A 3BOQA 1WCMJ 1RUOA 2JVHA 2EZIA 4ITVA 4XLHA 3JRAA 2X48A 1FE6A 3HUSC 1ETYA 3ZR8X 1OW7A 5CMZA 1MZBA 2YR2A 3H9QA 4FHTA 5HNHA 2AS5F 4MN4C 2HZTA 4U7DA 5B3SH 1STZA 1KB9E 2M8RA 5HDNA 1I50J 2VKEA 3A01A 1O3QA 3VWBA 2VIXA 1J2XA 3PUFA 2TCTA 1IXRC 4BH9A 2R5DA 3ABVC 1N8RQ 2XAFA 5LHHA 2WWWA 4ENNA 2Y0SA 3CDLA 3F6OA 2A45H 3Q3SA 3C2BA 1R8EA 1PJRA 1AWCA 4HNUA 4L0ZB 1G3WA 2IBZI 1NU1K 1J75A 2Z5UA 3ASOH 3PIOF 3L36A 1S3JA 2EWNA 2YSRA 1BGYJ 5FO5A 1PP7U 2OUMA 3Q5PA 1K9MQ 1UZCA 1JM0A 3Q1MA 2HS5A 3BROA 1V5EA 3LAPA 2QJPB 3ZPLA 4JBZA 3H32A 1QVTA 2H8WA 4S0HB 3V7CA 2OTLP 1QA6A 4RB1A 1JY3P 4WB4A 5TISE 3S17J 3TNUB 3CCSI 1MFTA 3I9V2 5FD6A 1CZQA 3JRDA 2BEZF 3K4CA 4H13B 4I99C 3LA2A 4IRGA 5KNLA 1GU5A 1YW8A 1JB0J 1FBUA 1ZYRF 4D5FA 3L9FA 1XDSA 3MMYB 1NH3A 1W0UA 1J1DC 1QL2A 2IRFG 1GD2E 2L02A 3CTAA 3KFWX 3R0JA 2DU9A 1KONA 1WWXA 2FRHA 1F4KA 3ZMDA 2K3PA 2YKOA 4NDLA 2HQ5A 1ZLLA 5IT3A 1A6QA 1J5YA 3H1KJ 2KUBA 1R22A 1RETA 1X1CA 4AIDA 4ASVA 4H13C 1YQAA 5IP7J 3FXOA 5CJ4A 3PJSK 5CLSA 1JHFA 3E1SA 4C7RA 2CO5A 2D1VA 4D5CA 1HSJA 2BVLA 2QG4A 1BE3D 2FMLA 2Z1DA 1GDTA 3FF5A 1L0LJ 3QPSA 4DYCA 1B8IB 5TJHA 1O4XA 2IA0A 2Q0OA 4CCNA 2KJCA 4FTHA 3HD7C 3UKGA 2E35A 1XSXA 3GG2A 3E1IA 1MV8A 5KLVK 1MJ9A 2KK7A 4AM3A 4CH7A 5DV5A 1A5JA 4RO0A 1XSVA 4EQQA 1KYOI 3QWOC 2ME0A 5E79H 1WH7A 3F9KA 2OCEA 3AEDC 1SQBD 3WUTA 1VQOP 1I3QJ 3S9OA 4MGRA 3BR6A 2XAHA 4WWCA 2VPLA 2EILH 3SDBA 5HLTA 2MLKA 4ZZDA 2LOOA 1X0TA 1ZXGA 2NPSD 2BBYA 1D0ZA 4DGWB 4W97A 2B89A 3VMYA 2HGCA 1QVGO 1H89A 2V7QH 3CMMA 2ZJRF 1EJ9A 2O8KA 4R4MA 2O9LA 2K37A 2A6EF 2B0LA 3E1RA 5APTA 1BSHA 2LR2A 1J59A 1Q1HA 1TZLA 1AVYA 2FFDC 3CCMP 5L3GA 1Z21A 2EIKH 4C3HJ 2BEQD 4XKWA 2WSCJ 2V4HA 4KDPA 3OJAB 5GAGJ 3GFMA 4HSRA 1W2BO 4FASD 2ZT9C 2HPCB 2ECCA 3C1DA 3CCUP 2OYOA 4RB3C 4OWFA 5APWA 3I0TA 3RK2D 3LW5J 4FE7A 4L9JA 5M5YJ 4KFCA 2K9SA 2WPQA 3L71G 1LNWA 2M7BA 2K3RA 3D6ZA 1WJAA 3AEFC 2P67A 3ABUA 3K2AA 1S29A 4JP0A 3HEFA 3R0AA 2E76B 2RVCA 2Z16A 2M0CA 4ZZLA 3A0HE 5GAEJ 2HPCA 4UB6H 2CV1A 4HSTA 2QKLB 2Y0EA 2MKVA 3RBZA 2QQAA 5M3FJ 1NK2P 2BY3A 4GOFA 1DD4A 3CC7P 2W90A 2VQGA 3V2RA 2VJ4A 2EINH 3AG1H 1ZRFA 2PAJA 2NVYJ 2WT7B 3OYJA 1JKQC 1NK3P 1YX3A 2F5VA 1SAXA 5ERIA 2GXGA 1A04A 4L9VA 3J7AY 1BIBA 4DCKA 4PD4H 3GBGA 1RKTA 2R7FA 3BPVA 2NVUB 1YITP 1Y0NA 2GZWA 1FIAA 3M91A 2MYSA 2CRGA 3LA3A 2JTVA 2OYIB 4EM0B 1FC3A 2VT3A 4NC8A 1S72I 3VSKA 3ISPA 4CUGA 2NVQJ 3HB9A 3MD0A 2ZNZA 3R2PA 4XA4A 1RC9A 1NTMD 4JYKA 3T97B 3QRFF 4LG0B 2LC2A 2OTLI 1Y6IA 3MZ8A 1FJPA 3OIQA 2H7HA 2E5NA 1G3YA 1N7SD 5IYDJ 3IWFA 1FBQA 1KQLA 2CS3A 1L0NG 4U7BA 5IY5H 2PFXA 3RL0C 4PV1C 3E7KA 3WHBA 2CQKA 1JY2N 1EXIA 1OIPA 3JRHA 3E6BA 1A02F 5BMZA 2RKLA 4IEJA 4KT5C 1M1EB 3SFIA 2DOAA 4HYTB 3G3ZA 3JCUH 2DA1A 2QEXI 2KJBA 2CGPA 1IRGA 3A2AA 2ISYA 1OYYA 1KU2A 1ZKGA 2PFBA 1A31A 1J2JB 4Y13A 3CDIA 2YXQB 3NEUA 2M5AA 4NQWB 2OTKE 2XU6A 3IN6A 2PMUA 5GTHE 3NTNA 1FZGA 1EDJA 2ZXIA 4QPQA 2EZHA 1DPRA 4X0GA 3HRUA 3J7AO 1IFMA 2L7ZA 1I39A 3G1MA 2R0QC 1P4WA 2Q1KA 3CWBE 3GFLA 4IQJA 3QYEA 3U59A 4BE0A 1E5WA 3JCUE 3M9QA 1P84I 2HOTA 3S14J 3O6BB 5AONA 1D0XA 3LSRA 5FD5A 3BR2A 5ICEA 4F52A 3SYTA 1QBJA 2CV0A 1KORA 1QGKB 1MBJA 3HE5A 4I02A 1WVRA 1NVOA 3M9HA 3GVAA 3V7RA 1WFXA 2FNAA 5GTIC 3GZNB 3HOTA 3W2AA 1Y47A 5AW5B 2V6CA 2XPWA 4A3JJ 3HXLA 4B4CA 2MSYA 4M3BA 3LNQA 1GW4A 2E2HJ 3OY9A 2JWTA 3RCOA 1KILB 2WB1A 4P55A 3LFKA 3D5LA 3K1NA 2E75D 4XL9A 5CCHC 3J80Z 2EA2A 4AVZA 3OIPA 2KIFA 2B7EA 1D1AA 4ZYEA 3HD7D 4EYYQ 3H9JA 4E7SA 5AVUB 1PVEA 4PFPA 1NTKD 1Q7YQ 3FWEA 2L7FP 3H9GA 1FYMA 1DIPA 5H20A 3I56P 3T1BA 3GF2A 2QJYC 1HJBA 3DKWA 1XTAA 1SQBJ 1FWZA 1WI9A 4B48A 1WZ2A 5IP6A 4L9NA 1EXJA 3R61A 1HTLC 3IFMA 1YG2A 3AECC 1BR4A 3FX3A 1X79B 2N9YB 2O03A 2WAQA 4A0XA 1UFMA 4OINF 2CW8A 3VYSB 2GA2A 3IR9A 2W27A 5KLIB 3P9KA 2R3SA 3H1CA 5F64A 4LIVA 2HEOA 2V9KA 2Y0MA 1R6RA 2ZXWH 3L00A 3MAJA 3X2QH 3H3VK 1I1SA 4LOCA 2DN0A 5GTHC 5K7FA 3BDDA 3B5ND 4CO8A 5AW6B 3R60A 1IRZA 2H94A 2V4JC 5AVYB 1TWHJ 1SD7A 3DTIA 1XCVA 3EYIA 1FYLA 1FZCC 3E7LA 2KFDA 2KDZA 3HUGA 3EPZA 4E70A 2JQ7A 2ZJQF 2PJRB 3RPUD 1JJ8C 3DV8A 1WKMA 2VKHA 3K7AJ 1IFNA 1W1WE 3PH0A 1LT1A 3ZRGA 1EDKA 3TO9A 1IK9A 4OAYA 1ZGJA 3IAM2 2Q9IA 2IGOA 4YEJA 2V1UA 1G2CA 3A3YB 2VC1A 2K02A 2WVRA 1JUMA 3KZIC 3F22A 2ZXHA 2P5VA 1N7SB 3O8GA 4LGDE 5FKNA 5BU8B 1P84D 3I55P 3FXDA 4I2OA 1MBHA 2L5GB 1VF9A 1MKMA 4CDGA 3DP7A 3HRTA 3RIRA 5ICGA 5JI6A 4A3EJ 2LKPA 1OCOH 1Y1VJ 2KIUA 2E74B 5CVJA 1SFCD 4ENMA 3L74D 3LMMA 1EV7A 5B66C 2E36A 4BQQA 2DLLA 3CC4I 1RH5B 1VF5C 2YMYA 3A5TA 1TNTA 3P8CE 1QZYA 3BR0A 2FXOA 2P6TA 3CXHH 3NWTA 2UXNA 2RKHA 3L37A 2FOKA 2Q3IA 1LWUA 3MUDA 2CQQA 1BOBA 1E17A 4K2EA 2LRDA 3ABMH 4F55A 3GTOJ 4W7YA 4LG3A 1VDFA 2KIMA 4BUPA 4OMZA 3BZKA 5CYVA 1FP1D 2K4BA 3C18A 2G8YA 4BNCA 1YIJP 1OX3A 1RE3C 1G4DA 2B63J 2HU9A 3LL7A 1Z05A 3M8FA 4HV6A 4RAGA 4XKBA 3SJMA 2GM4A 2HG5D 3COAC 1KILE 4EOTA 5APQA 3FMRA 4A5NA 2WBMA 2CUFA 2FBHA 2RGVA 1UG0A 1R49A 2AEFA 2YU3A 1FMVA 5KAIE 5EZHA 1JE8A 1LDDA 2KSJA 3S4RA 1YE9A 4I0AA 5JHFA 1U0JA 2XHKA 3D5RC 2E1OA 2W48A 3G4SI 3Q2YA 3LSTA 2V9PA 4BE2A 1MBEA 4CA0A 5EG0B 2FE3A 3GW6A 2X9DA 1NTMJ 1MMSA 4XORA 2VI6A 2KRFA 1SFKA 3QU6A 5FJ8J 5F0CA 1GHCA 1MIJA 2Z4EA 3DTEA 3OOUA 1T2KC 4JQFA 3A0BH 5A2QZ 3II6A 3JR9A 1IFPA 4G9YA 2XB5A 4RGRA 1BC7C 1C0WA 1ZTRA 3SDGA 3A1YA 1OW8A 5GTHH 1U3EM 4N78E 3RK3E 4LB5A 3M4OJ 3L2WA 3K10A 2W84A 1RQUA 1ZRTE 4BS9A 2A06G 1WJBA 2L9NA 4WXCA 2KDOA 3N97A 2HR3A 3KP5A 5L3CA 4IL6C 4CGZA 1SS1A 2HKOA 5APUA 3H5RA 4IHXA 4LB6B 3CWBD 5CQEA 2WA0A 4C30A 5EEAA 2DMTA 3V4GA 3EQ2A 3MKLA 2VJ5A 3BQZA 3RKWA 2GWRA 2R44A 1NKZB 2D2CD 1IK7A 3OL3A 3S1RJ 1LVKA 1X9VA 2W1OA 2E34A 3B6AA 3O6QB 3FM3A 1VQ8P 2L3DA 4PD4E 1BJAA 2R7UA 4XSZF 2Q2EA 1PUFA 2OD5A 3O2PE 3M07A 3OMYA 3J81K 4HRIA 4XOPA 5E17F 2P2UA 2FYNC 3H36A 2RNJA 2H89C 3AEGC 3GMEA 2P81A 3KYCB 4IOAF 4CYCB 1T3JA 1BIAA 3PIPF 2JPBA 2BEOA 1L4AB 3PUBA 5F08A 5E18F 1P84E 3AE5C 4BEHA 4CZZA 4OGQB 1VQ6P 1FPQA 4NUBA 2OAZA 3TW7A 2VUMJ 1D8JA 1VQ9P 3I4NJ 3WUUA 3IRQA 5CKTA 2P10A 1MW7A 3SZPA 3IV5A 1FS0E 2PP6A 2A3SA 2EV5A 2BZTA 3OYKA 5J4YA 1OKRA 3USSA 4ZDLA 4KUMA 3DFGA 4A93J 1LT9C 3L75G 1WRGA 1RR8C 3AE8C 4ZDPA 1M57D 3CWBJ 1RF1A 3KP4A 2HYNA 2PN6A 4PJ0C 1R7JA 4AYCA 3V8LA 2FD5A 2HVRA 3HDDA 1QGPA 3WTUC 1EQ7A 2XV5A 3EUAA 3OW2O 3H1LG 4ENKA 4CCKA 1U8RA 3VMAA 2KRHA 5KKZC 4A7PA 3LSMA 2WT7A 1M1JB 3H3ZA 2ELJA 4I6ZA 1IF1A 1Q81Q 2MH2A 1UIIA 4RB2C 2MD5A 3CMAI 3GW2A 4QLCU 3KETA 3C8VA 2X85A 4IHVA 2LY9A 2FYUK 3HE4B 2GBYA 3J81Z 3R4KA 2P0WA 4DBRA 5LRSA 1LJ2A 3GZ6A 4DT0A 1XX5A 5ICFA 2IVMA 1J1DB 3CCLP 4LLHA 2IA2A 1TP4A 4RESB 2QZ8A 3IH2A 3W3CA 2ECBA 2QUFA 3NMDA 2DCEA 1F36A 2CK3H 2FA5A 3DBLB 3FKJA 2Q1ZB 1OCTC 2DYRH 3HOZJ 2RQPA 1T0FC 2JRTA 4YPCA 3D6YA 2ELKA 3U21A 3VB2A 1AVOA 1BOAA 3KE2A 3WU2H 2JP3A 1OR7A 4PFOA 2OYIC 3FIWA 2N1TB 3O3KA 3FHNA 3OOPA 2KPMA 1S7AA 1QRYA 3PL8A 2CQXA 1L2PA 3KZIH 2ZSHB 2AQFA 4D7MA 3HUSA 1VF5B 4Q4ZF 3L74J 5AVQB 3F89A 4IX7A 1IJWC 1CSBA 2G7UA 2HTSA 3ZN0A 1URQC 3NFQA 2QLZA 4DIQA 1PFIA 5DS9A 2F6CA 1IGNA 1D5VA 4EJUA 5HOOA 2OF7A 1IZNB 4N78D 2QVAA 4M6XA 3IHUA 4N9IA 1ZRTD 1ODDA 4MFDA 4ZDOA 3M1CA 3KPHA 3P7NA 5EFWB 4EDFA 3QAHA 2QVOA 2JWAA 2R7OA 4BL0B 5AW7B 1LDJA 4BU2A 4XLPF 3CESA 3B02A 2HNHA 1Z7LA 2AXTC 2FOWA 3HGGA 3GFIA 4G7HF 3CL3D 3EWKA 2L7KA 2VKVA 2H8RA 1SQQG 1YTZT 3N7NA 4PK4A 5HS9A 4GRIA 3RSNA 3TP0A 4D9JA 3TO7A 3WGHA 3HD7A 2O01N 2DOFA 3K2ZA 1S9HA 3QYFA 4R4LA 4IPAA 3AE1C 4AWXB 1U2WA 5J8CA 2E74D 4XNFA 3BCCG 3CUQC 3KZZA 3WTSC 3CCRI 1MSFC 1ETXA 3KPEA 2BV6A 2EBIA 5GAHJ 1X1PA 1VQKP 2CFXA 2RAEA 1Y8QB 2IYPA 2Z33A 2R7DA 4HW0A 1M1JA 3C1LA 2FBWC 2Y48A 4EM2A 3W6JB 3Q5RA 4MQ9F 2GUVA 5LGUA 3TQNA 5C3EJ 4PDKA 1KYOE 2K9JB 1SD5A 4FETA 3RBXA 2M4KA 2ZB9A 4NHJA 1NTZD 1VL2A 3LIDA 4JX4A 5CQGA 3CMYA 3RL0g 1I3AA 2X6WA 3BG5A 2OYHB 4BACA 3LSGA 3L75D 2DDAA 4O5VA 3H1IG 1XMKA 2DMUA 2X0LA 2DFHA 2FYUE 1L4AD 3K4KA 1ZR2A 2VBYA 2V7QJ 1RI7A 2WV0A 2X1DA 4XQFA 5CCHD 2VONA 4R79A 1K4SA 3S15J 2PGDA 4HAMA 3V4QA 4PSXA 5EF6A 3CXHD 4KN7X 2YIUC 4HB1A 3BRVB 1DH3A 2XIGA 2LY1A 3G1LA 4HOBA 3CCQP 1RESA 3SWYA 1H88A 1JHHA 2KISA 3LA7A 5D5UB 2LP0A 1IN5A 1GW3A 4A12A 2DW3A 3HKZN 2ESHA 1GU4A 3IKTA 4U7JA 2EFQA 1XS9A 4I98B 2IT0A 1WHUA 2DTRA 1JGSA 3WTYC 5APVA 3F8FA 5FKOA 1BGYG 1S4XA 4UVBA 3CUQB 1GUUA 3FBNB 2WMMA 4BXFA 3SWKA 3H0GJ 5LEJA 2L54A 4PD4D 2LF7A 4E4HA 1FDOA 2NRAC 2EK5A 5GPCA 4WY4A 3A01B 1AHDP 2VQCA 1PPJE 3WUVA 2ZXJA 5E20A 1APLC 3Q5FA 1ZN2A 1YFHA 2BY0A 1EH7A 3CJNA 4G12A 1JT0A 1SQXK 3H1KE 2EB7A 3HKZA 3CCQI 2Y9ZA 3MP7B 2L2OA 4A3FJ 4YELA 5IOZA 2WTEA 4XBFA 3AAFA 2J5PA 1OCCH 1SVLA 3WHCA 4DYRA 4EJOA 4IFMA 2QA4P 2FFDA 2L7MP 3TNUA 2EQRA 3JRCA 2XKOA 1S7EA 3BJAA 2VJIA 1OPCA 2MJZA 5AVWB 4GO1A 1PYVA 1YRNA 5CVIA 3JSOA 2ZCWA 5H2FH 4UXNA 5DDGA 3HRMA 3CMAP 1FOSF 1KB9H 1G8XA 2IP2A 1LPQA 1X2MA 3ULQB 2XGCA 5LBQA 1FZEA 3OSFA 2Y69H 1IFDA 2BXZA 1VQNP 2HDDA 1B72A 4ZMDA 1JKOC 2FSWA 3PO2J 1FJKA 4KHXA 3Q9SA 4X6AJ 1FJLA 5FLVA 3K1PA 2K85A 1KU3A 2BYVE 3E6MA 2IZ0A 4CYDA 3WU1B 5KJ7C 3H0DA 3DBRB 1K7AA 3GTPJ 1J9IA 4FX0A 2HVQA 5LHIA 1Q90D 2OBPA 4BY7J 2BGCA 1O7LA 2QQ8A 1KQ0A 2W8ZA 2W25A 2YPRA 3DPTA 5HDGA 5F1RA 2GAUA 3KIOA 3ZQGA 4W1UA 3MTUE 3EFFK 1BI0A 4UB8E 3OYGA 3VYIA 5E79C 5TISH 4G7OF 1I5ZA 1R36A 1BDCA 1Y8RB 1SLQA 3KEOA 1KILD 4G8XA 1OVUA 4L74A 3NWSA 1T8IA 1JEKA 3MKZA 3QODA 1KGSA 1OISA 1HBWA 3QOPA 2WPVB 3C9IA 2O61A 4A6DA 3L72E 3HOUJ 4ESFA 5CPRB 3Q0VA 2FU4A 2KNCB 5J8FA 5DYMA 2X6YA 4YRVA 3CCVP 5B1BH 5GTIH 4A5MA 4XN3A 2G9WA 3UR3C 2EZKA 3RQIA 2HOSA 3K9TA 2IBDA 5H2FE 3ESWB 2GQQA 4AU7A 5LLQA 3V42A 2Z5IA 1K83J 3ZQHA 1LT9B 2VXDA 2XSJC 1JNMA 1ULYA 2KIKA 2WAQN 1RR7A 5E1ZB 2O5RA 3WGIA 1BDDA 1FP2A 3O6QA 4HEA2 2STTA 3CUOA 2XGEA 4RDUA 2NS7A 3RK3D 2W4SA 3C3WA 3OS2A 4QIWN 1JTYA 1T56A 3IAS2 3DQVC 4B43A 1L3LA 2H88C 2MGQA 2Z3YA 4ASNA 3NARA 5LGNA 1N7SA 5AW9B 1FY7A 1TQIA 1LT9A 5CVVA 4FT8A 4NB5A 3LAJA 1SFXA 3G71I 4ZTFA 2F48A 5LEKA 3VEPA 3BZ6A 1IAWA 1Z56A 1N73A 2V79A 5KLIC 3G73A 2B87A 4D6TG 1VQ7I 1V55H 2V1XA 4MIMA 2CW0F 1ZARA 4C2UA 1T38A 3K1MA 3M0DA 3OAKA 4IHWA 4Y99C 5APSA 3CCEP 1IN6A 1BBYA 3TMOA 4AUXA 2M3AA 5F1JA 1K78A 2GXBA 1LGHB 3CX5H 5TRDA 3P32A 4OIPF 1X3UA 2ID3A 3TKYA 2VOOA 1ONVA 2GLOA 3I59A 1XG1A 3HRNA 5AVVB 2E60A 2ID6A 1FOXA 4OVNF 1YS7A 2E42A 3LQQA 4WX9A 4BWNA 4BJTA 2V6EA 1FYKA 2Z99A 2LVSA 5DUIA 2LKMA 2DW4A 4HV5A 3PQJA 4XN0A 3AKZA 4UY8I 5EEGA 4HBLA 2JJLA 3RYRA 1NTKE 1ZLKA 4I0BA 4I09A 4NPDA 2QBYB 2KZVA 2ZFWA 2A68F 1LTSC 4IHYA 2GXAA 3G71P 1FOSE 1HF0A 1UHWA 1MUUA 1TWCJ 1NTZK 1W36C 1HOMA 2B9BA 2FXMA 3WU2C 3QPHA 4EMSA 3HZJA 3S1NJ 3CC2P 5DM7F 1HC8A 2M2EA 2LXBA 2IGNA 4ENJA 3L73J 1CQTA 5KTBA 1SVOA 3WTZA 2EV6A 2OQGA 3OIOA 2HPIA 4M9XA 3TYYA 5GPAA 2LBFB 1YJNI 2F5CA 4JOMA 5EJCA 1H8AC 3PTZA 2F4OB 2L4MA 2PJRA 2J59M 3OYCA 4XOTA 2KZJA 1XGMA 4UB6E 3A0BE 3FWNA 3CPWO 4KT0J 4MQVA 5KHDA 3AE6C 4L5JA 2HYFA 3AL0C 2EPFA 2AXTE 2I1JA 4BYYA 2H27A 4EJVA 3KLOA 2EFOA 4HYEA 4Y4RA 1HLVA 2PJPA 1FDMA 2JKVA 1XTCC 5APXA 2W57A 1TW3A 4L9TA 5FKMA 3WODF 3L70E 4NPFX 3VMXA 5KAFE 3U1AA 1HKQA 4RB0A 3K69A 3U9GA 4UUSB 1PZQA 1Z67A 4HX7A 1WI3A 5KLVE 1HSTA 1SQPE 3H1KD 4WY4B 2HI3A 3TOAA 3ERED 4ON0A 1WJEA 4BRYB 1A02J 2BXYA 2P5KA 2X51A 1HW2A 3S1MJ 3NAUA 1FTZA 2K40A 2XF6A 1B59A 2BHZA 4RS8A 3P9IA 3A02A 5IYBJ 3FXUA 4II2A 1MDMB 3GHGC 2R32A 2C0WA 4N6JA 1J1EC 2V7FA 2QYOA 1IN4A 1FTTA 2HODB 5KAFH 2DFFA 3RYPA 1WSUA 1U6GA 3IKVA 1RF0A 1JO5A 3Q3DA 2BW3A 1ZGWA 1P92A 3HHHA 2IX7C 4UNOA 2LFBA 2X6XA 3PNTA 3HOSA 5FRNA 2N1TC 2LNBA 2E1MC 2M4GA 1V3FA 5K7HA 3T5XA 2HWVA 1QO0D 1RNLA 2HOAA 1P7IA 2RN0A 3K4NA 2KNCA 1F1ZA 1SFCC 1D7MA 4I2LC 2L4AA 2R7WA 2M34A 4M3EA 1TWGJ 1WJ5A 4A2UA 4ZH4F 5E3MA 1U5TA 1TL8A 2CQNA 4KJZA 1ZELA 1R4NB 2KHMA 2O1KA 2H09A 3S2HJ 1SQVJ 5EGOA 1U9NA 1ORKA 3L4FA 4DZOA 3MVPA 4LMYA 1PV3A 1MMNA 2DA5A 5D5WB 3WU2E 4HX4A 1Q86Q 3SHFA 1DX7A 4XICA 1M7LA 4UVAA 4GT1A 4A3BJ 1W36D 3J7ZI 2OV7A 3K0LA 2LY2A 4Z1MH 1P4AA 2H1LA 5KVRA 1NTME 1ZLJA 3CC4P 3TOBA 2XAUA 2NS8A 3L73D 3RZDJ 3CP8A 4AYBN 2NOGA 1OVVA 2VXZA 5JLXA 1KZUB 1B9NA 2JSCA 3MQ0A 1KN7A 3FBIB 1W7PA 2XGDA 1QL1A 3HTKB 1FZAA 2ZYAA 1NKNA 2R5YB 3GLMA 1OYIA 2AEMA 3E97A 1D1CA 3JW4A 1JTHA 3PHLA 2MABA 1XGNA 3SZGA 1W5TA 4V2FA 1TBXA 4PJNA 2FY8A 2NS0A 1B1BA 3M8JA 5D5XB 3I53A 2V9VA 5D8KB 2WZ7A 4ESJA 3HHGA 1MSEC 1ZG1A 3LW5H 3QPTA 1LQ1A 3FXQA 1USDA 4XLAA 2LREA 5LFAA 1NG7A 4M71A 2I10A 1KTMA 3HOWJ 1FSHA 1S5LX 2JSPA 2K9QA 4E7HA 1WRJA 1LE8A 1FMWA 3EUHA 1KU7A 4HPQA 3V5BA 1IXSB 2ACJA 1K6OA 3KP2A 3A4CA 3KHUA 1AFOA 2OYHC 3FXKA 4HZFA 3HJEA 3TBIA 1NJIQ 5KK1A 2JR8A 4DOZA 1LFPA 1QZZA 1RY3A 1I27A 1N75A 3D5SC 4P9UA 2AXLA 2FYNB 3Q0WA 3ZOBA 2K88A 5K5RA 4E6KG 2B9SA 2QSGX 4XLFA 4JPZB 1AU7A 3H1HD 4D1QA 2DBBA 5DCMB 5M3MJ 1H9TA 1JXSA 2M7AA 1YQ4C 1TQPA 3VP8A 1H88C 3CI9A 3TK1A 5EDNA 2KXPB 1P6RA 2P4WA 3ZQQA 4D0PA 4DYQA 1Z77A 3F21A 1QPMA 2A5WA 1LWUC 3H1JJ 4S05A 4XRMA 5DD8A 2IGMA 2OTJI 3L74G 1YQ3C 3GMAA 4PD4I 2ZC2A 4AQRD 4OMYA 1E2XA 1FLIA 1U5TB 2BASA 1R1UA 3QPLA 5C4XJ 3WG9A 1L0LE 4YIRX 1FAVA 4XM3A 4WY4C 1MNMC 1G1JA 2M8EA 2AQEA 3CF2A 2IPQX 3CZ6A 4P1WA 1JGGA 1T08B 2IW5A 1S5LE 3FKIJ 5FROA 4JX6A 1YYCA 2C0XA 2P58A 2OQRA 1YS6A 2CW7A 1V4RA 2FQ3A 2XRLA 2ZSIB 2WV1A 4XKVA 4BDZA 1LUJB 4A0YA 4PGHA 1Y9BA 2EZLA 1WH5A 2IXSA 4L5EA 2E75B 4EM1A 1DPUA 2OYIA 1M1JC 1GK6A 3L72G 3F3XA 3OA7A 3FISA 3GO5A 4IXAA 1S5LH 3VP9A 3G6EI 1YTZI 1M1KQ 1RF1B 2YO2A 1E0EA 4AIHA 2DAOA 3MHVA 4XLEA 1NTMK 2CJJA 3S3MA 3CXHE 2K86A 5K5GB 3IUOA 4M3DA 3AG3H 1E3OC 4IL6E 1T2KD 3OYNA 3BG9A 2M9HA 1JT6A 2ZMEB 4RGXA 1LKXA 4KISA 2M5WA 3OS0A 4YTPC 2WB1N 4Y3OA 5D5VB 4N9HA 1V5GA 2P1JA 3OSGA 1XB4A 1SQBE 4J19A 4EJTA 3GTGJ 1S8NA 5KJ7A 1IUFA 1P9QC 3MUDC 4HJGH 3L70D 2AO9A 2E5TA 2XNDH 5DUKA 5HS7A 1YITI 1JKPC 2AXTH 3H1IE 2ZFCA 4HF2A 1RE4C 4QTRA 4Y33A 3S16J 2YX4A 2PRRA 1K73Q 1PP9E 2OQQA 5BVZA 4LGWA 2E7XA 4HX8A 3FGAD 5D6EA 3MN2A 4KJMA 4IOCF 1KA8A 5C44J 1XMAA 1MBKA 1W7PB 3FXRA 1U78A 3JAMK 4L5IA 1PGPA 1OZHA 1DP7P 1AKHB 1ERDA 1T0FA 1O57A 3V2PA 4IO9F 1JY2O 1VQLI 4XK4A 2I5UA 4M3FA 2GOMA 3AG4H 3N4XA 4UUTA 3BCAA 3H1KG 3TO6A 1D5YA 2HQRA 3M06A 1KV4A 1Z3YA 3L2RA 3B71A 3ZCOA 4UVCA 3HUSB 5EGOB 2JWDA 4M6YA 2E2IJ 5JVTA 3MKYB 2O8XA 3H3UA 1V5FA 4WXHA 3K6GA 5IOYA 1LE8B 4U3FJ 2JJ7A 1TNSA 2XUBA 1QU3A 5CBNA 1NAFA 5FFZA 3PFYA 4BXXJ 4A3IJ 3ZMTA 3OWTA 1JY2P 3TDKA 3KEYA 2NXNB 1UG2A 1MBGA 5CCGA 1NU1E 5B5EC 3RL0D 4BBRJ 5FLMJ 1U57A 1W0TA 2DA6A 3MD2A 4XLCA 5F0HA 3I59B 2JEEA 5FB2A 3S1KA 2W00A 3A0BC 4N0BA 5DM6F 1H8AA 1GZLA 1O3SA 1BW5A 5FFXA 1XD7A 4JYCA 3VMZA 3I5CA 1ZQ3P 2HQNA 1M8OB 4P96A 4L18B 1MMGA 1GTWA 5IP9J 5TISC 1SFUA 3RK3C 4YFXF 2PEXA 3MZWB 1KYOD 2R7XA 2W82A 2IGKA 1R1VA 3BT9A 3L75J 1SANA 1S9KD 2IS4A 4OWRB 1F43A 3HOYJ 2XB0X 1SQVK 4E7LA 1FU1A 2PG4A 3G4SP 2H43A 1VQ5P 3FZVA 3REOA 3F6VA 3U2RA 2NNNA 1CW5A 1URQB 2YX7A 3RPUA 3W2VA 3HSFA 2R7RA 1NTKJ 4JQ0D 4YXWH 3CCEI 1QPIA 1SP4A 3OYBA 3ZMVA 2A05A 1OLTA 1QVFO 4GYGA 2MG4A 4W80A 2GUSA 4FE4A 3B5NA 4C3IJ 3BCCD 3CCRP 1GVDA 2M8GX 4R8HA 3HPHA 2XVCA 2K9MA 4XRSA 1VQKI 3BCCE 5GTIE 3BG3A 3I71A 3HC7A 2HYGD 4AIKA 1MFZA 1SD6A 3JC22 1HDPA 1N25A 3VOEA 4IHSA 3GF3A 1HBXG 1URQA 2KYVA 4D6TD 3DXJF 1IG7A 5L3BA 4QWQA 5LD2C 2Z5HA 2O1JA 4H0LD 5AVTB 1SQXE 1KYZA 2Y31A 3HOXJ 2Y0DA 1FZPB 3TF5A 1SQXD 9ANTA 1RF1C 3QU3A 4EVIA 1VQ9I 1KQFB 3N05A 3UNGC 2E2JJ 3A2KA 3KEQA 3ZQIA 1SFOJ 2Y30A 3UIAA 1U5TC 4BRYA 3G9RA 1VQMI 2M5AB 2CPBA 2EV0A 1IUYA 4RMNA 2JUGA 3CCSP 4WK8F 3V4WA 1BW6A 3TDUC 1BCCD 3RK3B 1K4TA 1PPJD 2E1MB 4M9ZA 4BHCA 4GDFA 3EYYA 1BCCE 4NBQA 2R3CA 1TTYA 2HQAA 2GIZA 5DEQA 1AOYA 3P7KA 1LTTC 3K4MA 1HKTA 4Y17A 1HUCA 1O7FA 1R5GA 2VT2A 1KQGB 2A45G 4RKUJ 3FXMA 3B73A 4M9SA 1H0TB 1X19A 1R23A 3CCYA 2OC6A 5J4VA 4U3FG 1OMIA 3T8RA 2HDCA 4I1LA 1W5CC 1NOHA 2NVTJ 2O0YA 3DBHB 1WJDA 3H1JD 1T98A 2AHQA 2I8DA 1DD3A 3L74E 3TGUE 1NH4A 2JPCA 1K78B 4BXLA 2MW8A 1JUPA 2Y0SN 5ILSA 4G7ZF 2FFDB 3L1PA 3GFJA 4E7IA 4L76A 2LDUA 3S8PA 1H0TA 4MEYF 5BS6A 2TDXA 1SAUA 2JT1A 3MFKA 3BASA 2R5ZB 2LKSA 3RJPA 5GP9A 2LSOA 3U1CA 1S5LC 4XLNF 1SQBG 5DJUB 4XSXF 2RNGA 2Z9OA 1K8AQ 2JA8J 2Z2SB 4ABZA 4U0YA 1RHZB 3F8BA 1U7JA 1FZCB 3L2CA 5HVQC 1G3SA 4OIOF 5E3OA 4PV1D 2HXOA 2JRMA 3SXYA 1RZ4A 2QA4I 1T6SA 2XKPA 2K1AA 4V2GA 4F91B 3AFHA 1TT5B 2R7ZJ 1N7SC 1YJWP 3FXJA 4MLOA 5H6QA 2HDWA 1FOYA 3K70C 1GL2B 4NPEA 1X2NA 5J1RA 1I6HJ 1SQPK 2QRXA 3PLNA 3HSRA 2F4MB 1PUEE 1LTBC 2ADUA 3A0HC 3JRBA 2M3EA 3BZCA 4HF1A 2QSIA 2UZKA 2ZVNB 2N1TD 2KLVA 3QH9A 1YJ9I 4ESBA 3OR2C 4G6TB 4CZCA 4DOJA 3I56I 1EZVD 2ESNA 1KD1Q 2D1HA 4UUVA 2WADA 2PMZA 1UCRA 2VBXA 5CJ9A 3LQRA 3M1EA 1JI8A 1FBMA 1YHQI 1VI0A 1O3RA 3P8MC 3BVHA 2Y2ZA 1IRFA 1NAYA 4PJJA 1LTJB 5B66E 2IBZE 4DJAA 4LC1A 1MH4A 2KZGA 2DT7B 3E3VA 1KZHA 2DOEA 3GCMA 2ZVOB 1SD4A 4NQWA 2JZYA 4B09A 2P8TA 4LLLA 1Z6RA 1U9OA 3JSPA 5HLIA 3SWFA 2PMZN 3DEUA 4KIFA 4PUSA 3MKWB 3CCJI 1EDLA 3IH3A 1R5HA 1Q2NA 3DTKA 2HZDA 3W67A 1VZ0A 3GTMJ 5AW1B 3MZHA 1RKWA 4MEXF 1VQ8I 1X4OA 4PJ0H 1XDUA 2IPPA 3W6VA 1IRXA 3WG7H 2P7JA 3O8HA 3VN0A 3PNVA 3H1HE 1USTA 1KFNA 1OXZA 1EZVG 5B1AH 2K9YA 2ZT9D 4UB8H 2W6BA 1YW9A 2QM3A 4KIGA 2DDBA 3TGNA 2H1KA 5LHGA 4XMYA 2XAJA 1URQD 4C46A 2OTJP 2ETHA 2A06D 1P4XA 2X6OA 3BY6A 4HDVA 3HYIA 3GLXA 3ITKA 2RV8A 2A06E 1WJFA 3FMQA 2ISZA 4GIFA 4YG2F 1HGZA 3C7JA 4M6VA 1VQ5I 2WSEH 5CVUA 1R00A 2D5VA 2K3FA 4L73A 1OJLA 3ZQ7A 2NPSC 2KB7P 4CPGA 2E75C 2NOJB 4IHTA 3ZQCA 4ASWA 3CLQA 4HA8A 3OS1A 4M74A 3PSFA 2VOPA 3QYBA 2LF8A 2VE9A 1SQPJ 5KLVJ 2ZFUA 4GFBA 2A45I 2H6CA 3PQKA 1N77A 5JFRA 2JA2A
chains in the Genus database with same CATH topology
3P9CA 3ML6A 4M73A 1KYWA 4R1HA 3SQNA 4YFKF 2D45A 1Z9CA 3PFIA 4JK1X 4CICA 2FF4A 1I1GA 4M72A 3MZYA 1QQIA 1S6LA 2QQBA 5E8IA 3V8KA 2FEZA 1H0MA 3GWZA 1IW7F 4KA4A 2PLYA 3WE3A 2DT5A 1W4MA 1MJBA 2ZO4A 2P5LC 4UHTA 3F23A 2IA1A 5A2QK 4G94A 1HKSA 3EDPA 2PMHA 1BM9A 1LDKB 4ZYDA 4WF2A 3VFZA 1DUXC 3WTXC 4Q5SF 1FT9A 2QWWA 4S04A 3ROUA 5HDKA 2CG4A 1WQ2A 4OIQF 4HLXA 3FM5A 2MH9A 3ABTA 1DDNA 3TDZC 5D4SA 5HLGA 5TJJA 4AD9A 3E5XA 4EGYA 3RI4A 2VC0A 3V8JA 1RUNA 2OU2A 4KMFA 2NAZA 1XGSA 3S2WA 1B4AA 1YYVA 2MC3A 2F5FA 2MBFA 3BJ6A 4U88A 3I64A 3GZ5A 3I5UA 4O3MA 3RPQA 5F6FA 2VBZA 4BQAA 1BI3A 3QP5A 1O3TA 3BPXA 1OYWA 3GUDA 2ZMEA 4DQ2A 3BJOA 3OV8A 3ZN1A 2ZNYA 3F8MA 4CHUA 3GX4X 1SMTA 2FBKA 1BI1A 1S7OA 4LJZF 4HLYA 4MTEA 5IT9K 4AIJA 2BE5F 3KP3A 5L3EA 2K27A 1QNTA 4KICA 3T8TA 3J80K 2XV4S 4GGGA 4UV9A 4LK1F 2GIVA 5CVRA 5DCFA 5DCMA 5LGTA 1Z7UA 1YLFA 4HQMA 3NQOA 3RKYA 2MA3A 3ZMSA 2RDPA 2P6SA 4EV0A 3WTWC 1IN7A 2UXXA 3N4MA 1ON2A 3VODA 1ZAOA 1XN7A 4LD5A 3HSEA 2A6HF 2ZBKA 1BN5A 3HTUA 4WCGA 1LEBA 1BC8C 3IC7A 4RGUA 5FGMA 2EFPA 2C6YA 4RAZA 4Q47A 1LVAA 4PZJA 3T0YA 2VE8A 1KQ9A 5EEHA 1R1TA 1FX7A 1B9MA 3MCZA 5K5OA 3E5UA 3IWZA 1SMYF 4PCQA 3KP7A 3IRRA 2A07F 1ZG5A 1GXQA 4CXFA 3RDIA 4OU0A 3LWFA 3ZP5A 2VBWA 1FSEA 2XAGA 2NYXA 2VN2A 2K4JA 4HDUA 4KN4X 4KNYA 4ETSA 3M7GA 4MNUA 2COMA 3CDHA 3L09A 3L7WA 2ELHA 3MEXA 4Q48A 4U0WA 3WU0A 1YO5C 2DI3A 1VTNC 3FHZA 1MDMA 5BPIA 1HW1A 1IZ1A 2XROA 3WGGA 1EH6A 4O6JA 1HW5A 2Q8KA 1ON1A 2V1DA 2O3FA 2OZ6A 2HTJA 2L01A 2DPDA 2EFWA 5BOXA 4LLNA 4LFUA 4EGZA 5E1WA 5L3DA 2F5DA 5IT9Z 4JBAA 4P9FA 3BP8A 3H92A 2QQ9A 3NRVA 3F8NA 2PI0A 1Y0UA 2IJLA 1TW2A 1ZREA 1NHAA 4ZYGA 4B8XA 2GA1A 3I4PA 1KQ8A 1P2FA 3E5QA 3KLNA 1XCBA 4LLGF 3M8EA 2FXAA 2FNPA 4ZYHA 4I01A 1FOKA 1MD0A 2DK5A 2A5YB 3EETA 1YIOA 3KCCA 1YW7A 5ED4A 1Z91A 4RAYA 1ZRCA 4H0EA 2P7CB 4BAYA 3JTGA 1FBSA 3I54A 1USSA 4IF4A 1J7KA 4U0VA 4EJWA 3Q9VA 2UWMA 2WC2A 3HTSB 2F2EA 1J0RA 4HQEA 1RIOH 2DQLA 3D0SA 5D8LB 3ELKA 5D6FA 1KU9A 2DK8A 3MWMA 1CGPA 2PQ8A 5K5QA 2EJRA 4HF0A 6PAXA 1F5TA 3GEZA 2XGXA 2E1CA 1CF7B 1H9GA 1MJAA 2M30A 1ZH5A 1EH8A 1FNNA 1GVJA 4OOIA 3HIFA 2HFHA 4GXOA 2ZKZA 1CF7A 2E1NA 2OZUA 4I7HA 3F72A 2M45A 4L0YB 3JAMZ 1LEAA 2XAQA 2DQRA 4PGGA 4XRFA 5FLXK 5H6RA 1MGTA 1F9NA 1TQMA 1TLHB 1G6NA 4YIFA 3WTVC 1D3YA 4DNCA 1YTYA 1XSDA 3HRSA 5ICCA 5K1YA 5LRRA 2CWEA 2DFIA 2FMYA 5ILVA 4A6EA 4KIBA 4IRHA 2STWA 2EA4A 2K7LA 4Y15A 1I6XA 3M9AA 4BHPA 4YIIA 2EFNA 5D4RA 2HOEA 3BWGA 2Y75A 2RC4A 2X4HA 1K79A 1D8KA 3EQLF 2XASA 3ECHA 1UB9A 2F5EA 3WTTC 1SFEA 5E1XA 2WWYA 2E7WA 4GYIA 2FBIA 3ZMUA 1T39A 1PP8F 1IN8A 3W6KB 3V7SA 3IL2A 2P7VB 1B6AA 1IXCA 3I58A 2M1BA 5HLHA 4Z2YA 2DPUA 4IRIA 4P5OA 1R58A 5E8GA 5JHUA 3RTRA 4KMUX 2A61A 2QENA 3SZTA 2PBIA 2QBYA 3WE2A 2G7HA 4F7ZA 4WXDA 4GCVA 1GXPA 3RKXA 2O6GE 5BPDA 2KKOA 5JR3A 3KZYA 2OA4A 4MHGA 1HXDA 1XGOA 2H6BA 2J5OA 4A0ZA 5AIPA 4G6QA 2DO7A 1PDNC 1UHMA 2VODA 5J6XA 5FLXZ 2D2WA 1L0OC 4TV7A 3DF8A 3F8CA 3GYHX 5AIQA 4G6DA 1LB2A 1BI2A 3QP6A 4RGSA 4LK0F 3JTHA 2M87A 5DD4A 5BQTA 1W7PD 2HKXA 3FMSA 1REPC 1ZG3A 1LJ9A 4MTDA 2XRNA 1G3TA 4IJAA 4BXUA 4UV8A 2CSOA 3E6CC 1T2KA 3ZMZA 3CLOA 3CO6C 2A69F 1ZHFA 1W5SA 3R6SA 5L3FA 1ZGAA 2W85A 1HQCA 3CUQA 2CYYA 1ZRDA 4YFNF 5ILUA 2W24A 4AVPA 2ZJ2A 3ECOA 3GXOA 4FX4A 3SFZA 3DPLC 4OIRF 3KP6A 2NNYA 5HS8A 1Z6TA 4BHBA 4IVNA 3CO7C 4KYWA 1Z1DA 2RN7A 3U1DA 4LG0A 2MLGA 3E6DA 3BOQA 1RUOA 1MZBA 2YR2A 4FHTA 2AS5F 2HZTA 4U7DA 1STZA 5HDNA 1O3QA 1J2XA 1IXRC 4BH9A 2XAFA 5LHHA 4ENNA 3F6OA 1AWCA 4L0ZB 1G3WA 1J75A 2Z5UA 1S3JA 2EWNA 2YSRA 5FO5A 1PP7U 2HS5A 3BROA 3LAPA 3ZPLA 3V7CA 4RB1A 5FD6A 3LA2A 4IRGA 1YW8A 1FBUA 1ZYRF 3L9FA 1XDSA 2IRFG 2L02A 3CTAA 3KFWX 3R0JA 2DU9A 1WWXA 2FRHA 1F4KA 3ZMDA 5IT3A 1J5YA 1R22A 1YQAA 5CLSA 1JHFA 2CO5A 2D1VA 1HSJA 2FMLA 3FF5A 2IA0A 2Q0OA 2KJCA 1XSXA 1MJ9A 5DV5A 1XSVA 4EQQA 4MGRA 2XAHA 4WWCA 2MLKA 4ZZDA 2BBYA 2HGCA 2A6EF 2B0LA 1J59A 1Q1HA 5L3GA 4KDPA 3GFMA 3C1DA 4RB3C 3I0TA 4L9JA 4KFCA 1LNWA 3ABUA