2GA1A

Crystal structure of a duf433 member protein (ava_0674) from anabaena variabilis atcc 29413 at 2.00 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
MNKKTQLLEVIAALPEELVDQALNYVQMLQNPIQITPGVCGGQARIRNTRIPVWTLVAYRQQGAPDKELLANYPGLTAEDLSAAWHYYEQNPEQIDREIAQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein of unknown function DUF433
publication title Crystal structure of (YP_321193.1) from Anabaena variabilis ATCC 29413 at 2.00 A resolution
rcsb
source organism Anabaena variabilis
molecule tags Unknown function
total genus 30
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04255 DUF433 Protein of unknown function (DUF433)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ga1A02
1.20.5.800 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Alr1493-like domains 2ga1A01
2FMLA 4EQQA 3PQKA 4KA4A 2IT0A 3HUGA 2KJCA 4CHUA 3T1BA 1W5TA 2WWYA 5CVRA 1DPRA 4M9ZA 4N9IA 3BY6A 5HLGA 3GWZA 4QLCU 4XSXF 1YIOA 3ZMDA 2HKXA 3LA7A 2YX4A 1J59A 2A68F 4FT8A 4G6QA 4PCQA 1OR7A 3DFGA 3HRTA 4Q48A 5BQTA 3BJ6A 4MQVA 3JTGA 1XMKA 3RKXA 1OYWA 1W7PB 1YLFA 3QAHA 1HBXG 3QU6A 4AVPA 1B9NA 2VT3A 3F8BA 2ETHA 1IN6A 3E6CC 4RGUA 4M71A 1XDUA 4G7OF 1U8RA 2V9VA 5LEKA 2GQQA 3TDUC 1OMIA 2FF4A 2ISYA 1BIBA 1ONVA 3F21A 4KMFA 2NNNA 1BM9A 1XN7A 4HF0A 1J7KA 3KP3A 2OBPA 3B02A 4I98B 4A5MA 3J81K 1UHWA 1REPC 5EEGA 3H3UA 2EV5A 3GEZA 3CDHA 4FX4A 1IF1A 2ZO4A 2K86A 2O8XA 4LG0A 1XGOA 3LFKA 3F6OA 3REOA 1YFHA 1O3SA 3CJNA 1USTA 1LB2A 1LEAA 1LEBA 4RB2C 1QPMA 2XAHA 3LQRA 5DDGA 1S8NA 3DQVC 2PG4A 4S04A 3HTSB 2CW0F 3RYPA 5IT3A 1DDNA 4LLNA 1YQAA 3GVAA 1FLIA 1FPQA 3KZYA 1XCVA 4BH9A 5K5QA 3R61A 1J9IA 2CYYA 1U6GA 1XB4A 4HZFA 2VXZA 2EJRA 1F4KA 2JSCA 1WQ2A 1R36A 2R3SA 3HIFA 4NHJA 1ZAOA 4WXDA 2HTSA 1LQ1A 4ZYGA 3E5UA 2OA4A 1O3QA 4IVNA 4RAZA 4MEYF 2ZBKA 2STWA 4P9FA 3R0AA 4AIKA 2STTA 3D5LA 2ADUA 5JHUA 1EH6A 1P2FA 3KCCA 1YW9A 3MZHA 2IA0A 1IXRC 4ZYEA 4OIOF 4EGZA 1KU2A 3BP8A 2A5YB 1QZYA 1O57A 4A12A 2X0LA 4U7BA 4LLLA 2DLLA 5DUKA 4N0BA 1HKTA 4HDUA 3JAMK 4JBAA 2F5DA 3SFZA 5FO5A 3WG9A 3WTVC 2FEZA 4EJTA 2PI0A 5ICEA 1ZRDA 1T98A 4TV7A 2Q8KA 1ZRCA 2VBWA 5CVIA 3ECOA 2HOEA 5DUIA 3M8FA 2FRHA 5HS9A 2LF8A 4LJZF 1Z05A 2EFWA 2QZ8A 1FP1D 4GO1A 1LNWA 3KLNA 1Z9CA 1XGMA 2V1UA 4G6DA 2ZNYA 2MH2A 2RKHA 3QP6A 1ZREA 4HX4A 2XIGA 3CUOA 1JGSA 2ZMEA 2E1NA 4BYYA 2K02A 2NS0A 1IN7A 1R22A 1I6XA 2BEOA 3FHZA 3SXYA 5K5OA 1E17A 5EEHA 1JXSA 1I5ZA 4JQFA 3WTTC 1R23A 5E8IA 5FLXK 1R1TA 2PMUA 1XMAA 3WTSC 4ENKA 4ASNA 4E70A 2FXAA 3HRMA 3J7AO 3ZP5A 3K0LA 1LJ9A 2M5WA 2VE9A 3MZYA 1B4AA 2DQLA 4O6JA 1R1UA 4U7DA 1CF7B 2LF7A 1ZGJA 1WRJA 1G3YA 1TNTA 5KVRA 3KZZA 2CGPA 1LVAA 2PN6A 2EA2A 4LK1F 4G7ZF 1IUYA 1J2XA 5D8LB 3SZPA 2XGXA 3ZQ7A 5FFXA 4NB5A 5D5VB 3KFWX 4K2EA 1BN5A 3K2ZA 2HEOA 2A61A 5L3CA 2E7XA 2QM3A 3HOTA 2VODA 5J6XA 5L3BA 1R00A 5D4SA 3BJOA 4G8XA 5ILUA 2EK5A 4WWCA 2BGCA 5DD8A 1KQ9A 4HA8A 3E6BA 1X3UA 2Z3YA 4UHTA 2HYGD 4PGHA 3WTUC 3WU1B 1EV7A 2G7HA 1Y0UA 1HSTA 3IHUA 3OV8A 4LMYA 3F8FA 4LFUA 3JTHA 1L3LA 2NRAC 1SD6A 2GXBA 4P5OA 4EM1A 1B59A 2TDXA 1MDMA 4MHGA 4L5JA 3FWEA 2L01A 1U78A 2H6CA 2A6EF 1ZG3A 1ZGAA 4RGXA 1WSUA 1C0WA 4G7HF 2FA5A 1EH8A 3RKYA 1S3JA 4IPAA 1UB9A 3TOBA 3I0TA 4XSZF 1R58A 2QLZA 1QGPA 1BC7C 1PP8F 4R8HA 2DK8A 2L4MA 2B0LA 2CWEA 3E3VA 5HDNA 4M6YA 2EV6A 1TLHB 2XAFA 5FFZA 1JE8A 4UV9A 2QENA 3KP4A 4RAYA 3CO7C 1G3WA 2O61A 3MAJA 1IN8A 2DTRA 5H20A 4EGYA 1RUOA 5D6EA 4GYIA 5LBQA 5DYMA 4ENJA 3BZ6A 2OZUA 4OU0A 4A0YA 4UVAA 3I59A 4EVIA 1KYZA 3T0YA 2ZCWA 2DFIA 2HTJA 1ULYA 3IKTA 2P5LC 5F64A 3P9CA 4OIRF 4EV0A 3FXQA 1QBJA 5DCMB 2LDUA 1IW7F 2BYVE 2IRFG 3CO6C 3HHGA 4ZH4F 1B1BA 1TQIA 3ULQB 2ELHA 3GFJA 2F5EA 4A0ZA 1PP7U 4HAMA 3F72A 2OZ6A 1T38A 4CDGA 1G3TA 4G94A 4Y15A 4OMYA 2EFOA 1SFEA 4M73A 2YSRA 3BJAA 3K1MA 4Q47A 2BE5F 4UVBA 4U88A 4WXHA 5E1XA 1ZHFA 3RIRA 1XSDA 4I7HA 1KGSA 3U9GA 1I27A 3F23A 3KETA 4HQMA 4QWQA 5BOXA 2LNBA 4L9NA 2YPRA 1HQCA 1WWXA 3I5UA 1JHHA 3V7RA 4KUMA 3R60A 4GGGA 4IF4A 1W7PA 2EB7A 1UCRA 3NEUA 3C18A 4UUVA 1F5TA 2P5VA 3W6JB 3F8NA 1J75A 5HLHA 2CSOA 3HOSA 4Z2YA 5DV5A 1U2WA 2GIVA 3NRVA 1I1GA 3FMQA 5A2QZ 3L2CA 4ENNA 2K4BA 2IW5A 2FBKA 1TQMA 4ON0A 2XUBA 2PQ8A 1R7JA 2W84A 2PEXA 4IRGA 2H27A 1LDJA 3BPXA 1XSXA 1BJAA 5F6FA 3IRQA 2P6SA 1SMTA 5F1RA 2NYXA 3T8RA 1YG2A 2FSWA 3KEOA 2ISZA 3K69A 1SAXA 3P7NA 2ZJ2A 2ZKZA 4KYWA 2FOKA 2C6YA 4I09A 4L9VA 4N9HA 3C7JA 5LGUA 2PJPA 3C1DA 3LAPA 2F5FA 2H94A 2KJBA 2RVCA 2VBZA 3J81Z 2A6HF 4AIJA 5CJ9A 2V79A 5E20A 2V1DA 1F9NA 2Y0MA 1FYLA 4AWXB 4HOBA 4IRHA 3T5XA 4M74A 1IZ1A 4A6EA 3V4GA 4RGRA 1YS7A 5D5UB 4A0XA 4MEXF 3NQOA 3CUQA 4OIPF 2COMA 2A07F 1OKRA 2HR3A 4YG2F 3E5XA 4RGSA 4Q4ZF 2Q2EA 4WCGA 5D8KB 4LG0B 4WXCA 3B73A 5HVQC 4A2UA 3MWMA 1UHMA 5CYVA 4RB1A 2KIMA 1PDNC 5CVUA 3ELKA 1YS6A 4KN4X 3QPHA 1IRGA 2BV6A 2P5KA 2JZYA 1DPUA 3V8LA 5E8GA 2RDPA 4MTDA 3F22A 3VFZA 3FMRA 3DPTA 3LQQA 5AIQA 4OINF 1QZZA 3F8CA 3VODA 3N4MA 1R1VA 3KE2A 1FOKA 3DF8A 1T6SA 4I0AA 2DQRA 2LKPA 4UVCA 1JHFA 4KT5C 3RI4A 2CQKA 1KU3A 3LAJA 2M87A 2DK5A 1IN5A 1AOYA 4U0WA 1ON2A 3Q5FA 1B6AA 1XCBA 3QU3A 1BC8C 5E17F 1MJBA 3J80K 3F3XA 1G4DA 4CXFA 1E2XA 3TO6A 3SQNA 2EA4A 3ISPA 3V8JA 2PLYA 1BI2A 1I1SA 1Q1HA 2RC4A 3GF2A 2P7VB 3ABTA 2YX7A 2GZWA 2D2WA 3M1EA 1RI7A 4AIHA 2UZKA 2HFHA 4PDKA 5HS8A 1MD0A 3GFIA 1FSHA 5FD6A 2D1HA 3TQNA 4ZYDA 1YTYA 3E97A 2Z9OA 5FB2A 1D3YA 4ESJA 1HKQA 2MC3A 2OAZA 3DXJF 1K78B 3TOAA 3S2WA 2X4HA 2MD5A 3RDIA 1SD5A 4YFKF 2K7LA 2M45A 2XV4S 2Q0OA 4LLGF 1BI1A 1D5VA 4IXAA 1CF7A 2ZXJA 3DV8A 3R0JA 5FLXZ 1BIAA 1K7AA 3WTZA 3LA2A 1U5TB 3IC7A 4YIIA 1XD7A 5HDGA 2BBYA 2V1XA 1P92A 2DW4A 2ZMEB 4P55A 1S7AA 2QQBA 1IRFA 2V6CA 4HX8A 1ZG1A 4JK1X 4GXOA 2FQ3A 1O7LA 2L54A 4WK8F 1U5TC 2QWWA 1FYKA 2W25A 1OYIA 5H6QA 3EETA 4EJVA 1KQ8A 5J8FA 4M9SA 1RZ4A 1BOAA 2HWVA 1H9TA 1G3SA 3F8MA 3O3KA 4L9JA 3QPTA 3Q9SA 5CVVA 3T8TA 3N97A 5LRRA 2O03A 2JRTA 1Z91A 4R79A 2VT2A 2QVOA 5ICGA 4KIFA 1LDKB 3IWFA 4ESBA 2RN7A 2DU9A 3QOPA 4EJWA 2QYOA 2J5OA 3R6SA 5ED4A 3OOPA 2ESNA 3WTXC 5BMZA 4LD5A 3MFKA 2R7FA 2JT1A 4OIQF 1L0OC 1O3RA 1FY7A 1P4WA 1SD4A 4UXNA 1H0MA 2A69F 4Y13A 1YW7A 4XLPF 4A6DA 4ESFA 3ABUA 2MA3A 3MEXA 1KU9A 1IN4A 2UXXA 4XLNF 3RPQA 3L00A 4YFNF 2J5PA 2HYFA 3DPLC 3CLOA 2IA2A 1ZG5A 1MDMB 3KP6A 4EJOA 2Z99A 3QRFF 2MLKA 4BHPA 1BI0A 2HGCA 1FT9A 2P6TA 1XDSA 4PZJA 3ZMVA 1ZLKA 4BNCA 2PBIA 2VBXA 5ERIA 3RTRA 1FZPB 2EFNA 2HDCA 3SHFA 2EV0A 3I54A 2HQNA 2QUFA 1W4MA 1HKSA 3BPVA 3E6DA 3ZN0A 4MQ9F 5FGMA 2FE3A 2GA2A 2W24A 2XRNA 2P7CB 2QBYA 3EYIA 1ON1A 5DCFA 3F6VA 2FBHA 2DO7A 3DKWA 2M8EA 1AWCA 3FMSA 1W5SA 5K1YA 4CGZA 2OD5A 4KFCA 1STZA 5CLSA 2MH9A 2Y48A 3TO7A 1TW3A 5IT9Z 4HV5A 5DD4A 2NNYA 2WTEA 1HW1A 1U3EM 2VC0A 1XGSA 3COAC 3ZMTA 5HLIA 1MJAA 4MGRA 2M1BA 2JPCA 3FF5A 3WE2A 4HF1A 4XRFA 2H09A 4Q5SF 3I64A 3GFMA 4EM2A 3HSRA 5ICCA 1YO5C 2NAZA 3EDPA 1UFMA 1MGTA 5J8CA 2RNJA 1TW2A 3ZMUA 4MTEA 3V7CA 2QQAA 3H92A 4HLYA 5AIPA 4EM0B 3RKWA 3GXOA 2CG4A 3M9AA 4CO8A 1H9GA 1O7FA 3M7GA 5HDKA 2FNAA 3DEUA 1D8JA 3H3ZA 3BWGA 1ODDA 1ZRFA 2AXLA 4IHSA 2XAJA 5A2QK 1ZLJA 1R5GA 5TJJA 5LHHA 2EFQA 1FYMA 2YR2A 1S6LA 3TGNA 3P9IA 2VOOA 5D4RA 2DAOA 2L4AA 3WODF 2XROA 2ZFWA 4L18B 2VN2A 1SFUA 2P8TA 1USSA 1MZBA 2Z5UA 3VEPA 1P4XA 4HX7A 5E1WA 1KYWA 2PMHA 2W85A 3WTYC 3HYIA 1FX7A 1OYYA 2XAQA 4U0VA 2M30A 3FXRA 2XKPA 3WGHA 2Y75A 3K9TA 5TRDA 1P6RA 4CZZA 2FU4A 1SD7A 5LGNA 2D1VA 4AD9A 4DNCA 1T39A 3ZN1A 3IL2A 1FBQA 3HRSA 4BAYA 3BROA 2D45A 4LB6B 3ZPLA 2IA1A 3O2PE 3KP5A 5BS6A 3HSEA 2EFPA 5LRSA 4HF2A 3AAFA 1IXSB 1W7PD 1Z7UA 2JPBA 3WGIA 4ZYHA 4KN7X 1HW5A 5E18F 2ZNZA 1O3TA 4XBFA 2QQ9A 6PAXA 3ECHA 3CTAA 4EJUA 2CFXA 4G9YA 3FZVA 5KK1A 2MBFA 3TDZC 4U0YA 3I71A 3M8EA 2GA1A 2XHKA 3CUQB 2VBYA 5LHIA 1DUXC 5ILVA 3LSTA 2KRFA 3HSFA 3GZ5A 5JFRA 1FBUA 4M6XA 1MJ9A 4CYDA 2FBIA 2ACJA 2XASA 4BXUA 3C3WA 4L0YB 4A5NA 5L3EA 5LLQA 5LHGA 1FWZA 1DP7P 3BDDA 1ZARA 3FX3A 3CUQC 3ZMSA 3HTUA 3V8KA 1J5YA 5LEJA 1XSVA 3GYHX 1IAWA 3O6BB 4WX9A 3L09A 4R1HA 3MQ0A 4B8XA 4HLXA 2P4WA 3JAMZ 3WTWC 4MNUA 2L3DA 4LB5A 1YYVA 1TQPA 1G6NA 4L5IA 5JI6A 1QQIA 3J80Z 1RIOH 1HW2A 3BOQA 2DBBA 4WF2A 3K1NA 2EWNA 4GCVA 3ROUA 3P9KA 3KEQA 2PFBA 2OQRA 1Z6TA 2FNPA 5D5WB 2ESHA 3FM5A 2K27A 1D8KA 1FP2A 4EMSA 1K78A 3GZ6A 4KICA 2OQGA 1FSEA 4LK0F 1FC3A 1V4RA 1F1ZA 4BHBA 2DT5A 1BI3A 1Z1DA 4O5VA 2HS5A 1TTYA 1P4AA 2IPQX 1KA8A 2O6GE 3VOEA 1U5TA 2OU2A 4S05A 3D0SA 1TNSA 4ZZDA 5BPDA 5D6FA 2GXGA 3I4PA 3QP5A 4H0EA 3WE3A 1S29A 2IVMA 4YFXF 5L3GA 4HBLA 4FHTA 4UNOA 1LDDA 1MKMA 3HHHA 3GLXA 3EQLF 1GHCA 3JSOA 4O3MA 3K1PA 4CICA 4RB3C 2KIUA 5FD5A 4KMUX 3IKVA 2VC1A 2UWMA 2R7DA 1YW8A 4P9UA 4Y17A 4YIFA 1T2KA 4F7ZA 3JSPA 2IJLA 1SMYF 5K5RA 3KP2A 2HZTA 2VE8A 2HKOA 1KU7A 4GYGA 4M72A 2MLGA 3L9FA 4RS8A 2HQRA 2IP2A 3G3ZA 5L3DA 1VTNC 3RYRA 3TO9A 1PUEE 2CO5A 3FM3A 2F5CA 5HOOA 4OMZA 4HYEA 5DEQA 2JTVA 5E1ZB 3GX4X 1GXPA 4HDVA 4KIBA 3GFLA 4KNYA 1FBSA 1GVJA 2RQPA 4ETSA 4B09A 1RNLA 3Q9VA 2FMYA 3EUHA 1NHAA 1WI9A 3E6MA 3L7WA 2A3SA 1ZH5A 3V7SA 1HXDA 3IWZA 4I2OA 2DPDA 3GUDA 5CVJA 2YU3A 4FX0A 1TBXA 3KLOA 5AONA 3HRUA 2O0YA 5H6RA 2K4JA 4IHTA 1V3FA 3VB2A 3EYYA 3RPUA 3IRRA 4IRIA 4KIGA 3U2RA 1QNTA 2Z33A 4I02A 2VONA 2F2EA 1XGNA 1WKMA 4UV8A 4OOIA 5ILSA 1GXQA 4P96A 2KIFA 2DI3A 4PGGA 5L3FA 4BHCA 4I0BA 3U1DA 5ICFA 1HSJA 4L0ZB 2E7WA 1T0FA 3KP7A 4HV6A 2XAGA 2KKOA 2G9WA 2G7UA 2W57A 4I01A 3G73A 2O3FA 5LGTA 2VOPA 3GO5A 2GWRA 2XVCA 3PFIA 4D0PA 1CGPA 4L9TA 5DCMA 5BPIA 1ZN2A 1EH7A 1Z6RA 1K6OA 4NQWA 2AS5F 3ZMZA 3ML6A 3I58A 2XKOA 3PQJA 3JW4A 5D5XB 3W6KB 1R5HA 2UXNA 3MCZA 3TKYA 2DPUA 2L02A 2RV8A 1OPCA 4DQ2A 3WGGA 3R4KA 4HW0A 1A04A 5JVTA 1J0RA 2GAUA 5HS7A 3SZTA 4ZZLA 4LGWA 3I53A 3ERED 3I59B 2RGVA 4M9XA 1BBYA 1IXCA 4HQEA 4BQAA 4IJAA 2WV0A 3WU0A 3LWFA 4RB0A 1QO0D 5JR3A 1FNNA 3FXUA 2H6BA 3RJPA 1K79A 1RUNA 2E1CA 4KDPA 4ENMA 2WC2A 1S7OA 1SFXA 3E5QA 2QBYB 5IT9K 1ZYRF 1KQ0A 1B9MA 3LA3A 3DP7A 2LSOA 3GW2A
chains in the Genus database with same CATH superfamily
3NMDA 4RMNA 3Q1MA 4IHYA 2M0BA 2P58A 3V5BA 4IQJA 2FMLA 2OTJP 4EQQA 3PQKA 3BCCE 3KXDA 2X48A 1UIXA 1WCMJ 4PUSA 1D0ZA 4KA4A 3CC7I 3A7OA 4RM2A 2IT0A 4BY1J 1QU3A 3I55P 1BE3E 3HUGA 4IX7A 2KJCA 4CHUA 2VQHA 3M8JA 2LKSA 2P81A 4LIVA 3T1BA 1W0UA 4Z1MH 3GCMA 2K9NA 3H1JD 4BY7J 1W5TA 2WWYA 3Q5PA 2OYHA 2EIJH 3BATA 4D5CA 2TRTA 2H1LA 5CVRA 1DPRA 1EDKA 1SQQK 4DZPA 4M9ZA 4N9IA 2ZSHB 2COBA 3H1ID 3BY6A 5HLGA 1Y8AA 3GWZA 2ECCA 4QLCU 2AQEA 1NTMD 1V54H 1ETYA 4XSXF 1YJ9I 1YIOA 3ZMDA 4E7HA 3WU2E 2HKXA 1R49A 1EKEA 2R5ZB 3LA7A 2YX4A 1J59A 3VMYA 2A68F 3CQZJ 4FT8A 4G6QA 4D6TJ 5E79C 4XRSG 1GV5A 2H8WA 5KKZB 4PCQA 3ZQQA 1K04A 1N8RQ 1TWAJ 2XPVA 1IJWC 2WT7B 1MBFA 3WHBA 2HODB 4D7MA 1OR7A 3DFGA 3PL8A 4PD4E 2LH9A 3HRTA 5AVTB 4Q48A 5BQTA 1SVFA 1OLTA 2A45G 3BJ6A 5EZGA 3H1JJ 4DOZA 4MQVA 5J40A 2BY0A 3JTGA 5FRMA 3GMEA 1XMKA 1HC8A 3HOZJ 3RKXA 3TF5A 1OYWA 3MKLA 1W7PB 1YLFA 1JKRC 2FY8A 3QAHA 1NTMJ 1HBXG 3OYBA 3QU6A 2A06E 2V26A 4AVPA 1SQQE 1B9NA 2I1JA 2VT3A 2A05A 1WVRA 2CUJA 5IP9J 5KAIC 1QVFO 3F8BA 1BGYG 2ETHA 1N86A 1IN6A 3E6CC 3A0HH 4I7ZC 3BR5A 3K4MA 2K9LA 2M4GA 4RGUA 4M71A 1M7LA 2QJPC 2WPSA 1L0LD 2CQNA 1XDUA 2MGQA 2Q3IA 3C2GA 3OYDA 4G7OF 1QHHD 1SQBJ 2IGKA 5KKZC 1U8RA 2V9VA 3RQ4A 5LEKA 3HEFA 2GQQA 2E75C 4ZDOA 2BY1A 2XF6A 2JVGA 3QYFA 3RZOJ 5FLMJ 2YS9A 1JGGA 1MV8A 3TDUC 1OMIA 2FF4A 3LSPA 4RBOA 3A0HE 2ISYA 5TGTA 3D6ZA 1Z7LA 4C46A 2X1CA 1NAFA 2M8RA 3JREA 1MSFC 1BIBA 1ONVA 5FKMA 4IOCF 2YKPA 1ETVA 5B1BH 3F21A 4XA4A 3V4QA 4HSTA 1E3PA 4KMFA 2EQRA 2NNNA 3M0DA 2W6BA 3RK3E 5M5XJ 4K3AA 1BM9A 4W80A 1XN7A 1FE6A 2YO2A 4HF0A 2BASA 1J7KA 1YI2I 3KP3A 2CUFA 1RQUA 3KZIH 2OBPA 2B87B 2JJLA 2ZXEB 3CMMA 3B02A 3CCYA 4I98B 1YTZT 2XV5A 4A5MA 2O01N 3J81K 1UHWA 1X1PA 1Y1VJ 2XF7A 1REPC 5F0FA 5F04A 1HCRA 2WY7Q 1PYVA 3CJTB 4MFDA 5CQGA 3H3UA 2EV5A 2DMNA 3GEZA 5EEGA 3CDHA 4XRSA 3J7ZI 5EZHA 4FX4A 2ZXHA 5GTHC 1IF1A 3KHUA 4H13B 2ZO4A 2KLOA 2KP8A 1DIPA 4ABZA 3WUVA 2O01J 4Y33A 1FJLA 2K86A 1K05A 3CCSP 1H88A 2O8XA 1RC9A 3MUDA 2CS3A 4LG0A 1YRNB 1XGOA 1FOXA 2NPSA 2OARA 4WY4C 3LFKA 3F6OA 3REOA 1YFHA 1O3SA 3CJNA 1USTA 3OIOA 4LG3A 3L1PA 1EZVG 4I1LA 3S1MJ 1LB2A 1KB9D 1R5LA 3P8MC 1LEAA 3DTKA 3H1HD 1JCCA 3VYIA 2JUGA 1MBEA 2W4SA 1LEBA 2RREA 2IZ0A 1FEXA 3O6QA 4RB2C 1QPMA 2XAHA 3LQRA 2HVRA 1GZLA 5DDGA 2J58A 4UB6E 4BDZA 2YIUB 1S8NA 3ZQLA 1KORA 2DA5A 3DQVC 2PG4A 4S04A 4KT0J 3HTSB 3A3YB 3RL0C 2KMUA 2CUEA 2CW0F 2IGMA 4GOEA 4H13C 3RYPA 2KLUA 4YRVA 5IT3A 1DDNA 4UB8E 3BTCA 2DCEA 4LLNA 1YQAA 3GVAA 4QSHA 1B8IA 4GFBA 1BJZA 1FPQA 3KZYA 1XCVA 1FLIA 3P8CD 3V2RA 2IFNA 4BH9A 1WJBA 5K5QA 4CPGA 4LC1A 3H1HJ 3PUFA 2ZT9D 3R61A 2R7SA 1A5JA 2R5BA 3CD6I 4NPFX 1J9IA 3W68A 2AXCA 2CYYA 1U6GA 3A1YA 5M3MJ 1KQSO 1XB4A 4HZFA 4HNUA 4U3FD 4EIJA 2PMZN 5APTA 1V5EA 2VXZA 2RN0A 2B63J 5AVQB 1SQXK 2EJRA 2WITA 1F4KA 2JSCA 2HXIA 1QEXA 2ELJA 2YIUC 1WQ2A 2DYRH 3EUKL 4XIDA 1R36A 2R3SA 3HIFA 4NHJA 3H1KJ 4BWNA 1ZAOA 4WXDA 1VQ9P 4KJZA 2VUMJ 2HTSA 1B72A 2R7ZJ 1PFIA 1LQ1A 4ZYGA 2VRSA 2VJ4A 5DTDA 4IL6H 3G4SP 1S72P 5KLVK 2ZC2A 2VKEA 2MKVA 3E5UA 1UIIA 2OA4A 2UV1A 3S8PA 1O3QA 1S2EA 3NWTA 4IVNA 4YXWH 2DT7B 4RAZA 5KJ7C 3ABVC 4U3FJ 2W27A 4FE7A 3S1KA 4MEYF 1AQTA 2LVSA 2IBZD 2JWDA 2ZBKA 2STWA 4P9FA 1G2HA 3R0AA 1JY2O 2LY2A 2E5TA 3GHGA 3W67A 4E7LA 4PK4A 2JDIH 4AIKA 1VI0A 3D5LA 4IEJA 2STTA 1PP9G 1GD2E 1P84E 1VQKP 3CZ6A 3GBGA 1IFMA 2PP6A 2ADUA 3E7KA 1K61A 5JHUA 1EH6A 4YIRX 1P2FA 2EBIA 3KCCA 5AW7B 1YW9A 1R71A 3FXOA 3TNUB 2WSSH 3MZHA 3K4KA 2IA0A 2KS1A 1IXRC 1OCOH 4ZYEA 1T08B 2JMWA 4OIOF 3CCJP 1G1IA 3LSHA 4EGZA 3IH3A 1KU2A 2FOWA 3BP8A 4I6ZA 3HUSC 2A5YB 4NUBA 1QZYA 3B4SA 1XX5A 3L71G 1O57A 2OTJI 4A12A 4MLOA 2X0LA 4AVZA 3HG9A 4U7BA 4LLLA 3P7KA 2DLLA 2R7UA 2E2JJ 5DUKA 4N0BA 1LP1B 1HKTA 4HDUA 3EFFK 4RA2A 4JPZB 2BCCG 3JCUE 3CLQA 4NBQA 1PPJD 4XN3A 4JX6A 3JAMK 1SFOJ 2QJKB 1TT5B 4A3IJ 1JTYA 1VQPI 4JBAA 1G1JA 3FWLA 1LE8A 3BLYA 2F5DA 3SFZA 5FO5A 3WG9A 2DA3A 3UKGA 1Q82Q 4FASD 3OOUA 5EF6A 1VPCA 3HD7A 3WTVC 4N6JA 2FEZA 5JLWA 3WUTA 4PFOA 2E1OA 4EJTA 3AFHA 2XB5A 1KN7A 2PI0A 1VFCA 1MFZA 2V4HA 5ICEA 2BW3A 3PSFA 3L4FA 4ZKPA 3S17J 5KAFH 2B88A 3A5TA 3ZGKA 3ZOBA 1UELB 3OYEA 1ZRDA 2KSJA 1T98A 2NS8A 2QSFX 4TV7A 3S93A 3L73D 1KB9H 1Y47A 2EZKA 2IEKA 2Q8KA 4XKWA 1ZRCA 2VBWA 3ASOH 5CVIA 1JMBA 3ECOA 2HOEA 5DUIA 4A3MJ 4BBSJ 1BGYD 1J1EB 1SQPK 3AE5C 1QA6A 1VQ5I 1LTIC 3M8FA 4LLHA 2FRHA 5HS9A 2KSEA 2LF8A 4DYRA 4C9YA 3S1NJ 2F4MB 3S3OA 2QJKC 2KK7A 4H44D 1IJDB 3M0AA 5K7FA 3IR9A 1KD1Q 2HVSA 1X3WB 5FKLA 1YHQI 1ZQ3P 2CRGA 4DJAA 4LJZF 1Z05A 2EFWA 2QZ8A 2HU9A 5CCHC 3A0BH 1FP1D 3AEBC 2XF5A 2M3BA 3HDDA 4GO1A 4A3JJ 1LNWA 1L0NE 2Y0EA 1FZCA 3KLNA 1Z9CA 1XGMA 2V1UA 1BGYJ 4G6DA 2ZNYA 2MH2A 2RKHA 3QP6A 1ZREA 3VMZA 1VQLP 2AXTE 3OYIA 2OYIB 4HX4A 2XIGA 1J1EC 1FMVA 3CUOA 4B47A 1X0TA 2R3CA 1JGSA 2ZMEA 2DMUA 4BEHA 1L0LK 1SQXG 2E1NA 1BCCG 1HTLC 2DMTA 1A35A 5J3LA 4BYYA 3BCCD 1D5YA 2L2OA 4F92B 2K02A 5CCGC 2NS0A 1IN7A 1R22A 5EGOB 1I6XA 2OV7A 1LUJB 2BEOA 1L4AB 2G8YA 3FHZA 4W1UA 4HEA2 3SXYA 5EJCA 5K5OA 2CJJA 3OR1C 2N1TC 1S5LH 5KLVG 5JVGF 2BEZF 3PTZA 1E17A 4AYBN 1HGVA 5EEHA 1IC8A 1JXSA 1I5ZA 4JQFA 4V2GA 2WY8Q 3WTTC 2L7ZA 1R23A 5E8IA 5FLXK 3SYTA 1R1TA 4CCMA 3FXJA 4UUSB 4J00A 2H43A 2CW7A 2PMUA 1XMAA 3WTSC 3SJMA 1LWUC 4II2A 1EZVD 2KDOA 2XSDC 5GPCA 1WFXA 4ENKA 4ZTFA 4ASNA 1ZRTE 4E70A 2FXAA 3HRMA 3J7AO 5GTIC 3ZP5A 3K0LA 5EYRA 2OYIC 1MNEA 1LJ9A 2HVQA 3H0GJ 3GTMJ 1Y39A 2DA2A 1UG2A 2M5WA 1YIJI 2IS4A 2R7OA 1FOSF 2VE9A 3MZYA 2XSJC 1USEA 1B4AA 3CCSI 2YO3A 2WBMA 4PD4D 2DQLA 2DA7A 1POGA 3OYLA 3VMXA 1D1AA 4O6JA 1NK2P 3CMYA 2C9NY 3H1CA 1VNDA 1R1UA 2CQXA 2KLVA 2E2IJ 4U7DA 1CF7B 1SFCB 2QE7H 2O7OA 2HLOA 2OCCH 4HYTB 2LF7A 2M8GX 4XLEA 1ZGJA 3CCLI 1WRJA 1G3YA 1TNTA 2M9HA 5KVRA 2A06D 1LT9A 3A01A 3KZZA 2CGPA 1TWGJ 1LVAA 1SQQD 2PAJA 2PN6A 4QPQA 2WSCH 3S32A 2BEQD 1QLED 1ZKGA 2EA2A 1NAYA 2MC4A 4LK1F 1X22A 4G7ZF 1AV1A 3KPHA 1IUYA 5F0CA 1J2XA 2XGCA 3L70E 1K4TA 4BL0B 5D8LB 3LSKA 3SZPA 1KMIZ 3V2QA 2FFDB 2XGXA 4DZOA 3ZQ7A 1Q86Q 1ZR4A 5FFXA 2H89C 4NB5A 3HD7D 4RM3A 3AE8C 5D5VB 4F91B 3KFWX 4K2EA 2WV1A 1BN5A 3K2ZA 3TGUG 3IUOA 4OAYA 1RR7A 5E79E 2A45H 1LTTC 2HEOA 1YJ9P 2A61A 4LGDE 3S1QJ 5TISH 5APWA 3RK2C 4GODA 3AL0B 2XNDH 5E3LA 2K40A 1JY2P 5L3CA 1SQQJ 1Q90D 2E7XA 2MSYA 2QM3A 1DGRM 2Q6QA 1EDJA 3HOTA 3H9JA 4A93J 3I56I 4JP0A 2BXYA 3H1IG 5APVA 1BW6A 1SQPG 2VODA 1Y6IA 4A3BJ 1OFCX 5J6XA 5L3BA 3L2UA 1R00A 2EPFA 2HI3A 3BJOA 4G8XA 5D4SA 5ILUA 2HPMA 2EK5A 5TJHA 4RLFA 3O8ZA 5KAIE 3V4WA 4WWCA 3G4SI 3WMM0 2FUG2 1BSHA 2E35A 2BGCA 1OQYA 5DD8A 2FBWC 3PLNA 2OYOA 3H1LE 3NAUA 1KQ9A 3BTJA 3ABKH 1ZXGA 3HE5B 4HA8A 3DKYA 3E6BA 1X3UA 2Z3YA 1MNMC 4UHTA 3VWBA 1NU1E 2M3AA 1VF5D 2Q5UA 2FXMA 5H2FH 2HYGD 4PGHA 1Z77A 3WTUC 1HF9A 1TL8A 1S9HA 3WU1B 2G3AA 1EV7A 1N7SD 4JYCA 2OQQA 2WSEJ 3TSIA 2E76B 1KFMA 3AE2C 2G7HA 2H7HA 1X79B 1Y0UA 1HSTA 2QEXI 3IHUA 1RE4C 3B5NB 3OV8A 4LMYA 5IYBJ 3F8FA 3L71D 1SQVK 1I6HJ 4LFUA 3HGGA 1GK4A 3JTHA 5F1JA 3CDIA 1L3LA 2NRAC 4OWFA 1SD6A 2GXBA 1L0LG 4J01A 1PP9J 2BCCD 3UR3C 2ZVNB 4P5OA 5AW4B 2WB1A 4EM1A 2O1KA 2JKVA 4QMAA 1B59A 2QCOA 3CXHH 1Y56A 2TDXA 1R4NB 1MDMA 2UWJE 1A6IA 2O8KA 4MHGA 4ITVA 5FLVA 1RE3A 1E5WA 1YYCA 2HG5D 3OIPA 1A31A 3U59A 4CCKA 1JTHA 2L9NA 3Q3SA 4L5JA 3CX5D 3IN6A 2PJRB 3U1CA 3FWEA 1HGZA 2L01A 1LTJB 3TEDA 1U78A 2H6CA 4OWRB 2A6EF 3MN2A 1ZG3A 5GTHE 2WPQA 1ZGAA 2E76C 1ZGWA 3L71J 3DPUA 5AVRB 4RGXA 1U7JA 1I3QJ 3LL7A 1SS1A 3IAOA 1WSUA 1TWHJ 3ABLH 4XONA 1C0WA 2BCCJ 4G7HF 2FA5A 3RKQA 1EH8A 3D1NI 3BCBA 1XS9A 3RKYA 2QRXA 1S3JA 1PUFA 3VYSB 5CJ0A 1BL0A 4IPAA 1UB9A 4RAGA 3TOBA 4GDOA 1Z67A 3ASNH 3I0TA 1R58A 4XSZF 2QLZA 1QGPA 4PFPA 1PP8F 1BC7C 4R8HA 4RKUJ 2DK8A 2L4MA 3VYTB 3VYRB 3ZQIA 1GL2B 1YJWP 2B0LA 2CWEA 1MFTA 1QRYA 2HPCB 3E3VA 3FDYA 3AE1C 3T97A 3O8GA 4IZZA 5HDNA 5M1BA 4M6YA 1TLHB 2EV6A 2XAFA 2E60A 3FK6A 5FFZA 5JHFA 1JE8A 1YBKA 2FYUK 2I10A 3VMAA 1NJIQ 5IP7J 3KZIC 4I99C 2KZJA 5B66H 4CYCB 4KT6A 1ORKA 3HOUJ 4UV9A 2QENA 2Y30A 3EUHC 3KP4A 3BT9A 4II3A 4RAYA 3CO7C 4XKVA 5FJ8J 1G3WA 3DBRB 4PV1D 4HJGH 2O61A 3HE4A 3MAJA 1IN8A 2DTRA 1OCPA 1Z3XA 4UUTA 5H20A 5D6EA 4EGYA 1RUOA 1KYOH 4H0LD 1FOYA 4GYIA 2JR8A 1P84D 5AW0B 1SQXD 1F43A 3E1IA 5BNGA 5DYMA 5LBQA 1Z21A 1NG7A 4XOPA 4ENJA 3BZ6A 1QPIA 1KQGB 1M1JA 3OYHA 2WVRA 4EDFA 1GL2C 2OZUA 4OU0A 3G1MA 2X85A 4UVAA 4A0YA 1LFUP 2M5AA 3I59A 4QPOA 2P0WA 2ZB9A 2WSFJ 3CWBE 4NNJA 3PO3J 2H8PD 5KLVD 4NC6A 2FYUE 1X3ZB 1KYZA 4EVIA 2C0WA 1S7EA 3T0YA 1WZ2A 2IS1A 2ZCWA 2DFIA 1AVYA 2HTJA 3L2RA 1ULYA 2KDZA 1H8AC 3GW6A 5EEAA 3IKTA 3F0CA 2P5LC 3DWLE 1N77A 5F64A 1CI6B 3K70D 3P9CA 2R7XA 4OIRF 4EV0A 3FXQA 1U0JA 1KILD 2OTLP 1LFPA 3KIOA 2VLAA 5B5EH 1SQXJ 3S2DJ 1QBJA 5DCMB 1BCCJ 2LDUA 1M8OB 4U3FG 1IW7F 2BYVE 3OL3A 2IRFG 3CO6C 3HHGA 1MMDA 4C3HJ 4R4LA 1V5GA 4ZH4F 1B1BA 1TQIA 1Y8RB 4NQWB 3JR9A 3CCMI 4CUGA 3BVHA 3ULQB 1SP4A 1V55H 2ELHA 3TW7A 5KLVJ 3GFJA 2F5EA 4XL9A 2L7KA 2RMZA 4DYQA 4LOCA 4A0ZA 3H35A 3IFMA 1PP7U 1E79H 4YEJA 3JRBA 2QM7A 4HAMA 4XM3A 4N3YB 3F72A 5B1AH 4E7JA 1T33A 1RF0C 2OZ6A 3H9GA 1T38A 4CDGA 1G3TA 1HOMA 1SQVG 3GMAA 4RESB 2X1DA 4G94A 2DFEA 2CH0A 3PH0A 1W2EA 1OISA 2YMYA 2XPWA 4Y15A 3BG3A 1YX3A 1SFEA 2EFOA 2LR8A 2VKHA 4M73A 2YSRA 4OMYA 2WPRA 3HOWJ 1RPWA 3BJAA 3K1MA 4Q47A 5FKKA 4IL6C 1NHLA 2BE5F 4UVBA 4U88A 4WXHA 5E1XA 1BDDA 1ZHFA 3C2BA 1J09A 1RHZB 2IGOA 3A4CA 3RIRA 3TGUD 1XSDA 3L72E 4I7HA 2KFDA 1GK6A 1KGSA 3U9GA 3CX5H 1I27A 2A6TA 3F23A 3KETA 4NPDA 5AW1B 5C39A 1FDMA 3ONQA 2AO9A 4HQMA 4HSRA 2LP0A 4D1QA 2E2HJ 2QF7A 4L5EA 3BQZA 1PJRA 4QWQA 4XICA 5BOXA 3HTKB 2F4IA 1VQPP 2LNBA 4L9NA 2YPRA 2A5WA 1HQCA 1WWXA 2Y0SA 3I5UA 3MD0A 1JHHA 3MMYB 3V7RA 2WTYA 2W1OA 4KUMA 2QJYC 2RNGA 1TU3F 3R60A 4GGGA 1IV6A 2X6XA 1SQPD 2EINH 1W1WE 4IF4A 1FJKA 4JYKA 1PPJG 3M9QA 1IV8A 4BBRJ 3AECC 4BE2A 1W7PA 2R44A 2LOOA 3TGUJ 4FQGA 4CH7A 2EB7A 1NTKK 1IO4A 3DEWA 2NXNB 1ETOA 1UCRA 1PIXA 3NEUA 4C7NA 3C18A 4A7PA 3L75E 4UUVA 1F5TA 2P5VA 2FYUG 1VQ5P 1AA0A 3DLLF 3W6JB 2WSFH 3M91A 3F8NA 2VB6A 1J75A 5HLHA 4GKGA 2E71A 2HXOA 2CSOA 3H1IJ 4DW6A 3HOSA 3L73G 3U21A 4IL6X 1SQPJ 2KXPB 4M6VA 1ZRTD 2VL8A 1HJBA 2QKLB 3AEEC 1YHQP 3FISA 2DODA 4Z2YA 3PNVA 3L74G 2QSHX 5DV5A 3PM1A 2OYHB 1A36A 1X2NA 1U2WA 2GIVA 3NRVA 1I1GA 3FMQA 1MMGA 5CQEA 4C2MJ 3CJRB 3CESA 5A2QZ 2X51A 3EWKA 3L2CA 4ENNA 1W5CC 2VQCA 2K4BA 1RESA 2IW5A 2FBKA 1TQMA 4WY4A 2E43A 2LREA 2R92J 2W7NA 1DU0A 3LMMA 4ON0A 1ZK8A 4M3DA 5KAFC 1NTKE 2ZT9B 2XUBA 2PQ8A 3SDBA 2M0MA 1R7JA 2W84A 2PEXA 2LY9A 3ESWB 4IRGA 2H27A 2BXZA 1LDJA 2Q1ZB 2OGUA 3BPXA 5AVSB 2Y69H 2VJJA 2DA4A 4RDUA 1XSXA 1BJAA 2JJ7A 5F6FA 2P6SA 5KHDA 3IRQA 1SMTA 2P2UA 5F1RA 3F9KA 2NYXA 3PIPF 5BVZA 3PFYA 3V2NA 3T8RA 3H32A 4M3FA 1YG2A 5C44J 2FSWA 2NVUB 3KEOA 2ISZA 3QPLA 3K4JA 4XLAA 3K69A 2WAEA 2Z5IA 1L0LJ 2VASA 5JLXA 3NFQA 3JRHA 2L9SA 1SAXA 5GADJ 3P7NA 1AQ5A 2E36A 2ZJ2A 2R5YA 2ZKZA 4KYWA 3N05A 2FOKA 2C6YA 4DIQA 1OJLA 3N4XA 3BCCG 5GTIE 1MBGA 1OXZA 2YXRB 3A0BC 2HNHA 4I09A 4L9VA 1UZCA 4N9HA 3AG4H 3C7JA 3RQIA 5LGUA 2K9SA 1DP3A 1E3HA 1BE3G 3MP7B 3PO2J 3HRNA 2PJPA 4BRYA 3C1DA 3LAPA 2ELKA 2BVMA 2F5FA 2H94A 2KJBA 2RVCA 3TMOA 2VBZA 1AU7A 2ICWG 2KNCA 2OF7A 2R5DA 1YIJP 3J81Z 2A6HF 4IQ4A 1LTAC 1HUCA 2K85A 1FAVA 2LXCB 4HPQA 2YKQA 4AIJA 5CJ9A 2G0EA 2XDJA 3LIEA 2V79A 3AG2H 1KV4A 3OJAB 3X2QH 1YJWI 5E20A 2HDWA 2CUZA 2V1DA 1F9NA 1DH3A 2Y0MA 1ETQA 3KQGA 3QYBA 2BHZA 1FYLA 4AWXB 3CCLP 4IHWA 4HG2A 4HOBA 1S5LC 4IRHA 5GAEJ 5J1RA 1T95A 3T5XA 3AE9C 5KTBA 3BR1A 4M74A 1IUFA 1IZ1A 3V4GA 4A6EA 5KJ7A 1RF1A 1P7JA 2Z1DA 1QL1A 4XE5B 2K3RA 1NU1D 3W2AA 1K9MQ 4RGRA 1YS7A 3VOPA 5D5UB 4A0XA 2E75D 1BDCA 2BY2A 4MEXF 4M3EA 3NQOA 3M3YJ 4H4KC 2VQLA 3PJRA 2DFFA 3CUQA 4OIPF 3D70A 2COMA 2A07F 3OAKA 1OKRA 2HR3A 3KYCB 3VDXA 1HDPA 2WAQA 3KEYA 2A06G 4YG2F 1SQQG 2BZTA 1NTZE 3E5XA 4RGSA 2QM8A 3CMEP 4Q4ZF 2Q2EA 1HJ0A 2LD5A 3LOCA 2CQQA 4XQFA 4WCGA 5D8KB 4LG0B 5BU5A 3IV5A 4PJ0H 4WXCA 2LR2A 3HUSA 5FROA 3V42A 3B73A 2K3PA 3I56P 5HVQC 4WVZA 4A2UA 2DN0A 3MWMA 3CL3D 1UHMA 3A03A 2LFBA 1PZQA 5CYVA 3O6QB 3L36A 2RKLA 2CQ7A 2KIMA 4RB1A 3G1LA 1PDNC 5CVUA 3SFIA 2MJZA 4XKCA 3ELKA 1PGJA 2LY1A 2OTLI 1YS6A 2L91A 4KN4X 3J7AY 2LRDA 3BC8A 1FOWA 4IHVA 4XLCA 3QPHA 1S5LX 3I4NJ 1JOCA 3KDPB 3C2HA 4X6AJ 1IRGA 2JSPA 1FOSE 2BV6A 4H44B 2CU7A 2XGDA 1SQVD 1B8IB 2P5KA 1OZHA 2JZYA 4WY4D 4XKBA 3Q2YA 1DPUA 3V8LA 5AVXB 1KONA 1H88C 5E8GA 1YX5A 3RBZA 1NWQA 4DZJA 4U87A 5TISC 3BASA 2RDPA 3IF4A 5AW8B 3TDKA 4MTDA 3F22A 1TWCJ 3K4NA 3VFZA 5K7ZA 3FMRA 5DM7F 3DPTA 5FKOA 3CCUI 2QEXP 4L76A 3LQQA 5AIQA 3GLMA 4OINF 1VQNP 1QZZA 3GF7A 3F8CA 2ZXXA 1QVGO 1OCTC 3VODA 1LP1A 4YELA 5CKTA 3N4MA 1R1VA 3KE2A 4M3BA 3H5AA 1HWTC 3H5NA 1FOKA 3DF8A 2HZDA 3D71A 2QSGX 3RL0D 1T6SA 3OS1A 4I0AA 5CPRB 2O01H 2DQRA 3QWLA 1SQVJ 2F48A 1B72B 1LFBA 4BJ6C 3HKZA 4XK4A 2LKPA 4UVCA 1JHFA 1YJNI 4KT5C 3RI4A 3KYLA 2CQKA 1J1DB 1G2CA 1IC2A 1KU3A 4AU7A 4XORA 3LAJA 1KFNA 4H44C 2M87A 1JO5A 3CX5E 4LITA 3LW5J 2V1NA 4JYBA 3PRJA 2DK5A 2KZGA 3R4YA 5H2FC 5CCHA 3S4RA 1IN5A 1AOYA 2C9LY 4TT3H 4U0WA 1ON2A 2Y9YA 5IYCJ 1MH3A 3Q5FA 2MD0A 5AW5B 1H0TA 3QODA 5AW2B 3GHGB 2EH3A 4YXDC 1B6AA 5M3FJ 1XCBA 3CWBD 4XFJA 1SAUA 3QU3A 1X4OA 1BC8C 4AM3A 3BCAA 1MJBA 5E17F 2FYUD 1I3AA 5FKNA 5DM6F 3J80K 2NPSD 2ZYDA 3L35A 4BJ5C 2Y0DA 1VQ6P 4J19A 1S9KE 3F3XA 2LMDA 2FJ1A 5CCGA 1L0NK 3CC2I 2KS1B 1MSEC 1G4DA 3GTOJ 3MKWB 5E3NA 2KRHA 2N1TA 3KZIE 4CXFA 1E2XA 3DEEA 3TO6A 3SQNA 4N4NB 3WHCA 4N4OB 3L74D 1Q81Q 2D2CD 2K3FA 1EF4A 2EA4A 3ISPA 5B3SH 5F08A 2LBFB 3V8JA 2PLYA 4C2TA 5C4JJ 3ZDMA 1BI2A 4RJTA 1I1SA 2GUSA 1JM0A 1Q1HA 1LWUA 3LNQA 3CWBJ 4Y3OA 2RC4A 2ZAEB 3GF2A 1QZEA 4LIUA 2P7VB 2FYUJ 3ABTA 2YX7A 2OYIA 2GZWA 2D2WA 1UHSA 3M1EA 2LK2A 3DLAA 2R93J 1RI7A 2QIWA 3AEGC 4AIHA 2UZKA 3GF3A 4ZYAA 2HFHA 3HOYJ 4PDKA 3L73J 5HS8A 1AHDP 3HD7B 4Y99B 2QQ8A 3SWKA 2XPUA 3L74J 3E1RA 3SZGA 3B6CA 1MD0A 3GFIA 2BW3B 3KX2A 3EPZA 4BDYA 2QSIA 1JT0A 1FSHA 2ECBA 1U9NA 5FD6A 4NC8A 2D1HA 1ZOYC 3TQNA 1O4XA 1GDTA 1EC5A 4ZYDA 3USSA 1YTYA 4U7JA 3E97A 3G2BA 4D6TE 2VKDA 2XAUA 2W83C 2Z9OA 3Q0UA 3VPRA 3H5RA 5FB2A 1M56D 2M7BA 3SSUA 1NK3P 1D3YA 4ESJA 1SC7A 3JC22 3BZCA 5B66C 1HKQA 4W97A 2A45I 3A2AA 2MC3A 2OAZA 1MNDA 3DXJF 1BE3D 3H1JE 1K78B 3TOAA 3S2WA 2X4HA 3HPHA 1RH5B 2MD5A 2KZVA 3RDIA 1SD5A 3U1KA 4YFKF 1X4PA 2K7LA 3TBIA 2W6JH 3CCMP 2M45A 2XV4S 2GLOA 1NTME 2Q0OA 2F6CA 3WG7H 5KLIB 2AEFA 5IYDJ 4LLGF 1BI1A 1IK9A 4A3EJ 2JUCA 2HQAA 4QIWN 1D5VA 3G71P 4IXAA 3BTLA 2O5RA 2DDBA 1CF7A 3GTKJ 1VF5B 1PGOA 1Z56A 4KHXA 1LGHB 3VTPC 2ZXJA 2P10A 2MYSA 3DV8A 3R0JA 1QGKB 3LW5H 2Y2ZA 5FLXZ 3KPEA 3BCCJ 2I8DA 1N7SB 1BIAA 1K7AA 1SQBE 3PUBA 3WTZA 2B9SA 1T56A 3LA2A 2KISA 3H0DA 1U5TB 5J1UA 1BE3J 1OIPA 4BE0A 1SVOA 3IC7A 1ETXA 4YIIA 2NVQJ 1XD7A 5HDGA 4E7IA 3L75D 1GU4A 2FYZA 3LFUA 2BBYA 2V1XA 1HLVA 1P92A 2DW4A 2ZMEB 4DBQA 3ZQGA 4IL6E 5DJUB 4P55A 5J4YA 1SEUA 3K7AJ 1L4AC 1S7AA 3HM5A 2F5VA 5J47A 2K9JA 2ZYGA 5B5EC 2V7QJ 4IFMA 2EZLA 2XKMA 5CCHD 2QQBA 1X58A 2ME0A 3NWSA 2RH0A 1IRFA 1VF5C 2BHYA 3AEAC 2V6CA 1X1BA 1Z0XA 1FIAA 4HX8A 3FBNB 4V2FA 1ZG1A 1VL2A 1P9QC 4JK1X 4GXOA 4C30A 1KTMA 2O9LA 4IFFA 3G6EI 1N7SC 1RE4A 2FQ3A 5CBNA 3CXHI 1NTKD 5DJTB 1O7LA 2L54A 4WK8F 1U5TC 1ZW0A 5KCMA 1JB0J 2WZ7A 4AUXA 2QWWA 1FYKA 2W25A 3CMEI 1NU1K 1U57A 2V7FA 1H89C 1OYIA 3OSGA 1SFCC 5H6QA 3UNGC 1UMQA 1JJ6C 1RR8C 1JUSA 3EETA 4EJVA 5EG0B 1IZNB 1L0NG 2N1TD 1KQ8A 5J8FA 2FX0A 1ENHA 2Q1KA 5M5YJ 3BRTB 1JT6A 1X9VA 3HE5A 3RK3D 4M9SA 1RZ4A 1BOAA 2HWVA 1H9TA 1G3SA 3F8MA 3O3KA 3DBLB 2O3JA 1RY3A 1YE9A 1LT9B 3A01B 5AVUB 4L9JA 3TP3A 1FIPA 1U9OA 4A3KJ 3QPTA 2FFDC 3FGAD 3Q3DA 4IKFA 3Q9SA 2EIMH 5CVVA 1LVKA 3T8TA 3N97A 2PRRA 1CW5A 1GW4A 5LRRA 3CMAP 2R7QA 1Z3YA 4KISA 1W5CE 2O03A 1DEBA 3K6GA 2JRTA 1JCDA 1Z91A 4PV1B 1ACIA 2ZSIB 1BR1A 1UJ8A 1FZBA 2AEJA 4R79A 5KAFE 2NOGA 3I3LA 4H0LB 2VT2A 2X6OA 2QVOA 5ICGA 4X0GA 4V19K 3BTIA 3AL0C 1PGPA 4KIFA 1URQA 4TLFA 1KB9E 1LDKB 1DGWY 3IWFA 1BR4A 1WH7A 3H1HE 4ESBA 3V6IA 2RN7A 2DU9A 5AW9B 3QOPA 4EJWA 1GLNA 4PJMA 4I2LC 1VQNI 2QYOA 1R9TJ 2J5OA 3R6SA 2PJRA 3CP8A 4BXFA 5AVWB 3CC4I 5ED4A 2DOFA 3OWTA 2HOAA 1LT1A 4OGQD 3OOPA 1T2KC 2WADA 2ESNA 3WTXC 5BMZA 2PFXA 2WMMA 2IFMA 1MMNA 3L2WA 4LD5A 2E74D 2HOTA 3MFKA 1ZLLA 2JO1A 2OPTA 1XTGB 3H1KE 2R7FA 3CCVP 1FZGA 4C3IJ 2IAIA 2JT1A 3PNYA 5HNHA 2ZJQF 5EDNA 1KILB 3EQ2A 2KQRA 3H9QA 4PV1C 3W6VA 1VQOP 3A0BE 2R7VA 5HNFA 1G8XA 2TCTA 4OIQF 4H0LC 1L0OC 1CSBA 3VSLA 1O3RA 1FY7A 1P4WA 1SD4A 4UXNA 2V7QH 1H0MA 2JEEA 2BY3A 3S9OA 3NARA 4WBAA 2A69F 4Y13A 1YW7A 3B5NC 5E3MA 3AG1H 3FHNA 4XLPF 2M4KA 3L70G 3WU2H 4AYCA 4A6DA 4ESFA 1JY3O 3ABUA 1VQMP 1GU5A 2MA3A 3MEXA 2L5QA 1KU9A 1H8AA 1IN4A 1X19A 3OL4A 2UXXA 4NDLA 4CCLA 4XLNF 4ZMDA 2R4GA 3DTIA 1VQ6I 4MFEA 3RPQA 5E3OA 2K5CA 2DMQA 4PD4H 1VDFA 4K35A 3L00A 4GDFA 1S5LE 4P1WA 4YFNF 2J5PA 4BS9A 2B9BA 2OTKE 2YMKA 3K70C 3TP0A 5LD2C 2HYFA 3DPLC 4Z6YA 3CLOA 1OVRA 5GP9A 2IA2A 1KILC 1D1CA 1ZG5A 1N7LA 1LPQA 1MDMB 3KP6A 4EJOA 2NRGA 1LTJC 2Z99A 1G59A 3QRFF 3W3CA 3L2QA 3N7NA 4A69C 1NYHA 2JA7J 3DKXA 2IBZE 2MLKA 4OAZA 4BHPA 2MABA 3ZQFA 3L37A 1BI0A 3M9HA 1XTAA 2HGCA 2CW8A 1FT9A 3TW6A 1RF0A 2P6TA 2AHQA 3GLLA 1XDSA 4PZJA 3ZMVA 3JRIA 1ZLKA 2PBIA 2NVXJ 4BNCA 3H1LG 1DD3A 2VBXA 1R4MB 3DCFA 3DU5A 3M1CA 5ERIA 3RTRA 1PUFB 1FZPB 1DD4A 2MG4A 2EFNA 1JEKA 1NU1G 2I1KA 3Q5RA 3TK1A 2HDCA 3SHFA 4ZKUA 2EV0A 3I54A 3CPWO 2HQNA 1Q1VA 4Y7NJ 4PJJA 1OX3A 2L9VA 1X1DA 3HGYA 2QUFA 1W4MA 1HKSA 3BPVA 3CCEP 1ITYA 2H88C 2E42A 2M2EA 1RRJA 1MIJA 2WSEH 2WAFA 3E6DA 4XLFA 1Y9BA 4EI2A 3SDGA 5C3EJ 1AKHA 3ZN0A 4PSXA 1N78A 4HKZH 1FC2C 2Z4EA 1IFNA 1WJAA 4MQ9F 4A3FJ 5FGMA 2FE3A 2GA2A 3K10A 1K83J 2JRMA 2W24A 2AQFA 2XRNA 4CCOA 2P7CB 3U1AA 2VJ5A 3CCQI 2QBYA 4CSWA 2ZJRF 2DJIA 3EYIA 1FZEA 1ON1A 2NZ2A 4FETA 2Q9IA 4B3XA 1OCCH 3Q0WA 5TISE 5DCFA 3F6VA 5APSA 2FBHA 1URQD 4IOIH 2DO7A 3DKWA 5AW6B 3GTJJ 3G71I 1GMJA 1FDOA 2DDAA 1YQ4C 4GT1A 2M8EA 1AWCA 3FMSA 1W5SA 1S9KD 1N73B 3M4OJ 2M5AB 3CCUP 1NKNA 1T0FC 2KYVA 4PJ0C 3VP9A 5K1YA 2KP6A 4C3JJ 4CGZA 3JRFA 2MW8A 2OD5A 4KFCA 1Y1WJ 2RAEA 1STZA 1E3OC 2Z5HA 1S1CX 4GOFA 4E7ZA 4XN0A 5CLSA 1PGQA 2MH9A 3B8EB 3MTUE 2EZHA 4L73A 3CJQB 2L7FP 2Y48A 3TO7A 1TW3A 3QQAA 5IT9Z 4UB6H 4HV5A 1GTWA 1MMAA 4BACA 1WJ5A 5DD4A 4XRMA 2NNYA 1DEEG 2O1JA 3LIDA 2CFOA 1VQ4P 2WTEA 1ERDA 1ZV8A 1YJNP 1HW1A 5IY5H 2VC0A 3ZQHA 1U3EM 2JWTA 3F5HA 5H2FE 1XGSA 3COAC 3ZMTA 5HLIA 1MJAA 2HQ5A 3NTNA 1SANA 4MGRA 4UB8H 2WB1N 3C9IA 2M1BA 1ZP0C 2JPCA 3FF5A 3WE2A 2R5ZA 4HF1A 3ZQCA 4XRFA 1JY2N 3KYDB 1J2JB 3CDLA 3CCRP 1N73C 5CJ4A 1NGMB 1EA3A 2H09A 1KC8Q 1L0ND 4Q5SF 1FMWA 2DMPA 2M34A 3MKYB 2WT7A 3I64A 2HODA 2SPZA 1HBWA 2XB0X 3GFMA 3LSMA 4B1RA 3C1LA 1OVVA 2H8RA 4EM2A 1X1AA 5K7HA 2P7JA 5GAGJ 1HF0A 2LLKA 1Y8QB 4OVNF 3HSRA 4ANJA 2POHA 4D6TD 5ICCA 3QPSA 2XZRA 2Y31A 2JWAA 2OJED 1YO5C 3BG7A 1N75A 3CXHE 3CC2P 2DA6A 4Y4RA 4I6MC 4A3GJ 2NAZA 3HC7A 1IFDA 3EDPA 1UFMA 1MZ9A 5AW3B 1MGTA 5J8CA 3BG5A 2RNJA 4C7RA 2VI6A 4XNFA 3OYKA 4O9BA 1EXIA 1ZMEC 1YTZI 3CWBG 1TW2A 1KYOI 1A02J 3ZMUA 1IRZA 1FDIA 1QX8A 2XDVA 1L0NJ 3M06A 2PMZA 3S3MA 3GTGJ 2VQGA 4MTEA 3P5JA 3CI9A 3V7CA 1W36D 1EZVE 2QQAA 2M0CA 3H92A 3D5RC 4HLYA 4HH2A 1N2DC 3HJEA 3IH2A 1IG7A 2J5UA 5AIPA 2QJPB 3PHLA 1R8EA 3HXLA 1EDLA 3HUGB 3RKWA 3GXOA 4EM0B 2CG4A 2IX7C 2KIKA 3M9AA 3PNTA 4CO8A 1H9GA 2X1EA 1FS0E 1O7FA 1R5SA 3CMAI 1IK7A 5F27A 1ZTRA 2E75B 3M7GA 1PV3A 5HDKA 1X8YA 4D9JA 2FNAA 1SQBD 1GUUA 3AG3H 1P84H 5AVVB 3DEUA 3G9RA 1D8JA 3SEZA 3H3ZA 4IOAF 3OYJA 1T8ZA 3BWGA 1ODDA 1ZRFA 2YNYA 2AXLA 3QOEA 4IHSA 1KQFB 2Y9ZA 1HH0A 2XAJA 2GBYA 2H1KA 1WRGA 5A2QK 2LKMA 2LTPA 1ZLJA 1R5GA 5TJJA 1JY3P 5GAHJ 5LHHA 1WH5A 2B87A 2EFQA 5B66E 1IO2A 3I4MJ 3HL2A 3SFEC 4MN4C 4C7NB 1TT0A 1RKTA 1WI3A 4CA0A 1FYMA 2YR2A 4D7NA 1K4SA 2DXIA 2JP3A 1S6LA 3BG6A 3TGNA 3P9IA 3FXKA 2VOOA 3JCUH 3IAM2 3L70D 3CCVI 1MBHA 5D4RA 1IDYA 1YOVB 2OYHC 5IOZA 2DAOA 2L4AA 3ZRGA 5HODA 3CF5F 1VQOI 4DCKA 3WODF 2XROA 1JUNA 1LTSC 2ZFWA 4ZDPA 4D5FA 1YRNA 2QA4P 4L18B 3MHVA 2VN2A 3SWFA 3L72G 1WJCA 3E7LA 4JX5A 2HYNA 2ZT9C 1GT0C 4WY4B 2L9RA 1SFUA 1MBKA 3BR0A 2P8TA 5KNLA 4B48A 4DGWB 2DW3A 1USSA 3JSVC 1MZBA 2Z5UA 3VEPA 3JRAA 1VQMI 1P4XA 4JQ0D 3FXLA 2DA1A 4DJGA 4HX7A 5E1WA 1KYWA 5FRNA 2K9YA 1OR7C 1NVOA 4JOMA 2PMHA 3A02A 1NTZK 2Q3EA 3L70J 3GTPJ 2W85A 3WTYC 3S15J 4AC0A 5B5EE 3HYIA 4ASWA 1VF9A 1FX7A 3OYMA 1OYYA 1X1CA 1OCRH 3H32B 2XAQA 2Z16A 4U0VA 2DTZA 2M30A 3FXRA 1YITP 2XKPA 1PP9E 1DX7A 3WGHA 2KB7P 2Y75A 3K9TA 1IRXA 5TRDA 3RL0B 3DTEA 4MIMA 1P6RA 4CZZA 2JVHA 1M57D 2KOGA 2FU4A 1SD7A 3CP2A 4BQQA 4JF7A 5LGNA 4A3DJ 4IO9F 3L75G 2R5YB 3H1LD 2D1VA 4AD9A 4DNCA 1BW5A 3RSNA 1T39A 3FXEA 2WWWA 3E1SA 3ZN1A 3IL2A 1OWAA 1RETA 1XG1A 2YKOA 1FBQA 3HRSA 4BAYA 3G6EP 3H25A 3BROA 2D45A 4N78E 1KQLA 1X2MA 4LB6B 3ZPLA 2IA1A 3HOVJ 3L71E 3O2PE 3KP5A 4XOTA 5BS6A 4BRYB 3HSEA 4XMYA 2W6AA 1OW8A 2KNCB 2AXTH 2EFPA 3HPGA 3GTQJ 2BCCE 2IDBA 4B44A 2LG4A 5LRSA 4HF2A 3AAFA 1IXSB 2DYSH 1W7PD 1Z7UA 2EZIA 1K73Q 2NPSB 4KITB 2D5VA 2FYNB 2V6EA 3ERMA 2JPBA 2Y0SN 3WGIA 1JKQC 3H1LJ 4NC7A 4ZYHA 3BRVB 1T3UA 4KN7X 1HW5A 1NTKG 3M0DC 5E18F 2ZNZA 3CCEI 1SVMA 1O3TA 1NU1J 2LXBA 5IPAA 1QVUA 4DYCA 4EATA 3H1KD 3RL0g 3OYGA 4XBFA 2QQ9A 6PAXA 3ECHA 2DT6A 3CTAA 1LTBC 3SEQA 3HOXJ 4EJUA 2CFXA 1V5FA 2QKMB 4F55A 3RZDJ 3UIAA 3OIQA 4ASVA 1Q7YQ 4AUWA 2D2CB 2QGUA 4G9YA 1CQTA 1RF1B 2MFZA 2K9QA 3FZVA 4BXXJ 1IFIA 1FU1A 3MIWA 1APLC 5KK1A 1I50J 3LSIA 1GV2A 1KZHA 2MBFA 3TDZC 4U0YA 3I71A 1D7MA 1KB9I 3M8EA 3J7YJ 2GA1A 2XHKA 3CUQB 2VBYA 1I39A 2WQYC 5LHIA 1RKWA 3TNUA 3QWOC 1FBMA 1DUXC 2UUZA 2JK3A 3BR2A 4AYBA 2NPSC 5ILVA 2FYNC 2WPVB 3MUDC 3BZKA 2R7RA 2Q2EB 3LSTA 2KRFA 2NVYJ 4CZCA 4OH8B 3HSFA 3CF2A 3GZ5A 2L7MP 5JFRA 1W0TA 2HDDA 3PSIA 2Z2SB 1FBUA 3AE6C 4M6XA 4BU2A 1HDDC 1MJ9A 4CYDA 3HUSB 2FBIA 1AVOA 2ACJA 3EUAA 2NVTJ 3CC4P 2XASA 4B86A 4BXUA 3C3WA 4L0YB 4A5NA 2D2CC 4BKXA 2IYOA 4DOJA 5L3EA 5LLQA 5LHGA 1FWZA 4H13D 1RF1C 1DU6A 2YUSA 1DP7P 1VQ4I 4W7YA 3BDDA 3I5CA 1R6RA 1ZARA 1GW3A 3D6YA 3FX3A 1VQ8P 2E5ZA 4BQNA 3CUQC 3ZMSA 3HTUA 3Q5SA 1SQXE 2HYJA 3V8KA 1J5YA 1BCCE 5LEJA 1XSVA 3RCOA 2E5YA 4PSWA 1TC3C 3GYHX 5IOYA 1IAWA 3O6BB 4WX9A 3L09A 3CCRI 1WJEA 4R1HA 3OR2C 5E79H 3L2VA 4S0HB 5J1YA 3BQYA 2E19A 3FKJA 3MQ0A 3MVPA 4B8XA 2N9BA 4HB1A 5KLVE 3IP4B 1TZLA 4HLXA 1OVUA 2VXDA 3M9BA 2JQ7A 4FTHA 4X1EA 2KRCA 3S1RJ 5LFAA 2P4WA 3JAMZ 2LBFA 3WTWC 4MNUA 2KPMA 5C4XJ 1LTGC 4EOTA 3GTLJ 4BE1A 1WHUA 3K4BA 2L3DA 4LB5A 1NTZG 3S2HJ 1QL2A 1KILE 1YYVA 1TQPA 4BGDA 2V4JC 1G6NA 3I55I 4L5IA 2HFED 5JI6A 3MKZA 1QQIA 3SWYA 5CMZA 2IBZI 1J1DC 2KUBA 2LKXA 4YTPC 4KJMA 3J80Z 4C2UA 1RIOH 1K6YA 1HW2A 3IH4A 1JJ8C 3FIWA 5KAIH 3OS0A 2J59M 3BOQA 4ZJZA 3M07A 3Q0VA 4Y52J 5KJ7D 2DBBA 1G2CB 4WF2A 3S14J 5L8RJ 4E7KA 2IYPA 3S16J 1NTCA 4HNTA 3K1NA 1JTXA 2EWNA 3LSRA 2W48A 2XC7A 1KYOE 2VPRA 4GCVA 3A2KA 4AQRD 2WSCJ 3GHGC 1JY3N 4M3LA 3ROUA 3P9KA 4E6KG 5APYA 3KEQA 2N8GA 2DOAA 2WA0A 3WU2C 2PFBA 3TL4X 2W82A 4YPCA 1LNQA 1H0TB 1LE8B 2X6YA 2OQRA 3O8HA 1Z6TA 2FNPA 1NTMK 5D5WB 2ESHA 4E7SA 3FM5A 2ZJPF 5EGOA 1UAAA 3HB9A 2K27A 1D8KA 1FP2A 1L4AA 4EMSA 1USDA 1D0XA 2FQ4A 3GZ6A 1K78A 4Y28J 1GVDA 5DS9A 4KICA 2OQGA 1FSEA 2WAQN 4LK0F 1FC3A 1V4RA 1F1ZA 4M3GA 3FK7A 4B3AA 1VQ7P 2ZFUA 1WJDA 1SQBK 3TGUE 1HA8A 3OYAA 4BHBA 2DT5A 2N1TB 3II6A 1A6QA 1BI3A 2GXAA 1Z1DA 4UUSA 1EJ9A 3KYQA 4WB4A 2YXQB 3LSGA 3L72D 3RK3B 1OW6A 4O5VA 1OW7A 4FCYA 1PL5A 2HS5A 1TTYA 4F52A 2CK3H 1LWUB 1M1EB 1P4AA 3I9V2 2IPQX 3FX0A 3CCQP 1K8AQ 1N7SA 5GTHH 1KA8A 2O6GE 2GOXB 3BG9A 3VOEA 3OYCA 1EQ7A 3H1IE 1U5TA 2C0XA 2KHMA 2IXSA 2E1MB 1SQPE 3HD7C 2OU2A 4S05A 2IS2A 4Y99C 2QA4I 1XTCC 1H89A 1SFCA 4PJ0E 3A0HC 4CCJA 1NH4A 3RBXA 1FZCB 4DBRA 3OMYA 3CXHD 2HPIA 2K37A 1UG0A 3FWNA 4PJNA 3L72J 3W2WA 3MZWB 3OW2O 1KZUB 2KIQA 3VN0A 3D0SA 1TNSA 1NOHA 2FXOA 1YQ3C 4ZZDA 5BPDA 1JI8A 2NOJB 1P7IA 5D6FA 3RK3C 2CV1A 4I7ZB 3PIOF 2GXGA 1AJYA 3I4PA 3QP5A 4BEHB 1IGNA 2W8ZA 2N9YB 3ZCOA 4H0EA 2FFDA 1WPKA 2FD5A 2GIZA 1S29A 3WE3A 2IVMA 2DJNA 4YFXF 1YITI 5L3GA 4QTRA 2K88A 4OGQB 2KL4A 4HBLA 4FHTA 4UNOA 1LDDA 1MKMA 2BOLA 3HHHA 3GLXA 2E74B 1ETWA 2E1MC 5EFWB 3EQLF 3DU6A 2PX9A 5KLIC 1L0LE 2L5GB 2M3EA 2L0KA 1CZQA 1GHCA 1WJFA 3AKZA 3JSOA 4O3MA 3K1PA 1BA5A 1PVEA 4CICA 2XU6A 3D5SC 4RB3C 3C8VA 3F89A 2KIUA 1FZCC 5FD5A 5EG0A 3HKZN 4KMUX 1LKXA 4RO0A 3AE4C 1JKPC 3L75J 3RK2B 3DBHB 3IKVA 1IDZA 3WUUA 5CHXA 2CMPA 3OA7A 2VC1A 3VP8A 2UWMA 3EFGA 2M7AA 2R7DA 1YW8A 2KT0A 1T8IA 3AEDC 4P9UA 2ZMEC 3GG2A 4Y17A 5CCGD 4YIFA 1T2KA 3CC7P 2EIKH 4F7ZA 3JSPA 2IJLA 1SMYF 4OGQC 5K5RA 2DOEA 3KP2A 4UB6C 2HZTA 3ZXSA 1IFPA 1EZVI 2VE8A 2GM4A 2E74C 5IP6A 2HKOA 4CCNA 2K9JB 1KU7A 3K4LA 4GYGA 4M72A 2BVLA 4BQOA 4D6TG 2I5UA 1SLQA 4UB8C 2MLGA 3L9FA 4RS8A 1NTKJ 2HQRA 2IP2A 3G3ZA 4F3QA 4EYYQ 5L3DA 3VYUB 4PD4I 1VTNC 3AE3C 3GZNB 3FXDA 3HZJA 3RYRA 3TO9A 1PUEE 1XC5A 3VSKA 3B5NA 3E0JB 1ZN5A 2EILH 4PJLA 1Y0NA 3H1JG 2CO5A 3FM3A 3MD2A 2F5CA 1WT6A 2XNXA 4JBZA 4R4MA 5HOOA 4OMZA 4BJTA 1L2PA 4HYEA 5DEQA 2JTVA 2ME6A 2R7WA 1L4AD 1NTMG 5E1ZB 3JRGA 3GX4X 2ZYAA 4ZTJA 1GXPA 1JMMA 4NPEA 5J4VA 4HDVA 2ZJSE 4E4HA 1VQ9I 4KIBA 4DT0A 3GFLA 4KNYA 1FBSA 1S72I 1MW7A 1GVJA 2RQPA 4ZDLA 1KILA 3ITKA 4ETSA 1SFKA 1SVLA 1PP9D 2GUVA 1AA7A 1F36A 4B09A 3B6AA 3H6PA 1RNLA 2JN6A 1LTJA 1LT9C 1SQBG 3Q9VA 2OUMA 2ZVOB 2FMYA 4I76A 5GPAA 4BXLA 1FJPA 4G12A 2QVAA 3MGNA 3EUHA 1NHAA 2GOMA 1WI9A 2VKVA 2X9DA 4BUPA 3RGUA 1JKOC 3PJSK 3E6MA 3G1OA 3L7WA 2JA8J 2A3SA 1ZH5A 3V7SA 1HXDA 2LC2A 5APUA 3P8CE 3IWZA 5HLTA 1VQ8I 3BR6A 4I2OA 2B89A 1M90Q 2XRLA 1VQKI 4N78D 2DPDA 1M1KQ 3GUDA 3K4CA 5CVJA 2YU3A 2FXPA 4XR6A 4GIFA 4FX0A 5M5WJ 1A02F 1TBXA 3RK2D 1SFCD 3IAS2 3KLOA 1GL2A 2R0QC 1NTZD 5AONA 1E0EA 1IFJA 1RQVA 1JUPA 2RQQA 3HRUA 1JUMA 2K9MA 2O0YA 5H6RA 4EEFG 2P67A 3SFDC 2JA2A 2R32A 2HPCA 1URQB 1NH3A 4U3FE 2K4JA 4IHTA 5BU8B 3R2PA 1V3FA 3VB2A 3EYYA 3CCJI 5APXA 2JA6J 3OY9A 3RPUA 3OYFA 3HBLA 3IRRA 2OC6A 4IRIA 3OYNA 1YI2P 1QVTA 1FTZA 1AFOA 4CYCA 1EXJA 4KIGA 4W7ZA 3U2RA 3QH9A 3P32A 1QNTA 2Z33A 4I02A 2B7EA 1R5ID 3FKIJ 2VONA 2F2EA 1LJ2A 1XGNA 1WKMA 4UV8A 4G6TB 2ID3A 4OOIA 1NO4A 2FKWB 5AVZB 1W2BO 2V9KA 4MO7A 3FXMA 5ILSA 1GXQA 3JCUC 2KI7B 2IBDA 4P96A 3W2VA 5K5GB 1NTZJ 2XGEA 2CV0A 1T6AA 2KIFA 4IFDK 2DI3A 4PGGA 1SQVE 5L3FA 4BHCA 2AEMA 4I0BA 3U1DA 2W90A 1JTHB 4ZC3A 5ICFA 2Q7CA 3AE7C 1HSJA 1Q2NA 3V2PA 4L0ZB 3OSFA 1URQC 4GRIA 4RAFA 4HNVA 2K1AA 2E7WA 3BR3A 1T0FA 3H3VK 3S3NA 3KP7A 3LSJA 4HV6A 1XPXA 2XAGA 2KKOA 2G9WA 2G7UA 2W57A 4F93B 2CPSA 1JNMA 4I01A 4XLHA 3G73A 1FZAA 2O3FA 4L74A 5LGTA 2YU9J 1T2KD 1CI6A 3FBIB 2VOPA 2CPBA 1BOBA 2GWRA 3GO5A 1DQUA 4A3CJ 2IZ1A 3CX5I 2XVCA 3PFIA 2DFHA 3AEFC 4D0PA 3B71A 4B43A 4FISA 1CGPA 4L9TA 5DCMA 1OCZH 5BPIA 4B4CA 1ZN2A 1EH7A 4UY8I 1FZFA 2ZXIA 5CBOA 3H1HG 2IS6A 1VQ7I 1Z6RA 3JRCA 1K6OA 3ABMH 4NQWA 2AS5F 1RE3C 2ID6A 3T97B 2VPLA 3ZMZA 4FE4A 3K5BA 3ML6A 3QYEA 5F0HA 1MMSA 1BR2A 2NS7A 2E34A 3I58A 2VIXA 2XKOA 2E76D 1WMKA 1PPJE 4A3LJ 3K2AA 3PQJA 1BCCD 2ZXWH 3JW4A 1VZ0A 5D5XB 1WGXA 1U8BA 3TYYA 3W6KB 3B5ND 1R5HA 1N73A 3CD6P 2UXNA 2E5NA 3MCZA 3TKYA 2DPUA 2L02A 5GTIH 1S4XA 2RV8A 1OPCA 2V9PA 4DQ2A 1VQLI 2HOSA 1NKZB 3HE4B 3WGGA 3H1KG 1MH4A 3R4KA 1ETKA 2ZFCA 4WWIA 2LYCA 3NXSA 1D1BA 2CV2A 4HW0A 1A04A 5JVTA 1J0RA 2AXTC 2VJIA 2GAUA 5HS7A 4HRIA 1U7MA 1M1JB 3SZTA 2IPPA 2ITAA 4ZZLA 3L73E 2JA5J 1N25A 4LGWA 2X6WA 2Y0CA 1NG6A 3ZR8X 3I53A 2OCEA 3ERED 3I59B 2RGVA 4JX4A 4M9XA 1BBYA 3L74E 1IXCA 1FTTA 2IGNA 4HQEA 4BQAA 4IJAA 1BGYE 2WV0A 5APQA 3WU0A 2R7TA 3LWFA 1MUUA 4L75A 4ZNCA 1ZR2A 2P1JA 1XMXA 4RB0A 1QO0D 9ANTA 5JR3A 1FNNA 1P84I 3FXUA 1TP4A 2H6BA 3RJPA 1K79A 1D0YA 1RUNA 2PGDA 1HVVA 1AKHB 3HTKA 2E1CA 4KDPA 3PP5A 1W36C 1ZELA 4AIDA 4ENMA 1T3JA 3H36A 1KYOD 1TWFJ 4RLQA 2QG4A 2WC2A 3OS2A 1S7OA 1SFXA 1BSNA 3E5QA 2QBYB 1QHGA 5IT9K 3MZ8A 1ZYRF 1KQ0A 1B9MA 5AVYB 1GL2D 1M1JC 2QJYB 3LA3A 1EDIA 3JRDA 3DP7A 2IBZG 1MBJA 2KZIA 3RPUD 2LSOA 2F4OB 4IHXA 2W00A 3GW2A
chains in the Genus database with same CATH topology
2FMLA 4EQQA 3PQKA 4KA4A 2IT0A 3HUGA 2KJCA 4CHUA 3T1BA 1W5TA 2WWYA 5CVRA 1DPRA 4M9ZA 4N9IA 3BY6A 5HLGA 3GWZA 4QLCU 4XSXF 1YIOA 3ZMDA 2HKXA 3LA7A 2YX4A 1J59A 2A68F 4FT8A 4G6QA 4PCQA 1OR7A 3DFGA 3HRTA 4Q48A 5BQTA 3BJ6A 4MQVA 3JTGA 1XMKA 3RKXA 1OYWA 1W7PB 1YLFA 3QAHA 1HBXG 3QU6A 4AVPA 1B9NA 2VT3A 3F8BA 2ETHA 1IN6A 3E6CC 4RGUA 4M71A 1XDUA 4G7OF 1U8RA 2V9VA 5LEKA 2GQQA 3TDUC 1OMIA 2FF4A 2ISYA 1BIBA 1ONVA 3F21A 4KMFA 2NNNA 1BM9A 1XN7A 4HF0A 1J7KA 3KP3A 2OBPA 3B02A 4I98B 4A5MA 3J81K 1UHWA 1REPC 5EEGA 3H3UA 2EV5A 3GEZA 3CDHA 4FX4A 1IF1A 2ZO4A 2K86A 2O8XA 4LG0A 1XGOA 3LFKA 3F6OA 3REOA 1YFHA 1O3SA 3CJNA 1USTA 1LB2A 1LEAA 1LEBA 4RB2C 1QPMA 2XAHA 3LQRA 5DDGA 1S8NA 3DQVC 2PG4A 4S04A 3HTSB 2CW0F 3RYPA 5IT3A 1DDNA 4LLNA 1YQAA 3GVAA 1FLIA 1FPQA 3KZYA 1XCVA 4BH9A 5K5QA 3R61A 1J9IA 2CYYA 1U6GA 1XB4A 4HZFA 2VXZA 2EJRA 1F4KA 2JSCA 1WQ2A 1R36A 2R3SA 3HIFA 4NHJA 1ZAOA 4WXDA 2HTSA 1LQ1A 4ZYGA 3E5UA 2OA4A 1O3QA 4IVNA 4RAZA 4MEYF 2ZBKA 2STWA 4P9FA 3R0AA 4AIKA 2STTA 3D5LA 2ADUA 5JHUA 1EH6A 1P2FA 3KCCA 1YW9A 3MZHA 2IA0A 1IXRC 4ZYEA 4OIOF 4EGZA 1KU2A 3BP8A 2A5YB 1QZYA 1O57A 4A12A 2X0LA 4U7BA 4LLLA 2DLLA 5DUKA 4N0BA 1HKTA 4HDUA 3JAMK 4JBAA 2F5DA 3SFZA 5FO5A 3WG9A 3WTVC 2FEZA 4EJTA 2PI0A 5ICEA 1ZRDA 1T98A 4TV7A 2Q8KA 1ZRCA 2VBWA 5CVIA 3ECOA 2HOEA 5DUIA 3M8FA 2FRHA 5HS9A 2LF8A 4LJZF 1Z05A 2EFWA 2QZ8A 1FP1D 4GO1A 1LNWA 3KLNA 1Z9CA 1XGMA 2V1UA 4G6DA 2ZNYA 2MH2A 2RKHA 3QP6A 1ZREA 4HX4A 2XIGA 3CUOA 1JGSA 2ZMEA 2E1NA 4BYYA 2K02A 2NS0A 1IN7A 1R22A 1I6XA 2BEOA 3FHZA 3SXYA 5K5OA 1E17A 5EEHA 1JXSA 1I5ZA 4JQFA 3WTTC 1R23A 5E8IA 5FLXK 1R1TA 2PMUA 1XMAA 3WTSC 4ENKA 4ASNA 4E70A 2FXAA 3HRMA 3J7AO 3ZP5A 3K0LA 1LJ9A 2M5WA 2VE9A 3MZYA 1B4AA 2DQLA 4O6JA 1R1UA 4U7DA 1CF7B 2LF7A 1ZGJA 1WRJA 1G3YA 1TNTA 5KVRA 3KZZA 2CGPA 1LVAA 2PN6A 2EA2A 4LK1F 4G7ZF 1IUYA 1J2XA 5D8LB 3SZPA 2XGXA 3ZQ7A 5FFXA 4NB5A 5D5VB 3KFWX 4K2EA 1BN5A 3K2ZA 2HEOA 2A61A 5L3CA 2E7XA 2QM3A 3HOTA 2VODA 5J6XA 5L3BA 1R00A 5D4SA 3BJOA 4G8XA 5ILUA 2EK5A 4WWCA 2BGCA 5DD8A 1KQ9A 4HA8A 3E6BA 1X3UA 2Z3YA 4UHTA 2HYGD 4PGHA 3WTUC 3WU1B 1EV7A 2G7HA 1Y0UA 1HSTA 3IHUA 3OV8A 4LMYA 3F8FA 4LFUA 3JTHA 1L3LA 2NRAC 1SD6A 2GXBA 4P5OA 4EM1A 1B59A 2TDXA 1MDMA 4MHGA 4L5JA 3FWEA 2L01A 1U78A 2H6CA 2A6EF 1ZG3A 1ZGAA 4RGXA 1WSUA 1C0WA 4G7HF 2FA5A 1EH8A 3RKYA 1S3JA 4IPAA 1UB9A 3TOBA 3I0TA 4XSZF 1R58A 2QLZA 1QGPA 1BC7C 1PP8F 4R8HA 2DK8A 2L4MA 2B0LA 2CWEA 3E3VA 5HDNA 4M6YA 2EV6A 1TLHB 2XAFA 5FFZA 1JE8A 4UV9A 2QENA 3KP4A 4RAYA 3CO7C 1G3WA 2O61A 3MAJA 1IN8A 2DTRA 5H20A 4EGYA 1RUOA 5D6EA 4GYIA 5LBQA 5DYMA 4ENJA 3BZ6A 2OZUA 4OU0A 4A0YA 4UVAA 3I59A 4EVIA 1KYZA 3T0YA 2ZCWA 2DFIA 2HTJA 1ULYA 3IKTA 2P5LC 5F64A 3P9CA 4OIRF 4EV0A 3FXQA 1QBJA 5DCMB 2LDUA 1IW7F 2BYVE 2IRFG 3CO6C 3HHGA 4ZH4F 1B1BA 1TQIA 3ULQB 2ELHA 3GFJA 2F5EA 4A0ZA 1PP7U 4HAMA 3F72A 2OZ6A 1T38A 4CDGA 1G3TA 4G94A 4Y15A 4OMYA 2EFOA 1SFEA 4M73A 2YSRA 3BJAA 3K1MA 4Q47A 2BE5F 4UVBA 4U88A 4WXHA 5E1XA 1ZHFA 3RIRA 1XSDA 4I7HA 1KGSA 3U9GA 1I27A 3F23A 3KETA 4HQMA 4QWQA 5BOXA 2LNBA 4L9NA 2YPRA 1HQCA 1WWXA 3I5UA 1JHHA 3V7RA 4KUMA 3R60A 4GGGA 4IF4A 1W7PA 2EB7A 1UCRA 3NEUA 3C18A 4UUVA 1F5TA 2P5VA 3W6JB 3F8NA 1J75A 5HLHA 2CSOA 3HOSA 4Z2YA 5DV5A 1U2WA 2GIVA 3NRVA 1I1GA 3FMQA 5A2QZ 3L2CA 4ENNA 2K4BA 2IW5A 2FBKA 1TQMA 4ON0A 2XUBA 2PQ8A 1R7JA 2W84A 2PEXA 4IRGA 2H27A 1LDJA 3BPXA 1XSXA 1BJAA 5F6FA 3IRQA 2P6SA 1SMTA 5F1RA 2NYXA 3T8RA 1YG2A 2FSWA 3KEOA 2ISZA 3K69A 1SAXA 3P7NA 2ZJ2A 2ZKZA 4KYWA 2FOKA 2C6YA 4I09A 4L9VA 4N9HA 3C7JA 5LGUA 2PJPA 3C1DA 3LAPA 2F5FA 2H94A 2KJBA 2RVCA 2VBZA 3J81Z 2A6HF 4AIJA 5CJ9A 2V79A 5E20A 2V1DA 1F9NA 2Y0MA 1FYLA 4AWXB 4HOBA 4IRHA 3T5XA 4M74A 1IZ1A 4A6EA 3V4GA 4RGRA 1YS7A 5D5UB 4A0XA 4MEXF 3NQOA 3CUQA 4OIPF 2COMA 2A07F 1OKRA 2HR3A 4YG2F 3E5XA 4RGSA 4Q4ZF 2Q2EA 4WCGA 5D8KB 4LG0B 4WXCA 3B73A 5HVQC 4A2UA 3MWMA 1UHMA 5CYVA 4RB1A 2KIMA 1PDNC 5CVUA 3ELKA 1YS6A 4KN4X 3QPHA 1IRGA 2BV6A 2P5KA 2JZYA