2GA1A

Crystal structure of a duf433 member protein (ava_0674) from anabaena variabilis atcc 29413 at 2.00 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
b'MNKKTQLLEVIAALPEELVDQALNYVQMLQNPIQITPGVCGGQARIRNTRIPVWTLVAYRQQGAPDKELLANYPGLTAEDLSAAWHYYEQNPEQIDREIAQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein of unknown function DUF433
publication title Crystal structure of (YP_321193.1) from Anabaena variabilis ATCC 29413 at 2.00 A resolution
rcsb
source organism Anabaena variabilis
molecule tags Unknown function
total genus 30
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04255 DUF433 Protein of unknown function (DUF433)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ga1A02
1.20.5.800 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Alr1493-like domains 2ga1A01
3Q9SA 2ELHA 1DPRA 1IN8A 4KICA 3QPHA 3AAFA 3QOPA 2P6SA 4P5OA 2VT2A 3PFIA 2IP2A 3KZYA 4D0PA 3RI4A 3QRFF 3CDHA 1J2XA 1REPC 4RAZA 1KQ9A 1NHAA 4FHTA 4Y15A 3BJAA 2PN6A 2DK8A 2MD5A 4UV9A 3BROA 4WX9A 2HWVA 3WTXC 2W85A 2ISYA 3Q5FA 3I5UA 2IPQX 1IN5A 2KJBA 1K78B 1J0RA 1P4AA 3F8CA 4M73A 1HKQA 4N9IA 1W4MA 1KYZA 1SD4A 3CO6C 4HQEA 4HOBA 5K5QA 4TV7A 4M72A 2Q2EA 2M5WA 5FFXA 3FM3A 1ONVA 2MA3A 1I6XA 1BM9A 4DQ2A 1K6OA 2O6GE 2DW4A 1PP8F 3BWGA 2EFOA 1EH8A 1YTYA 4G7OF 2V9VA 1XMAA 1HKTA 2NS0A 2Y75A 1U78A 1FYKA 3T8RA 4EJTA 1IXSB 3ECOA 1FYMA 1TQPA 1VTNC 1DUXC 2ACJA 2VONA 5E8IA 2CO5A 2ADUA 2EK5A 2ZNYA 5ILSA 1BIAA 1G3WA 4OIQF 2W24A 4RGXA 3NRVA 2JSCA 2VE8A 4CICA 5E20A 4P96A 3P9IA 5CVRA 2CW0F 2QQ9A 5LLQA 4ZYEA 5ED4A 4MTDA 1ZHFA 1IN7A 4P9FA 1UCRA 3H3UA 3KP6A 2M8EA 1Z05A 1XN7A 1BOAA 2QUFA 3MQ0A 2ISZA 5BQTA 3P9KA 3CUQA 3MCZA 4LMYA 5E17F 1I1GA 1OR7A 2B0LA 1TLHB 4Q4ZF 2GAUA 2J5PA 2QQBA 2HTJA 1ZG5A 2V79A 5F6FA 3RYPA 1IF1A 3DV8A 3WE2A 1KU7A 3L09A 3IC7A 3GX4X 4BHPA 3MAJA 2GA1A 4ESBA 1XDUA 3B73A 3GFJA 3N4MA 1Z1DA 4KIBA 3ZN0A 3F6OA 4NHJA 3GEZA 2FF4A 4A2UA 3K1PA 4RS8A 2AS5F 3R6SA 4XRFA 3FX3A 1SFEA 2GIVA 1OMIA 1RUOA 3J81K 5DYMA 5K5OA 1R1VA 3ISPA 4B8XA 1LNWA 2C6YA 4ENMA 1S3JA 3ZMDA 3QP5A 5D5UB 1T39A 4BHBA 4IRGA 4IHTA 3F21A 2RQPA 4WXHA 1U8RA 4AWXB 2E1NA 5E1XA 5JFRA 2P4WA 1ON1A 4KMUX 2EFNA 2FRHA 2PJPA 4IHSA 3I64A 2YX4A 3IRQA 4I0BA 4RGSA 1QZZA 5FD5A 4M71A 4BYYA 5KK1A 2HYFA 3I59B 2DTRA 2UXXA 2QZ8A 3ZMZA 3P7NA 2UWMA 3ABTA 1R36A 3COAC 2YPRA 2FU4A 1MGTA 4PZJA 4DNCA 4FT8A 2ZO4A 4MHGA 3WG9A 5JI6A 1LEAA 5CJ9A 1KA8A 2G9WA 5A2QK 3ROUA 3J80Z 1FBSA 2MC3A 5JVTA 1QBJA 4EV0A 5FFZA 4L18B 2KJCA 2PLYA 1OPCA 4YFKF 4M6YA 2XVCA 4XLNF 5DCFA 4FX0A 5J8FA 3T1BA 2Z33A 2XKOA 3E5QA 1XSDA 1R5GA 5LGUA 3PQKA 1ZRFA 1G6NA 3I71A 5CVVA 4G6DA 2E1CA 4LJZF 5ICCA 3RYRA 2G7HA 5ICGA 4CO8A 3TOBA 2STTA 1BI1A 1UB9A 3TQNA 2O3FA 2GA2A 1QZYA 5HVQC 1KU3A 1P92A 3REOA 4G7ZF 2RVCA 1IN6A 3WTSC 2VN2A 5HDNA 4AIJA 2O8XA 1O57A 4UXNA 4MTEA 2L54A 5BOXA 1PUEE 3GWZA 2PBIA 2HDCA 4HF2A 2M1BA 2JT1A 1WWXA 2WV0A 4IPAA 5FLXZ 1YIOA 2BBYA 1TW2A 1FBUA 2MH9A 1BC8C 4GCVA 4YG2F 1J9IA 4PDKA 1LQ1A 1U5TC 3C18A 2RV8A 4EGYA 2A68F 4N0BA 1USTA 5AIQA 1ZREA 3BY6A 5LGTA 2A6EF 1JHHA 2PEXA 3DXJF 2XKPA 2HZTA 4U0VA 2OZ6A 2CYYA 4BQAA 3RJPA 1XGOA 4EQQA 2H27A 2BE5F 1YG2A 1V3FA 4OU0A 2Q8KA 5IT9Z 4A6EA 1WKMA 2DBBA 4UVAA 1D5VA 1TQMA 1D8KA 2QYOA 1ODDA 2IW5A 4LGWA 2A61A 1E17A 2Y48A 1MKMA 3BOQA 3BP8A 1H9GA 2ETHA 1P6RA 1O3QA 1HW5A 4E70A 1UHWA 1GXQA 1AWCA 3T8TA 1MJ9A 5JHUA 2PI0A 1OKRA 1U6GA 2H6CA 4HLYA 1TBXA 3ZPLA 5BMZA 4FX4A 2L4AA 4BH9A 2KIUA 4EM0B 1W7PD 5K5RA 1YW8A 1YW9A 1T0FA 1C0WA 4ZZDA 2BV6A 1ZRDA 1LB2A 1HSJA 2GXBA 4Y17A 2OBPA 4YIIA 3VB2A 3HHGA 5L3DA 2ZKZA 3CUQB 3HOTA 3M9AA 1F5TA 4EMSA 1AOYA 3TO6A 4UHTA 2A3SA 4B09A 1S7AA 1USSA 2P6TA 3GFMA 3FMSA 4WCGA 2XAHA 1L0OC 1Z9CA 4OIPF 4EVIA 4UUVA 4MQVA 1G3YA 5LGNA 3WU1B 1LVAA 2FEZA 1XDSA 4L9NA 1OYYA 2ZMEA 2RN7A 4Y13A 4CDGA 1I27A 2BYVE 5JR3A 4HF0A 4H0EA 1HW2A 1SFUA 4A12A 2XGXA 4UNOA 4HYEA 1FOKA 1EH7A 2LNBA 3KFWX 1CF7A 4XSZF 1KU2A 2WTEA 5HLHA 2HKOA 3WODF 1YFHA 5HS7A 3FXRA 3ML6A 2EV6A 1GVJA 3LQRA 1P2FA 2XUBA 5L3FA 3WGIA 3R60A 2QLZA 4I02A 4IRIA 1R00A 4KFCA 2CWEA 1JXSA 1TW3A 4HX7A 5LRSA 2DQLA 4P55A 1QNTA 1B1BA 2L3DA 3GW2A 4RB2C 5EEGA 3RPQA 2DI3A 2FA5A 4G6QA 1KQ8A 4HF1A 1S29A 3DPTA 4A6DA 3WTTC 4BHCA 4XBFA 1S8NA 5FO5A 4EJUA 2EWNA 3F23A 3C3WA 5DCMA 2PMUA 2V1XA 4HAMA 1R1TA 1R58A 4M9SA 3OOPA 1IN4A 5DUKA 2Z9OA 4L9VA 4RGRA 4HX8A 5LHHA 1OYIA 5HDGA 3HIFA 4GXOA 1XMKA 1O7FA 5D6EA 2NNYA 2QQAA 3F8FA 3V7RA 2V6CA 2CFXA 2OA4A 3BJOA 2GQQA 4HW0A 4I98B 2MLKA 1BI2A 2WC2A 4NB5A 2F5FA 1XD7A 4NQWA 1FX7A 1LJ9A 2OAZA 3DQVC 1FNNA 2COMA 5H20A 3J81Z 4WK8F 5D6FA 4S05A 2W84A 1J7KA 1MDMA 3CTAA 3TO9A 2GZWA 5LHGA 3L7WA 4R1HA 2FXAA 1FY7A 2DFIA 3KP4A 3KCCA 3JW4A 5F64A 4QLCU 3SXYA 1FSEA 3RDIA 4U0WA 1Z6RA 1YYVA 3KEQA 3WE3A 4WWCA 2JPCA 5ICEA 3EDPA 1YO5C 2CSOA 2Z3YA 3OV8A 3RTRA 4LLGF 3ZMVA 2P5LC 5HOOA 3K1NA 3D0SA 5FGMA 3E6DA 3WTUC 1FWZA 1TNTA 2R7DA 2HYGD 3KLOA 4LK1F 3I58A 4ENKA 4UVBA 1B59A 1Y0UA 4LG0A 2XRNA 4LD5A 4WXDA 2A69F 3MZYA 2LDUA 2ZCWA 3I53A 1ZRCA 5A2QZ 4ZZLA 2YSRA 5E1ZB 1RUNA 2ZXJA 3ECHA 3KZZA 1XGMA 1YLFA 4ESFA 1HXDA 4EM2A 3KEOA 3SQNA 3E3VA 5HLIA 4ON0A 1QO0D 4JBAA 2H94A 2LF8A 1Z91A 4YFXF 2XIGA 2L02A 1B9MA 1D3YA 3KETA 4KDPA 3ZP5A 4HV5A 1O3SA 2VE9A 3TKYA 3S2WA 4BNCA 3LFKA 4PGGA 4OOIA 4L0YB 1MD0A 2LF7A 2QBYA 3SHFA 3LA7A 1IW7F 3D5LA 4O3MA 3QP6A 2NYXA 3E97A 2QWWA 2FE3A 4Q5SF 2HQRA 2DK5A 1QGPA 2D2WA 1W7PA 4A5MA 1RZ4A 4ASNA 1SD6A 5F1RA 3DFGA 1CGPA 3FWEA 2F5EA 2PQ8A 2CGPA 1SAXA 4YFNF 2UXNA 3MZHA 1ZG3A 4L5JA 2HR3A 1T6SA 3C7JA 3V8JA 5H6QA 1Z6TA 1UFMA 1I5ZA 1YW7A 1D8JA 4HV6A 2MBFA 2A07F 3NQOA 3RIRA 1DPUA 2G7UA 5IT3A 3KP3A 1XB4A 5L3EA 2VODA 1UHMA 1P4WA 4ENJA 3E5XA 2FMLA 4O5VA 4U0YA 1U2WA 2Q0OA 1L3LA 2DT5A 4L0ZB 1IXCA 1SFXA 3WGHA 1B4AA 3MWMA 2STWA 1RIOH 2V1UA 4KA4A 3JTGA 2IA0A 3TOAA 2ZMEB 3IWFA 4IXAA 5D5XB 1BC7C 3ULQB 4IF4A 2BGCA 1SD5A 1WRJA 2KKOA 3HRTA 3O6BB 5H6RA 1ZH5A 3T5XA 1CF7B 3ZQ7A 3WTYC 4RB1A 3WTVC 5ERIA 2FNAA 4RB0A 2LSOA 2R7FA 1QPMA 1LDJA 1IRGA 3V8LA 3QPTA 4IRHA 3L2CA 1EH6A 4KIGA 2FNPA 2K4JA 2VC0A 2E7XA 5AONA 1J59A 3I54A 2HGCA 1FBQA 2O61A 1MJAA 2DAOA 3G3ZA 3MEXA 4MEYF 5LHIA 4LK0F 1HW1A 5BS6A 2ESHA 1XCVA 1XGSA 2IA1A 2RC4A 3ELKA 1FP2A 3JAMK 5HS8A 2XASA 3K69A 3V7CA 3E6MA 2EV0A 2Y0MA 2KRFA 3HSRA 3F3XA 3V8KA 4JQFA 3LSTA 3GVAA 1ON2A 5DCMB 3I4PA 5D5WB 2F2EA 1XSXA 3V7SA 2FBIA 3G73A 3R4KA 1S6LA 2NRAC 2PMHA 4L9JA 3HTUA 5ICFA 4EJOA 2JPBA 1TTYA 3TGNA 5D8LB 2EFPA 5TRDA 2XAQA 2HS5A 1HBXG 1R1UA 1DP7P 3GO5A 2RDPA 4EM1A 1RNLA 1B6AA 3ABUA 1J5YA 1QQIA 4KUMA 1SMTA 4CZZA 2VXZA 3M7GA 1ZG1A 2VOOA 4HDUA 1KGSA 2DLLA 4OIOF 2IA2A 2P5VA 3HHHA 2P7CB 2HFHA 3LAJA 3CUQC 2WWYA 4LLNA 3QAHA 4I7HA 2MH2A 3K0LA 3R0JA 2FBKA 5ILUA 2ZFWA 1WSUA 3HSEA 1MDMB 4K2EA 4CXFA 3BPVA 5E18F 5K1YA 3GFLA 1JGSA 3RKWA 1KU9A 1K79A 1O3TA 1FPQA 3FMQA 1E2XA 3HRSA 3U9GA 2M87A 4U7BA 4UV8A 5J6XA 4IVNA 1R7JA 2K4BA 2F5DA 3RKYA 4XLPF 2EV5A 1ZAOA 1J75A 2DPUA 5DEQA 4LB5A 3K2ZA 3GYHX 2HTSA 4CGZA 2KIFA 2K86A 3HSFA 2MLGA 3IKTA 4LG0B 1WQ2A 2V1DA 2D1VA 4RAYA 2VBWA 1V4RA 3TDZC 2IRFG 3CJNA 3BZ6A 1HQCA 4KN4X 3IRRA 2ZNZA 4AIKA 2EJRA 2EFWA 2X0LA 4PGHA 1KQ0A 4G8XA 1FC3A 1S7OA 3V4GA 4YIFA 2VBYA 5CVIA 2YX7A 3CLOA 5DD4A 3L00A 5HLGA 3FMRA 1B9NA 2P8TA 3HRUA 3E6CC 1PDNC 2M45A 1ZLKA 2M30A 3C1DA 3FXUA 1BBYA 4U88A 5L3BA 3LA2A 2DQRA 3M8EA 1U5TA 2Z5UA 1G3TA 1XCBA 2LKPA 4HA8A 3SFZA 1FLIA 2BEOA 1ZARA 2QBYB 3QU3A 4RGUA 4GO1A 3J7AO 2OQGA 3F8NA 2EFQA 2XV4S 4N9HA 4BAYA 2VOPA 1FYLA 1H0MA 4ZYHA 4EGZA 4ZH4F 1HKSA 1BJAA 5E1WA 1W5SA 3GFIA 2FMYA 1W7PB 3E5UA 4OMYA 4HQMA 2W25A 4LB6B 3DPLC 1FT9A 5CVUA 3U1DA 4ETSA 1ZGAA 3BDDA 2VT3A 4KNYA 1LDKB 2H6BA 2PFBA 3IKVA 3DKWA 4A0YA 4MQ9F 2FSWA 4GYIA 5LEKA 2JTVA 4KIFA 4EJWA 5TJJA 1OYWA 4JK1X 3GUDA 1O7LA 2L01A 1FZPB 4P9UA 2GXGA 3VODA 3CO7C 1T38A 4O6JA 3JTHA 3KP2A 3P9CA 2OZUA 3H92A 3LAPA 5BPDA 1XSVA 4M9ZA 2UZKA 3M8FA 3B02A 3HOSA 3GF2A 1MJBA 4BXUA 3W6JB 2HOEA 2RGVA 3EUHA 5D4SA 2O03A 2XHKA 3LQQA 3R0AA 1R23A 1G4DA 2DO7A 3ZMTA 4G9YA 1ZN2A 4MNUA 3QU6A 1F9NA 2TDXA 4Q47A 3FXQA 3K1MA 1A04A 4AVPA 1I1SA 4L5IA 2VC1A 5LEJA 3HRMA 5ILVA 5DD8A 1SD7A 4HBLA 3BJ6A 2QM3A 3K9TA 2OQRA 3WU0A 1BI0A 3VEPA 4A0ZA 5FD6A 1PP7U 3EYIA 2PG4A 1G3SA 3ZN1A 1K78A 2P5KA 2OD5A 2D1HA 4ZYDA 1Q1HA 2H09A 4UVCA 1RI7A 2VBZA 4I09A 4LFUA 2NNNA 3FF5A 2XAFA 1U3EM 3ERED 3KE2A 2XAJA 3GZ5A 2EA2A 4XSXF 2Z99A 5LRRA 4M9XA 3IHUA 2X4HA 1ZLJA 4HDVA 3R61A 4RB3C 1DDNA 3VFZA 1JHFA 4A5NA 3Q9VA 5FB2A 2RNJA 5L3CA 2K7LA 1X3UA 4Q48A 4R79A 2HQNA 4F7ZA 3JSPA 2HEOA 3CUOA 2JRTA 3KP7A 2W57A 3GXOA 1K7AA 1WI9A 3DP7A 3LA3A 4OINF 3BPXA 4GYGA 2P7VB 2YU3A 1ZGJA 5HS9A 4CYDA 4ESJA 3GLXA 1F4KA 1GHCA 1T98A 2QVOA 3DF8A 3H3ZA 5AIPA 1T2KA 1FP1D 1XGNA 2GWRA 3F6VA 2F5CA 4KMFA 4KN7X 2DU9A 2L4MA 3JAMZ 5CYVA 4CHUA 2VBXA 5KVRA 5J8CA 4G7HF 3ZMUA 1YS6A 2QENA 3WTZA 2FBHA 3IWZA 1H9TA 2J5OA 1IRFA 1YQAA 1TNSA 4GGGA 2KIMA 2RKHA 3HYIA 1R5HA 1Z7UA 1BN5A 4I2OA 5CVJA 2D45A 2JZYA 3N97A 3EYYA 3EETA 1W5TA 4G94A 1IUYA 3J80K 2HKXA 4S04A 2R3SA 3FHZA 3TDUC 1STZA 4HZFA 1KYWA 2A6HF 4HX4A 3JSOA 3L9FA 3MFKA 3DEUA 2EB7A 2AXLA 1TQIA 2EA4A 4QWQA 2IVMA 5CLSA 3M1EA 1MZBA 3T0YA 3WTWC 4R8HA 1IZ1A 4HLXA 1ULYA 1SMYF 1U5TB 4AD9A 5BPIA 1LEBA 1IAWA 5EEHA 3F8MA 5DV5A 3ZMSA 2IJLA 3IL2A 1F1ZA 3I0TA 4ZYGA 1EV7A 3F22A 4KT5C 3O2PE 1YS7A 4WF2A 1LDDA 3KLNA 2E7WA 3SZTA 5DDGA 1FSHA 2ESNA 3W6KB 2ZBKA 3F8BA 3PQJA 3HUGA 3RKXA 4OMZA 4PCQA 3VOEA 6PAXA 3I59A 4ENNA 1ZYRF 2FQ3A 5L3GA 4A0XA 5FLXK 1BIBA 4MGRA 3GZ6A 2IT0A 3EQLF 3NEUA 2ZJ2A 2K27A 3FM5A 5D8KB 3KP5A 3SZPA 2XROA 3F72A 3RPUA 4U7DA 4M6XA 4L9TA 4M74A 2CG4A 5E8GA 2O0YA 5D4RA 1JE8A 4AIHA 2NAZA 2FOKA 4MEXF 4Z2YA 3E6BA 3LWFA 2XAGA 1IXRC 5LBQA 4I01A 1R22A 2OU2A 2CQKA 5IT9K 3FZVA 1BI3A 4I0AA 4OIRF 3TO7A 4EJVA 3HTSB 4WXCA 2DPDA 5HDKA 5DUIA 4LLLA 1GXPA 3O3KA 2A5YB 1HSTA 3WGGA 3U2RA 4IJAA 1O3RA 2YR2A 1P4XA 5D5VB 2K02A 4KYWA
chains in the Genus database with same CATH superfamily
3Q9SA 2ELHA 2NVQJ 1DPRA 1VQPP 1IN8A 1MNDA 4KICA 2VLAA 2ME0A 4LLHA 3QPHA 2X1DA 2DFFA 3QOPA 3AAFA 1KFNA 1U7JA 2P6SA 4P5OA 2VT2A 2CV0A 3PFIA 3FKJA 4AYBN 2IP2A 1GVDA 3KZYA 1NU1J 1OCCH 5AVXB 1J1EB 1SQBK 4D0PA 3RI4A 3QRFF 3CDHA 1X1CA 1YJNI 1U57A 2FYZA 2GUSA 2OTKE 3QPLA 1J2XA 1SC7A 4RAZA 4F93B 1QA6A 1REPC 1ZW0A 5M5YJ 2KNCB 2WT7A 1KQ9A 1NHAA 3AEFC 3KZIC 1KYOI 1KB9D 3K70C 4S0HB 4FHTA 4Y15A 3BJAA 2BCCJ 2BY0A 4BDYA 4BY7J 1X1AA 3H1HJ 1A36A 5K5GB 2BVLA 2PN6A 3CCEI 1QEXA 1SQPE 3LIEA 2DK8A 2W00A 2KRCA 3A03A 2MD5A 3OSGA 3V2PA 1EJ9A 2ZJPF 4UV9A 4D6TE 3BROA 1V5GA 1K05A 3OMYA 2HWVA 4WX9A 3II6A 3SEZA 3WTXC 2RQQA 4QMAA 1N73B 2W85A 2ISYA 3HGGA 5KJ7D 3Q5FA 2M34A 2XSJC 3I5UA 2GBYA 4XORA 5K7ZA 1RPWA 1IRXA 3AE6C 2IPQX 3CCUP 5JLXA 1IN5A 3C2BA 1NTZD 3FIWA 1XX5A 4H0LB 1P7IA 1GV2A 2N9BA 2KJBA 4P1WA 1K78B 1MSEC 1JI8A 1J0RA 2OYHA 3BR5A 1P4AA 2AO9A 3F8CA 3EUAA 4M73A 2HXIA 2BW3A 1EC5A 1HKQA 4U3FG 1OWAA 5KAIE 2X6WA 5DTDA 4PFPA 1X79B 3E1IA 4DCKA 1QPIA 5APYA 3OA7A 1HWTC 4N9IA 1W4MA 1KYZA 3I9V2 2KDOA 1Q2NA 1SD4A 5EJCA 5GAEJ 4EOTA 3CO6C 4HQEA 1BR1A 2IGOA 4HOBA 1FIPA 4TV7A 4M72A 2Q2EA 5FKNA 5K5QA 3L2UA 4IHYA 2M5WA 3CP2A 3OYDA 5FFXA 5KKZB 2CQXA 1VQLP 3HRNA 5AVUB 4NC8A 2UWJE 4DT0A 3FM3A 2LK2A 4C2MJ 2VB6A 4E7HA 1YQ4C 4LC1A 3OS2A 1ONVA 2JO1A 2Q9IA 2MA3A 4IOIH 5FKMA 1I6XA 1Y9BA 1BM9A 4DQ2A 2KZGA 1LGHB 1K6OA 2E74D 2O6GE 4YELA 5M1BA 1HJ0A 2Z4EA 2FXPA 2DW4A 1MMSA 1PP8F 3L71D 3BWGA 3S2HJ 1WT6A 4X6AJ 1YJWI 2ZT9C 2KI7B 4KITB 2CUEA 2ELJA 5AVZB 4B4CA 3HL2A 4NDLA 3OIPA 4W97A 2EFOA 1EH8A 2MFZA 2WAFA 3OYGA 1YTYA 5AVVB 3A3YB 3JR9A 1AA7A 4XICA 4G7OF 1S5LE 2V9VA 4AUWA 1XMAA 3MD0A 4U3FE 3MUDA 3ASOH 3HOYJ 3SDGA 2NS0A 2Y75A 2CH0A 3MKYB 1U78A 1FYKA 3T8RA 1HKTA 2WQYC 2QSIA 4EJTA 1IXSB 3ECOA 5E79E 1FYMA 3L73D 1GK6A 5KLVG 1TQPA 3S9OA 2IYOA 5K7HA 1VTNC 1AVYA 1DUXC 2ACJA 2VONA 1SQQK 4AYBA 2HFED 3R4YA 2LTPA 2WVRA 2OYIC 3CCRI 3DTIA 5E8IA 2CO5A 3MKLA 2VUMJ 2ADUA 1NTKE 2POHA 2W27A 2EK5A 2KISA 3WUTA 2ZNYA 5ILSA 1BIAA 3PIPF 1QHHD 1G3WA 3CLQA 3JCUC 3KYDB 4OIQF 2R7XA 1HCRA 3MKWB 1FDOA 4W7YA 3LOCA 3ZQIA 3V5BA 2W24A 1VF5B 2HU9A 3ERMA 3EUKL 1MBKA 4RGXA 1VQMP 3NRVA 2E5TA 2JSCA 1S5LX 2VE8A 3PNYA 5BVZA 2B63J 2F4MB 5BNGA 5E3LA 2XZRA 4CICA 2W6JH 3JRBA 3QYFA 2O9LA 1LFPA 5E20A 4P96A 2H89C 3P9IA 3H0DA 5CVRA 1FZGA 2CW0F 4RMNA 2QQ9A 3RPUD 5B5EC 1QL2A 2WSFH 5LLQA 4ZYEA 5ED4A 4MTDA 1GU4A 1ZHFA 1MV8A 5KLVE 1U9OA 2KRHA 1IN7A 2A5WA 4P9FA 5GTIC 5J4YA 1FOWA 1TL8A 1UCRA 3H3UA 3A0HH 3QOEA 2KXPB 2C0WA 4C7RA 3KP6A 1JUPA 2M8EA 1K4TA 2AHQA 2YIUC 1D0YA 3CX5E 1Z05A 1XN7A 3S16J 1W5CE 1BOAA 2R5DA 2QUFA 3OR2C 3PHLA 4IL6H 2QIWA 1NU1G 3PH0A 3MQ0A 3L70J 2ISZA 3OAKA 3B5NB 5AW7B 3OYMA 5K7FA 2DA7A 1NTZJ 1JGGA 2WAEA 5BQTA 3P9KA 2R7UA 2FFDA 5H2FC 4LIVA 1WVRA 3CUQA 2WSCH 1VQ5P 3MCZA 4LMYA 2E75B 5E17F 2QJKC 4I7ZB 1JT0A 2G3AA 1U0JA 1QVFO 4C3IJ 4MIMA 1VQOP 1TWHJ 2K9JA 1I1GA 1OR7A 1BE3E 4WY4D 3G9RA 1KILE 3VP9A 2UV1A 2B0LA 1TLHB 3DTEA 3X2QH 3H32B 2BCCG 5APVA 2JKVA 4C30A 3H1HG 3TK1A 3WUUA 4Q4ZF 4BXFA 2L5QA 2GAUA 2VKHA 2J5PA 2QQBA 2K3FA 2Y2ZA 4H44D 4ZMDA 1NGMB 3CD6P 3HPGA 2HTJA 3RQ4A 1ZG5A 1SVMA 4L76A 2V79A 3QWOC 2I1JA 1EDLA 2FBWC 3LIDA 4C7NA 5F6FA 2OCEA 1ETXA 3RYPA 3EWKA 3MKZA 1ZQ3P 1N7SD 3CCVP 3I55P 1IF1A 4XKBA 1NU1E 3DV8A 3A1YA 3SYTA 3G6EP 5APQA 3WE2A 1U7MA 1KU7A 3WU2E 3L09A 1IK9A 1FZEA 1QRYA 1WJ5A 2M9HA 3IC7A 2ZXIA 3GX4X 3FBIB 2KIKA 4BHPA 3MAJA 3PJRA 2VKDA 2CUFA 2GA1A 3BR0A 2E2HJ 3L73J 1MMAA 2BCCE 2L7KA 4ESBA 1UMQA 1XDUA 3B73A 3GFJA 4JYKA 3N4MA 3H1HE 4KHXA 1GL2A 3CP8A 4BS9A 2P1JA 4PD4H 3D6YA 1Z1DA 5EG0B 4KIBA 3CCMP 3ZN0A 4ZDOA 2ZXWH 2DMTA 4AU7A 3F6OA 2Z5IA 4NHJA 1OJLA 1EZVG 3RBXA 3RL0B 1L4AB 3GEZA 2KL4A 1GK4A 3CXHH 4N78E 4R4MA 2FF4A 4A2UA 1LTJB 2YO2A 2K9QA 1L2PA 3K1PA 1YOVB 2DA4A 1MMDA 4RS8A 2AS5F 4PD4E 4IFDK 4FTHA 2LR2A 3R6SA 4EATA 2E71A 4MO7A 1X4PA 4XRFA 4V19K 3FX3A 1SFEA 1BDDA 2GIVA 1Z77A 1SFCB 1HBWA 2NS8A 4GDOA 1WJDA 3PSFA 4JQ0D 1OMIA 1RUOA 2QA4P 3J81K 1LVKA 5DYMA 1KILA 2E1MC 2KSJA 1S9HA 5K5OA 1R1VA 2RREA 3ISPA 4B8XA 1LNWA 3NWTA 2C6YA 4DJAA 1BGYD 1K9MQ 4ENMA 1H88C 1S3JA 3ZMDA 3QP5A 3L75D 3MP7B 5D5UB 1T39A 4BHBA 4IRGA 4IHTA 3F21A 3RBZA 3TBIA 2RQPA 2E74B 4WXHA 5JVGF 1NVOA 3H1JJ 1U8RA 4AWXB 2E1NA 3OYNA 5E1XA 2LG4A 5JFRA 2VIXA 2P4WA 3H5NA 1A6IA 2QEXI 1ON1A 3AG1H 4KMUX 3HUSB 3OL3A 3CMYA 1EXJA 4N3YB 3V42A 4BQNA 2IEKA 2EFNA 2FRHA 3JRAA 3CCYA 4XRMA 1PYVA 3CZ6A 3T97B 2PJPA 1J1DB 4IHSA 2CPSA 3I64A 1B8IA 3S14J 1M7LA 2YX4A 3IRQA 4I0BA 4RGSA 4RBOA 3HD7C 1QZZA 5FD5A 5DM7F 1WH5A 4EYYQ 2M0MA 3HDDA 3FXDA 4M71A 4BYYA 4CYCA 3HUGB 4U87A 2AXCA 5AVQB 3RK2B 3ZDMA 5KK1A 3JCUE 2V9PA 2HYFA 1J09A 4BGDA 3BCCE 3I59B 2DTRA 2UXXA 3F5HA 2QZ8A 3ZMZA 3P7NA 1WPKA 2Z5HA 2UWMA 3ABTA 1R36A 3COAC 4QIWN 1CI6A 1T0FC 2YPRA 4M3EA 2FU4A 1MGTA 4PZJA 4DNCA 2QSFX 3AL0B 1LWUB 3VSKA 4CH7A 1URQB 4FT8A 2NPSA 2PJRA 3GTOJ 3BRVB 3CWBE 1SQPD 3TSIA 2WY8Q 2ZO4A 4MHGA 3WG9A 5JI6A 1MNEA 1LEAA 2G0EA 5B5EE 4HEA2 2ZJSE 5CCGA 4D6TD 5CJ9A 1KA8A 3L70G 1SVLA 2MD0A 1IJDB 3U1CA 5EYRA 2G9WA 2Y9YA 3S1QJ 5A2QK 1FDIA 5GTIE 1VQ8I 3ROUA 1W36C 1JCCA 1NTZG 4BRYB 1HGVA 3K4JA 4A3JJ 1KB9H 3J80Z 1FBSA 2MC3A 4IFFA 2DA5A 1AHDP 1L0NK 5JVTA 3ONQA 2BOLA 3BTCA 2XPWA 4EV0A 1QBJA 5FFZA 4L18B 4AM3A 2KJCA 2PLYA 1I3QJ 3BLYA 2BEZF 2BHZA 2LY2A 1KB9E 4PUSA 1OPCA 3LW5H 4HKZH 4YFKF 4M6YA 1MFZA 1TP4A 3P8CE 2XVCA 1MBGA 4XLNF 1LFUP 2D2CD 2E60A 5H2FE 2XB5A 3GHGA 2VQCA 1LT9A 1U9NA 4FX0A 4M6VA 5DCFA 1VQ4I 1F43A 3ITKA 2JVHA 4AQRD 1FTZA 5J8FA 2R93J 3T1BA 2Z33A 1FJPA 3PO2J 1ZR4A 1JY3O 1TT0A 2XKOA 3E5QA 2GM4A 3L2QA 2YU9J 1XSDA 2VQHA 1R5GA 3CC4I 5LGUA 3PQKA 1ZRFA 4BKXA 2QSGX 1G6NA 4BQOA 4JF7A 3L70E 3L71G 3I71A 2Y0EA 5CVVA 4G6DA 1U8BA 4W7ZA 1WCMJ 1NTZE 2E1CA 3KDPB 4LJZF 2A45G 5ICCA 2QKMB 3RYRA 3PO3J 1BGYJ 4XLEA 1MH3A 2G7HA 3PP5A 2JA2A 3OL4A 2GIZA 4CO8A 5ICGA 1QVGO 3L75J 1JY3P 2FYNC 3IF4A 3CMAP 1QHGA 1OX3A 3TMOA 3TOBA 2STTA 2ZYAA 3M9BA 3FXJA 3L73G 1BI1A 2QCOA 1VQ7I 5AW6B 2K88A 1UB9A 5AVWB 2LBFA 1RR8C 1FC2C 5GPCA 5EGOB 3ESWB 4PJLA 1RF1B 3TQNA 1L0NJ 3AEEC 2W6AA 2O3FA 3BG3A 5EEAA 1XTGB 1USEA 2GA2A 3O8ZA 3IH2A 2ZYGA 1QZYA 1KU3A 1X1DA 5HVQC 1P92A 1XTAA 2L9VA 3REOA 1NTKD 4G7ZF 2A45H 2ZFUA 2RVCA 1IN6A 3BTLA 3OS1A 3WTSC 2IS1A 2VN2A 5HLTA 5FLVA 2XF7A 4E7ZA 5HDNA 1VQKI 4GOFA 4XMYA 3GTJJ 2R4GA 2ID6A 2W48A 1RRJA 2OTLP 4XNFA 4AIJA 2PAJA 2O8XA 1O57A 4M3DA 4UXNA 3HKZN 2L54A 4MTEA 5BOXA 3KHUA 2HQ5A 4H13B 1PUEE 3BG5A 2WT7B 2MW8A 3AG3H 3GWZA 1SQXD 3D6ZA 2PBIA 2HDCA 1S1CX 4A93J 2Y0SN 4PJMA 4HF2A 4PV1D 5AW0B 3CMEP 3L73E 3Q2YA 5TGTA 2M1BA 3DEWA 2JT1A 1J2JB 1WWXA 2WV0A 2FX0A 4IPAA 5FLXZ 1HVVA 3H1JG 1YIOA 4HSTA 1A5JA 1ZK8A 5KJ7A 2BBYA 1TC3C 5EZHA 2DCEA 3HE4A 1OISA 2LFBA 1YQ3C 5KLVD 1TW2A 3F9KA 1AJYA 1FBUA 2MH9A 1FIAA 1BC8C 3QH9A 4GCVA 4YG2F 1EQ7A 5APWA 1J9IA 4D6TJ 4PDKA 1LQ1A 3M0DC 3CX5D 1U5TC 1GL2D 4RAGA 3C18A 2RV8A 4EGYA 1IG7A 1OCOH 2A68F 4N0BA 1USTA 5AIQA 1ZREA 1PP9J 4UB6H 2GUVA 3BY6A 5LGTA 2A6EF 1JHHA 2PEXA 4D9JA 3I56P 2OYHB 2H7HA 3WG7H 2BW3B 3DXJF 1KQSO 2XKPA 2QF7A 3S8PA 2BASA 2Q1ZB 4RAFA 2HZTA 3M8JA 2XSDC 4U0VA 1XG1A 2OZ6A 2CYYA 3GCMA 4BQAA 1BE3D 1OCTC 3RJPA 1XGOA 2Q2EB 1HF9A 4EQQA 2V4HA 1RF0C 2H27A 1YI2I 2BE5F 3H1JE 1NJIQ 3ZQCA 3GF3A 3FXEA 1YG2A 4PJJA 1YJWP 5CBNA 3CC7P 3VPRA 3L2VA 1V3FA 2E2JJ 2O1JA 1JTYA 2HOSA 4OU0A 5FLMJ 3OYKA 3GTMJ 3ZCOA 2Q8KA 5B3SH 4YTPC 5IT9Z 4A6EA 1WKMA 2DBBA 3O8HA 4UVAA 5B66H 2DDBA 3H5AA 1DGRM 3K70D 1YHQP 4KT0J 1D5VA 1TQMA 1D8KA 1YRNA 3GMAA 5AW8B 3OS0A 2BXYA 3FXLA 1NU1D 2QYOA 3B71A 5B66E 1RE4A 1FZCC 1ODDA 1GD2E 1Y56A 2IW5A 3CCRP 2E35A 4WB4A 1UZCA 4LGWA 2A61A 2OUMA 2HVQA 2Y48A 1MKMA 4Z6YA 1W0UA 1E17A 2KYVA 3L37A 4ASVA 2LREA 1NG6A 3TGUD 1H88A 4AUXA 2HNHA 3L72J 3BOQA 2VKVA 2COBA 3BP8A 1H9GA 2ETHA 4E7IA 4XLHA 1P6RA 4BBSJ 1O3QA 1VZ0A 4V2GA 2A6TA 3UIAA 3AE5C 4L75A 5AW3B 1HW5A 4E70A 2NRGA 1JY2O 2QJYB 2RMZA 1SP4A 1A35A 1UHWA 3FKIJ 1GXQA 1AWCA 1Y1WJ 2V1NA 1ACIA 2R44A 1AQ5A 3T8TA 1MJ9A 2JK3A 3HKZA 1D0ZA 3H35A 2J5UA 3K10A 5JHUA 2PI0A 1OKRA 4PSWA 1LP1A 2WMMA 3H1KJ 1U6GA 2HPCA 2H6CA 4HLYA 4RLFA 2Y0SA 3OYFA 3CCLI 3H9JA 3S15J 1K4SA 3C1LA 2LXCB 4DBQA 1DD4A 1BGYG 4EIJA 5FRMA 1TBXA 3H0GJ 5FKKA 1GDTA 2OARA 1AV1A 4AYCA 3L75G 2L2OA 1JNMA 1JY2P 4RKUJ 3ZPLA 5BMZA 1HA8A 4XKWA 1SQXJ 3L74E 4FX4A 2XPUA 2L4AA 2OCCH 4BH9A 2KIUA 3LNQA 2CV1A 1X58A 4EM0B 2EIJH 1W7PD 1SQBD 4B3XA 2AEJA 3FX0A 1VQNI 5AW1B 3ZQLA 3AE8C 4XOPA 2Q5UA 2K3RA 4XLCA 1SQVK 5K5RA 1P84I 3A7OA 1YW8A 2KFDA 2KZIA 1YW9A 1T0FA 1FMVA 1C0WA 4ZZDA 2BV6A 1ZRDA 1LB2A 1HSJA 5GAHJ 1R6RA 2X6YA 2GXBA 1UIXA 4Y17A 1V54H 2OBPA 5IP7J 1Y6IA 3EUHC 4YIIA 2H8RA 2KHMA 1LPQA 3VB2A 3HHGA 5L3DA 2MKVA 1MBJA 2ZKZA 4WY4A 2FFDB 1CZQA 3CUQB 3KEYA 3HOTA 3M9AA 4G12A 4E7KA 1F5TA 1A31A 3K5BA 4HPQA 2FJ1A 4X0GA 2G8YA 1JY3N 4EMSA 5DS9A 1AOYA 3TO6A 4UHTA 4PSXA 1W0TA 2K9JB 2A3SA 3FHNA 2L5GB 3SFDC 4B09A 1S7AA 1USSA 1LJ2A 3WUVA 2P6TA 3GFMA 1BDCA 3FMSA 3H1CA 1FEXA 2E5ZA 1JKOC 4DZJA 4WCGA 3BCCD 3IAOA 2XAHA 2RNGA 1L0NE 1L0OC 2I8DA 1Z9CA 2IBZI 4F55A 3B4SA 3JRIA 2LP0A 3W2AA 1FZAA 4OIPF 1J1EC 1N7SA 4EVIA 2FOWA 4MQVA 3CF5F 4UUVA 1V5EA 2XKMA 4D6TG 4C7NB 1G3YA 1EKEA 3CWBD 5LGNA 3PL8A 2K9LA 2LMDA 1X1BA 3WU1B 1HLVA 1LT1A 5HNHA 3S3MA 5KAFH 1SQVJ 1LVAA 2FEZA 1PP9G 3ZQGA 1G2HA 3M06A 9ANTA 1FU1A 1XDSA 3WHBA 3CCJI 2WPSA 2W83C 1UG0A 4L9NA 4XR6A 1OYYA 2ZMEA 2RN7A 5M3MJ 2DFHA 4Y13A 4CDGA 1I27A 1JJ6C 2JA5J 2BYVE 5JLWA 5KAFE 4YIRX 2FYUK 4JYBA 5JR3A 1BA5A 3TGUJ 4HF0A 4H0EA 1HW2A 1SFUA 4A12A 2XGXA 4UNOA 2WZ7A 2IAIA 2MC4A 4HYEA 1FOKA 1N73C 1GL2B 3N7NA 3H1LE 3P8CD 5E3OA 3RK3B 1EH7A 2LNBA 3GMEA 3SWYA 3KFWX 1CF7A 4XSZF 1KU2A 3VYTB 2WTEA 1YBKA 5HLHA 2QJPB 3OYCA 4DJGA 3UR3C 3S3NA 1KYOE 2IFNA 2HKOA 4H0LC 3CESA 2NVYJ 3WODF 1RH5B 2K9MA 1YFHA 5HS7A 3FXRA 3ML6A 2LC2A 3VYSB 2EV6A 1FOSE 2LVSA 5IP9J 3GTPJ 5KAIH 1GVJA 3LQRA 1PP9E 2KMUA 3L70D 4Y28J 1OCPA 4FCYA 1SQQD 2HDDA 1KILB 1M90Q 2DA1A 1P2FA 2OQQA 3S4RA 2XUBA 5L3FA 3WGIA 5KKZC 3R60A 4I6ZA 2QLZA 1PIXA 2MSYA 2WAQN 3OWTA 4PJNA 4I02A 1JKPC 2TCTA 3JRGA 4IRIA 1R00A 1SQBJ 4NUBA 4ZDLA 4KFCA 5DM6F 5APXA 2CWEA 1JXSA 1TW3A 1QX8A 3CC2P 1R49A 2CFOA 4J00A 4B44A 4HX7A 5KLIB 2V6EA 1H89C 5LRSA 2R5YA 1D1CA 2DQLA 4P55A 5CCHC 2DN0A 5EF6A 5DJUB 1NTKG 1QNTA 1B1BA 2H1LA 2L3DA 3GW2A 4XLFA 4RB2C 4DOZA 5EEGA 3RPQA 2DI3A 2FA5A 4G6QA 5IYDJ 1Z67A 2HVSA 1ZLLA 2HLOA 3P5JA 1BSNA 2PRRA 3P32A 4ZKUA 1KQ8A 3C9IA 1RE3C 3CMMA 2ZJQF 1IFMA 3KX2A 1X1PA 4HF1A 1S29A 3IR9A 1MBEA 1MNMC 2B87A 4OGQC 2L91A 1A6QA 1B8IB 5TISE 5TJHA 1S5LH 2BHYA 4F52A 2R7WA 1LUJB 1PGQA 3DPTA 4CYCB 2DMQA 4A6DA 4BEHA 1IFJA 5E79H 2NOJB 1SQXG 3AE3C 2OTJI 3WTTC 2R5BA 4BHCA 1YITP 5J47A 2Q3IA 4XBFA 1VDFA 2O1KA 2ME6A 1FOYA 1S8NA 5FO5A 4EJUA 3L72E 3BCCJ 2E5NA 2EWNA 1AKHA 3F23A 5APUA 3C3WA 1CI6B 1IDYA 1VQ6I 5DCMA 4HB1A 1FOSF 2PMUA 3LFUA 2NPSB 2V1XA 2FQ4A 2H8PD 2PJRB 5C4JJ 4HAMA 1VF5C 2P10A 1R1TA 3CWBJ 1T6AA 2M8RA 4B43A 4QTRA 1R58A 4M3GA 3G1LA 4M9SA 3OOPA 1IN4A 4QPQA 2AXTH 2YKPA 1M1JC 5DUKA 2Z9OA 3IFMA 3SWKA 4L9VA 1D0XA 4RGRA 4XK4A 4HX8A 1ZV8A 2RH0A 1A02J 5LHHA 1OYIA 4ITVA 2JSPA 3JRDA 1DEBA 3H1KE 3R2PA 5HDGA 3HIFA 3A0BH 4GXOA 2PFXA 1T2KC 1G1JA 1E5WA 3EFFK 2AXTE 1XMKA 2LKXA 1VQ4P 1O7FA 5D6EA 2VASA 2MJZA 2NNYA 3V2QA 1AFOA 2DFEA 1JY2N 2QQAA 3F8FA 1ETOA 2H1KA 1SQXE 3V7RA 3JREA 3A0BE 1P9QC 4A69C 1BE3G 2V6CA 2A06G 3FXOA 5C44J 1WJFA 3CCQI 2CFXA 2OA4A 5J4VA 2RAEA 3CCSI 2HODA 3GHGB 3VTPC 1S2EA 1LT9B 2F4OB 3BJOA 2RKLA 2XF6A 2GQQA 1JEKA 3CX5H 3HD7D 2CQ7A 3F0CA 3MZ8A 4HW0A 1JUSA 4I98B 1PGOA 1X22A 2MLKA 1BI2A 2WC2A 4NB5A 4CCNA 3H1JD 3HGYA 4UY8I 2F5FA 1XD7A 2X1EA 4NQWA 3PRJA 3KQGA 1FX7A 1LJ9A 2OAZA 3DQVC 3ZQFA 1FNNA 1IRZA 2E75C 2COMA 4I7ZC 4O9BA 1UG2A 2E76C 3HJEA 5H20A 5F0CA 3B6AA 1SQVG 3J81Z 1WZ2A 4WK8F 2W82A 2PP6A 3D70A 2WAQA 3MHVA 3G71P 4L74A 5D6FA 4S05A 3OR1C 1AU7A 1SQQJ 2W84A 1J7KA 3FXMA 2R7OA 4M3BA 2HOTA 3DWLE 1MDMA 3CTAA 1S4XA 4JYCA 2EH3A 3QQAA 4PJ0C 3TO9A 2GZWA 5LHGA 3L7WA 4R1HA 1HC8A 2FXAA 1FY7A 2DFIA 2K3PA 2ZVNB 3ZGKA 1D7MA 3KP4A 1DU0A 3TGUG 1DP3A 1RR7A 3KCCA 3OIOA 2C0XA 1R5ID 2JUCA 3JW4A 5E3MA 5F64A 2A06E 3SWFA 2LBFB 3SXYA 4QLCU 5IPAA 1FSEA 3RDIA 1W36D 3AFHA 1KD1Q 1FDMA 2JWTA 4U0WA 1FS0E 3KZIH 1Z6RA 1YYVA 2BY2A 3KEQA 3WE3A 4WWCA 4B48A 4PFOA 4XM3A 2WPVB 5HNFA 2JPCA 2DDAA 4C2TA 2K5CA 5ICEA 3EDPA 1YO5C 3AECC 2YNYA 2CSOA 2Z3YA 4GT1A 4ASWA 3OV8A 1KV4A 3RTRA 1RY3A 3NFQA 1M1KQ 4LLGF 3ZMVA 2P5LC 3KZIE 5HOOA 3IUOA 4MLOA 1G2CA 1NO4A 3WU2H 3K1NA 2D5VA 1PV3A 3D0SA 3RCOA 5FGMA 5J1RA 4BJ5C 4I6MC 1BJZA 4UUSA 1E3HA 1SQVE 3E6DA 3WTUC 4BE2A 3UNGC 1IO4A 1PPJD 1OCRH 1H8AC 4GDFA 1FWZA 1TNTA 2DODA 2QKLB 2Z16A 2R7DA 5E3NA 2R7RA 2HYGD 2M4KA 3KLOA 4BDZA 4A3EJ 4F92B 2FXOA 2FXMA 3G4SP 2KZJA 3HG9A 1L0LK 4LK1F 3I58A 4ENKA 4UVBA 3TGUE 3RL0C 1B59A 1L4AC 1SQBG 3V4QA 1Y0UA 4LG0A 1UJ8A 3L74D 3FXKA 2DA6A 2XRNA 4LD5A 4WXDA 4K35A 3U59A 2WY7Q 3CF2A 2A69F 3MZYA 4AC0A 1SFCC 1XC5A 1ETYA 3HE4B 2LDUA 3GTQJ 2ZCWA 4BWNA 3I53A 3CQZJ 4QSHA 2R5ZA 4GFBA 3DTKA 1FBMA 1ZRCA 1G1IA 5APTA 5A2QZ 2R0QC 4V2FA 2V7QJ 4ZZLA 1X2MA 4IQ4A 5J3LA 2YSRA 2QSHX 4DIQA 2VJ4A 5E1ZB 4XL9A 1RUNA 1OVRA 3K4LA 2ZXJA 3FBNB 3ECHA 3KZZA 1XGMA 3RZDJ 4BL0B 3HB9A 1YLFA 3JRHA 2KSEA 1OVUA 3LSKA 2K85A 4ESFA 1HXDA 3S93A 4EM2A 3FISA 3OOUA 1USDA 3NAUA 1XMXA 3KEOA 3SQNA 4ZTFA 3BCCG 3CXHI 4ZC3A 3KXDA 3E3VA 5HLIA 4ON0A 1PZQA 1SQBE 5B1AH 3MTUE 1NWQA 1QO0D 1RESA 3BR3A 5IY5H 2IGKA 2H94A 4JBAA 1J1DC 1L0ND 2FYUE 2LF8A 2DT6A 1M1EB 1Z91A 1BL0A 4YFXF 4I99C 2XIGA 3CWBG 1JUMA 2ZJRF 5AVYB 2ZXHA 1ZKGA 2QE7H 3HE5A 3TNUA 2L02A 5GTHC 3SZGA 2DJNA 3TEDA 1SVFA 1B9MA 1Y39A 1D3YA 2H88C 2Y0DA 2W4SA 1YRNB 3RK2C 4XA4A 2V9KA 4JX6A 3KETA 1VFCA 3VOPA 4KDPA 3ZP5A 1EZVI 3JCUH 4HV5A 3NARA 3NWSA 2JDIH 4XKCA 1GU5A 1O3SA 1MBFA 5M5XJ 3CCUI 3C2GA 2VE9A 3DPUA 2X1CA 3TKYA 1BW5A 3S2WA 1LWUC 1URQC 3CDLA 4BNCA 3AL0C 2HOAA 2FY8A 2ZXXA 2L9RA 3RL0g 3LFKA 4PGGA 4OOIA 3BCAA 3UKGA 2OPTA 2P0WA 3G1OA 4L0YB 1MD0A 5CJ0A 5B5EH 2O01J 2LF7A 3OYLA 1JJ8C 2MABA 3SHFA 2QBYA 3IN6A 2LR8A 4LIUA 3H1LD 2BXZA 3LA7A 1IW7F 5GTIH 3D5RC 3TF5A 4B3AA 2CUJA 1ZTRA 1R8EA 4J19A 4DYCA 3D5LA 1VQLI 4O3MA 1HH0A 2DOEA 3QP6A 2Q3EA 2HI3A 1KYOD 3HPHA 1UAAA 2NYXA 3E97A 2QWWA 3VMYA 4A3FJ 2FE3A 1LP1B 1SQQG 2HPCB 2NS7A 4Q5SF 2HQRA 3PFYA 1FJKA 3VMXA 4IHVA 1N86A 2DK5A 1PUFA 1QGPA 3BQZA 1BCCJ 1PP9D 2C9LY 2KQRA 3Q0VA 2D2WA 2XDJA 1W7PA 2GOXB 5CQGA 5H2FH 4A5MA 2JA8J 3PUBA 2VJJA 1RZ4A 2W90A 1DIPA 3O6QB 4ASNA 1SD6A 5F1RA 3DFGA 2QG4A 1LTIC 1CGPA 3F89A 3L74J 5AW4B 3FWEA 2F5EA 2M0CA 2PQ8A 1YX3A 2JEEA 4PJ0E 2CGPA 1KORA 3BRTB 1SAXA 3WMM0 2KB7P 4YFNF 3OY9A 3CPWO 2N1TC 4GODA 1W2EA 2UXNA 4CCLA 3MZHA 1E79H 1OIPA 4RESB 2Q6QA 3GZNB 2QVAA 2WPQA 1VNDA 4ZNCA 1ZG3A 1T08B 4L5JA 2HR3A 1YJ9P 1T6SA 2LYCA 3C7JA 4DBRA 1NTMK 2ZFCA 5EFWB 3V8JA 2OYIA 4NPEA 3VDXA 3FWNA 3D1NI 5H6QA 1Z6TA 1M1JA 1UFMA 2ZSIB 4A3GJ 1ITYA 1I5ZA 3C2HA 1SQQE 1YW7A 4WY4B 4A3DJ 2XPVA 4CA0A 1D8JA 3DBLB 4HV6A 4EI2A 2MBFA 2A07F 1QGKB 1RF1C 3NQOA 1UHSA 3VYRB 3RIRA 5FRNA 1ZN5A 1DPUA 1EDIA 1EDKA 3AEAC 2G7UA 2K9NA 5IT3A 2E5YA 4H44B 1RKWA 1VQMI 2WB1N 3KP3A 1XB4A 4PK4A 5L3EA 2VODA 1UHMA 5AVSB 1P4WA 1AA0A 4XKVA 5F0HA 1PL5A 5J40A 2XV5A 4ENJA 3E5XA 1HDDC 2FMLA 3S3OA 4O5VA 3L72D 1A02F 2F4IA 3KYQA 5FROA 3LSGA 3QWLA 4U0YA 1N7SB 2R3CA 1U2WA 3CCJP 2Q0OA 1IZNB 2DOFA 3IV5A 1YJNP 2XRLA 3IAM2 1M57D 4CCOA 1WHUA 2DT5A 1L3LA 4L0ZB 3C8VA 4B86A 3CJRB 1R5LA 4UB8C 1IXCA 1IO2A 1SFXA 4H13C 4WBAA 3WGHA 1B4AA 4A3LJ 1B72A 3MWMA 2STWA 4JX4A 2HVRA 4HRIA 3JC22 1RIOH 2V1UA 1LNQA 4KA4A 3JTGA 4NPFX 2IA0A 3TOAA 3H1KD 2ZMEB 3ZQQA 3IWFA 1AQTA 3CCEP 4IXAA 3NTNA 1BW6A 5IYBJ 1I50J 5D5XB 2Z1DA 3H9QA 1BC7C 4WVZA 4XE5B 3ULQB 4IF4A 1LKXA 2BGCA 1VQ5I 4XLAA 5AW5B 1SD5A 1LFBA 3PJSK 1WRJA 1VQOI 4OVNF 3M0AA 2KKOA 3BT9A 1M8OB 2QQ8A 2IDBA 2V7QH 3HRTA 3O6BB 5H6RA 4DYRA 1ZH5A 1GMJA 3BASA 1ETKA 2K1AA 5F27A 3H1LJ 2CMPA 3T5XA 1CF7B 3ZQ7A 4FASD 3WTYC 3PIOF 4RB1A 2Q1KA 3WTVC 1HOMA 3I4MJ 5ERIA 3PLNA 2FNAA 2I5UA 4FQGA 4ZDPA 2KDZA 2IZ0A 3CD6I 3VN0A 2OYHC 2EZIA 2GLOA 5KTBA 3H1IJ 4RB0A 3M91A 2LSOA 2R7FA 4IKFA 5CPRB 3MIWA 1QPMA 4Y4RA 1LTAC 1HUCA 4EEFG 1OVVA 1LDJA 4A7PA 3LSIA 1IRGA 3CCVI 2JR8A 3I55I 2DMPA 3V8LA 1TU3F 5GTHE 1KC8Q 4D5CA 1MMNA 2CW7A 3QPTA 1EH6A 4IRHA 4KIGA 3L2CA 1IJWC 2O7OA 2WWWA 4HNUA 2P7JA 2FNPA 2IFMA 1GW4A 1POGA 2K4JA 2VC0A 2E7XA 2V4JC 4E7SA 2KOGA 5AONA 1J59A 2HXOA 3I54A 2HYNA 1VF9A 4U7JA 2A06D 2HGCA 2L9NA 2M4GA 5FKLA 3M3YJ 1VQ9I 2WSEJ 3MMYB 3DEEA 1FBQA 4IZZA 2O61A 1MJAA 2HPIA 2DAOA 3PNTA 2R5YB 3ABLH 4UUTA 3G3ZA 4YPCA 3HEFA 2O01N 5CHXA 1LE8A 4RM2A 1SAUA 3MEXA 2KK7A 3HOVJ 2DOAA 3OYHA 2BVMA 2EZHA 4MEYF 2YUSA 2KP6A 3CCMI 4FE7A 4K3AA 2WSSH 2ZB9A 5LHIA 4LK0F 2CPBA 1HW1A 3RQIA 2M3AA 5BS6A 1CW5A 4J01A 5EDNA 2ESHA 2X85A 3BR1A 1XCVA 1XGSA 1PPJG 3CL3D 2IA1A 2RC4A 3MUDC 1LTTC 3GTKJ 2WB1A 2EIMH 2B87B 2E42A 4OH8B 3ELKA 1FP2A 3TW7A 3JAMK 5HS8A 3P8MC 5EZGA 1SQVD 2XASA 3K69A 3VYIA 2B7EA 3V7CA 2F48A 3NXSA 2OGUA 3E6MA 4BEHB 2EV0A 3W2WA 2Y0MA 1X3WB 2KRFA 3TP3A 1ERDA 5AVTB 4H0LD 1VPCA 2JUGA 3ASNH 4QPOA 4IEJA 1TWAJ 2O01H 3HSRA 2IS6A 3L74G 1N8RQ 1WJEA 3F3XA 3V8KA 2QJYC 4JQFA 2A05A 3I3LA 3LSTA 2AEMA 4Y52J 1BOBA 2N8GA 1AKHB 3GVAA 3PTZA 1ON2A 4LITA 1FAVA 3KYLA 5DCMB 3I4PA 2NOGA 3OYBA 5D5WB 3W2VA 3L4FA 1JKRC 1OFCX 2F2EA 1RKTA 2B89A 1XSXA 3V7SA 1YIJI 1JTHA 4RDUA 3HOUJ 1X0TA 1JM0A 2FBIA 3G73A 1T3JA 3BQYA 3W68A 2ECCA 3R4KA 1S6LA 1Q7YQ 2NRAC 3P7KA 2PMHA 5CKTA 5DJTB 4L9JA 3HTUA 4OAYA 2QGUA 3BZCA 3MVPA 4N4OB 2L7FP 5ICFA 3VSLA 3CCQP 4EJOA 1PPJE 2JPBA 1TTYA 3V2RA 2JJ7A 1Y8RB 4G6TB 2JA6J 3TGNA 1M56D 3DU6A 1N75A 5D8LB 2EFPA 2HPMA 3ABKH 1BCCE 1K04A 1D1BA 3PNVA 5TRDA 2D2CB 3MZWB 2XAQA 4GIFA 2DA2A 5CCHD 3QPSA 3WHCA 1NOHA 3ZRGA 5KHDA 2HS5A 5C4XJ 1HBXG 1R1UA 3HM5A 1DP7P 3GO5A 2RDPA 4EM1A 3HD7A 1NAYA 1KTMA 2PMZN 3O6QA 2M3BA 1RNLA 1B6AA 3ABUA 1J5YA 1MUUA 2HODB 4EDFA 1QQIA 3LSJA 3Q0WA 1SMTA 4KUMA 4CZZA 4OGQD 3QODA 2VXZA 2DA3A 1VI0A 3M7GA 1ZG1A 2VOOA 1L0NG 2IGNA 2X6OA 1KGSA 4HDUA 2CK3H 2XAUA 2L7MP 2ZT9D 1ZP0C 2XB0X 2DLLA 4OIOF 4NQWB 2IA2A 2P5VA 3HHHA 2P7CB 4HJGH 2FFDC 1IFPA 2HFHA 2FYUD 3LAJA 3CUQC 4Z1MH 2WWYA 3EPZA 4C3HJ 4LLNA 5F0FA 2KT0A 3QAHA 3BATA 2JMWA 4W1UA 2IBZG 4I7HA 2MH2A 1OR7C 2Y31A 3K0LA 2FBKA 3R0JA 2ZFWA 5ILUA 3SJMA 2IGMA 3KPEA 4XFJA 1P84E 1WSUA 3HSEA 4XN0A 1MDMB 1KONA 4K2EA 1MIJA 1WJBA 3J7ZI 4CXFA 4DYQA 3BPVA 5E18F 4GKGA 1EXIA 2R32A 5K1YA 3GFLA 3S1KA 1JGSA 3K6GA 2VL8A 2O8KA 3RKWA 1JOCA 1I39A 1XPXA 4ANJA 1KU9A 1K79A 1O3TA 3MD2A 1FPQA 1KFMA 1WGXA 3FMQA 3PSIA 5JHFA 4M3LA 2JP3A 2DYSH 1T2KD 2X51A 3V2NA 1I3AA 1WJAA 1E2XA 1TWFJ 2Y69H 3AG2H 3HRSA 3U9GA 2R7VA 3H1LG 2ITAA 2M87A 3ZOBA 4U7BA 5CBOA 4Y99B 2HYJA 4UV8A 4Y33A 4IVNA 1PJRA 5J6XA 4BE1A 1R7JA 2K4BA 2F5DA 2E1OA 2N1TA 1YTZT 2AQEA 2DT7B 1W1WE 3RKYA 3MGNA 1G2CB 4XLPF 3H1IG 2LXBA 3CJTB 4CPGA 2EV5A 1ZAOA 3SDBA 1KMIZ 4UUSB 4DZOA 2IBZE 1P7JA 1MFTA 4C46A 2J59M 1J75A 2WV1A 2KS1A 2QM8A 2DPUA 5DEQA 5FKOA 4LB5A 4PV1B 3W3CA 3K2ZA 3GLLA 3GYHX 2CW8A 2WSCJ 3M07A 3L2WA 2HTSA 2KUBA 3H6PA 4CGZA 2KIFA 4OWRB 1S7EA 3RK3C 2K86A 3A0HC 2VQLA 1JT6A 2MLGA 3HSFA 2W7NA 2E76D 3SFIA 4ZYAA 3IKTA 2WITA 1SVOA 2DTZA 2X9DA 4LG0B 1WQ2A 2AEFA 3DKXA 4NBQA 2QJPC 3OSFA 2V1DA 3CMAI 2D1VA 5LD2C 4RAYA 4A3MJ 1KYOH 2VBWA 4IL6C 1HDPA 3IAS2 1OW6A 5APSA 1V4RA 3TDZC 2IRFG 1QVTA 3CJNA 2R5ZB 4F91B 3BZ6A 3FK6A 1KILC 3A2AA 5C39A 1Z21A 3BG7A 1X19A 1ENHA 1HQCA 2DYRH 5M3FJ 3H1IE 4KN4X 3IRRA 1KN7A 3DLLF 2ZNZA 1SS1A 4AIKA 3K7AJ 4OWFA 4R4LA 2EJRA 2PMZA 2EFWA 3RZOJ 2X0LA 2ICWG 3RSNA 4DGWB 2HZDA 4PGHA 4H4KC 1KQ0A 4G8XA 2MGQA 4LOCA 2K37A 3M9QA 5KLIC 1JO5A 1FC3A 1S7OA 3V4GA 4YIFA 2WSEH 2VBYA 2X48A 4RJTA 2LRDA 2QEXP 2OTLI 5CVIA 3HTKA 2YX7A 2VXDA 3CLOA 1BR2A 3L72G 5DD4A 3L00A 3SFEC 1X2NA 3WU2C 3K4CA 4TT3H 3Q5SA 5HLGA 3FMRA 1B9NA 1ZRTE 2P8TA 3CMEI 2ZAEB 4CCKA 3HRUA 2YS9A 5J1YA 3E6CC 1PDNC 2M45A 1T3UA 2XU6A 2CUZA 3I5CA 1R4MB 1TT5B 2FYUJ 1ZLKA 1S9KE 2M30A 3C1DA 3HE5B 3TNUB 4L5EA 3FXUA 5TISH 3RL0D 2BY1A 1L4AD 1BBYA 1MH4A 3W67A 4U88A 4E4HA 2L9SA 5L3BA 3U1AA 2K9SA 3LA2A 2DQRA 2VI6A 3FDYA 3H1KG 3M8EA 2V7FA 3M0DA 1V55H 2CV2A 1U5TA 2EQRA 4C2UA 1SFCD 3A2KA 2Z5UA 4N6JA 1GV5A 1G3TA 1XCBA 2K9YA 2N9YB 1Q86Q 3KPHA 2LKPA 4HA8A 5FJ8J 2NPSC 4JX5A 4Y3OA 3I56I 2IXSA 1X9VA 3GF7A 4YXWH 1FOXA 3SFZA 1FLIA 2BEOA 1GW3A 5F1JA 4LG3A 5CCGC 2JA7J 5KCMA 1S72I 1YE9A 1ZARA 2EINH 3AE4C 4BQQA 4RO0A 1VQ8P 2QBYB 1H0TA 3QU3A 4RGUA 4GO1A 4KT6A 3J7AO 2OQGA 2R92J 1V5FA 1R5SA 3F8NA 1RF0A 2OYOA 2EFQA 2Y9ZA 1IK7A 2BZTA 4XN3A 3J7AY 2XV4S 3CC7I 4N9HA 2M8GX 4B47A 4BAYA 1VL2A 2VOPA 4C3JJ 1FYLA 4RA2A 1H0MA 2EZLA 4ZTJA 3M4OJ 1EDJA 4ZYHA 4EGZA 1YHQI 1ZELA 4ZH4F 1HKSA 1BJAA 5E1WA 3A01A 1W5SA 1PUFB 2L7ZA 3LSMA 3GFIA 1LT9C 3GHGC 4OGQB 2FMYA 1W7PB 2EBIA 3E5UA 4OMYA 4HQMA 2W25A 2ZT9B 3JSVC 3BVHA 2R7ZJ 1FZCA 1NKNA 4LB6B 3DPLC 1FT9A 5CVUA 3U1DA 4ETSA 3L2RA 1N77A 3RK2D 1NTZK 1ZGAA 2GOMA 1IFIA 3BDDA 3CC4P 1XTCC 2OJED 2VT3A 1BR4A 3N05A 4DW6A 4KNYA 2HDWA 2IS2A 1ZXGA 3E7KA 1LDKB 2E19A 2H6BA 4BBRJ 3BR6A 2PFBA 3IKVA 1DU6A 3DKWA 4BXXJ 3B5NC 1L0LD 1WI3A 2OV7A 3HC7A 4A0YA 1URQD 4I2LC 4MQ9F 1JCDA 1HJBA 5L8RJ 2OYIB 2Y30A 1Y8AA 2IBDA 2FSWA 3GTLJ 2E43A 4GYIA 1M1JB 5LEKA 4KISA 2M5AA 2M0BA 1VQ7P 1KQFB 2JTVA 2M7AA 4KIFA 1GT0C 2KPMA 1DQUA 3Q0UA 4EJWA 5TJJA 3CX5I 1OYWA 1IGNA 1WH7A 4JK1X 3QYBA 2VJIA 3GUDA 1O7LA 2L01A 1FZPB 4P9UA 2GXGA 5GPAA 3VODA 1LTSC 3CO7C 2P2UA 3AEBC 1YYCA 2M3EA 3LW5J 2AQFA 4DZPA 3D5SC 3E1RA 1T38A 4YXDC 2E34A 4O6JA 3JTHA 3KP2A 3P9CA 1APLC 2ID3A 2OZUA 3H92A 3RK3E 1RC9A 3LAPA 4BJTA 3GBGA 1XSVA 3VYUB 5B1BH 5BPDA 1E3OC 1GZLA 4M9ZA 2UZKA 1TZLA 3A4CA 2W1OA 2VPLA 1VQKP 3BG6A 2IS4A 3M8FA 3B02A 2JWDA 3HOSA 1DX7A 1DD3A 3GF2A 4C9YA 1GLNA 1MJBA 4XQFA 3S1MJ 4BXUA 3W6JB 3DU5A 4TLFA 2YIUB 3IH3A 2HOEA 3AEDC 1B72B 4IL6E 2E76B 2RGVA 2WA0A 3V6IA 1TWCJ 1XS9A 5CMZA 1QLED 2N1TD 2WADA 3EUHA 5D4SA 2O03A 2XHKA 4GOEA 3E1SA 4CSWA 1GUUA 4XOTA 1RHZB 3NMDA 5KJ7C 1BCCD 4BJ6C 1E0EA 2Y0CA 4IHWA 3BR2A 2QJKB 3LQQA 4JPZB 1R4NB 3GTGJ 1QU3A 1Z56A 3R0AA 1R23A 1G4DA 2E36A 2WPRA 2DO7A 1LTBC 2YO3A 5CJ4A 3ZMTA 5CQEA 3PUFA 2DMUA 1DGWY 4G9YA 1LTJC 5F04A 5KNLA 1ZN2A 4MNUA 5IP6A 4Y7NJ 2P67A 2I1KA 4YEJA 2FYUG 1T8IA 3OW2O 3QU6A 1F9NA 2TDXA 1DEEG 2P81A 5BU8B 3L71J 2EPFA 4D7NA 4Q47A 1SLQA 3AEGC 1OQYA 3CDIA 4IL6X 3FXQA 3FGAD 1CQTA 2XC7A 1TWGJ 1A04A 3K1MA 3BZKA 1X8YA 2EZKA 2ZYDA 4AVPA 3B8EB 1I1SA 4AIDA 1VQPI 4L5IA 2KNCA 2K40A 1K6YA 2VC1A 5LEJA 1VQ9P 3HRMA 5ILVA 1P84D 1ZMEC 5AW2B 1YI2P 1NG7A 2CS3A 4CUGA 4ZJZA 5DD8A 1NH4A 2E74C 3Q5PA 1SD7A 4PD4I 1PGJA 1GTWA 2MG4A 4HBLA 3BJ6A 2QM3A 3K9TA 3S32A 2I10A 4H13D 2HQAA 2YKOA 3J7YJ 2OQRA 3K4MA 3S1NJ 2LD5A 1T95A 2JVGA 3WU0A 3HUSC 4HH2A 1RQUA 3DBHB 2QRXA 3Q5RA 3RGUA 1L0LJ 1BI0A 3VEPA 4XRSG 4A0ZA 1IC8A 1LE8B 3U1KA 4A3BJ 1N73A 2X6XA 5FD6A 1PP7U 1Y0NA 3HOXJ 1RE4C 1JUNA 3CXHE 3EYIA 4HNTA 2PG4A 1G3SA 4IFMA 1FJLA 4RLQA 4D5FA 3ZN1A 1Y47A 3TYYA 1K78A 3S2DJ 2P5KA 4FETA 2CU7A 1HTLC 2IBZD 2R7QA 2KLVA 2B88A 3IP4B 3AKZA 3PM1A 1NTMD 2OD5A 2D1HA 3N4XA 2IX7C 1YIJP 4ZYDA 2E1MB 1Q1HA 2P58A 1OXZA 1JB0J 2H09A 4KJMA 4JP0A 1OW7A 1JMMA 4UVCA 2F5VA 2O3JA 1RI7A 2VBZA 1EZVE 4I09A 2IYPA 2CRGA 4LFUA 3ZXSA 3SSUA 2FUG2 2NNNA 3A5TA 2TRTA 5GADJ 5F08A 3FF5A 4IOCF 1OCZH 1JTHB 3CCLP 1OLTA 3CC2I 4A3CJ 3CI9A 2XAFA 4UB6C 3ERED 1U3EM 3JRFA 4IHXA 2XGDA 3B6CA 1H89A 3KE2A 2XAJA 3GZ5A 4E6KG 2EA2A 4XSXF 5CCHA 2Z99A 5LRRA 3EQ2A 4DOJA 2CQQA 3OYJA 4M9XA 1KZUB 2IPPA 3IHUA 3H1ID 2X4HA 3HOWJ 2V26A 1Y8QB 1ZLJA 2NVUB 1RETA 4HDVA 1ZGWA 3R61A 3BTIA 4RB3C 1RE3A 2PX9A 3OJAB 1VQNP 1DDNA 4LGDE 3VP8A 2F6CA 2OF7A 3VFZA 2JRMA 1NYHA 3VMAA 4PJ0H 1K73Q 3HD7B 1JHFA 2LH9A 4A5NA 3Q9VA 5IOYA 5FB2A 2RNJA 5L3CA 2K7LA 1X3UA 4Q48A 4R79A 2HQNA 1YITI 3AE9C 3EFGA 3GLMA 5B66C 4F7ZA 4M3FA 3JSPA 2FD5A 2HEOA 2WTYA 1F36A 2O5RA 2JRTA 3ABMH 3CUOA 3KP7A 5HODA 1ZRTD 2B9BA 2ZXEB 2W57A 3GXOA 1K7AA 3A02A 4WY4C 1WI9A 3Q3DA 1KB9I 3L1PA 3DP7A 2XNXA 3LA3A 4OINF 3BPXA 4GYGA 2P7VB 2YU3A 1S9KD 1ZGJA 3H36A 5HS9A 4CYDA 4H44C 4ESJA 3GLXA 3KYCB 1F4KA 1UELB 1GHCA 1T98A 2R7SA 4IO9F 4BACA 4JBZA 2QVOA 2ZSHB 3DF8A 3H3ZA 2KLOA 2W8ZA 4IOAF 2JQ7A 2Q7CA 5AIPA 2ELKA 2QM7A 1T2KA 1FP1D 1N7SC 1XGNA 1EF4A 2YXQB 2GWRA 3AG4H 1UIIA 1RQVA 2GXAA 3DCFA 3F6VA 2VPRA 4XRSA 2DMNA 4F3QA 2HG5D 3S1RJ 2F5CA 4GRIA 4HG2A 3TP0A 4KMFA 2N1TB 4A3IJ 4BU2A 1DH3A 4KN7X 1AVOA 2ZMEC 2DU9A 3B5NA 2DJIA 4W80A 2BY3A 3SEQA 1YJ9I 2L4MA 1FMWA 1FE6A 3JAMZ 3K4BA 4BE0A 5CYVA 1KQGB 1Q82Q 4CHUA 3H25A 3OIQA 2VBXA 5KVRA 1SQPK 5J8CA 4G7HF 4XONA 2KS1B 2YXRB 3ZMUA 4BUPA 1YS6A 2QENA 2VQGA 3G71I 1R9TJ 4U3FD 4NPDA 1NTMJ 3WTZA 3H32A 2FBHA 3IWZA 3HBLA 1H9TA 2LLKA 2J5OA 3DKYA 3E7LA 1IRFA 1YQAA 3TDKA 3RKQA 2FYNB 1TNSA 4GGGA 4HYTB 1QZEA 1WRGA 2KIMA 1NAFA 2RKHA 3HYIA 1IV8A 1R5HA 1SFKA 5AW9B 1Z7UA 1BN5A 3CJQB 4I2OA 1MMGA 4MN4C 1ETWA 2A45I 1L0LG 3I4NJ 2BEQD 5CVJA 4NNJA 1IV6A 1Y1VJ 4I76A 3E0JB 2D45A 2H8WA 2JZYA 3N97A 4IQJA 3EYYA 3O8GA 3L71E 3S17J 2LKSA 1I6HJ 3LSPA 2ECBA 3EETA 4E7LA 1D1AA 1W5TA 2KLUA 1IFDA 1YX5A 1N78A 1SANA 2DXIA 1JMBA 5GTHH 2PGDA 4G94A 1IUYA 3J80K 2HKXA 4KYWA 5AVRB 2H43A 4S04A 1MSFC 2R7TA 1ZR2A 3A0HE 2R3SA 1IFNA 3FHZA 3VMZA 2M2EA 1Q81Q 3TDUC 1NK2P 2ZVOB 1FZFA 1STZA 1H8AA 2VKEA 2JWAA 3LL7A 3G6EI 3OYIA 3BCBA 4NC6A 1KQLA 3H9GA 4HZFA 3LSRA 1N2DC 1IC2A 1KYWA 3HTKB 2A6HF 3G4SI 3FK7A 1SQPJ 5EG0A 4HX4A 1O4XA 3JSOA 3L9FA 1WMKA 3MFKA 5IYCJ 3BG9A 1PGPA 3DEUA 1NKZB 2EB7A 2AXLA 4NC7A 1L4AA 1SEUA 1TQIA 3BC8A 3BTJA 1BSHA 2EA4A 4CCMA 5KAFC 1CSBA 4YRVA 1L0LE 3OYEA 1LTJA 2RN0A 3QYEA 4QWQA 4BY1J 2IVMA 3RK3D 2SPZA 1ETQA 5CLSA 2NXNB 3H5RA 3M1EA 1SFCA 1IUFA 4I1LA 3D71A 1ETVA 2OTJP 1SFOJ 1W2BO 1MZBA 3T0YA 1T33A 1PVEA 2EILH 3WTWC 3JRCA 4R8HA 3M1CA 1IZ1A 4HLXA 1ULYA 1SMYF 1U5TB 1S72P 4UB6E 1N7LA 4AD9A 1NHLA 1BCCG 5BPIA 3KIOA 3K4KA 3H3VK 1LEBA 1NTKK 1VQ6P 1IAWA 5EEHA 1KILD 1KZHA 5LFAA 4A3KJ 3USSA 4ZKPA 3F8MA 2NVTJ 2C9NY 1E3PA 5DV5A 3ZMSA 2IJLA 3IL2A 2QA4I 1ZOYC 1F1ZA 1NH3A 4HNVA 3I0TA 1T8ZA 2VRSA 2WBMA 4ZYGA 2YKQA 1EV7A 1MW7A 1H0TB 2XGEA 5C3EJ 3F22A 4CCJA 3K4NA 2LY1A 3MN2A 4KT5C 5GAGJ 3HUSA 2W6BA 1SQXK 3O2PE 5KAIC 4OAZA 3Q3SA 4E7JA 1IDZA 3T97A 2DW3A 1YS7A 4WF2A 2D2CC 1LDDA 1X4OA 1Z3XA 3KLNA 3VWBA 2E7WA 2LKMA 2XNDH 3SZTA 5DDGA 1FSHA 2NZ2A 4MFEA 2ESNA 2JN6A 3W6KB 1NK3P 1HGZA 3ZQHA 5KLVK 2ZBKA 3F8BA 3L35A 3LMMA 3PQJA 3HUGA 3RKXA 4OMZA 3CCSP 4CZCA 3A01B 1Z3YA 4PCQA 3VOEA 4HSRA 3W6VA 4U3FJ 6PAXA 3I59A 1Z0XA 4II2A 4ENNA 1K61A 2LY9A 1PFIA 1ZYRF 2FQ3A 1FZCB 2BCCD 1FZBA 1Q1VA 5L3GA 1T56A 3H1HD 1JKQC 3ZR8X 5TISC 1LWUA 4A0XA 5FLXK 1URQA 1BIBA 2CJJA 1LTGC 2YMKA 4MGRA 3GW6A 2KP8A 1NTKJ 5BU5A 3GZ6A 4N78D 5M5WJ 2Z2SB 2M7BA 1X3ZB 2XGCA 2IT0A 4PD4D 2L0KA 1R71A 3Q1MA 2NPSD 3EQLF 1S5LC 3NEUA 2ZJ2A 1OZHA 1P84H 2K27A 2MYSA 1N25A 4BRYA 3FM5A 5D8KB 3KP5A 3SZPA 2XROA 4IX7A 3F72A 1D5YA 2ZC2A 3RPUA 3AE2C 2IZ1A 5E79C 3CXHD 5CCGD 4RM3A 1HF0A 3OYAA 2E2IJ 4U7DA 1JTXA 2CQNA 2M5AB 4M6XA 4UB8H 4X1EA 1QL1A 4L9TA 4M74A 1EA3A 3M9HA 1NTMG 2XF5A 2CG4A 1WJCA 5E8GA 5GP9A 3GG2A 1MZ9A 2O0YA 5D4RA 1VF5D 2LOOA 1JE8A 4XIDA 4AIHA 1FTTA 4UB8E 4FISA 4Y99C 2NAZA 2FOKA 5KLVJ 1NTCA 3DLAA 1OW8A 4MEXF 4FE4A 4Z2YA 2NVXJ 3E6BA 1NU1K 3LSHA 1Q90D 4L73A 5J1UA 3LWFA 2AXTC 2KZVA 2JJLA 4ABZA 4D7MA 1QVUA 2FKWB 1ORKA 2XAGA 2WSFJ 1EZVD 1IXRC 5IOZA 5LBQA 3HOZJ 1WFXA 4I01A 3U21A 3L36A 1MBHA 3AE1C 3HXLA 1R22A 2OU2A 3IH4A 3A0BC 4MFDA 3FWLA 2CQKA 5IT9K 4JOMA 3FZVA 1BI3A 4I0AA 4PV1C 4B1RA 4OIRF 1Z7LA 3TO7A 1K8AQ 4EJVA 3HTSB 4WXCA 2YMYA 2OC6A 2EIKH 3ABVC 1BGYE 2B9SA 4II3A 1YTZI 3K2AA 2DPDA 5HDKA 5DUIA 3L75E 2UUZA 3DBRB 4LLLA 1GXPA 3G1MA 3O3KA 2KIQA 2A5YB 4KJZA 3TL4X 1G8XA 4WWIA 1BE3J 3B5ND 4BXLA 3HZJA 1HSTA 1NTME 2XDVA 3TW6A 1K83J 4D1QA 3WGGA 3U2RA 1G59A 1GL2C 2VJ5A 1W5CC 4IJAA 1O3RA 2J58A 2YR2A 1P4XA 5EGOA 1RF1A 3AE7C 5D5VB 1SQPG 2E75D 3V4WA 2K02A 4N4NB 3G2BA 4AVZA
chains in the Genus database with same CATH topology
3Q9SA 2ELHA 1DPRA 1IN8A 4KICA 3QPHA 3AAFA 3QOPA 2P6SA 4P5OA 2VT2A 3PFIA 2IP2A 3KZYA 4D0PA 3RI4A 3QRFF 3CDHA 1J2XA 1REPC 4RAZA 1KQ9A 1NHAA 4FHTA 4Y15A 3BJAA 2PN6A 2DK8A 2MD5A 4UV9A 3BROA 4WX9A 2HWVA 3WTXC 2W85A 2ISYA 3Q5FA 3I5UA 2IPQX 1IN5A 2KJBA 1K78B 1J0RA 1P4AA 3F8CA 4M73A 1HKQA 4N9IA 1W4MA 1KYZA 1SD4A 3CO6C 4HQEA 4HOBA 5K5QA 4TV7A 4M72A 2Q2EA 2M5WA 5FFXA 3FM3A 1ONVA 2MA3A 1I6XA 1BM9A 4DQ2A 1K6OA 2O6GE 2DW4A 1PP8F 3BWGA 2EFOA 1EH8A 1YTYA 4G7OF 2V9VA 1XMAA 1HKTA 2NS0A 2Y75A 1U78A 1FYKA 3T8RA 4EJTA 1IXSB 3ECOA 1FYMA 1TQPA 1VTNC 1DUXC 2ACJA 2VONA 5E8IA 2CO5A 2ADUA 2EK5A 2ZNYA 5ILSA 1BIAA 1G3WA 4OIQF 2W24A 4RGXA 3NRVA 2JSCA 2VE8A 4CICA 5E20A 4P96A 3P9IA 5CVRA 2CW0F 2QQ9A 5LLQA 4ZYEA 5ED4A 4MTDA 1ZHFA 1IN7A 4P9FA 1UCRA 3H3UA 3KP6A 2M8EA 1Z05A 1XN7A 1BOAA 2QUFA 3MQ0A 2ISZA 5BQTA 3P9KA 3CUQA 3MCZA 4LMYA 5E17F 1I1GA 1OR7A 2B0LA 1TLHB 4Q4ZF 2GAUA 2J5PA 2QQBA 2HTJA 1ZG5A 2V79A 5F6FA 3RYPA 1IF1A 3DV8A 3WE2A 1KU7A 3L09A 3IC7A 3GX4X 4BHPA 3MAJA 2GA1A 4ESBA 1XDUA 3B73A 3GFJA 3N4MA 1Z1DA 4KIBA 3ZN0A 3F6OA 4NHJA 3GEZA 2FF4A 4A2UA 3K1PA 4RS8A 2AS5F 3R6SA 4XRFA 3FX3A 1SFEA 2GIVA 1OMIA 1RUOA 3J81K 5DYMA 5K5OA 1R1VA 3ISPA 4B8XA 1LNWA 2C6YA 4ENMA 1S3JA 3ZMDA 3QP5A 5D5UB 1T39A 4BHBA 4IRGA 4IHTA 3F21A 2RQPA 4WXHA 1U8RA 4AWXB 2E1NA 5E1XA 5JFRA 2P4WA 1ON1A 4KMUX 2EFNA 2FRHA 2PJPA 4IHSA 3I64A 2YX4A 3IRQA 4I0BA 4RGSA 1QZZA 5FD5A 4M71A 4BYYA 5KK1A 2HYFA 3I59B 2DTRA 2UXXA 2QZ8A 3ZMZA 3P7NA 2UWMA 3ABTA 1R36A 3COAC 2YPRA 2FU4A 1MGTA 4PZJA 4DNCA 4FT8A 2ZO4A 4MHGA 3WG9A 5JI6A 1LEAA 5CJ9A 1KA8A 2G9WA 5A2QK 3ROUA 3J80Z 1FBSA 2MC3A 5JVTA 1QBJA 4EV0A 5FFZA 4L18B 2KJCA 2PLYA 1OPCA 4YFKF 4M6YA 2XVCA 4XLNF 5DCFA 4FX0A 5J8FA 3T1BA 2Z33A 2XKOA 3E5QA 1XSDA 1R5GA 5LGUA 3PQKA 1ZRFA 1G6NA 3I71A 5CVVA 4G6DA 2E1CA 4LJZF 5ICCA 3RYRA 2G7HA 5ICGA 4CO8A 3TOBA 2STTA 1BI1A 1UB9A 3TQNA 2O3FA 2GA2A 1QZYA 5HVQC 1KU3A 1P92A 3REOA 4G7ZF 2RVCA 1IN6A 3WTSC 2VN2A 5HDNA 4AIJA 2O8XA 1O57A 4UXNA 4MTEA 2L54A 5BOXA 1PUEE 3GWZA 2PBIA 2HDCA 4HF2A 2M1BA 2JT1A 1WWXA 2WV0A 4IPAA 5FLXZ 1YIOA 2BBYA 1TW2A 1FBUA 2MH9A 1BC8C 4GCVA 4YG2F 1J9IA 4PDKA 1LQ1A 1U5TC 3C18A 2RV8A 4EGYA 2A68F 4N0BA 1USTA 5AIQA 1ZREA 3BY6A 5LGTA 2A6EF 1JHHA 2PEXA 3DXJF 2XKPA 2HZTA 4U0VA 2OZ6A 2CYYA 4BQAA 3RJPA 1XGOA 4EQQA 2H27A 2BE5F 1YG2A 1V3FA 4OU0A 2Q8KA 5IT9Z 4A6EA 1WKMA 2DBBA 4UVAA 1D5VA 1TQMA 1D8KA 2QYOA 1ODDA 2IW5A 4LGWA 2A61A 1E17A 2Y48A 1MKMA 3BOQA 3BP8A 1H9GA 2ETHA 1P6RA 1O3QA 1HW5A 4E70A 1UHWA 1GXQA 1AWCA 3T8TA 1MJ9A 5JHUA 2PI0A 1OKRA 1U6GA 2H6CA 4HLYA 1TBXA 3ZPLA 5BMZA 4FX4A 2L4AA 4BH9A 2KIUA 4EM0B 1W7PD 5K5RA 1YW8A 1YW9A 1T0FA 1C0WA 4ZZDA 2BV6A 1ZRDA 1LB2A 1HSJA 2GXBA 4Y17A 2OBPA 4YIIA 3VB2A 3HHGA 5L3DA 2ZKZA 3CUQB 3HOTA 3M9AA 1F5TA 4EMSA 1AOYA 3TO6A 4UHTA 2A3SA 4B09A 1S7AA 1USSA 2P6TA 3GFMA 3FMSA 4WCGA 2XAHA 1L0OC 1Z9CA 4OIPF 4EVIA 4UUVA 4MQVA 1G3YA 5LGNA 3WU1B 1LVAA 2FEZA 1XDSA 4L9NA 1OYYA 2ZMEA 2RN7A 4Y13A 4CDGA 1I27A 2BYVE 5JR3A 4HF0A 4H0EA 1HW2A 1SFUA 4A12A 2XGXA 4UNOA 4HYEA 1FOKA 1EH7A 2LNBA 3KFWX 1CF7A 4XSZF 1KU2A 2WTEA 5HLHA 2HKOA 3WODF 1YFHA 5HS7A 3FXRA 3ML6A 2EV6A 1GVJA 3LQRA 1P2FA 2XUBA 5L3FA 3WGIA 3R60A 2QLZA 4I02A 4IRIA 1R00A 4KFCA 2CWEA 1JXSA 1TW3A 4HX7A 5LRSA 2DQLA 4P55A 1QNTA 1B1BA 2L3DA 3GW2A 4RB2C 5EEGA 3RPQA 2DI3A 2FA5A 4G6QA 1KQ8A 4HF1A 1S29A 3DPTA 4A6DA 3WTTC 4BHCA 4XBFA 1S8NA 5FO5A 4EJUA 2EWNA 3F23A 3C3WA 5DCMA 2PMUA 2V1XA 4HAMA 1R1TA 1R58A 4M9SA 3OOPA 1IN4A 5DUKA 2Z9OA 4L9VA 4RGRA 4HX8A 5LHHA 1OYIA 5HDGA 3HIFA 4GXOA 1XMKA 1O7FA 5D6EA 2NNYA 2QQAA 3F8FA 3V7RA 2V6CA 2CFXA 2OA4A 3BJOA 2GQQA 4HW0A 4I98B 2MLKA 1BI2A 2WC2A 4NB5A 2F5FA 1XD7A 4NQWA 1FX7A 1LJ9A 2OAZA 3DQVC 1FNNA 2COMA 5H20A 3J81Z 4WK8F 5D6FA 4S05A 2W84A 1J7KA 1MDMA 3CTAA 3TO9A 2GZWA 5LHGA 3L7WA 4R1HA 2FXAA 1FY7A 2DFIA 3KP4A 3KCCA 3JW4A 5F64A 4QLCU 3SXYA 1FSEA 3RDIA 4U0WA 1Z6RA 1YYVA 3KEQA 3WE3A 4WWCA 2JPCA 5ICEA 3EDPA 1YO5C 2CSOA 2Z3YA 3OV8A<