2GA1A

Crystal structure of a duf433 member protein (ava_0674) from anabaena variabilis atcc 29413 at 2.00 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
MNKKTQLLEVIAALPEELVDQALNYVQMLQNPIQITPGVCGGQARIRNTRIPVWTLVAYRQQGAPDKELLANYPGLTAEDLSAAWHYYEQNPEQIDREIAQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of (YP_321193.1) from Anabaena variabilis ATCC 29413 at 2.00 A resolution
rcsb
source organism Anabaena variabilis
molecule tags Unknown function
molecule keywords Protein of unknown function DUF433
total genus 30
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04255 DUF433 Protein of unknown function (DUF433)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ga1A02
1.20.5.800 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Alr1493-like domains 2ga1A01
3T8RA 1SAXA 4EV0A 1KA8A 5HVQC 3E5QA 2A69F 4IPAA 1XGNA 2FOKA 2EB7A 1XGSA 3ERED 1K7AA 2VE8A 2WC2A 4G94A 2CFXA 3V8LA 1OYIA 3O3KA 5E1ZB 1ZYRF 4IF4A 2HKOA 4KMFA 2O6GE 2LSOA 1FYMA 1S8NA 2ZNYA 1JE8A 2RDPA 2ESNA 1USTA 2ACJA 1T98A 2WV0A 4B8XA 2GA2A 2KIMA 1K78A 3HSEA 3EDPA 4N9HA 3ROUA 1W7PD 2ZMEB 3K0LA 5HS7A 1E2XA 2DPDA 1LJ9A 5D5XB 3ML6A 3O6BB 4Q48A 3ZP5A 4TV7A 3IRQA 3GEZA 3E97A 1FBSA 2WWYA 5LRRA 4U0YA 5FGMA 3KZYA 3CUQB 3LQRA 3QP5A 3TDUC 2L4MA 3LAJA 3D0SA 3LQQA 4NQWA 3KZZA 5D4RA 4WX9A 4EJTA 5LGTA 1SFXA 2FQ3A 2VBWA 1SD5A 3MFKA 1YS6A 2P5KA 5DUKA 3C18A 3SQNA 2QBYA 1VTNC 1G3WA 5LEKA 1ZG5A 4RS8A 4MGRA 5FLXZ 2VC1A 3SFZA 3WTXC 5HS8A 3ZMUA 1XSXA 3E6MA 1C0WA 3J7AO 2DLLA 3TDZC 1BC8C 1YIOA 2OZ6A 2R7FA 3NEUA 1QNTA 1JHHA 3K1PA 1P2FA 2PMHA 4ZYHA 5LLQA 4IJAA 3V8KA 3ZPLA 2PMUA 4A6DA 3ZMDA 2NAZA 2F5EA 3K1MA 3WU0A 2DT5A 5CVUA 4L5JA 4FT8A 1S3JA 5KVRA 5AIQA 2P7CB 2V1XA 4KMUX 2BGCA 4R79A 1KGSA 2OZUA 3R0JA 5LHHA 1IN4A 5J8CA 5ILUA 1XGMA 4R8HA 4OINF 4B09A 1G6NA 1R1TA 4Y15A 3RPQA 5DV5A 1ZARA 6PAXA 2LDUA 1CF7A 2DK5A 3WTVC 2LF7A 1W7PA 1HKTA 1O3RA 2O8XA 2QQAA 3IKVA 4JK1X 4M9XA 1BM9A 1RUOA 1BIAA 2V6CA 2XHKA 1U5TC 1YQAA 1IF1A 3GZ6A 3T1BA 4EJOA 2YPRA 2JTVA 3R61A 4KDPA 4XLPF 3WTTC 3FXUA 2H6CA 4G8XA 5DDGA 5D8KB 1ZREA 3BROA 2CW0F 4KICA 2AS5F 1STZA 2DU9A 1DPUA 3FWEA 3RPUA 3KP3A 3FF5A 4HLXA 4WXHA 5IT9K 3RIRA 3MCZA 1R58A 4HQEA 3WU1B 2OBPA 4O6JA 1R1UA 2ZMEA 1GXPA 3F72A 5CJ9A 1I5ZA 5DCFA 4M73A 4YG2F 4XRFA 2ELHA 1J2XA 4M6XA 3HOSA 5F6FA 1O7LA 4KUMA 3SZPA 4Q47A 1FOKA 4NHJA 1FLIA 1K6OA 1WWXA 3LAPA 2MLKA 2XKOA 3I0TA 1R7JA 3GFLA 4AIKA 1BI2A 2A6HF 4KIGA 3IKTA 2DQRA 4OIQF 2FF4A 2QUFA 3CUQA 1HKSA 4RB0A 4EGYA 1ZN2A 4OIPF 1W5SA 2NNYA 3M8EA 2HWVA 1JXSA 2AXLA 2V79A 5AIPA 2QWWA 1LDKB 4P96A 2DK8A 4N9IA 3K1NA 1FP1D 2W85A 3RKXA 2UXXA 1RIOH 2MH2A 3KE2A 1YLFA 2K02A 2VBXA 4D0PA 4QWQA 1S7AA 1I27A 1ZAOA 4LG0B 3EQLF 1XDSA 2Z3YA 4HX8A 2COMA 3JTHA 4ZYEA 4G6QA 2CGPA 3LA2A 1P4AA 3RYRA 4G6DA 5CVIA 3U2RA 1U8RA 2ZO4A 3I71A 3V4GA 4RB3C 2XUBA 3ABTA 3ABUA 1USSA 3M7GA 3KP2A 1LB2A 2A5YB 3GFJA 4LFUA 3F8NA 3JSPA 2W84A 2EA4A 4KT5C 2PFBA 4O5VA 1TNSA 1J0RA 1ZHFA 3V7CA 1TLHB 1KQ0A 5D5WB 4GYIA 2P5VA 2HOEA 2DI3A 4RGSA 4ENMA 1E17A 5K5QA 3QU3A 3T8TA 4CO8A 2Z99A 2C6YA 1BOAA 1CF7B 3TQNA 3VODA 5LEJA 4EJUA 4A0YA 5L3GA 4HX4A 2B0LA 1W7PB 4E70A 3KP4A 5J6XA 1SD6A 3F6OA 2BEOA 4PGHA 4UXNA 3WODF 4A0ZA 3LSTA 2IP2A 1W4MA 3HTUA 1IRGA 5TJJA 2PJPA 5HDKA 1B4AA 4OMZA 2Y0MA 3ZN1A 3KP7A 3EYIA 2G7HA 4EMSA 5JFRA 2A6EF 2GXGA 2CSOA 5ILSA 2Q0OA 3WG9A 1KU3A 2KIUA 4I09A 5ICGA 3R6SA 3K2ZA 4P55A 1SFUA 3VOEA 2XAJA 2MH9A 5BPDA 4JBAA 2D1HA 2EV6A 1T2KA 1KYWA 4U7DA 1BN5A 5IT3A 3F22A 4HBLA 1YO5C 2XAFA 2ADUA 3WTUC 3TOBA 3BP8A 3GLXA 3HRSA 1RI7A 1B59A 3L00A 1S6LA 3E6CC 4I2OA 2ZFWA 5ICFA 2A61A 5FD5A 3LA3A 3SZTA 1FZPB 3IC7A 4UVCA 5ERIA 1Y0UA 1ZRDA 4ZYDA 2GWRA 3BZ6A 1F5TA 4KN7X 2CG4A 4YFXF 5ED4A 1HSJA 4WXDA 3N4MA 4G7ZF 1XCBA 2K27A 4GO1A 4WK8F 2OU2A 4EQQA 4YIIA 4YIFA 1J75A 1IRFA 2IW5A 3I64A 1KQ8A 2OD5A 1U5TA 4I0BA 4UVBA 3LFKA 2YX7A 4OOIA 2GQQA 1OYWA 1FSEA 4I98B 1U3EM 3F3XA 5BOXA 1ZG3A 1J9IA 2XGXA 3P9IA 4GXOA 5CVJA 1YS7A 3T0YA 5E1WA 3TKYA 3KP6A 2DQLA 1Q1HA 5ILVA 4EJVA 3HRTA 4Y17A 2QM3A 1MD0A 3E3VA 1XB4A 1WI9A 3R4KA 4CHUA 1BI0A 2ZXJA 1RZ4A 4ENNA 5H20A 1YW8A 4RGUA 1D8JA 4IHTA 5H6QA 3M1EA 1JHFA 2RQPA 3DFGA 2XASA 4IHSA 1CGPA 5FO5A 2QVOA 2O3FA 1HSTA 3ZMZA 1TQMA 5JR3A 3KFWX 5TRDA 5D5UB 3QRFF 2J5OA 2GXBA 1X3UA 4BXUA 5E18F 4LG0A 3WTSC 3BJ6A 3DPTA 5AONA 1IZ1A 5D6EA 4IRIA 4ZZDA 2FE3A 2K7LA 5FFZA 5LHGA 3H92A 2VONA 3F8FA 1G3SA 3GW2A 2LF8A 4ON0A 5E1XA 2RNJA 1K78B 5J8FA 2F5FA 4U0VA 2W24A 2G9WA 3KLNA 4WWCA 4WF2A 5FD6A 3JSOA 2M87A 1BJAA 3J81K 1R22A 1OYYA 4RB2C 4L0ZB 3DKWA 3FXQA 3GFIA 1G3YA 4LB5A 2ISYA 1F1ZA 2FMLA 5E20A 1TW2A 2H6BA 1MGTA 1UFMA 1HQCA 4ASNA 5JHUA 1P6RA 1P4WA 3GWZA 5D4SA 3B02A 2Y48A 5LHIA 2QYOA 2FMYA 2IA2A 2XIGA 3G73A 1WSUA 2CO5A 5IT9Z 1ON2A 1HKQA 1FC3A 4OIRF 1FYKA 1P4XA 2DTRA 4HLYA 1XCVA 2M45A 1MDMA 1LNWA 3Q5FA 3HUGA 4XSXF 3KEQA 3M8FA 1MJBA 2DBBA 1BI3A 1FX7A 2GAUA 2F5DA 4L5IA 1L0OC 2RKHA 1O3SA 1W5TA 1QQIA 3M9AA 5FB2A 2OQGA 4M9ZA 3JTGA 2E1CA 3FMQA 1R00A 4BQAA 1QO0D 1QGPA 2HQRA 2EWNA 2A3SA 4A12A 1V3FA 4ESBA 1SD7A 4R1HA 3S2WA 5ICCA 2BE5F 2ISZA 1YG2A 2IA1A 1XD7A 3C3WA 4U88A 2Y75A 5JI6A 4ESFA 1A04A 2GZWA 4Y13A 1S29A 1ZH5A 4UV8A 1I1GA 2VXZA 1ZLKA 2E7XA 2EFWA 3WGIA 2LNBA 1SD4A 2VT2A 4I01A 3EUHA 2HYFA 1PUEE 4HZFA 3NRVA 4BHCA 3BJOA 3ECHA 1FWZA 5F1RA 4WCGA 3DV8A 3KETA 3HTSB 3JAMK 1OPCA 1FT9A 3L9FA 3MZHA 2EFPA 2H94A 3RYPA 4KIFA 4RGXA 3CO6C 5D6FA 5BS6A 3HIFA 4LD5A 2L02A 2PN6A 2IVMA 4MQVA 3H3ZA 4ETSA 1TBXA 4BH9A 1ONVA 1V4RA 2FNAA 5CVRA 1MDMB 2PEXA 2DPUA 1T38A 3CUQC 3U9GA 3RDIA 3I58A 3RJPA 1GXQA 3F8BA 5DCMB 3F8CA 3GYHX 2MA3A 2VBZA 5CLSA 2FSWA 3IHUA 2NS0A 2PLYA 4HV5A 2QZ8A 3IWZA 1ZGJA 4GYGA 3E5UA 5HDGA 4QLCU 1FNNA 1AWCA 1IW7F 2XKPA 4EJWA 1ODDA 1YTYA 1GHCA 2FRHA 3OV8A 2Z33A 2P5LC 3QU6A 4FHTA 5A2QZ 1XMAA 2HGCA 3I59B 5F64A 2J5PA 1DPRA 1EH6A 2DFIA 2IJLA 5DYMA 3SXYA 2K4JA 2V1UA 3BOQA 3P7NA 2KRFA 4A5MA 4P5OA 2VC0A 3PQJA 2K4BA 4KFCA 4HYEA 1UB9A 1HBXG 4MEYF 4ZYGA 1KYZA 1XSDA 4P9UA 3G3ZA 2HEOA 2Q8KA 3I4PA 3FM5A 3P9KA 4AWXB 2QLZA 4I0AA 3GVAA 2FBHA 2W57A 2Q2EA 4WXCA 2M30A 2VOPA 3GO5A 2ZBKA 2D1VA 2HTSA 3WTZA 1R23A 1R36A 4RB1A 3HHHA 3BWGA 4IVNA 4BAYA 2WTEA 2DAOA 2CYYA 3QPTA 3GUDA 1O57A 2UXNA 2XV4S 2YU3A 1FBQA 1O3TA 4IRHA 1NHAA 4LB6B 2YR2A 4HOBA 2MBFA 1AOYA 1QBJA 4KN4X 1UHMA 3I53A 4LLGF 1Z1DA 1FPQA 2ZJ2A 2VT3A 1MKMA 4KNYA 4LLNA 4UNOA 1EV7A 2M8EA 3ZN0A 4ZZLA 2EFQA 3DP7A 1TNTA 1TTYA 4S05A 4PZJA 4LGWA 2O0YA 3MEXA 1GVJA 3FM3A 5L3BA 2HS5A 1XDUA 3RI4A 5BPIA 4N0BA 3I5UA 3GX4X 3JAMZ 2CQKA 4UV9A 3T5XA 5HS9A 2P8TA 4HDUA 5HOOA 4IRGA 3PQKA 3FHZA 4RAZA 4BNCA 3HRMA 4M74A 5EEGA 4I02A 1IUYA 4M71A 1HW2A 5D8LB 3V7RA 2FEZA 3FX3A 1Z7UA 2Z9OA 2QQBA 3DQVC 4RAYA 1LEAA 2RVCA 4HW0A 3E5XA 2NYXA 1BI1A 2HFHA 3C1DA 4HF0A 3W6JB 1YFHA 3F21A 3TGNA 5E8IA 3DPLC 4Q5SF 1Z05A 1FSHA 2EA2A 2UWMA 2OAZA 5E17F 4L9NA 3WE3A 3HRUA 5HLHA 4CGZA 4G7HF 3REOA 2LKPA 4L0YB 2P6SA 3MAJA 2NRAC 4MQ9F 2V1DA 2P7VB 5FFXA 4ZH4F 1ULYA 3N97A 2RC4A 2HTJA 2HQNA 3RTRA 1XSVA 3DF8A 4F7ZA 4U7BA 2L54A 1ZRCA 2KJCA 1O3QA 3ZMSA 3TO9A 4CICA 2X0LA 3FZVA 3IL2A 3QPHA 1Z91A 3CJNA 2VOOA 4A0XA 3GFMA 2FA5A 1R5GA 2DW4A 3L09A 2IRFG 2QBYB 4H0EA 1LQ1A 4HA8A 1YYVA 3BPXA 4G9YA 3HOTA 1WKMA 1PDNC 4BHPA 1HW5A 3KEOA 1KU7A 1JGSA 2JPCA 2D45A 1QZZA 1LDDA 1IN8A 2EV5A 2JPBA 3LWFA 4KYWA 3QOPA 4OMYA 1SMTA 3I54A 1FBUA 1QPMA 1J59A 1BC7C 5EEHA 3C7JA 4FX4A 3EETA 3VB2A 5CVVA 2FBKA 3MWMA 5DD4A 4MTDA 3F6VA 2FNPA 2W25A 1T0FA 2K86A 2KKOA 1J7KA 3Q9VA 2H09A 4CYDA 3WGHA 2VN2A 3CTAA 1ZLJA 4L9VA 1KQ9A 3TO7A 4OU0A 3HHGA 1WQ2A 1MJAA 1PP8F 2GIVA 3VEPA 4MNUA 1ZGAA 2E7WA 5DD8A 1ZRFA 4CZZA 3J80K 2P4WA 4M6YA 2BBYA 4Z2YA 2HDCA 2O61A 4O3MA 4A5NA 1G4DA 2IPQX 4M72A 3WTYC 3CO7C 4XSZF 1DDNA 2M1BA 2RN7A 1LDJA 5LRSA 4HF1A 2EFNA 4HQMA 4FX0A 4EM0B 1PP7U 4BYYA 3QAHA 3DXJF 2PG4A 3R0AA 3WGGA 5ICEA 3BDDA 3ISPA 1IXCA 1UCRA 3F8MA 4AVPA 4MEXF 2OQRA 3L2CA 1XGOA 4XLNF 1U6GA 1QZYA 3LA7A 3IWFA 2XVCA 1T6SA 5E8GA 3J81Z 3IRRA 3P9CA 4EVIA 3FMSA 3GF2A 3MZYA 4RGRA 3NQOA 2XRNA 4G7OF 2PBIA 5FLXK 5HDNA 2CWEA 5BMZA 1U78A 1HXDA 1REPC 1U2WA 2DO7A 4P9FA 2F2EA 3GXOA 1TQPA 4YFKF 4XBFA 4HX7A 3TO6A 4EM2A 4EGZA 2A07F 1D5VA 1IN7A 2JSCA 1ON1A 3RKYA 5A2QK 4PCQA 3U1DA 1R1VA 4YFNF 1XN7A 1LVAA 3D5LA 2QQ9A 2VODA 4LLLA 3QP6A 4L18B 3K69A 1FY7A 2FXAA 2TDXA 2Z5UA 1SMYF 2BYVE 2XAHA 1Z6TA 2E1NA 1B9NA 2QENA 3V8JA 1TQIA 2XROA 5K5RA 4IXAA 3ELKA 3VFZA 1T39A 1WRJA 1OKRA 2MD5A 1MJ9A 4AIHA 2EK5A 1YW7A 2M5WA 3MQ0A 2HKXA 1Z6RA 5L3FA 1IXRC 3EYYA 4MTEA 2O03A 1H9GA 1ZG1A 4L9TA 3CDHA 1SFEA 3KLOA 1LEBA 3GZ5A 2G7UA 4S04A 1BBYA 4PGGA 5LGUA 4UUVA 3I59A 5HLIA 2VE9A 2YX4A 1IN6A 1I6XA 4KIBA 4LMYA 1RUNA 2FBIA 3Q9SA 1KU2A 2VBYA 3J80Z 1D8KA 2UZKA 2ZNZA 1H9TA 2FU4A 3BJAA 1MZBA 4GGGA 5LGNA 1IAWA 3WTWC 4AD9A 3BY6A 5HLGA 3CUOA 2JT1A 5DEQA 3B73A 2EV0A 5DCMA 2STTA 1FP2A 3JW4A 5BQTA 2IA0A 3O2PE 4Q4ZF 2EFOA 4CXFA 2XAQA 1U5TB 1S7OA 1F9NA 5D5VB 3HYIA 1F4KA 4A6EA 2R3SA 2GA1A 3FXRA 4HF2A 2ZCWA 4GCVA 4BHBA 3TOAA 5JVTA 3R60A 1P92A 1J5YA 5LBQA 4NB5A 4U0WA 4ENKA 5L3CA 2L01A 3HSFA 4EM1A 3H3UA 2HYGD 2OA4A 1Z9CA 3E6BA 3KCCA 2H27A 2F5CA 4OIOF 2KJBA 2HZTA 2NNNA 4UVAA 3SHFA 5DUIA 1BIBA 1G3TA 1H0MA 1OR7A 2HR3A 3ECOA 1FYLA 5K1YA 2ZKZA 3V7SA 3ZMTA 3KP5A 3HSRA 4L9JA 1EH7A 4KA4A 3E6DA 1L3LA 4I7HA 2STWA 2IT0A 1O7FA 2L4AA 3K9TA 1K79A 2RV8A 4LJZF 3OOPA 5L3EA 1B1BA 2JZYA 1DUXC 3F23A 2V9VA 1DP7P 4ESJA 5H6RA 2XAGA 2PQ8A 3ZMVA 3WE2A 1UHWA 2PI0A 3ZQ7A 3DEUA 3FMRA 1YW9A 2YSRA 1RNLA 1TW3A 1B9MA 3L7WA 4LK1F 2L3DA 4LK0F 4MHGA 4AIJA 3RKWA 4A2UA 3CLOA 5KK1A 4K2EA 4DQ2A 2X4HA 3BPVA 4HDVA 5L3DA 2BV6A 3ULQB 1D3YA 1R5HA 3COAC 3W6KB 2ESHA 2A68F 2P6TA 2D2WA 2EJRA 2KIFA 3AAFA 2ETHA 1IN5A 1EH8A 3PFIA 4HAMA 4JQFA 4UHTA 1B6AA 4HV6A 2MLGA 1KU9A 4PDKA 1HW1A 5K5OA 1XMKA 1IXSB 2RGVA 4M9SA 2R7DA 4DNCA 2MC3A 1I1SA 4CDGA 2JRTA 1OMIA 5CYVA 4ENJA
chains in the Genus database with same CATH superfamily
3T8RA 1SAXA 1OWAA 4EV0A 4OVNF 4CCJA 1YE9A 4IQ4A 4NC6A 4BEHB 1KA8A 1WHUA 3W3CA 4BY1J 2R5ZB 1VF5C 5IOYA 5HVQC 3H32A 3E5QA 2A69F 4IPAA 1VQ4P 1XGNA 4V2GA 3CL3D 2DT7B 2FOKA 1NK3P 1MMSA 1APLC 2EB7A 1K61A 2WPSA 1XGSA 3ERED 1K7AA 2J59M 3H1LE 2WAEA 3EUHC 2VE8A 3DTKA 4DT0A 2WC2A 4G94A 1YQ4C 1UZCA 2CFXA 4RM3A 1EXIA 3V8LA 1OYIA 3O3KA 2VJ4A 5E1ZB 1BL0A 1PGPA 3H1KE 1VQ7I 3HD7A 4CCMA 2UWJE 1USEA 1ZYRF 4IF4A 2HKOA 4KMFA 1T2KC 2O6GE 2Y9ZA 5FLVA 2LSOA 1PZQA 2JKVA 3RK3D 1FYMA 1S8NA 2ZNYA 1JE8A 3L74G 1JMBA 2CFOA 1JKRC 3S2HJ 2RDPA 2WTYA 3A1YA 1YYCA 3S93A 2E76C 4HG2A 2AHQA 3LSPA 1M1JC 3CCVI 4E7KA 1NK2P 2ESNA 5J1UA 5K7HA 1USTA 2ACJA 1T98A 1WJDA 1IJDB 1WZ2A 2GLOA 2WV0A 3BZKA 4XRSG 3A3YB 2HQ5A 2JDIH 2CS3A 3SZGA 4B8XA 2P58A 4XONA 2O8KA 1X3ZB 3QH9A 2GA2A 2KIMA 1K78A 3HSEA 3HB9A 3K4BA 3I55I 2R5YA 1L4AD 1URQB 3H1LD 1TWAJ 1JOCA 2OARA 2Q3EA 4PD4H 1CI6B 3MKZA 4A3CJ 1LWUC 2F6CA 3EDPA 1NTKK 1EXJA 4N9HA 1L0NK 3ROUA 3VYRB 3CCUI 1W7PD 2ZMEB 1NAYA 3K0LA 2IDBA 1SQBJ 2YKOA 2VKDA 5HS7A 1E2XA 5F04A 2DPDA 2A45G 2YMKA 1SQBD 4JP0A 1V5EA 1LJ9A 5D5XB 3ML6A 3KZIH 3O6BB 1NTZG 3A0BE 2AEJA 4Q48A 3ZP5A 3MZWB 3C1LA 2DODA 2YKPA 4HB1A 3B6AA 2ECBA 4TV7A 5J3LA 3GEZA 3IRQA 3E97A 3OYAA 3ZR8X 2O7OA 2PMZA 2KPMA 1FBSA 3OA7A 2WWYA 2K9LA 5CCHC 3OYGA 3S16J 2MGQA 5JLXA 3OY9A 1DU0A 5LRRA 2K1AA 4DBRA 5FGMA 4U0YA 3KZYA 3CUQB 3LQRA 1Y8AA 2BEQD 1OCTC 2FFDC 1T8IA 3QP5A 5FKKA 2CRGA 3TDUC 4I76A 2L4MA 3LAJA 3D0SA 3LQQA 1SQVG 4NQWA 3RL0C 2B88A 3KZZA 5D4RA 1FMWA 4WX9A 2B89A 4W7YA 1N2DC 4EJTA 1J2JB 2J58A 5LGTA 1SFXA 3P32A 1H0TA 2FQ3A 2VBWA 2CUFA 3LW5J 3RPUD 3TNUA 2AXTE 1SD5A 3MFKA 2TCTA 2P0WA 1YS6A 2P5KA 5DUKA 2L9VA 3CCQI 2CUJA 4K35A 1Z3XA 3C18A 3K70C 4WBAA 2W48A 3W6VA 3D5SC 3SQNA 4C3IJ 1VTNC 2QBYA 1G3WA 5LEKA 1ZG5A 1FDMA 2HDWA 2RH0A 3HUGB 3L71J 2HNHA 4RS8A 4MGRA 1OCCH 5FLXZ 2KSJA 1FOWA 1X4PA 2VC1A 1XG1A 3SFZA 1KYOD 1FBMA 1EKEA 1BCCG 1AKHB 1L2PA 3WTXC 5HS8A 1YJNI 3ZMUA 1E3HA 2O5RA 1XSXA 3E6MA 1SS1A 1C0WA 3J7AO 2DLLA 3TDZC 5AVQB 1MBKA 1BC8C 1KYOI 1JUMA 5C4XJ 2A5WA 2FOWA 2XZRA 2BHYA 2NVTJ 1ZRTD 3CCJI 1K05A 1YIOA 4A3GJ 3HD7B 2OZ6A 2R7FA 3NEUA 1QNTA 1HF0A 1JHHA 3K1PA 1ZTRA 1P2FA 2PMHA 3V42A 2BW3A 4YPCA 4ZYHA 3P8CD 2KLUA 5LLQA 1SQXK 2H1LA 4IJAA 3AE7C 3V8KA 3ZPLA 2AXTH 2PMUA 3GHGC 2FFDB 4A6DA 3ZMDA 4ZDPA 1PFIA 1LGHB 2NAZA 2F5EA 1Q1VA 3K1MA 3L70E 2QKLB 3TMOA 4XR6A 3WU0A 2OTJP 2DT5A 2DMNA 3EUAA 4I7ZC 3SFDC 5CVUA 5APWA 4L5JA 4FT8A 2HPCB 1S3JA 1IGNA 5KVRA 1N7SD 3OS2A 4Y7NJ 1IFIA 2IAIA 4ASVA 3II6A 1XTGB 3F89A 1V5FA 2HYNA 3L2WA 3A01A 5AIQA 2WADA 2P7CB 2V1XA 1WCMJ 4KMUX 5J40A 1NHLA 3TW6A 1ZR2A 4NUBA 4E7JA 3G4SP 2BGCA 3MUDA 3K4CA 3LSMA 4R79A 1KGSA 2OZUA 1KTMA 4DYQA 1UIXA 4M3GA 3HXLA 3OS0A 1VPCA 3H1IG 3H5NA 4B3XA 3R0JA 1BE3D 2Y2ZA 3KDPB 5LHHA 1IN4A 1SVLA 2X6WA 2DJNA 4AM3A 3ITKA 2OYIC 5CJ0A 5J8CA 2VXDA 1D0XA 4MFEA 1BGYD 1DH3A 4BJTA 5ILUA 5GTHE 1XGMA 2JR8A 2Z2SB 4U87A 1RR7A 4R8HA 1RF1A 2F4MB 4OINF 1XMXA 4B09A 3M91A 1FU1A 1G6NA 4XOTA 2PJRA 1R1TA 4Y15A 3RPQA 5B5EC 4PD4E 1QVFO 2CJJA 3CCEI 4RLFA 5DV5A 1ZARA 2P10A 2DYSH 6PAXA 1YJWI 1R6RA 1RH5B 2ZJRF 2LDUA 4GT1A 1CF7A 4H13C 2DK5A 3OJAB 3WTVC 2LF7A 1EDLA 1W7PA 4HRIA 1HKTA 1VQ6I 2EIJH 2O8XA 1O3RA 1J1DB 3BCCJ 2QQAA 1NU1D 3IKVA 2LH9A 3QQAA 1Y8RB 4JK1X 3OYLA 4M9XA 3H1KJ 3B6CA 2GM4A 1BM9A 3BR6A 1RUOA 3MGNA 1P84D 3FXKA 4F52A 1BGYJ 2Y30A 5KJ7D 1BIAA 2V6CA 4D6TJ 4QPQA 2XHKA 3LSKA 3HL2A 1U5TC 1YQAA 2M9HA 4PFPA 2DDAA 1IF1A 3SWFA 3GZ6A 5AVZB 2KQRA 3NFQA 3T1BA 3IUOA 2YPRA 2JTVA 3R61A 4EJOA 4E7IA 4KDPA 1FOSE 2M0CA 4XLPF 4A3JJ 2Y31A 3WTTC 3CWBE 1NU1K 3FXUA 1FMVA 2H6CA 4G8XA 5J1YA 2W00A 2FD5A 1AKHA 2G0EA 3L73G 2CQ7A 5GTHH 1EJ9A 2OCCH 3BR3A 5DDGA 1E3OC 1NWQA 1GTWA 5D8KB 2M7AA 1SVFA 5APTA 2KISA 2IS1A 1ZREA 3BROA 4PJNA 2CW0F 4OWRB 2WVRA 4KICA 3K10A 2AS5F 4ZJZA 5AW3B 5EJCA 1STZA 1XC5A 3LSIA 1U7JA 4B1RA 2ZT9B 2OYHC 3H0DA 2DA6A 4P1WA 3L72J 5AVXB 2DU9A 1H88C 1DPUA 3K5BA 3FWEA 1QRYA 3RPUA 3L73E 2GOXB 3KP3A 1LTIC 3OSGA 3MMYB 1ZQ3P 2CUZA 3CESA 2M7BA 2WB1N 2VI6A 1S2EA 3FF5A 4HLXA 1Y6IA 1VQOI 3KYQA 4WXHA 3HOVJ 4IHYA 5IT9K 3RIRA 3CC4I 1MH4A 3MCZA 1R58A 2QCOA 4HQEA 3KX2A 5GTIC 3WU1B 2W6BA 2E34A 2M4GA 1RETA 3FKJA 2OBPA 4DOZA 2QG4A 1FOSF 1ZK8A 4O6JA 4Y3OA 1R1UA 2ZMEA 1GXPA 5DJTB 3F72A 4XMYA 5GP9A 1JCDA 4GIFA 4Y99C 5CJ9A 1I5ZA 2VKVA 1KQLA 3VYSB 1LKXA 3HDDA 2W4SA 2XB0X 4B47A 5DCFA 1X58A 5APSA 3SFEC 4M73A 2P2UA 2KB7P 5BNGA 2QJKB 1SQVK 4YG2F 1A6QA 4EATA 1SFKA 1HJ0A 2X1CA 4XRFA 3GMEA 2ELHA 1J2XA 4M6XA 3HOSA 5F6FA 1O7LA 1JKPC 1I3QJ 1X1CA 4KUMA 3SZPA 3T97B 4Q47A 1FOKA 4NHJA 1E0EA 1FLIA 2JEEA 3OW2O 2KZVA 1K6OA 4IFFA 1WWXA 3LAPA 5CHXA 2MLKA 2XKOA 3I0TA 3MD2A 1R7JA 2HFED 3GFLA 1YJ9P 4ZNCA 4AIKA 3HUSB 2FXMA 2H43A 1BI2A 2A6HF 4XLAA 3H1JJ 1OX3A 2HXIA 3D5RC 3OR2C 4KIGA 2GUSA 2L5GB 3HUSC 1TT0A 2DQRA 3IKTA 1PPJG 2N1TD 3IH2A 2E2HJ 1NTMD 1NVOA 2VJIA 2L0KA 4OIQF 1SQPG 2FF4A 2AO9A 2QUFA 3CUQA 3S1MJ 1HKSA 4RB0A 4JX5A 4DJAA 4EGYA 3MZ8A 4JBZA 1ZN2A 1S9KD 4OIPF 1GU5A 1W5SA 3AE9C 2NNYA 3M8EA 2OCEA 4BACA 4U3FG 2HWVA 1LT9A 1JXSA 1SFCD 2YXRB 4BRYB 1X9VA 2AXLA 1YRNA 5APQA 4ZC3A 3VYTB 2V79A 5AIPA 2QWWA 4E7HA 3OYBA 1LDKB 2IZ1A 4P96A 2DK8A 1N73A 4N9IA 3E1SA 5F08A 4XQFA 3K1NA 3HE4B 2QEXP 1H8AC 2IS2A 2W6JH 1AVYA 2IS4A 1FP1D 3H1LG 2W85A 5EGOB 3RKXA 3BZCA 3NXSA 2UXXA 1LTJB 1RIOH 2MH2A 3KE2A 1YLFA 5M3FJ 3HE5A 2XU6A 5AW6B 3A5TA 2K02A 2VBXA 4D0PA 4ITVA 3X2QH 1QX8A 2OQQA 4F91B 2KRCA 4QWQA 1S7AA 3IAOA 1I27A 1ZAOA 2QF7A 2JWTA 3EQLF 1XDSA 2Z3YA 3KPHA 4LG0B 4HX8A 2COMA 1HA8A 4RA2A 3Q5SA 3MD0A 3JTHA 4ZYEA 3H35A 3EQ2A 4NPEA 4G6QA 1MV8A 2NRGA 1MBGA 5J4YA 2COBA 3LA2A 1P4AA 3M07A 2CGPA 1BA5A 4Y4RA 2FFDA 2QGUA 3ESWB 1VQPI 5BU5A 3CD6P 4YRVA 4RAGA 3RYRA 4G6DA 5CVIA 4IHXA 3S1NJ 5EDNA 2O9LA 3U2RA 1U8RA 1FDIA 2ZO4A 3I71A 1X1AA 4HSTA 3V4GA 2FXOA 1TWFJ 4RB3C 5E3OA 2XUBA 3FGAD 3ABTA 3ABUA 1USSA 3VSKA 3S2DJ 2O3JA 4ANJA 3HG9A 1VQ7P 2WSSH 4D1QA 2XKMA 2WY7Q 3M7GA 5KKZB 1YJ9I 3KP2A 1LB2A 2A5YB 2HDDA 3GFJA 4LFUA 3SFIA 3F8NA 1NH4A 4C3JJ 3H3VK 3JSPA 2W1OA 2W84A 2EA4A 4KT5C 3CCSI 3A02A 3DKXA 3HOXJ 4DJGA 2PFBA 3E7LA 4O5VA 1FZGA 1TNSA 1J0RA 4D9JA 5APYA 3K4LA 4ZDLA 1EZVG 1ZHFA 2X9DA 4BWNA 2HLOA 3V7CA 2EBIA 1TLHB 2I10A 1HGZA 5AW8B 1KQ0A 2BVMA 3QODA 5D5WB 3OS1A 4GYIA 2P5VA 3B5ND 3V2RA 4NPFX 2HOEA 5J47A 3G1LA 1N25A 2JVHA 5FKLA 3LMMA 1GL2C 2B87A 5K5GB 4EOTA 1UELB 1UG0A 2DI3A 4RGSA 2RMZA 3OYEA 2W27A 4ENMA 2XPVA 4TT3H 1MBFA 1E17A 1T6AA 2LRDA 1OCOH 1WRGA 2AXTC 5K5QA 1IJWC 3QU3A 3MKWB 3P8MC 3T8TA 4CO8A 2Z99A 3CMEP 1XX5A 3ZDMA 2HOAA 2C6YA 4PV1D 3I56I 1BOAA 5FROA 1CF7B 3TQNA 2JQ7A 2Y0EA 4FETA 3VODA 3M1CA 1LFBA 1GT0C 1W5CE 2X1DA 4XE5B 1MMAA 1S72P 2RAEA 2KT0A 1DQUA 5LEJA 3TEDA 3H25A 2ZXEB 4EJUA 3ZQIA 2CPSA 4A0YA 2K5CA 3PFYA 1YJNP 3H5RA 2B7EA 2LOOA 2VPRA 5L3GA 1KORA 4HX4A 2B0LA 1EZVI 3R4YA 3NWTA 1W7PB 3TGUD 1JB0J 4DOJA 1R9TJ 4E70A 4KISA 3KP4A 1X3WB 4U3FD 2K9QA 1MMDA 5J6XA 2BOLA 3NMDA 2OYHA 1NOHA 1SD6A 4UUTA 2E1MC 3AEEC 3FXDA 3F6OA 2BEOA 1EDJA 4PGHA 2QA4P 5EF6A 2BHZA 1LNQA 1S5LH 2VRSA 4UXNA 3WODF 4B4CA 1MMGA 4A0ZA 2XPUA 3LSTA 2IP2A 1W4MA 2CH0A 1EQ7A 2P1JA 3KHUA 3HTUA 1RC9A 1KILD 1DD3A 1OXZA 1PP9G 4CCKA 3CC2I 2IXSA 3CJQB 5TJJA 1MBEA 1IRGA 5KJ7C 2PJPA 1MUUA 4WY4B 5HDKA 3M9HA 2YUSA 2E5YA 2QSGX 3BG7A 1NYHA 1B4AA 3OR1C 1X19A 2K85A 4OMZA 1KYOE 4XFJA 1QVTA 2Y0MA 3RSNA 1JTYA 3PNTA 5BU8B 2P7JA 5F1JA 3ZN1A 1ZXGA 3KP7A 2QM7A 1MNDA 3EYIA 1G1JA 5EZGA 1EDKA 2QJYB 1YIJP 2XV5A 3C2GA 1DGWY 4IFMA 1VQ5P 2W90A 3QYFA 3FDYA 1VF5B 2G7HA 1YI2I 1BDDA 1JY3N 4D6TG 4MO7A 4HJGH 4EMSA 5JFRA 1ITYA 4AQRD 3K4JA 2F4OB 3NARA 4XN3A 2R7RA 2A6EF 1G8XA 2V4JC 5AW4B 3S1KA 2GXGA 2CSOA 2K37A 1CZQA 5ILSA 1DD4A 1A31A 4NPDA 1FZAA 3ABMH 2H8WA 2Q0OA 3K7AJ 3WG9A 1YHQI 2CMPA 5AVYB 1K83J 1KU3A 1TT5B 3FISA 1KILE 2HG5D 1S1CX 3CI9A 2KIUA 2DA5A 2R4GA 4I09A 5ICGA 1ETYA 3CF5F 3L71E 4GOFA 3R6SA 1RE4C 3IP4B 3K2ZA 4P55A 2ZSIB 3OIQA 1SFUA 2R7UA 3VOEA 2V9PA 2XAJA 2MH9A 5BPDA 3GTKJ 2E42A 3IAM2 4R4MA 1JY3P 3TW7A 4JBAA 2H88C 2D1HA 2EV6A 1T2KA 2QSHX 1PGQA 2G8YA 2NPSB 1MFZA 1KYWA 4PJLA 4U7DA 1BN5A 3GHGB 4IHVA 1ORKA 3L72G 3CC7P 5IT3A 3F22A 2M4KA 3R2PA 5F27A 4HBLA 1YO5C 2LY9A 2ADUA 1OLTA 2XAFA 1IK7A 2FBWC 4BKXA 3WTUC 2H8RA 4BU2A 1ZMEC 2E43A 5M5YJ 4HYTB 4WY4C 3TOBA 4I6ZA 3L2QA 4UB6H 1K9MQ 2DOFA 3BP8A 2JP3A 1G2HA 3GLXA 1TWHJ 2WAFA 2KS1A 4N6JA 3HRSA 5TJHA 1RI7A 3AG4H 3Q3DA 5EZHA 2CV0A 3D71A 1E79H 4R4LA 3TP3A 1B59A 1RE4A 1IO2A 5KAIC 3L00A 4C3HJ 1S6LA 2XF7A 3L75D 3E6CC 3Q1MA 3HM5A 4I2OA 3CCRP 2E75B 2ZFWA 5ICFA 5E3MA 1J09A 2ZXHA 2N1TC 1IC2A 2A61A 1IRZA 5DM7F 5FD5A 1HTLC 2ITAA 1J1DC 4H13B 3LA3A 1LT9C 1U0JA 2M3EA 3SZTA 1FZPB 3IC7A 4UVCA 2R44A 3SWKA 1BDCA 5ERIA 1Y0UA 3M9QA 1ZRDA 3HKZA 1LT9B 5GADJ 4RKUJ 4C30A 1OW7A 3V2NA 4ZYDA 4JPZB 2GWRA 2WAQA 3BZ6A 1EC5A 2HODB 1L0LE 1QZEA 2K40A 3VMYA 1F5TA 1I3AA 3DCFA 4KN7X 2CG4A 4YFXF 1SANA 3C2BA 3HBLA 5ED4A 2BCCE 1HSJA 4ZTJA 3BG6A 1URQD 4WXDA 1R8EA 3H1JG 3N4MA 1NTKJ 4G7ZF 3CWBG 2ZT9D 4A3KJ 1XCBA 1N7LA 5EGOA 1S72I 3FK7A 2K27A 2FYUD 4FE4A 4GO1A 3H6PA 4WK8F 3GMAA 3L75E 2OU2A 3C2HA 1M57D 3U59A 1QU3A 1G1IA 4HNTA 2D2CB 1JT0A 3DBLB 4EQQA 1HWTC 3SJMA 1HBWA 4YIIA 4YIFA 1J75A 2HVQA 1JTHB 1IRFA 2FYUJ 2IW5A 4A7PA 3I64A 2MFZA 1VFCA 2X51A 1KQ8A 1Q2NA 3LIEA 1P9QC 2XF6A 1TU3F 1WJBA 2OD5A 1NTKD 3TK1A 2MW8A 1U5TA 1IFJA 3OOUA 4I0BA 4UVBA 1S5LX 3LFKA 2YX7A 5CCGC 2HYJA 3DBRB 4OOIA 2GQQA 2M3AA 3O8GA 1FE6A 2BASA 2EILH 2KOGA 1OYWA 2ZAEB 1PGJA 1ZW0A 1FSEA 4I98B 1HC8A 1U3EM 3F3XA 5BOXA 4LITA 4B48A 4JYKA 2M2EA 3S17J 3VMXA 1HJBA 1ZG3A 3W67A 4A3BJ 3K4KA 2GBYA 5GTHC 4CCOA 1VQ8I 1J9IA 1HGVA 4DZOA 2XGXA 3S4RA 1IRXA 3P9IA 1EZVE 1VQ9I 1T8ZA 2KDOA 1MSFC 2D2CD 2EIMH 4GXOA 5CVJA 1YS7A 3T0YA 5E1WA 1ZN5A 2WWWA 2KK7A 2MD0A 3TKYA 3F5HA 3PUFA 1FDOA 2HOSA 1JT6A 4H4KC 3ZCOA 1OCRH 3KP6A 2DQLA 1Q1HA 1JKQC 1AVOA 5ILVA 1PIXA 4LOCA 1ERDA 1KFMA 1UIIA 4EJVA 2YIUB 3LSJA 3GF7A 3CCRI 3HRTA 1WH5A 1N8RQ 4Y17A 4BDZA 4IL6X 4W80A 2QM3A 2MG4A 1MD0A 3GTGJ 3E3VA 1XB4A 1WI9A 3R4KA 1NTCA 2DT6A 3DLLF 2NVQJ 2D2CC 4N3YB 2ICWG 3EFFK 4CHUA 1BI0A 4W97A 5CQEA 2ZXJA 1IV8A 3ABKH 4ABZA 3AG3H 3BG9A 1IFNA 1RZ4A 4ENNA 5KHDA 3AE1C 3Q5PA 2Y9YA 5H20A 3H1HG 4XOPA 3S1QJ 1YW8A 2JJ7A 2KDZA 2QA4I 2R7WA 4JYBA 4RGUA 1ZOYC 2WQYC 3LSGA 1FTTA 2DMQA 2F48A 1KD1Q 2CK3H 1D8JA 4IHTA 2O01J 1X8YA 5H6QA 3M1EA 3V4QA 1RE3C 3ZRGA 1JHFA 2RQPA 1SQXG 3H1KG 4C7NB 3DFGA 2YMYA 3A4CA 3GZNB 2XASA 3TDKA 3VP9A 1J1EC 4IHSA 1L0LD 1SQPE 1CGPA 5FO5A 1VDFA 1NGMB 2QVOA 2O3FA 1HSTA 4TLFA 1EA3A 3ZMZA 1TQMA 5JR3A 2Y0SN 2W83C 5EG0A 3FXOA 3KFWX 5GAHJ 1BGYE 5TRDA 1ACIA 4DYCA 9ANTA 1KN7A 3ASNH 3G71I 2B9SA 1POGA 3AE6C 4E6KG 5D5UB 5KAFE 5CJ4A 1I6HJ 3QRFF 4HSRA 2OTLP 3VWBA 2J5OA 2GXBA 4L73A 4AU7A 1JY2O 4HKZH 1X3UA 5M1BA 2OTJI 5C44J 5H2FC 2GUVA 4BXUA 2MJZA 3GG2A 3BATA 5E18F 1IZNB 4LG0A 3WTSC 2E76D 1VQ6P 3BJ6A 2YXQB 2R93J 1X79B 3DPTA 1R4MB 1IZ1A 5AONA 3U1CA 3ZQHA 2LR8A 1IDZA 1Y39A 4WY4A 5D6EA 1FEXA 1ETOA 4ZZDA 4IRIA 2FE3A 3J7YJ 1ETVA 3ZQQA 1KILB 3J7AY 2K7LA 3BC8A 5FFZA 5GTIH 4BUPA 3KYLA 1TWCJ 2EPFA 5LHGA 4DYRA 1A5JA 3H92A 2VONA 3A2AA 3L71D 3F8FA 3L2RA 1G3SA 3GW2A 2LF8A 1SVOA 2OTLI 3CCMI 4A3LJ 3GW6A 4L76A 1BSHA 4ON0A 1HF9A 1OVRA 5E1XA 3CX5E 3HPHA 5KKZC 1FJLA 4A3EJ 1AU7A 5FRNA 2RNJA 2A45I 3CC2P 1K78B 5J8FA 2ZXWH 2POHA 3MIWA 2F5FA 3CF2A 3CX5I 2E71A 3Q3SA 4F3QA 4U0VA 2W24A 1SQQJ 2SPZA 2G9WA 3KLNA 1RY3A 2FY8A 4WWCA 5KLVG 1VZ0A 4WF2A 5FD6A 3JSOA 2M87A 1BJAA 3J81K 1AJYA 3QPLA 4X1EA 2ZVNB 1A6IA 1R22A 1OYYA 3CCYA 1VQ5I 2IBZE 4RB2C 3E1IA 1VQPP 1XPXA 3MP7B 1AQTA 3ASOH 4L0ZB 3K4MA 4GDOA 4D5CA 4M6VA 5JVGF 3DKWA 3FXQA 3GFIA 5FKNA 4LLHA 1WT6A 1G3YA 4ZDOA 4LB5A 2E74B 5E79C 5DTDA 2ISYA 1N75A 3P5JA 1AFOA 2HXOA 1AQ5A 1F1ZA 1E3PA 5F0CA 2JWDA 2DMUA 4XIDA 3JREA 2FMLA 5E20A 4DIQA 1NTKE 1TW2A 2H6BA 4FTHA 3OSFA 2NPSD 4KHXA 1MGTA 1UFMA 1HQCA 1I39A 1FIPA 4ASNA 5DM6F 3AEFC 5JHUA 1P6RA 4EI2A 2EQRA 1P4WA 3PIOF 1D5YA 3CCQP 3PNYA 3D70A 1FZEA 2NOGA 5E3NA 3LNQA 2KS1B 3V2PA 2ZMEC 3GWZA 5D4SA 3B02A 2A06D 2Y48A 1X0TA 1PUFB 3OYHA 5LHIA 2QYOA 3MHVA 5JHFA 2BVLA 3ZQLA 2FMYA 2IA2A 2MKVA 1FZCA 2XIGA 3G73A 1OJLA 2JRMA 1QLED 1WSUA 2CO5A 3RK3C 3CLQA 1BW5A 1GU4A 5IT9Z 1H0TB 1ON2A 2KRHA 3AEGC 2FYNB 4ZMDA 3MKLA 1HKQA 1FC3A 3KZIC 4OIRF 2HODA 3AEAC 1FYKA 1P4XA 3JRGA 2DTRA 4HLYA 1JTXA 1XCVA 2JA8J 2M45A 1L0NE 1CW5A 2OUMA 1MDMA 1LNWA 3Q5FA 2HQAA 3BCCD 3TGUJ 2Q6QA 5KLIB 2MSYA 5AVRB 5C4JJ 3HUGA 4XSXF 5F0HA 3H1IJ 1KONA 4QSHA 1KZHA 3AL0B 3KEQA 2ELJA 3M8FA 3F0CA 5HNHA 4BE0A 3IR9A 1H88A 1MJBA 3OAKA 2O01N 2WMMA 2DBBA 4EYYQ 1QVUA 1BI3A 2NS7A 1FX7A 2GAUA 2F5DA 1PVEA 4L5IA 1EDIA 3TBIA 2LREA 3JC22 1KFNA 4N4NB 2LLKA 4IOCF 4OGQC 2VJJA 1YITP 1L0OC 2RKHA 1O3SA 1W5TA 3FIWA 3HE4A 4H0LB 3AG1H 3FKIJ 1HDPA 5FLMJ 2VLAA 4PD4D 1QQIA 3L74D 3WUUA 4FE7A 1VQKP 3HKZN 3M9AA 1GL2A 5FB2A 4X0GA 2JSPA 2OV7A 2PX9A 4DZPA 2OQGA 3MUDC 4CSWA 4M9ZA 3AKZA 2LY2A 4C7RA 4NDLA 3JTGA 1OW6A 3JCUH 2E1CA 1LPQA 2KMUA 3FMQA 3HOWJ 1LWUA 1R00A 1QGKB 2KXPB 4BQAA 1QO0D 1RQVA 1QGPA 2PAJA 2HQRA 1NTMJ 2EWNA 2DA1A 4UY8I 2C0XA 2A3SA 4BJ6C 4A12A 4CCNA 5B3SH 1V3FA 2HVSA 4ESBA 1SD7A 4BQNA 4R1HA 3S2WA 5ICCA 1Y9BA 3L37A 2CQNA 1AV1A 2BE5F 2X6XA 2ISZA 2I5UA 4NBQA 2XSJC 3H1HE 4IHWA 4FISA 1CI6A 1YG2A 4XM3A 3A2KA 2IA1A 1XD7A 3C3WA 4JX6A 2DA7A 4U88A 3L1PA 2Y75A 2DW3A 5JI6A 3BCCG 4ESFA 5AW2B 1A04A 2MABA 2MC4A 2GZWA 4XORA 1NJIQ 4M3EA 4Y13A 5FJ8J 1S29A 1ZH5A 1W0TA 4IOIH 1IFPA 5KNLA 4UV8A 3GTPJ 1I1GA 3BRVB 2VXZA 3AE5C 3S1RJ 1ZLKA 2E7XA 4WY4D 2Z4EA 2EFWA 3WGIA 1MNMC 1NU1E 2LNBA 1M1JB 2N1TA 1Z67A 1SD4A 1NTZK 2NVYJ 4BDYA 1SLQA 3EWKA 4RLQA 4EEFG 2VT2A 4I01A 5HLTA 1VI0A 3DEWA 3EUHA 3PH0A 3K6GA 2HYFA 4OGQB 1VQLP 1PUEE 4HZFA 3NRVA 4BHCA 3BJOA 3ECHA 3SYTA 1FWZA 5F1RA 1FS0E 2JWAA 4GRIA 4WCGA 3CMYA 2R92J 3OIPA 2R32A 3DV8A 4OWFA 3KETA 2AEMA 3HTSB 3IH4A 1RF1B 4RMNA 1SQVJ 3OL3A 4RBOA 3JAMK 1OPCA 1FT9A 3BR0A 3L9FA 3N05A 5C3EJ 3PUBA 3MZHA 1YQ3C 4NQWB 3BQZA 2EFPA 2H94A 2V9KA 3RYPA 2KNCA 3HOYJ 2QE7H 4KIFA 4RGXA 5LFAA 1JCCA 3G6EP 3CO6C 4L75A 4C2MJ 3BR5A 1RESA 2QVAA 2CW8A 5D6FA 2DMPA 2Q2EB 2VQHA 4D5FA 1KB9H 5BS6A 3HIFA 4LD5A 4B86A 3VMAA 3HOUJ 2L02A 4A3FJ 4XLCA 5AW5B 1YRNB 2E5ZA 2PN6A 2IVMA 4MQVA 3P7KA 3H3ZA 2QIWA 4ETSA 2WBMA 1TBXA 3OYJA 2LFBA 4BH9A 3OWTA 1ONVA 1V4RA 1WMKA 2FNAA 3DU5A 5CVRA 3OYIA 1MDMB 2PEXA 2F4IA 2DPUA 3E1RA 2Z5HA 3CCEP 1T38A 2BY0A 2Y0SA 3CUQC 1SQBG 2NPSC 3U9GA 3RDIA 1D7MA 3I58A 3DTIA 3U21A 1WVRA 2WB1A 1KB9D 3RJPA 3L73J 1GXQA 1JGGA 2XRLA 2KFDA 3F8BA 4HEA2 5DCMB 1OFCX 2WA0A 1GW3A 3F8CA 2UV1A 3GYHX 2MA3A 1SQXD 3CMAP 3G2BA 2VBZA 4MLOA 5CLSA 1WJCA 2P81A 2XGDA 3HTKA 2R7QA 4OH8B 2ELKA 2OF7A 2FSWA 3IHUA 4RESB 2IGOA 2VKEA 3DEEA 2L9SA 3S8PA 4PJ0C 2IPPA 4JF7A 2NS0A 4XNFA 4NC7A 2PLYA 1SQPJ 4YTPC 3RBZA 2C9LY 2DFFA 1LTTC 2KZIA 5AVWB 4HV5A 2H7HA 1ZLLA 1A02J 2QZ8A 3IWZA 5HNFA 1ZGJA 4GYGA 3E5UA 1SQVD 5HDGA 4UB6C 4QLCU 2KLVA 3Q0VA 1FNNA 1TP4A 2LG4A 2XF5A 1IW7F 2XKPA 2Y69H 3H36A 1OR7C 3HZJA 1AWCA 4EJWA 2JJLA 1ZP0C 1ODDA 1YTYA 1GHCA 1PJRA 1Z56A 1M56D 1RQUA 2FRHA 3TF5A 2QRXA 3OV8A 2Z33A 4BBSJ 3CCJP 2VQGA 4BQOA 3QU6A 4FHTA 2P5LC 2Y0DA 5A2QZ 4WWIA 1A02F 1XMAA 2KIQA 3CMEI 1U7MA 2DA3A 2HGCA 3I59B 5F64A 3UR3C 2J5PA 4DW6A 3JRIA 3JRCA 1DPRA 1EH6A 2DFIA 2IJLA 1LTSC 2BY1A 5DYMA 4BY7J 1HUCA 3SXYA 1T56A 2K4JA 4BJ5C 2V1UA 1Y56A 3I4NJ 3E7KA 3BOQA 3P7NA 2W8ZA 2LKSA 3LFUA 3GTQJ 3G6EI 3I4MJ 1ZR4A 1RPWA 2KRFA 4A5MA 1M1EB 3LOCA 2Z1DA 3H1IE 3RBXA 5CBNA 5CQGA 1CQTA 1VNDA 1PV3A 3AE8C 4P5OA 5F0FA 2VC0A 2OC6A 4J01A 3PQJA 2K4BA 1DX7A 4HPQA 4XRMA 4KFCA 1YX3A 2KIKA 2LTPA 4HYEA 1L0NJ 2QSIA 2R7SA 1BR2A 1UB9A 1HBXG 4MEYF 4ZYGA 1KYZA 2D5VA 2VUMJ 3CMMA 1XSDA 4P9UA 4C7NA 2OTKE 4LIUA 3H9JA 1HVVA 2XDVA 3G3ZA 4CCLA 2PP6A 2HEOA 3CC7I 2EZLA 2Q8KA 3LIDA 3ZXSA 1PUFA 1BE3G 3I4PA 3FM5A 3P9KA 1RKTA 1FAVA 2M8RA 4AWXB 5E79H 2QLZA 4I0AA 3GVAA 4M3FA 1JM0A 2JO1A 4C2UA 2Q7CA 2L7KA 2FBHA 2W57A 2Q2EA 1U57A 4WXCA 2M30A 2VOPA 5IYBJ 3H0GJ 1OW8A 3GO5A 2ZBKA 2RKLA 3JSVC 1XTCC 2D1VA 2HTSA 1MZ9A 2WPRA 2LR2A 3OYCA 2PGDA 4HNVA 1MMNA 2ZT9C 3WTZA 2OYHB 1R23A 2K9SA 4XICA 2EINH 3LSRA 3HE5B 2YS9A 3BG5A 2LKMA 1Z7LA 1R36A 2L7FP 3G1MA 2LD5A 2WSEJ 4RB1A 1AA7A 4ASWA 1ETKA 5K7FA 1LT1A 5B1BH 1B8IA 4DGWB 3S3NA 3HHHA 3SDGA 3BWGA 3HC7A 4IVNA 4BAYA 2ZXXA 1GV5A 3WHCA 2WTEA 1VQNI 3KXDA 1GL2B 2VASA 4II3A 1N86A 4PJ0H 2HOTA 1M90Q 2LK2A 4ZKPA 2DAOA 3MN2A 2CYYA 1L0LJ 2R7XA 3CZ6A 2M3BA 3N7NA 3HTKB 1JEKA 3QPTA 3RL0D 4A93J 3GUDA 3G4SI 1O57A 1FC2C 2UXNA 2XV4S 1R4NB 2VKHA 2YU3A 2WSCH 1FBQA 1O3TA 4IRHA 2OYIA 1NHAA 4LB6B 1R5LA 2YR2A 3CXHD 4HOBA 4XK4A 2MBFA 2WAQN 3Q0UA 1AOYA 5KLVJ 2XPWA 1FIAA 2YNYA 1QBJA 4V19K 1RF0A 5IYDJ 4KJZA 3M06A 4KN4X 1UHMA 3A0HE 3I53A 4LLGF 1MH3A 4BGDA 1ETQA 3V5BA 3CX5H 1Z1DA 1FPQA 2ZJ2A 3JCUC 3CDIA 2YU9J 4LC1A 2VT3A 3P8CE 3LSHA 4OAYA 2PMZN 2AXCA 1MKMA 2CV2A 4KNYA 2E1MB 1W36C 2HI3A 4S0HB 3VYUB 1SEUA 4LLNA 1MIJA 4XKBA 2LVSA 1EV7A 2M8EA 3GLLA 4UNOA 1YI2P 3ZN0A 4ZZLA 4YEJA 1P7JA 2EIKH 2E76B 2EFQA 2H8PD 4M3LA 2AEFA 3DP7A 1IFMA 2I8DA 2KP8A 4UB6E 1TNTA 1TTYA 4D7MA 3BTLA 2IBZG 3FX0A 4B43A 4S05A 4PZJA 2ID6A 1LFUP 4LGWA 2ME6A 5K7ZA 2O0YA 1MBJA 3MEXA 2XNDH 3HUSA 1Q82Q 1SQBK 1GVJA 4PK4A 2JUGA 1BSNA 2B63J 3FM3A 3GBGA 5L3BA 2HS5A 1W0UA 1XDUA 3RI4A 5BPIA 1BE3E 2ZJPF 5KAFC 4N0BA 3TYYA 3I5UA 4Y33A 3GX4X 2XC7A 2WSCJ 2WSFH 4I1LA 3H5AA 4AYCA 3KEYA 3JAMZ 2Z16A 3FXEA 5CBOA 2CQKA 4UV9A 3T5XA 5KJ7A 5CKTA 5HS9A 1LE8A 2E19A 2YIUC 2P8TA 4HDUA 1IG7A 4BRYA 2VB6A 5HOOA 3JRDA 4QMAA 4IRGA 3PM1A 4QIWN 2I1KA 3PQKA 4BE2A 4FASD 3A0BC 4G12A 3FHZA 3U1KA 2KLOA 4RAZA 1VQNP 4XKWA 1Y1WJ 3KIOA 4CH7A 4BNCA 3HRMA 4M74A 5EEGA 2K9JB 4C2TA 4I02A 1IUYA 2YO2A 1N73B 5AW0B 4NNJA 3PIPF 2FYNC 2BCCG 3VYIA 4M71A 1HW2A 1Y8QB 4BEHA 1KILC 1DEEG 3KPEA 1N73C 1JUSA 4ZTFA 3PJRA 3L72D 4Y28J 5D8LB 1NKZB 3V7RA 3M3YJ 2E74D 5L8RJ 2LMDA 2RNGA 1LVKA 2V7QH 2FEZA 2BY2A 1GUUA 3PP5A 3K70D 3H1ID 2QJPB 3FX3A 1Z7UA 2Z9OA 2QQBA 2LXCB 1JUPA 3DQVC 2K3RA 1K6YA 1LEAA 4RAYA 1G59A 2RVCA 4HW0A 3E5XA 4XKCA 1X1PA 2NYXA 1BI1A 1D1BA 1QEXA 2N8GA 4I99C 2HFHA 4F93B 3C1DA 3ONQA 4HF0A 3W6JB 4GDFA 1YFHA 1SQQE 5GPAA 3F21A 3TGNA 1YX5A 2DYRH 2QJYC 5E8IA 1LWUB 3IH3A 4IO9F 2KHMA 2DJIA 3RQIA 1UAAA 3DPLC 2Z5IA 1UJ8A 2WSFJ 3G71P 5KLVD 4Q5SF 2NXNB 1Z05A 1FSHA 1W2BO 2EA2A 2XAUA 5IP9J 1QVGO 1SQQG 1VL2A 2HVRA 2UWMA 2IFMA 3VDXA 3L70J 2OAZA 5E17F 1K73Q 1S7EA 1Z21A 2JUCA 4KITB 4L9NA 3WE3A 3RZDJ 2ZXIA 2R5YB 1JY2N 1URQA 3HRUA 3QWLA 5HLHA 2IYOA 2XNXA 3PTZA 2WT7A 1G2CA 1UG2A 4IX7A 1D1AA 1RR8C 4CGZA 1QL2A 4G7HF 3REOA 2BCCD 3AE4C 2HPCA 2LKPA 1KQFB 4F92B 4L0YB 3KQGA 1X22A 2EZHA 4RM2A 5J4VA 3GCMA 3Q2YA 3SEQA 3AFHA 2P6SA 2NPSA 5KLIC 3MAJA 4II2A 2NRAC 4MQ9F 3GHGA 1IDYA 2V1DA 2P7VB 5FFXA 1YJWP 1S5LE 3CCMP 1SFCB 4ZH4F 4IOAF 1ULYA 1X4OA 2KUBA 3N97A 2CQXA 4H0LD 5H2FH 1W5CC 2RC4A 2HTJA 2HQNA 3RTRA 1Z0XA 1XSVA 1LFPA 1JNMA 1L4AC 2IX7C 2ZYDA 1SQQK 2BZTA 2BCCJ 3LW5H 2M5AB 3EUKL 1WFXA 2VIXA 3DF8A 3SEZA 2PFXA 1S9KE 1BW6A 3L2VA 5APVA 3RKQA 3VOPA 1NU1G 4RJTA 4PJ0E 1B72A 4F7ZA 2E74C 3V4WA 2A05A 3CPWO 2QEXI 4H13D 4U7BA 4AUWA 2L54A 4Y52J 4MIMA 3CCUP 1GD2E 1FZFA 1ZRCA 3USSA 3L2UA 3ABVC 3AEDC 3L75G 3UNGC 2KJCA 4IFDK 2V26A 1O3QA 5TISC 3ZMSA 3TO9A 1KV4A 3O6QB 1S5LC 4CICA 2X0LA 1EZVD 3KZIE 3FZVA 1KMIZ 3IL2A 2X85A 3QPHA 5TGTA 4N78E 1NKNA 3DWLE 1Z91A 3CJNA 1VQLI 2VOOA 4A0XA 1DP3A 3L72E 4IL6E 4PV1C 3GFMA 2FA5A 1R5GA 1K04A 1KB9I 1NTZE 2BXYA 2DW4A 3L09A 5J1RA 1I50J 2YKQA 4ZKUA 2IRFG 1OVVA 3JCUE 2QBYB 3H32B 4H0EA 5EG0B 2DOAA 1LQ1A 1Z77A 4HA8A 1IO4A 1YYVA 3BPXA 2HU9A 4G9YA 5EEAA 3CD6I 3HOTA 1WKMA 4BBRJ 4E7ZA 1OIPA 2R3CA 3I56P 1PDNC 5AVVB 4BHPA 3HOZJ 1IUFA 1QHHD 1HW5A 4YELA 1A36A 2FYUG 2E1OA 1JGSA 3KEOA 1KU7A 1SQQD 2Q3IA 2JPCA 2ZJSE 3JRBA 2I1JA 3BCCE 4BXFA 4DCKA 3H1CA 2D45A 1LTBC 1QZZA 3CXHE 4RO0A 5APUA 3ZQCA 1LDDA 1K8AQ 1IN8A 1OCZH 2EV5A 2JPBA 4FQGA 3LWFA 4KYWA 1Q86Q 3QOPA 3NAUA 4DZJA 4N78D 4N4OB 4OMYA 3OYFA 1SMTA 4RDUA 3I54A 5KLVK 1FBUA 1NO4A 2IYPA 2ZYAA 5B5EE 2QJKC 4AC0A 1QPMA 4CA0A 2CPBA 3B5NB 2BW3B 4CYCA 1J59A 4V2FA 4H44D 1BC7C 4CZCA 3E0JB 5EEHA 3C7JA 3IF4A 3HD7D 4FX4A 1BJZA 3EETA 2DXIA 3OYMA 4Z1MH 3VB2A 3WU2C 1GVDA 2ECCA 1M8OB 1V54H 3A01B 5CVVA 2FBKA 3MWMA 5DD4A 4XRSA 2E36A 1ETWA 4MTDA 1JKOC 1VQKI 2FYUE 3SWYA 3V6IA 2WT7B 2QSFX 3F6VA 1NH3A 4RAFA 1OZHA 2FNPA 2K9NA 3RCOA 3PSIA 3L75J 2W25A 4UB8E 2O01H 4W7ZA 1T0FA 5AW7B 2K86A 2KKOA 1OCPA 1GMJA 2CUEA 5E79E 1J7KA 3Q9VA 2H09A 2ZB9A 3WGHA 2NOJB 4CYDA 1IV6A 1LTGC 2L91A 1PGOA 2VN2A 4LIVA 5IOZA 3JRAA 3BVHA 3CTAA 3FBNB 1KQGB 1ZLJA 4L9VA 3GF3A 1KQ9A 1VQOP 5IP6A 3TO7A 1BCCJ 4OU0A 5H2FE 3HHGA 3H1HJ 1WQ2A 3UIAA 1MJAA 3HGGA 1PP8F 1P84I 5DJUB 3HJEA 2GIVA 1JY2P 3VEPA 3BG3A 5LD2C 1BCCD 4MNUA 1F36A 3FWNA 1ZGAA 3HPGA 2CQQA 2E7WA 1T95A 1LTJA 5DD8A 3HD7C 1ZRFA 1P7IA 5TISE 4A3DJ 1BE3J 2X48A 4CZZA 3J80K 1FTZA 2N9BA 1PP9E 3VMZA 2P4WA 4M6YA 2Y0CA 2CU7A 4I2LC 4HH2A 1SFCC 2BBYA 4Z2YA 2HDCA 2O61A 2K9YA 4C46A 2IGKA 4IL6C 4O3MA 4A5NA 3WUTA 2ZSHB 3CP2A 1G4DA 1YITI 5FKOA 2IPQX 4M72A 1WPKA 3M0DC 5CCHD 3TNUB 3PO3J 3WTYC 3CO7C 4XSZF 1WH7A 3PL8A 2K9JA 1DDNA 2M1BA 5GTIE 2WZ7A 2RN7A 4JX4A 4BS9A 3PJSK 5AVTB 3SDBA 4KJMA 1V55H 2M8GX 1LDJA 2W82A 2FYUK 1SFOJ 2FJ1A 5LRSA 3B4SA 1WJEA 3WG7H 4AVZA 2ZYGA 3BRTB 4HF1A 2EFNA 4HQMA 4FX0A 4EM0B 1PP7U 2XGEA 3PLNA 3TGUE 4BYYA 3QAHA 1RRJA 3M8JA 3DXJF 2PG4A 3L4FA 1P84E 2FKWB 4D6TE 4UUSB 1NG7A 3R0AA 1VQ8P 1YHQP 2BXZA 2OPTA 3WGGA 5ICEA 1BR4A 3FK6A 3H9GA 4PJMA 3BDDA 2K3FA 3ISPA 3D1NI 2FQ4A 4PSXA 2B9BA 2R5DA 1T33A 4LGDE 2LBFA 3AG2H 3G1OA 1DU6A 2NZ2A 3GTJJ 4I6MC 1GK4A 2WPVB 1IXCA 3HEFA 1KILA 1UCRA 1TL8A 1RHZB 3FXLA 1CSBA 1LTJC 3F8MA 4AVPA 1ZGWA 4MEXF 1T2KD 1S9HA 2OQRA 3L74J 4U7JA 3L2CA 1USDA 4D7NA 1EF4A 1JI8A 1XGOA 1M7LA 3M0AA 4E7SA 4XLNF 1R71A 4IEJA 1QPIA 1U6GA 1QZYA 2WV1A 1JMMA 5APXA 2QM8A 3LA7A 3IWFA 5B66C 3TGUG 2XVCA 1T6SA 3WHBA 5M5XJ 4XA4A 4NC8A 3A0HC 1JO5A 5E8GA 3J81Z 3S9OA 1Q81Q 3IRRA 3A03A 3P9CA 2E75D 3EFGA 4EVIA 3FMSA 3GF2A 5C39A 3TSIA 2X1EA 3MZYA 5KAFH 4RGRA 1GL2D 2RN0A 3NQOA 2WITA 2XRNA 1IC8A 4G7OF 3B5NC 3HGYA 2PBIA 1J1EB 4YXDC 5FLXK 1L4AA 3QYBA 4JQ0D 5HDNA 2V1NA 5M3MJ 3IFMA 2CWEA 1NTMK 4IKFA 2JA5J 1X1DA 1N77A 5BMZA 2V7QJ 3RQ4A 4XN0A 2B87B 1ETXA 1U78A 3T97A 2FUG2 1HXDA 5CCHA 1REPC 1SQXE 1U2WA 4UB8C 4J19A 2DO7A 1SQXJ 4PSWA 5FRMA 3WMM0 4P9FA 2OGUA 1NTMG 2F2EA 4OAZA 2HPMA 3GXOA 1VQ4I 3HRNA 1SQPD 1N7SB 1TQPA 4YFKF 3RK3B 4MFDA 4XBFA 1UMQA 2C0WA 1NAFA 5CMZA 4HX7A 3S14J 3LL7A 1N78A 3TO6A 4EM2A 2KNCB 1WJFA 2F5VA 1QHGA 2NVUB 1SAUA 1KYOH 1LJ2A 3IN6A 4JYCA 4EGZA 2A07F 1D5VA 1HH0A 3BR1A 1IN7A 2KYVA 1PL5A 2Q1KA 3S3MA 3H9QA 2JSCA 2XDJA 2KL4A 4M3DA 1ON1A 2IBDA 3RKYA 5A2QK 1FJPA 4PCQA 1NU1J 5B66E 4GFBA 5KAIE 1BR1A 4X6AJ 3L35A 3CCLI 1D0ZA 3U1DA 1R1VA 2IFNA 3D6YA 4YFNF 2QJPC 3NWSA 1XN7A 1LVAA 5B1AH 1M1KQ 3D5LA 2QQ9A 1Y47A 2VODA 4D6TD 1Y0NA 1WGXA 3A0BH 4LLLA 3QP6A 4L18B 3K69A 1L0LG 3H1LJ 2QKMB 1FY7A 1LP1A 2A06E 2FXAA 2TDXA 2Z5UA 3PO2J 1SMYF 2VQCA 2BYVE 2XAHA 1Z6TA 3L70D 1GDTA 2HZDA 4DBQA 5AVUB 3W68A 2C9NY 2E1NA 5CCGD 1B9NA 2QENA 3V8JA 1TQIA 4G6TB 5K5RA 2XROA 2OYOA 2ZC2A 1H89C 4GOEA 1RF1C 2KP6A 5GPCA 1E5WA 4IXAA 3H1HD 3RK2D 3ELKA 3CMAI 5TISH 4ZYAA 4PJJA 3VFZA 1T39A 1Q90D 1WRJA 2XSDC 2BEZF 4CYCB 2UUZA 3DBHB 1OKRA 2MD5A 3B8EB 1FZCC 1MJ9A 2EK5A 1YW7A 2M5WA 4AIHA 1YTZT 2IBZI 5DS9A 5AVSB 2JA7J 3MQ0A 1SVMA 2LXBA 2HKXA 3JR9A 1G2CB 5GAEJ 1GLNA 2M0MA 3S3OA 1Z6RA 5L3FA 1JY3O 4U3FJ 2WY8Q 1RKWA 2L9NA 4W1UA 4BXXJ 3C9IA 2VPLA 4H0LC 1T08B 1IXRC 3EYYA 3BCBA 1MFTA 2HPIA 1H8AA 4MTEA 1JJ8C 1GW4A 2IZ0A 1YOVB 2O03A 1H9GA 3CJTB 2TRTA 1ZG1A 4L9TA 3CDHA 1SFEA 1X2MA 4XKVA 4B44A 2K88A 3B71A 3KLOA 3A0HH 2RQQA 3ERMA 1LEBA 3GZ5A 2G7UA 2LP0A 3VSLA 4BL0B 1SFCA 2ZFCA 1X1BA 3AECC 3CWBJ 3NTNA 5EFWB 3V2QA 3H1JD 4S04A 1M1JA 1BBYA 2N1TB 4PGGA 5LGUA 4UUVA 3C8VA 1FZBA 2DFHA 3CWBD 3I59A 2LC2A 5HODA 2Q1ZB 2ZJQF 5HLIA 3AEBC 3MKYB 2VE9A 1W36D 1A35A 3CP8A 4I7ZB 1AA0A 2DA2A 3DPUA 2ZVOB 4C9YA 1DIPA 1R49A 1WI3A 1L4AB 3RL0g 2IGMA 1PPJE 2DA4A 2YX4A 1IN6A 1QA6A 1I6XA 4KIBA 4LMYA 3ZOBA 2E60A 1RUNA 5AW1B 2FBIA 4YIRX 3Q9SA 2GXAA 1KU2A 1SQVE 2AQFA 3O6QA 2VBYA 3J80Z 1FZCB 1YBKA 5IY5H 1D8KA 1AHDP 1S4XA 3Q5RA 3CXHH 3FWLA 1SP4A 3RL0B 1T0FC 2X6OA 3KYDB 3PSFA 3M4OJ 3I9V2 2UZKA 2DOEA 2ZNZA 5IP7J 3MTUE 1H9TA 4XL9A 3MVPA 3AE3C 2FU4A 4XLFA 3BJAA 1D0YA 1MZBA 4GGGA 5M5WJ 2R7TA 5LGNA 1IAWA 3WTWC 4AD9A 4F55A 3BY6A 1OVUA 4EIJA 4QPOA 5HLGA 3FXJA 2R5ZA 3CUOA 2R7VA 3L36A 2JT1A 3L73D 1YIJI 3DKYA 5DEQA 2M34A 2A06G 2FXPA 3B73A 1VQMP 3IV5A 1MNEA 3JRFA 1T3JA 4KT6A 2L9RA 4J00A 2EV0A 5DCMA 2STTA 1QL1A 1FP2A 3WU2E 3JW4A 1UHSA 1YTZI 3AE2C 1ZRTE 2DDBA 1LUJB 3BTIA 4Z6YA 2ME0A 3CXHI 3DLAA 1T3UA 2LBFB 4UUSA 2KZGA 3CDLA 1JTHA 4H44C 4AYBN 3OYNA 1U8BA 2BY3A 2P67A 5BQTA 5B66H 3CCLP 2IA0A 3L70G 5BVZA 3B5NA 2EZKA 3O2PE 3DU6A 4IZZA 4Q4ZF 3CJRB 2QQ8A 2EFOA 1RE3A 2DFEA 4CXFA 2XAQA 2DCEA 2H89C 2EZIA 1U5TB 2YO3A 5AW9B 2JK3A 2DMTA 1S7OA 1U9OA 3FBIB 1NTZJ 4A69C 3PHLA 1F9NA 1XTAA 2WPQA 1F43A 3F9KA 5D5VB 3H1KD 2R5BA 3HYIA 4B3AA 2OYIB 1ZV8A 1F4KA 4A6EA 2Q5UA 2LYCA 1R5SA 1WJAA 2L7ZA 2R3SA 2GA1A 1FOXA 3FXRA 1W1WE 2JVGA 1KB9E 1PYVA 4HF2A 2G3AA 4GKGA 2ZCWA 4GCVA 1HDDC 2PRRA 1NG6A 3O8ZA 4MN4C 2FX0A 3TOAA 4BHBA 3R60A 5JVTA 1HLVA 2CV1A 2DTZA 3BQYA 1P92A 2DN0A 3GTOJ 1J5YA 1KZUB 5LBQA 3CX5D 4NB5A 4U0WA 4ENKA 3I5CA 4U3FE 3WUVA 1HCRA 5L3CA 2E75C 1ZELA 3U1AA 1D1CA 2L01A 3HSFA 3OL4A 2E2JJ 4EM1A 1PPJD 5KLVE 3BLYA 3H3UA 1KC8Q 3OMYA 1L0NG 2HYGD 2L5QA 1IK9A 1PP9J 2JA2A 2OA4A 1Z9CA 1TZLA 4O9BA 4A3MJ 3I55P 2NS8A 5GAGJ 3N4XA 2L2OA 2W7NA 2M0BA 1PP9D 3E6BA 2E2IJ 3BASA 1VQ9P 3KCCA 2A45H 3QPSA 1TC3C 4H44B 2H27A 2F5CA 3K4NA 3L71G 1BCCE 3FHNA 2KJBA 4OIOF 4XLHA 1VQMI 2HZTA 2NNNA 4PFOA 4UVAA 4WVZA 3SHFA 5DUIA 2K3PA 3QOEA 1BIBA 3RK3E 4IL6H 1G3TA 2KI7B 2H1KA 2V6EA 5CCGA 1H0MA 1OR7A 2HR3A 3W2AA 3ECOA 1LTAC 2MYSA 3W2VA 2JMWA 1FYLA 3JRHA 5K1YA 2ZKZA 4WB4A 3G9RA 3BT9A 1SQPK 3V7SA 5KTBA 3DTEA 2ID3A 3CQZJ 3KP5A 3TP0A 3ZMTA 4AYBA 3ZGKA 3HSRA 4Y99B 4L9JA 3UKGA 1EH7A 4KA4A 3BR2A 1JUNA 4CUGA 3OYKA 4M3BA 3GTMJ 2VL8A 2J5UA 2N9YB 3M9BA 4UB8H 2R0QC 4CPGA 5FKMA 3O8HA 2JA6J 2IS6A 1U9NA 1VF5D 2LKXA 3E6DA 3RZOJ 1BGYG 1XS9A 1L3LA 1MSEC 5E3LA 1SC7A 1JJ6C 2E5TA 4I7HA 2IT0A 1BOBA 2STWA 4GODA 2EH3A 1O7FA 4LG3A 1L0ND 2OJED 2L4AA 1SQBE 3K9TA 1K79A 2NVXJ 2RV8A 3PNVA 1OQYA 4LJZF 1B8IB 3QWOC 4EDFA 3CC4P 1LP1B 3OOPA 3W2WA 4PV1B 2E35A 5L3EA 3I3LA 3WU2H 2O1KA 1H89A 1B1BA 4AIDA 1FJKA 2JZYA 1DUXC 2CW7A 2IGNA 3TL4X 3F23A 2V4HA 3PRJA 2V9VA 1DP7P 4IQJA 2KSEA 3VTPC 4ESJA 5H6RA 2XAGA 2PQ8A 2RREA 1DGRM 3IAS2 4A3IJ 4OGQD 3ZMVA 1OISA 3RK2C 5IYCJ 1GV2A 3WE2A 3L74E 1UHWA 3H1JE 1K4TA 2PI0A 3ZQ7A 3RK2B 3VPRA 3DEUA 3VP8A 3FMRA 1YW9A 2YSRA 2W6AA 1RF0C 2IEKA 3GTLJ 4BXLA 4QTRA 3D6ZA 1RNLA 5KCMA 1TW3A 4BE1A 1B9MA 2K9MA 3L7WA 3RGUA 1KQSO 5EYRA 4LK1F 1Q7YQ 2L3DA 1X2NA 2JN6A 2LY1A 1GK6A 4LK0F 1W2EA 4MHGA 1NTZD 1GZLA 4AIJA 1O4XA 1IFDA 3ZQFA 1K4SA 3RKWA 4A2UA 2O1JA 3OIOA 4YXWH 3CLOA 5KK1A 1TWGJ 1NTKG 3GLMA 5B5EH 3CCVP 1V5GA 4JOMA 4K2EA 3VN0A 3EPZA 3QYEA 4DQ2A 4HNUA 2X4HA 2IBZD 4K3AA 4PD4I 2XB5A 3BPVA 1VF9A 4HDVA 5L3DA 4E7LA 2BV6A 1MW7A 4AUXA 1WJ5A 3ULQB 1D3YA 1Z3YA 1R5HA 5IPAA 3COAC 3W6KB 1P84H 2Q9IA 1MBHA 2VQLA 2ESHA 2A68F 2P6TA 2D2WA 3J7ZI 1HOMA 2FYZA 3Q0WA 3BTCA 2M5AA 2XGCA 1NTME 4BQQA 2EJRA 2KIFA 3AAFA 5KAIH 2ETHA 1IN5A 3KYCB 1EH8A 3PFIA 2VJ5A 4HAMA 4JQFA 4E4HA 4KT0J 3AL0C 2A6TA 4UHTA 1B6AA 4HV6A 1B72B 2MLGA 2WSEH 1N7SA 4L74A 1N7SC 3CCSP 2PJRB 4L5EA 1KU9A 4XLEA 1FOYA 2R7OA 2GIZA 3ZQGA 4PDKA 1HW1A 5K5OA 1XMKA 4PUSA 2GOMA 1IXSB 1ZKGA 3OYDA 2KZJA 1L0LK 2RGVA 1R5ID 1LE8B 1DEBA 2AQEA 4M9SA 5JLWA 4FCYA 3S15J 1Y1VJ 2R7ZJ 2R7DA 4DNCA 2MC3A 5CPRB 3FXMA 3S32A 1ENHA 2X6YA 3BCAA 3M0DA 3K2AA 1URQC 3SSUA 2E5NA 3ABLH 4CDGA 2JRTA 1OMIA 5CYVA 2ZFUA 4ENJA 3BTJA 1I1SA 2V7FA 2L7MP 3A7OA
chains in the Genus database with same CATH topology
3T8RA 1SAXA 4EV0A 1KA8A 5HVQC 3E5QA 2A69F 4IPAA 1XGNA 2FOKA 2EB7A 1XGSA 3ERED 1K7AA 2VE8A 2WC2A 4G94A 2CFXA 3V8LA 1OYIA 3O3KA 5E1ZB 1ZYRF 4IF4A 2HKOA 4KMFA 2O6GE 2LSOA 1FYMA 1S8NA 2ZNYA 1JE8A 2RDPA 2ESNA 1USTA 2ACJA 1T98A 2WV0A 4B8XA 2GA2A 2KIMA 1K78A 3HSEA 3EDPA 4N9HA 3ROUA 1W7PD 2ZMEB 3K0LA 5HS7A 1E2XA 2DPDA 1LJ9A 5D5XB 3ML6A 3O6BB 4Q48A 3ZP5A 4TV7A 3IRQA 3GEZA 3E97A 1FBSA 2WWYA 5LRRA 4U0YA 5FGMA 3KZYA 3CUQB 3LQRA 3QP5A 3TDUC 2L4MA 3LAJA 3D0SA 3LQQA 4NQWA 3KZZA 5D4RA 4WX9A 4EJTA 5LGTA 1SFXA 2FQ3A 2VBWA 1SD5A 3MFKA 1YS6A 2P5KA 5DUKA 3C18A 3SQNA 2QBYA 1VTNC 1G3WA 5LEKA 1ZG5A 4RS8A 4MGRA 5FLXZ 2VC1A 3SFZA 3WTXC 5HS8A 3ZMUA 1XSXA 3E6MA 1C0WA 3J7AO 2DLLA 3TDZC 1BC8C 1YIOA 2OZ6A 2R7FA 3NEUA 1QNTA 1JHHA 3K1PA 1P2FA 2PMHA 4ZYHA 5LLQA 4IJAA 3V8KA 3ZPLA 2PMUA 4A6DA 3ZMDA 2NAZA 2F5EA 3K1MA 3WU0A 2DT5A 5CVUA 4L5JA 4FT8A 1S3JA 5KVRA 5AIQA 2P7CB 2V1XA 4KMUX 2BGCA 4R79A 1KGSA 2OZUA 3R0JA 5LHHA 1IN4A 5J8CA 5ILUA 1XGMA 4R8HA 4OINF 4B09A 1G6NA 1R1TA 4Y15A 3RPQA 5DV5A 1ZARA 6PAXA 2LDUA 1CF7A 2DK5A 3WTVC 2LF7A 1W7PA 1HKTA 1O3RA 2O8XA 2QQAA 3IKVA 4JK1X 4M9XA 1BM9A 1RUOA 1BIAA 2V6CA 2XHKA 1U5TC 1YQAA 1IF1A 3GZ6A 3T1BA 4EJOA 2YPRA 2JTVA 3R61A 4KDPA 4XLPF 3WTTC 3FXUA 2H6CA 4G8XA 5DDGA 5D8KB 1ZREA 3BROA 2CW0F 4KICA 2AS5F 1STZA 2DU9A 1DPUA 3FWEA 3RPUA 3KP3A 3FF5A 4HLXA 4WXHA 5IT9K 3RIRA 3MCZA 1R58A 4HQEA 3WU1B 2OBPA 4O6JA 1R1UA 2ZMEA 1GXPA 3F72A 5CJ9A 1I5ZA 5DCFA 4M73A 4YG2F 4XRFA 2ELHA 1J2XA 4M6XA 3HOSA 5F6FA 1O7LA 4KUMA 3SZPA 4Q47A 1FOKA 4NHJA 1FLIA 1K6OA 1WWXA 3LAPA 2MLKA 2XKOA 3I0TA 1R7JA 3GFLA 4AIKA 1BI2A 2A6HF 4KIGA 3IKTA 2DQRA 4OIQF 2FF4A 2QUFA 3CUQA 1HKSA 4RB0A 4EGYA 1ZN2A 4OIPF 1W5SA 2NNYA 3M8EA 2HWVA 1JXSA 2AXLA 2V79A 5AIPA 2QWWA 1LDKB 4P96A 2DK8A 4N9IA 3K1NA 1FP1D 2W85A 3RKXA 2UXXA 1RIOH 2MH2A 3KE2A 1YLFA 2K02A 2VBXA 4D0PA 4QWQA 1S7AA 1I27A 1ZAOA 4LG0B 3EQLF 1XDSA 2Z3YA 4HX8A 2COMA 3JTHA 4ZYEA 4G6QA 2CGPA 3LA2A 1P4AA 3RYRA 4G6DA 5CVIA 3U2RA 1U8RA 2ZO4A 3I71A 3V4GA 4RB3C 2XUBA 3ABTA 3ABUA 1USSA 3M7GA 3KP2A 1LB2A 2A5YB 3GFJA 4LFUA 3F8NA 3JSPA 2W84A 2EA4A 4KT5C 2PFBA 4O5VA 1TNSA 1J0RA 1ZHFA 3V7CA 1TLHB 1KQ0A 5D5WB 4GYIA 2P5VA 2HOEA 2DI3A 4RGSA 4ENMA 1E17A 5K5QA 3QU3A 3T8TA 4CO8A 2Z99A 2C6YA 1BOAA 1CF7B 3TQNA 3VODA 5LEJA 4EJUA 4A0YA 5L3GA 4HX4A 2B0LA 1W7PB 4E70A 3KP4A 5J6XA 1SD6A 3F6OA 2BEOA 4PGHA 4UXNA 3WODF 4A0ZA 3LSTA 2IP2A 1W4MA 3HTUA 1IRGA 5TJJA 2PJPA 5HDKA 1B4AA 4OMZA 2Y0MA 3ZN1A 3KP7A 3EYIA 2G7HA 4EMSA 5JFRA 2A6EF 2GXGA 2CSOA 5ILSA 2Q0OA 3WG9A 1KU3A 2KIUA 4I09A 5ICGA 3R6SA 3K2ZA 4P55A 1SFUA 3VOEA 2XAJA 2MH9A 5BPDA 4JBAA 2D1HA 2EV6A 1T2KA 1KYWA 4U7DA 1BN5A 5IT3A 3F22A 4HBLA 1YO5C 2XAFA 2ADUA 3WTUC 3TOBA 3BP8A 3GLXA 3HRSA 1RI7A 1B59A 3L00A 1S6LA 3E6CC 4I2OA 2ZFWA 5ICFA 2A61A 5FD5A 3LA3A 3SZTA 1FZPB 3IC7A 4UVCA 5ERIA 1Y0UA 1ZRDA 4ZYDA 2GWRA 3BZ6A 1F5TA 4KN7X 2CG4A 4YFXF 5ED4A 1HSJA 4WXDA 3N4MA 4G7ZF 1XCBA 2K27A 4GO1A 4WK8F 2OU2A 4EQQA 4YIIA 4YIFA 1J75A 1IRFA 2IW5A 3I64A 1KQ8A 2OD5A 1U5TA 4I0BA 4UVBA 3LFKA 2YX7A 4OOIA 2GQQA 1OYWA 1FSEA 4I98B 1U3EM 3F3XA 5BOXA 1ZG3A 1J9IA 2XGXA 3P9IA 4GXOA 5CVJA 1YS7A 3T0YA 5E1WA 3TKYA 3KP6A 2DQLA 1Q1HA 5ILVA 4EJVA 3HRTA 4Y17A 2QM3A 1MD0A 3E3VA 1XB4A 1WI9A 3R4KA 4CHUA 1BI0A 2ZXJA 1RZ4A 4ENNA 5H20A 1YW8A 4RGUA 1D8JA 4IHTA 5H6QA 3M1EA 1JHFA 2RQPA 3DFGA 2XASA 4IHSA 1CGPA 5FO5A 2QVOA 2O3FA 1HSTA 3ZMZA 1TQMA 5JR3A 3KFWX 5TRDA 5D5UB 3QRFF 2J5OA 2GXBA 1X3UA 4BXUA 5E18F 4LG0A 3WTSC 3BJ6A 3DPTA 5AONA 1IZ1A 5D6EA 4IRIA 4ZZDA 2FE3A 2K7LA 5FFZA 5LHGA 3H92A 2VONA 3F8FA 1G3SA 3GW2A 2LF8A 4ON0A 5E1XA 2RNJA 1K78B 5J8FA 2F5FA 4U0VA 2W24A 2G9WA 3KLNA 4WWCA 4WF2A 5FD6A 3JSOA 2M87A 1BJAA 3J81K 1R22A 1OYYA 4RB2C 4L0ZB 3DKWA 3FXQA 3GFIA 1G3YA 4LB5A 2ISYA 1F1ZA 2FMLA 5E20A 1TW2A 2H6BA 1MGTA 1UFMA 1HQCA 4ASNA 5JHUA 1P6RA 1P4WA 3GWZA 5D4SA 3B02A 2Y48A 5LHIA 2QYOA 2FMYA 2IA2A 2XIGA 3G73A 1WSUA 2CO5A 5IT9Z 1ON2A 1HKQA 1FC3A 4OIRF 1FYKA 1P4XA